Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	dataset	MUTSIG_Significant_Genes	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	context_orig	context65	gene_name	newbase	categ	categ_ignoring_null_categ
C10orf68	79741	broad.mit.edu	37	10	33103303	33103304	+	Missense_Mutation	DNP	GA	AT	AT			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:33103303_33103304GA>AT	uc001iwn.3	+	12	1389_1390	c.916_917GA>AT	c.(916-918)GAT>ATT	p.D306I	C10orf68_uc001iwl.1_Intron|C10orf68_uc001iwm.1_Missense_Mutation_p.D282I|C10orf68_uc010qei.1_Missense_Mutation_p.D254I|C10orf68_uc001iwo.3_RNA	NM_024688	NP_078964	Q9H943	CJ068_HUMAN	chromosome 10 open reading frame 68	306										skin(2)|ovary(1)	3																		---	---	---	---	capture		Missense_Mutation	DNP	33103303	33103304	1650	10	GA	AT	AT	45	45	C10orf68	AT	2	2
VPS8	23355	broad.mit.edu	37	3	184689483	184689484	+	Nonsense_Mutation	DNP	GG	TT	TT			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184689483_184689484GG>TT	uc003fpb.1	+	39	3528_3529	c.3357_3358GG>TT	c.(3355-3360)GTGGAG>GTTTAG	p.E1120*	VPS8_uc010hyd.1_Nonsense_Mutation_p.E1030*|VPS8_uc010hye.1_Nonsense_Mutation_p.E549*	NM_015303	NP_056118	Q8N3P4	VPS8_HUMAN	vacuolar protein sorting 8 homolog isoform b	1122							zinc ion binding			ovary(1)	1	all_cancers(143;2.51e-11)|Ovarian(172;0.0339)|Breast(254;0.247)		Epithelial(37;1.02e-33)|OV - Ovarian serous cystadenocarcinoma(80;4.81e-22)															---	---	---	---	capture		Nonsense_Mutation	DNP	184689483	184689484	17785	3	GG	TT	TT	47	47	VPS8	TT	5	2
FAM198B	51313	broad.mit.edu	37	4	159076762	159076763	+	Splice_Site	DNP	CC	AA	AA			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:159076762_159076763CC>AA	uc003ipp.3	-	3	1577	c.1125_splice	c.e3+1	p.Q375_splice	FAM198B_uc003ipq.3_Splice_Site_p.Q383_splice|FAM198B_uc003ipr.3_Splice_Site_p.Q375_splice	NM_016613	NP_057697			hypothetical protein LOC51313 isoform 2							Golgi membrane|integral to membrane					0																		---	---	---	---	capture		Splice_Site	DNP	159076762	159076763	5743	4	CC	AA	AA	18	18	FAM198B	AA	5	2
CDKN2A	1029	broad.mit.edu	37	9	21994137	21994138	+	Splice_Site	DNP	CC	GA	GA			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:21994137_21994138CC>GA	uc003zpl.2	-	1	353	c.316_splice	c.e1+1	p.G106_splice	MTAP_uc003zpi.1_Intron|CDKN2BAS_uc010miw.1_5'Flank|CDKN2BAS_uc010mix.1_5'Flank|CDKN2BAS_uc003zpm.2_5'Flank	NM_058195	NP_478102			cyclin-dependent kinase inhibitor 2A isoform 4						cell cycle arrest|cell cycle checkpoint|G1 phase of mitotic cell cycle|G1/S transition of mitotic cell cycle|induction of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of cell-matrix adhesion|negative regulation of cyclin-dependent protein kinase activity|negative regulation of NF-kappaB transcription factor activity|positive regulation of macrophage apoptosis|positive regulation of smooth muscle cell apoptosis|Ras protein signal transduction|replicative senescence	cytosol|nucleus	cyclin-dependent protein kinase inhibitor activity|NF-kappaB binding|protein binding|protein binding|protein kinase binding	p.0?(197)		haematopoietic_and_lymphoid_tissue(647)|skin(419)|upper_aerodigestive_tract(414)|central_nervous_system(381)|lung(325)|pancreas(244)|oesophagus(230)|urinary_tract(225)|pleura(94)|liver(91)|soft_tissue(79)|bone(77)|ovary(76)|biliary_tract(71)|stomach(46)|breast(46)|kidney(39)|NS(28)|thyroid(24)|cervix(23)|meninges(18)|genital_tract(15)|endometrium(13)|prostate(11)|autonomic_ganglia(10)|salivary_gland(10)|large_intestine(9)|adrenal_gland(6)|eye(4)|vulva(2)|small_intestine(1)	3678		all_cancers(5;0)|Acute lymphoblastic leukemia(3;0)|all_hematologic(3;0)|all_epithelial(2;2.37e-290)|Lung NSC(2;1.26e-139)|all_lung(2;4.48e-131)|Glioma(2;3.26e-60)|all_neural(2;2.1e-52)|Renal(3;1.07e-46)|Esophageal squamous(3;3.83e-46)|Melanoma(2;2.74e-34)|Breast(3;1.14e-11)|Ovarian(3;0.000128)|Hepatocellular(5;0.00162)|Colorectal(97;0.172)		all cancers(2;0)|GBM - Glioblastoma multiforme(3;0)|Lung(2;4.07e-74)|Epithelial(2;1.08e-61)|LUSC - Lung squamous cell carcinoma(2;3.82e-48)|LUAD - Lung adenocarcinoma(2;4.56e-26)|OV - Ovarian serous cystadenocarcinoma(39;7.64e-10)|BRCA - Breast invasive adenocarcinoma(2;5.01e-09)|STAD - Stomach adenocarcinoma(4;4.63e-07)|Kidney(2;5.79e-07)|KIRC - Kidney renal clear cell carcinoma(2;7.27e-07)|COAD - Colon adenocarcinoma(8;5.15e-05)			17							Uveal_Melanoma_Familial|Familial_Malignant_Melanoma_and_Tumors_of_the_Nervous_System|Hereditary_Melanoma	HNSCC(2;<9.43e_08)|TSP Lung(5;3.83e-07)			---	---	---	---	capture		Splice_Site	DNP	21994137	21994138	3290	9	CC	GA	GA	18	18	CDKN2A	GA	5	3
FUBP1	8880	broad.mit.edu	37	1	78422308	78422324	+	Frame_Shift_Del	DEL	GTGGCTGTGCTTGCTGT	-	-			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:78422308_78422324delGTGGCTGTGCTTGCTGT	uc001dii.2	-	17	1727_1743	c.1638_1654delACAGCAAGCACAGCCAC	c.(1636-1656)CAACAGCAAGCACAGCCACCAfs	p.Q546fs	FUBP1_uc001dih.3_RNA|FUBP1_uc010orm.1_Frame_Shift_Del_p.Q567fs	NM_003902	NP_003893	Q96AE4	FUBP1_HUMAN	far upstream element-binding protein	546_552	Pro-rich.				transcription from RNA polymerase II promoter	nucleus	protein binding|RNA binding|sequence-specific DNA binding transcription factor activity|single-stranded DNA binding			central_nervous_system(2)|lung(1)	3																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	78422308	78422324	6343	1	GTGGCTGTGCTTGCTGT	-	-	44	44	FUBP1	-	5	5
EDARADD	128178	broad.mit.edu	37	1	236645688	236645688	+	Frame_Shift_Del	DEL	G	-	-			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236645688delG	uc001hxu.1	+	6	452	c.387delG	c.(385-387)CTGfs	p.L129fs	EDARADD_uc001hxv.1_Frame_Shift_Del_p.L119fs	NM_145861	NP_665860	Q8WWZ3	EDAD_HUMAN	EDAR-associated death domain isoform A	129	Death.				cell differentiation|signal transduction	cytoplasm					0	Ovarian(103;0.0634)|Breast(184;0.247)	all_cancers(173;0.0232)|Prostate(94;0.174)	OV - Ovarian serous cystadenocarcinoma(106;0.00117)															---	---	---	---	capture_indel		Frame_Shift_Del	DEL	236645688	236645688	5093	1	G	-	-	47	47	EDARADD	-	5	5
SEPHS1	22929	broad.mit.edu	37	10	13378352	13378352	+	Splice_Site	DEL	T	-	-			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:13378352delT	uc001imk.2	-	4	657	c.298_splice	c.e4-1	p.G100_splice	SEPHS1_uc001imh.2_Frame_Shift_Del_p.Q23fs|SEPHS1_uc010qbs.1_Splice_Site_p.G52_splice|SEPHS1_uc001imi.2_Splice_Site_p.G100_splice|SEPHS1_uc001imj.2_Splice_Site_p.G100_splice|SEPHS1_uc010qbt.1_Splice_Site_p.G33_splice|SEPHS1_uc009xje.2_Splice_Site_p.G100_splice	NM_012247	NP_036379			selenophosphate synthetase 1						protein modification process		ATP binding|GTP binding|selenide, water dikinase activity			skin(1)	1																		---	---	---	---	capture_indel		Splice_Site	DEL	13378352	13378352	14540	10	T	-	-	55	55	SEPHS1	-	5	5
SLC39A12	221074	broad.mit.edu	37	10	18276475	18276475	+	Frame_Shift_Del	DEL	C	-	-			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18276475delC	uc001ipo.2	+	7	1437	c.1164delC	c.(1162-1164)GTCfs	p.V388fs	SLC39A12_uc001ipn.2_Frame_Shift_Del_p.V388fs|SLC39A12_uc001ipp.2_Frame_Shift_Del_p.V388fs|SLC39A12_uc010qck.1_Frame_Shift_Del_p.V254fs	NM_001145195	NP_001138667	Q504Y0	S39AC_HUMAN	solute carrier family 39 (zinc transporter),	388	Helical; (Potential).				zinc ion transport	integral to membrane	metal ion transmembrane transporter activity			ovary(1)|breast(1)	2																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	18276475	18276475	15112	10	C	-	-	30	30	SLC39A12	-	5	5
OR4A16	81327	broad.mit.edu	37	11	55110725	55110726	+	Frame_Shift_Ins	INS	-	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55110725_55110726insA	uc010rie.1	+	1	49_50	c.49_50insA	c.(49-51)CAAfs	p.Q17fs		NM_001005274	NP_001005274	Q8NH70	O4A16_HUMAN	olfactory receptor, family 4, subfamily A,	17	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(2)|pancreas(1)	3																		---	---	---	---	capture_indel		Frame_Shift_Ins	INS	55110725	55110726	11447	11	-	A	A	29	29	OR4A16	A	5	5
DAGLA	747	broad.mit.edu	37	11	61488164	61488165	+	Frame_Shift_Ins	INS	-	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61488164_61488165insC	uc001nsa.2	+	3	220_221	c.109_110insC	c.(109-111)TCCfs	p.S37fs		NM_006133	NP_006124	Q9Y4D2	DGLA_HUMAN	neural stem cell-derived dendrite regulator	37	Helical; (Potential).				cell death|lipid catabolic process|platelet activation	integral to membrane|plasma membrane	acylglycerol lipase activity|metal ion binding|triglyceride lipase activity			ovary(2)|central_nervous_system(1)	3				READ - Rectum adenocarcinoma(4;0.219)														---	---	---	---	capture_indel		Frame_Shift_Ins	INS	61488164	61488165	4393	11	-	C	C	58	58	DAGLA	C	5	5
HTR3A	3359	broad.mit.edu	37	11	113860388	113860388	+	Frame_Shift_Del	DEL	C	-	-			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113860388delC	uc010rxb.1	+	8	1687	c.1454delC	c.(1453-1455)TCCfs	p.S485fs	HTR3A_uc010rxa.1_Frame_Shift_Del_p.S453fs|HTR3A_uc009yyx.2_RNA|HTR3A_uc010rxc.1_Frame_Shift_Del_p.S432fs	NM_213621	NP_998786	P46098	5HT3A_HUMAN	5-hydroxytryptamine (serotonin) receptor 3A	447	HA-stretch.|Cytoplasmic (Potential).				digestion|synaptic transmission	cell junction|integral to plasma membrane|postsynaptic membrane	serotonin binding|serotonin receptor activity|serotonin-activated cation-selective channel activity				0		all_cancers(61;2.31e-17)|all_epithelial(67;2.1e-10)|all_hematologic(158;4.64e-05)|Melanoma(852;0.000312)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0101)|all_neural(223;0.0281)|Prostate(24;0.0294)|Medulloblastoma(222;0.0425)		BRCA - Breast invasive adenocarcinoma(274;2.71e-06)|Epithelial(105;2.58e-05)|all cancers(92;0.000238)|OV - Ovarian serous cystadenocarcinoma(223;0.191)	Alosetron(DB00969)|Chloroprocaine(DB01161)|Cisapride(DB00604)|Dolasetron(DB00757)|Granisetron(DB00889)|Mirtazapine(DB00370)|Ondansetron(DB00904)|Palonosetron(DB00377)|Procaine(DB00721)|Tubocurarine(DB01199)													---	---	---	---	capture_indel		Frame_Shift_Del	DEL	113860388	113860388	7744	11	C	-	-	30	30	HTR3A	-	5	5
TXNRD1	7296	broad.mit.edu	37	12	104709579	104709580	+	Frame_Shift_Ins	INS	-	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104709579_104709580insG	uc010swk.1	+	7	657_658	c.635_636insG	c.(634-636)GTGfs	p.V212fs	TXNRD1_uc010swl.1_Frame_Shift_Ins_p.V62fs|TXNRD1_uc010swm.1_Frame_Shift_Ins_p.V114fs|TXNRD1_uc010swn.1_Frame_Shift_Ins_p.V62fs|TXNRD1_uc010swo.1_Frame_Shift_Ins_p.V62fs|TXNRD1_uc010swp.1_Frame_Shift_Ins_p.V24fs|TXNRD1_uc010swq.1_Frame_Shift_Ins_p.V112fs|TXNRD1_uc001tku.2_RNA|TXNRD1_uc009zun.2_Frame_Shift_Ins_p.V128fs	NM_001093771	NP_001087240	Q16881	TRXR1_HUMAN	thioredoxin reductase 1 isoform 3	212					cell redox homeostasis|cellular lipid metabolic process|electron transport chain|nucleobase, nucleoside and nucleotide interconversion|signal transduction|transport	cytosol|nucleolus	electron carrier activity|flavin adenine dinucleotide binding|NADP binding|protein disulfide oxidoreductase activity|thioredoxin-disulfide reductase activity				0																		---	---	---	---	capture_indel		Frame_Shift_Ins	INS	104709579	104709580	17363	12	-	G	G	59	59	TXNRD1	G	5	5
STK11	6794	broad.mit.edu	37	19	1207064	1207065	+	Frame_Shift_Ins	INS	-	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1207064_1207065insC	uc002lrl.1	+	1	1267_1268	c.152_153insC	c.(151-153)ATGfs	p.M51fs		NM_000455	NP_000446	Q15831	STK11_HUMAN	serine/threonine protein kinase 11	51	Protein kinase.				anoikis|cell cycle arrest|energy reserve metabolic process|insulin receptor signaling pathway|positive regulation of transforming growth factor beta receptor signaling pathway|regulation of fatty acid biosynthetic process|regulation of fatty acid oxidation	cytosol|nucleus	ATP binding|magnesium ion binding|protein serine/threonine kinase activity	p.0?(19)|p.?(3)|p.D53fs*11(1)|p.L50_D53del(1)|p.M51fs*14(1)		lung(174)|cervix(35)|skin(15)|large_intestine(12)|pancreas(6)|gastrointestinal_tract_(site_indeterminate)(5)|stomach(4)|ovary(4)|breast(2)|upper_aerodigestive_tract(1)|testis(1)|liver(1)|biliary_tract(1)|small_intestine(1)|urinary_tract(1)|oesophagus(1)|prostate(1)|kidney(1)	266		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;7.93e-06)|all_lung(49;1.25e-05)|Breast(49;0.000172)|Renal(1328;0.0183)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|Lung(535;0.00942)|STAD - Stomach adenocarcinoma(1328;0.18)			14	D|Mis|N|F|S		NSCLC|pancreatic	jejunal harmartoma|ovarian|testicular|pancreatic			Peutz-Jeghers_syndrome	TSP Lung(3;<1E-08)			---	---	---	---	capture_indel		Frame_Shift_Ins	INS	1207064	1207065	15807	19	-	C	C	51	51	STK11	C	5	5
LPAR2	9170	broad.mit.edu	37	19	19737866	19737867	+	Frame_Shift_Del	DEL	CG	-	-	rs148440416		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19737866_19737867delCG	uc002nnb.3	-	2	366_367	c.227_228delCG	c.(226-228)GCGfs	p.A76fs	LPAR2_uc002nna.3_Frame_Shift_Del_p.A76fs|LPAR2_uc002nnc.3_Frame_Shift_Del_p.A76fs	NM_004720	NP_004711	Q9HBW0	LPAR2_HUMAN	lysophosphatidic acid receptor 2	76	Helical; Name=2; (Potential).				activation of phospholipase C activity|elevation of cytosolic calcium ion concentration	cell surface|integral to plasma membrane	LIM domain binding|lipid binding			ovary(1)|breast(1)	2																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	19737866	19737867	9278	19	CG	-	-	23	23	LPAR2	-	5	5
LILRA1	11024	broad.mit.edu	37	19	55110733	55110733	+	Frame_Shift_Del	DEL	A	-	-	rs138750900		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55110733delA	uc002qgh.1	+	8	1476	c.1294delA	c.(1294-1296)AAGfs	p.K432fs	LILRA1_uc010yfh.1_Frame_Shift_Del_p.K432fs	NM_006863	NP_006854	O75019	LIRA1_HUMAN	leukocyte immunoglobulin-like receptor,	432	Extracellular (Potential).				cell surface receptor linked signaling pathway|defense response|regulation of immune response	integral to membrane|plasma membrane	antigen binding|transmembrane receptor activity			skin(2)|ovary(1)	3				GBM - Glioblastoma multiforme(193;0.0348)														---	---	---	---	capture_indel		Frame_Shift_Del	DEL	55110733	55110733	9110	19	A	-	-	5	5	LILRA1	-	5	5
PICK1	9463	broad.mit.edu	37	22	38470389	38470390	+	Frame_Shift_Del	DEL	GC	-	-			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38470389_38470390delGC	uc003auq.2	+	12	1300_1301	c.910_911delGC	c.(910-912)GCGfs	p.A304fs	PICK1_uc003aur.2_Frame_Shift_Del_p.A304fs|PICK1_uc003aus.2_Frame_Shift_Del_p.A304fs|PICK1_uc003aut.2_Frame_Shift_Del_p.A304fs	NM_012407	NP_036539	Q9NRD5	PICK1_HUMAN	protein interacting with C kinase 1	304	AH.				activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|DNA methylation involved in embryo development|DNA methylation involved in gamete generation|monoamine transport|neuronal ion channel clustering|protein phosphorylation|receptor clustering|retrograde vesicle-mediated transport, Golgi to ER|synaptic transmission	cell junction|endocytic vesicle membrane|Golgi apparatus|perinuclear region of cytoplasm|presynaptic membrane	ATPase activity|metal ion binding|protein C-terminus binding|protein kinase C binding|receptor binding				0	Melanoma(58;0.045)																	---	---	---	---	capture_indel		Frame_Shift_Del	DEL	38470389	38470390	12305	22	GC	-	-	42	42	PICK1	-	5	5
HAVCR1	26762	broad.mit.edu	37	5	156484938	156484939	+	Frame_Shift_Ins	INS	-	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156484938_156484939insC	uc010jij.1	-	2	201_202	c.16_17insG	c.(16-18)GTCfs	p.V6fs	HAVCR1_uc003lwi.2_Frame_Shift_Ins_p.V6fs|HAVCR1_uc011ddm.1_Frame_Shift_Ins_p.V6fs	NM_001099414	NP_001092884	Q96D42	HAVR1_HUMAN	hepatitis A virus cellular receptor 1	6					interspecies interaction between organisms	integral to membrane	receptor activity			ovary(1)|skin(1)	2	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.0999)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)															---	---	---	---	capture_indel		Frame_Shift_Ins	INS	156484938	156484939	7255	5	-	C	C	10	10	HAVCR1	C	5	5
ARHGAP6	395	broad.mit.edu	37	X	11200215	11200215	+	Frame_Shift_Del	DEL	G	-	-			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:11200215delG	uc004cup.1	-	6	2170	c.1297delC	c.(1297-1299)CGAfs	p.R433fs	ARHGAP6_uc004cuo.1_RNA|ARHGAP6_uc004cur.1_Frame_Shift_Del_p.R433fs|ARHGAP6_uc004cum.1_Frame_Shift_Del_p.R230fs|ARHGAP6_uc004cun.1_Frame_Shift_Del_p.R253fs|ARHGAP6_uc010neb.1_Frame_Shift_Del_p.R255fs|ARHGAP6_uc011mif.1_Frame_Shift_Del_p.R230fs	NM_013427	NP_038286	O43182	RHG06_HUMAN	Rho GTPase activating protein 6 isoform 1	433	Rho-GAP.				actin filament polymerization|activation of phospholipase C activity|negative regulation of focal adhesion assembly|negative regulation of stress fiber assembly|Rho protein signal transduction	actin filament|cytosol	phospholipase activator activity|phospholipase binding|Rho GTPase activator activity|SH3 domain binding|SH3/SH2 adaptor activity			urinary_tract(1)|lung(1)	2																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	11200215	11200215	901	23	G	-	-	39	39	ARHGAP6	-	5	5
PUSL1	126789	broad.mit.edu	37	1	1244324	1244324	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1244324G>T	uc001aed.2	+	2	137	c.107G>T	c.(106-108)CGC>CTC	p.R36L	ACAP3_uc001aeb.2_5'Flank|ACAP3_uc001aec.1_Intron|PUSL1_uc010nyi.1_Intron|PUSL1_uc009vjx.2_5'Flank	NM_153339	NP_699170	Q8N0Z8	PUSL1_HUMAN	pseudouridylate synthase-like 1	36					pseudouridine synthesis|tRNA processing		pseudouridine synthase activity|RNA binding			skin(1)	1	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;9.48e-15)|all_lung(118;9.67e-07)|Lung NSC(185;5.59e-05)|Renal(390;0.00571)|Breast(487;0.0183)|Hepatocellular(190;0.0268)|Myeloproliferative disorder(586;0.028)|Ovarian(437;0.127)|Lung SC(97;0.217)		Epithelial(90;4.95e-35)|OV - Ovarian serous cystadenocarcinoma(86;3.77e-21)|Colorectal(212;0.000155)|COAD - Colon adenocarcinoma(227;0.000193)|Kidney(185;0.00227)|BRCA - Breast invasive adenocarcinoma(365;0.0025)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0339)|Lung(427;0.199)														---	---	---	---	capture		Missense_Mutation	SNP	1244324	1244324	13293	1	G	T	T	38	38	PUSL1	T	1	1
VPS13D	55187	broad.mit.edu	37	1	12557583	12557583	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12557583G>T	uc001atv.2	+	68	12833	c.12692G>T	c.(12691-12693)CGT>CTT	p.R4231L	VPS13D_uc001atw.2_Missense_Mutation_p.R4206L|VPS13D_uc001atx.2_Missense_Mutation_p.R3418L|VPS13D_uc009vnl.2_RNA|VPS13D_uc010obd.1_Missense_Mutation_p.R229L	NM_015378	NP_056193	Q5THJ4	VP13D_HUMAN	vacuolar protein sorting 13D isoform 1	4230					protein localization					ovary(4)|pancreas(1)	5	Ovarian(185;0.249)	Lung NSC(185;4.08e-05)|all_lung(284;4.55e-05)|Renal(390;0.000147)|Colorectal(325;0.00058)|Breast(348;0.00093)|Ovarian(437;0.00965)|Hepatocellular(190;0.0202)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0327)|Colorectal(212;4.63e-06)|BRCA - Breast invasive adenocarcinoma(304;0.000289)|COAD - Colon adenocarcinoma(227;0.000801)|Kidney(185;0.00216)|KIRC - Kidney renal clear cell carcinoma(229;0.00544)|STAD - Stomach adenocarcinoma(313;0.012)|READ - Rectum adenocarcinoma(331;0.0476)|Lung(427;0.209)														---	---	---	---	capture		Missense_Mutation	SNP	12557583	12557583	17759	1	G	T	T	40	40	VPS13D	T	1	1
PRAMEF8	391002	broad.mit.edu	37	1	12979805	12979805	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12979805C>A	uc001aup.2	+	4	1080	c.997C>A	c.(997-999)CAT>AAT	p.H333N		NM_001012276	NP_001012276	Q5VWM4	PRAM8_HUMAN	PRAME family member 8	333	LRR 1.										0	Ovarian(185;0.249)	Renal(390;0.000469)|Lung NSC(185;0.00143)|all_lung(284;0.00181)|Colorectal(325;0.00215)|Breast(348;0.00224)|Myeloproliferative disorder(586;0.0393)|Hepatocellular(190;0.0623)|Ovarian(437;0.0731)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00812)|Colorectal(212;4.88e-06)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000194)|COAD - Colon adenocarcinoma(227;0.000241)|BRCA - Breast invasive adenocarcinoma(304;0.000293)|STAD - Stomach adenocarcinoma(313;0.0072)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---	capture		Missense_Mutation	SNP	12979805	12979805	12881	1	C	A	A	21	21	PRAMEF8	A	2	2
SPEN	23013	broad.mit.edu	37	1	16259730	16259730	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16259730G>A	uc001axk.1	+	11	7199	c.6995G>A	c.(6994-6996)CGC>CAC	p.R2332H	SPEN_uc010obp.1_Missense_Mutation_p.R2291H	NM_015001	NP_055816	Q96T58	MINT_HUMAN	spen homolog, transcriptional regulator	2332	RID.|Interaction with MSX2 (By similarity).				interspecies interaction between organisms|negative regulation of transcription, DNA-dependent|Notch signaling pathway	nucleus	nucleotide binding|protein binding|RNA binding			ovary(6)|breast(3)|lung(2)|skin(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	15		Colorectal(325;0.000258)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.000567)|Ovarian(437;0.0129)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0185)|Colorectal(212;5.96e-07)|COAD - Colon adenocarcinoma(227;3.11e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000115)|Kidney(64;0.000212)|KIRC - Kidney renal clear cell carcinoma(64;0.003)|STAD - Stomach adenocarcinoma(313;0.013)|READ - Rectum adenocarcinoma(331;0.0681)														---	---	---	---	capture		Missense_Mutation	SNP	16259730	16259730	15550	1	G	A	A	38	38	SPEN	A	1	1
C1orf64	149563	broad.mit.edu	37	1	16332412	16332412	+	Splice_Site	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16332412A>T	uc001axn.2	+	2	151	c.83_splice	c.e2-2	p.G28_splice		NM_178840	NP_849162			hypothetical protein LOC149563											breast(2)	2		Colorectal(325;0.000435)|Renal(390;0.00145)|Breast(348;0.00224)|Lung NSC(340;0.00566)|all_lung(284;0.00831)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.104)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|Colorectal(212;3.25e-07)|COAD - Colon adenocarcinoma(227;2.08e-05)|BRCA - Breast invasive adenocarcinoma(304;9.19e-05)|Kidney(64;0.000165)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(313;0.0114)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---	capture		Splice_Site	SNP	16332412	16332412	2128	1	A	T	T	15	15	C1orf64	T	5	4
ATP13A2	23400	broad.mit.edu	37	1	17331277	17331277	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17331277C>A	uc001baa.2	-	5	577	c.387G>T	c.(385-387)CGG>CGT	p.R129R	ATP13A2_uc001bab.2_Silent_p.R129R|ATP13A2_uc001bac.2_Silent_p.R129R	NM_022089	NP_071372	Q9NQ11	AT132_HUMAN	ATPase type 13A2 isoform 1	129	Cytoplasmic (Potential).				ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			skin(2)|ovary(1)|central_nervous_system(1)	4		Colorectal(325;0.000147)|Breast(348;0.00104)|Renal(390;0.00145)|Lung NSC(340;0.00566)|all_lung(284;0.00797)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0646)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00462)|COAD - Colon adenocarcinoma(227;1.11e-05)|BRCA - Breast invasive adenocarcinoma(304;1.99e-05)|Kidney(64;0.000171)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00645)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.182)														---	---	---	---	capture		Silent	SNP	17331277	17331277	1143	1	C	A	A	30	30	ATP13A2	A	2	2
PADI3	51702	broad.mit.edu	37	1	17594354	17594354	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17594354G>T	uc001bai.2	+	6	589	c.549G>T	c.(547-549)ATG>ATT	p.M183I		NM_016233	NP_057317	Q9ULW8	PADI3_HUMAN	peptidyl arginine deiminase, type III	183					peptidyl-citrulline biosynthetic process from peptidyl-arginine	cytoplasm	calcium ion binding|protein-arginine deiminase activity			ovary(1)|breast(1)	2		Colorectal(325;3.46e-05)|Breast(348;0.000162)|all_lung(284;0.000337)|Lung NSC(340;0.000419)|Renal(390;0.000518)|Ovarian(437;0.00409)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00488)|BRCA - Breast invasive adenocarcinoma(304;1.17e-05)|COAD - Colon adenocarcinoma(227;1.18e-05)|Kidney(64;0.000186)|KIRC - Kidney renal clear cell carcinoma(64;0.00272)|STAD - Stomach adenocarcinoma(196;0.00656)|READ - Rectum adenocarcinoma(331;0.0655)|Lung(427;0.189)	L-Citrulline(DB00155)													---	---	---	---	capture		Missense_Mutation	SNP	17594354	17594354	11795	1	G	T	T	47	47	PADI3	T	2	2
PDIK1L	149420	broad.mit.edu	37	1	26448341	26448341	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:26448341C>T	uc010oew.1	+	3	572	c.299C>T	c.(298-300)TCA>TTA	p.S100L	PDIK1L_uc001blj.3_Missense_Mutation_p.S100L|PDIK1L_uc009vsb.2_Missense_Mutation_p.S100L	NM_152835	NP_690048	Q8N165	PDK1L_HUMAN	PDLIM1 interacting kinase 1 like	100	Protein kinase.					nucleus	ATP binding|protein serine/threonine kinase activity				0		Colorectal(325;0.000147)|Renal(390;0.00211)|Lung NSC(340;0.00239)|all_lung(284;0.00366)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.051)|Breast(348;0.0589)|all_neural(195;0.0687)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|OV - Ovarian serous cystadenocarcinoma(117;7.32e-26)|Colorectal(126;1.24e-08)|COAD - Colon adenocarcinoma(152;9.31e-07)|KIRC - Kidney renal clear cell carcinoma(1967;0.000735)|BRCA - Breast invasive adenocarcinoma(304;0.000973)|STAD - Stomach adenocarcinoma(196;0.00151)|GBM - Glioblastoma multiforme(114;0.015)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---	capture		Missense_Mutation	SNP	26448341	26448341	12094	1	C	T	T	29	29	PDIK1L	T	2	2
BAI2	576	broad.mit.edu	37	1	32210249	32210249	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:32210249C>A	uc001btn.2	-	5	1276	c.922G>T	c.(922-924)GGC>TGC	p.G308C	BAI2_uc010ogo.1_Missense_Mutation_p.V5L|BAI2_uc010ogp.1_Missense_Mutation_p.V296L|BAI2_uc010ogq.1_Missense_Mutation_p.G308C|BAI2_uc001bto.2_Missense_Mutation_p.G308C|BAI2_uc001btq.1_Missense_Mutation_p.G296C|BAI2_uc010ogr.1_Missense_Mutation_p.V296L	NM_001703	NP_001694	O60241	BAI2_HUMAN	brain-specific angiogenesis inhibitor 2	308	Extracellular (Potential).				negative regulation of angiogenesis|neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(5)|breast(4)|ovary(2)|central_nervous_system(1)|skin(1)	13		Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0606)|all_neural(195;0.0837)|Breast(348;0.174)		STAD - Stomach adenocarcinoma(196;0.0557)														---	---	---	---	capture		Missense_Mutation	SNP	32210249	32210249	1320	1	C	A	A	24	24	BAI2	A	2	2
ZMYM1	79830	broad.mit.edu	37	1	35580552	35580552	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35580552G>C	uc001bym.2	+	11	3269	c.3121G>C	c.(3121-3123)GAT>CAT	p.D1041H	ZMYM1_uc001byn.2_Missense_Mutation_p.D1041H|ZMYM1_uc010ohu.1_Missense_Mutation_p.D1022H|ZMYM1_uc001byo.2_Missense_Mutation_p.D681H|ZMYM1_uc009vut.2_Missense_Mutation_p.D966H	NM_024772	NP_079048	Q5SVZ6	ZMYM1_HUMAN	zinc finger, MYM domain containing 1	1041						nucleus	nucleic acid binding|protein dimerization activity|zinc ion binding				0		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---	capture		Missense_Mutation	SNP	35580552	35580552	18290	1	G	C	C	33	33	ZMYM1	C	3	3
KIAA0754	643314	broad.mit.edu	37	1	39877045	39877045	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39877045G>T	uc009vvt.1	+	1	1870	c.1108G>T	c.(1108-1110)GCA>TCA	p.A370S	MACF1_uc010ois.1_Intron|MACF1_uc001cda.1_Intron|MACF1_uc001cdc.1_Intron|MACF1_uc010oiu.1_Intron	NM_015038	NP_055853	O94854	K0754_HUMAN	hypothetical protein LOC643314	234											0	Lung NSC(20;5.57e-06)|Ovarian(52;0.00769)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0393)	OV - Ovarian serous cystadenocarcinoma(33;7.78e-19)|Epithelial(16;1.73e-17)|all cancers(16;2.49e-16)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)													OREG0013393	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	39877045	39877045	8499	1	G	T	T	34	34	KIAA0754	T	2	2
B4GALT2	8704	broad.mit.edu	37	1	44446880	44446880	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44446880G>A	uc001clg.2	+	2	418	c.48G>A	c.(46-48)GTG>GTA	p.V16V	B4GALT2_uc001clh.2_5'UTR|B4GALT2_uc010okl.1_Silent_p.V45V|B4GALT2_uc001cli.2_Silent_p.V16V	NM_003780	NP_003771	O60909	B4GT2_HUMAN	UDP-Gal:betaGlcNAc beta 1,4-	16	Helical; Signal-anchor for type II membrane protein; (Potential).				post-translational protein modification|protein N-linked glycosylation via asparagine	Golgi cisterna membrane|integral to membrane	beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity|lactose synthase activity|metal ion binding|N-acetyllactosamine synthase activity			ovary(1)|skin(1)	2	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0511)			N-Acetyl-D-glucosamine(DB00141)													---	---	---	---	capture		Silent	SNP	44446880	44446880	1292	1	G	A	A	46	46	B4GALT2	A	2	2
KLF17	128209	broad.mit.edu	37	1	44595240	44595240	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44595240C>T	uc001clp.2	+	2	355	c.297C>T	c.(295-297)AGC>AGT	p.S99S	KLF17_uc009vxf.1_Silent_p.S62S	NM_173484	NP_775755	Q5JT82	KLF17_HUMAN	zinc finger protein 393	99					regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(1)|skin(1)	2	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---	capture		Silent	SNP	44595240	44595240	8657	1	C	T	T	28	28	KLF17	T	2	2
MAST2	23139	broad.mit.edu	37	1	46485316	46485316	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:46485316G>A	uc001cov.2	+	11	1520	c.1237G>A	c.(1237-1239)GTG>ATG	p.V413M	MAST2_uc001cow.2_Missense_Mutation_p.V413M|MAST2_uc001coy.1_Intron|MAST2_uc001coz.1_Missense_Mutation_p.V298M|MAST2_uc009vya.2_Missense_Mutation_p.V335M|MAST2_uc001cpa.2_RNA	NM_015112	NP_055927	Q6P0Q8	MAST2_HUMAN	microtubule associated serine/threonine kinase	413					regulation of interleukin-12 biosynthetic process|spermatid differentiation	cytoplasm|cytoskeleton|plasma membrane	ATP binding|magnesium ion binding|phosphatase binding|protein serine/threonine kinase activity			ovary(5)|lung(3)|stomach(2)|breast(1)	11	Acute lymphoblastic leukemia(166;0.155)|Lung SC(450;0.184)																	---	---	---	---	capture		Missense_Mutation	SNP	46485316	46485316	9709	1	G	A	A	44	44	MAST2	A	2	2
PRKAA2	5563	broad.mit.edu	37	1	57159485	57159485	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57159485G>C	uc001cyk.3	+	5	594	c.523G>C	c.(523-525)GGA>CGA	p.G175R		NM_006252	NP_006243	P54646	AAPK2_HUMAN	AMP-activated protein kinase alpha 2 catalytic	175	Protein kinase.				carnitine shuttle|cell cycle arrest|cholesterol biosynthetic process|energy reserve metabolic process|fatty acid biosynthetic process|insulin receptor signaling pathway|regulation of fatty acid biosynthetic process|regulation of fatty acid oxidation	cytosol|nucleoplasm	ATP binding|metal ion binding			breast(4)|ovary(1)|stomach(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	57159485	57159485	12937	1	G	C	C	39	39	PRKAA2	C	3	3
LRRIQ3	127255	broad.mit.edu	37	1	74648457	74648457	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:74648457T>A	uc001dfy.3	-	3	530	c.338A>T	c.(337-339)AAG>ATG	p.K113M	LRRIQ3_uc001dfz.3_RNA	NM_001105659	NP_001099129	A6PVS8	LRIQ3_HUMAN	leucine-rich repeats and IQ motif containing 3	113	LRR 3.									ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	74648457	74648457	9406	1	T	A	A	56	56	LRRIQ3	A	4	4
C1orf173	127254	broad.mit.edu	37	1	75038038	75038038	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:75038038G>A	uc001dgg.2	-	14	3575	c.3356C>T	c.(3355-3357)CCA>CTA	p.P1119L		NM_001002912	NP_001002912	Q5RHP9	CA173_HUMAN	hypothetical protein LOC127254	1119	Glu-rich.									ovary(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	75038038	75038038	2081	1	G	A	A	47	47	C1orf173	A	2	2
MCOLN2	255231	broad.mit.edu	37	1	85412758	85412758	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85412758C>A	uc001dkm.2	-	7	1046	c.805G>T	c.(805-807)GCC>TCC	p.A269S	MCOLN2_uc001dkn.2_RNA	NM_153259	NP_694991	Q8IZK6	MCLN2_HUMAN	mucolipin 2	269						integral to membrane	ion channel activity			ovary(3)|upper_aerodigestive_tract(1)	4				all cancers(265;0.0111)|Epithelial(280;0.0263)|OV - Ovarian serous cystadenocarcinoma(397;0.217)														---	---	---	---	capture		Missense_Mutation	SNP	85412758	85412758	9785	1	C	A	A	25	25	MCOLN2	A	2	2
MCOLN3	55283	broad.mit.edu	37	1	85487781	85487781	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85487781C>A	uc001dkp.2	-	11	1385	c.1292G>T	c.(1291-1293)TGG>TTG	p.W431L	MCOLN3_uc001dko.2_Missense_Mutation_p.W50L|MCOLN3_uc001dkq.2_Missense_Mutation_p.W375L	NM_018298	NP_060768	Q8TDD5	MCLN3_HUMAN	mucolipin 3	431	Helical; (Potential).					integral to membrane	ion channel activity			skin(1)	1				all cancers(265;0.00957)|Epithelial(280;0.0254)														---	---	---	---	capture		Missense_Mutation	SNP	85487781	85487781	9786	1	C	A	A	21	21	MCOLN3	A	2	2
COL24A1	255631	broad.mit.edu	37	1	86306922	86306922	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86306922C>A	uc001dlj.2	-	42	3652	c.3610G>T	c.(3610-3612)GGG>TGG	p.G1204W	COL24A1_uc001dli.2_Missense_Mutation_p.G340W|COL24A1_uc010osd.1_Missense_Mutation_p.G504W|COL24A1_uc001dlk.2_RNA|COL24A1_uc010ose.1_RNA|COL24A1_uc010osf.1_RNA	NM_152890	NP_690850	Q17RW2	COOA1_HUMAN	collagen, type XXIV, alpha 1 precursor	1204	Collagen-like 13.				cell adhesion	collagen	extracellular matrix structural constituent			ovary(3)|central_nervous_system(1)|skin(1)	5				all cancers(265;0.0627)|Epithelial(280;0.0689)														---	---	---	---	capture		Missense_Mutation	SNP	86306922	86306922	3821	1	C	A	A	21	21	COL24A1	A	2	2
TGFBR3	7049	broad.mit.edu	37	1	92178020	92178020	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:92178020C>A	uc001doh.2	-	13	2412	c.1946G>T	c.(1945-1947)AGG>ATG	p.R649M	TGFBR3_uc009wde.2_Intron|TGFBR3_uc010osy.1_Missense_Mutation_p.R607M|TGFBR3_uc001doi.2_Missense_Mutation_p.R648M|TGFBR3_uc001doj.2_Missense_Mutation_p.R648M	NM_003243	NP_003234	Q03167	TGBR3_HUMAN	transforming growth factor, beta receptor III	649	ZP.|Extracellular (Potential).				BMP signaling pathway|cardiac epithelial to mesenchymal transition|cardiac muscle cell proliferation|cell growth|cell migration|definitive erythrocyte differentiation|heart trabecula formation|immune response|intracellular protein kinase cascade|liver development|negative regulation of cellular component movement|negative regulation of epithelial cell proliferation|palate development|pathway-restricted SMAD protein phosphorylation|response to follicle-stimulating hormone stimulus|response to luteinizing hormone stimulus|response to prostaglandin E stimulus|transforming growth factor beta receptor signaling pathway|ventricular cardiac muscle tissue morphogenesis	external side of plasma membrane|extracellular space|inhibin-betaglycan-ActRII complex|integral to plasma membrane|intracellular membrane-bounded organelle	coreceptor activity|heparin binding|PDZ domain binding|SMAD binding|transforming growth factor beta binding|transforming growth factor beta receptor activity, type III|type II transforming growth factor beta receptor binding			ovary(3)	3		all_lung(203;0.00719)|Lung NSC(277;0.0268)		all cancers(265;0.0108)|Epithelial(280;0.0825)														---	---	---	---	capture		Missense_Mutation	SNP	92178020	92178020	16351	1	C	A	A	24	24	TGFBR3	A	2	2
DNTTIP2	30836	broad.mit.edu	37	1	94342030	94342030	+	Silent	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:94342030T>A	uc001dqf.2	-	2	1499	c.1461A>T	c.(1459-1461)GCA>GCT	p.A487A	DNTTIP2_uc010otm.1_RNA|DNTTIP2_uc009wdo.1_Silent_p.A282A	NM_014597	NP_055412	Q5QJE6	TDIF2_HUMAN	deoxynucleotidyltransferase, terminal,	487					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus					0		all_lung(203;0.0111)|Lung NSC(277;0.0347)		all cancers(265;0.00679)|GBM - Glioblastoma multiforme(16;0.0278)|Epithelial(280;0.128)														---	---	---	---	capture		Silent	SNP	94342030	94342030	4865	1	T	A	A	51	51	DNTTIP2	A	4	4
VCAM1	7412	broad.mit.edu	37	1	101200237	101200237	+	Missense_Mutation	SNP	G	T	T	rs146573744		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:101200237G>T	uc001dti.2	+	8	2092	c.1972G>T	c.(1972-1974)GCC>TCC	p.A658S	VCAM1_uc001dtj.2_Missense_Mutation_p.A566S|VCAM1_uc010ouj.1_Missense_Mutation_p.A596S	NM_001078	NP_001069	P19320	VCAM1_HUMAN	vascular cell adhesion molecule 1 isoform a	658	Ig-like C2-type 7.|Extracellular (Potential).				heterophilic cell-cell adhesion|interferon-gamma-mediated signaling pathway|interspecies interaction between organisms|leukocyte tethering or rolling|membrane to membrane docking|positive regulation of T cell proliferation|regulation of immune response	alpha9-beta1 integrin-vascular cell adhesion molecule-1 complex|apical part of cell|external side of plasma membrane|extracellular space|filopodium|integral to membrane|microvillus|podosome	cell adhesion molecule binding|integrin binding			central_nervous_system(1)	1		all_epithelial(167;3.83e-06)|all_lung(203;0.000485)|Lung NSC(277;0.0011)		Epithelial(280;0.0227)|all cancers(265;0.0276)|COAD - Colon adenocarcinoma(174;0.149)|Colorectal(144;0.169)|Lung(183;0.196)	Carvedilol(DB01136)													---	---	---	---	capture		Missense_Mutation	SNP	101200237	101200237	17702	1	G	T	T	42	42	VCAM1	T	2	2
GNAI3	2773	broad.mit.edu	37	1	110134722	110134722	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110134722A>G	uc001dxz.2	+	8	1089	c.932A>G	c.(931-933)AAC>AGC	p.N311S		NM_006496	NP_006487	P08754	GNAI3_HUMAN	guanine nucleotide binding protein (G protein),	311					cell cycle|cell division|inhibition of adenylate cyclase activity by G-protein signaling pathway|platelet activation|synaptic transmission	centrosome|heterotrimeric G-protein complex|midbody	G-protein beta/gamma-subunit complex binding|GTP binding|GTPase activity|metabotropic serotonin receptor binding|signal transducer activity			ovary(1)	1		all_epithelial(167;2.5e-05)|all_lung(203;0.000135)|Lung NSC(277;0.000269)|Breast(1374;0.244)		Lung(183;0.046)|Colorectal(144;0.119)|Epithelial(280;0.139)|all cancers(265;0.147)|LUSC - Lung squamous cell carcinoma(189;0.237)														---	---	---	---	capture		Missense_Mutation	SNP	110134722	110134722	6775	1	A	G	G	2	2	GNAI3	G	4	4
WNT2B	7482	broad.mit.edu	37	1	113058889	113058889	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:113058889T>A	uc001ecb.2	+	3	1046	c.531T>A	c.(529-531)CAT>CAA	p.H177Q	WNT2B_uc001eca.2_Missense_Mutation_p.H158Q|WNT2B_uc009wgg.2_Missense_Mutation_p.H85Q	NM_024494	NP_078613	Q93097	WNT2B_HUMAN	wingless-type MMTV integration site family,	177					chondrocyte differentiation|cornea development in camera-type eye|dorsal/ventral axis specification|forebrain regionalization|hemopoietic stem cell proliferation|iris morphogenesis|lens development in camera-type eye|lung induction|male gonad development|neuron differentiation|positive regulation of branching involved in ureteric bud morphogenesis|positive regulation of canonical Wnt receptor signaling pathway|Wnt receptor signaling pathway, calcium modulating pathway	extracellular space|plasma membrane|proteinaceous extracellular matrix	frizzled-2 binding|signal transducer activity			ovary(2)|breast(2)|skin(1)	5	Lung SC(450;0.246)	all_cancers(81;7.31e-07)|all_epithelial(167;4.59e-06)|all_lung(203;2.56e-05)|Lung NSC(69;4.38e-05)		Lung(183;0.0234)|all cancers(265;0.0246)|Epithelial(280;0.0342)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---	capture		Missense_Mutation	SNP	113058889	113058889	17961	1	T	A	A	51	51	WNT2B	A	4	4
CASQ2	845	broad.mit.edu	37	1	116280898	116280898	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:116280898C>A	uc001efx.3	-	4	743	c.479G>T	c.(478-480)CGC>CTC	p.R160L	CASQ2_uc010owu.1_Intron	NM_001232	NP_001223	O14958	CASQ2_HUMAN	cardiac calsequestrin 2 precursor	160					heart development|striated muscle contraction	sarcoplasmic reticulum lumen	calcium ion binding			skin(1)	1	Lung SC(450;0.211)	all_cancers(81;1.25e-06)|all_epithelial(167;1.02e-06)|all_lung(203;8.03e-06)|Lung NSC(69;5.01e-05)		Lung(183;0.0171)|Colorectal(144;0.0686)|LUSC - Lung squamous cell carcinoma(189;0.0903)|all cancers(265;0.108)|COAD - Colon adenocarcinoma(174;0.111)|Epithelial(280;0.12)														---	---	---	---	capture		Missense_Mutation	SNP	116280898	116280898	2800	1	C	A	A	27	27	CASQ2	A	1	1
ITGA10	8515	broad.mit.edu	37	1	145538010	145538010	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145538010G>C	uc001eoa.2	+	22	2765	c.2689G>C	c.(2689-2691)GAG>CAG	p.E897Q	NBPF10_uc001emp.3_Intron|ITGA10_uc010oyv.1_Missense_Mutation_p.E766Q|ITGA10_uc009wiw.2_Missense_Mutation_p.E754Q|ITGA10_uc010oyw.1_Missense_Mutation_p.E842Q	NM_003637	NP_003628	O75578	ITA10_HUMAN	integrin, alpha 10 precursor	897	Extracellular (Potential).				cell-matrix adhesion|integrin-mediated signaling pathway	integrin complex	collagen binding|receptor activity			lung(2)|ovary(2)|kidney(2)|large_intestine(1)|skin(1)	8	all_hematologic(18;0.0187)|Acute lymphoblastic leukemia(18;0.0786)																	---	---	---	---	capture		Missense_Mutation	SNP	145538010	145538010	8177	1	G	C	C	45	45	ITGA10	C	3	3
ARHGEF2	9181	broad.mit.edu	37	1	155920118	155920118	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155920118G>T	uc001fmt.2	-	21	2977	c.2859C>A	c.(2857-2859)AGC>AGA	p.S953R	ARHGEF2_uc001fmq.2_Missense_Mutation_p.S191R|ARHGEF2_uc001fmr.2_Missense_Mutation_p.S925R|ARHGEF2_uc001fms.2_Missense_Mutation_p.S952R|ARHGEF2_uc001fmu.2_Missense_Mutation_p.S997R	NM_001162383	NP_001155855	Q92974	ARHG2_HUMAN	Rho/Rac guanine nucleotide exchange factor 2	953					actin filament organization|apoptosis|cell division|cell morphogenesis|induction of apoptosis by extracellular signals|intracellular protein transport|mitosis|negative regulation of microtubule depolymerization|nerve growth factor receptor signaling pathway|positive regulation of NF-kappaB transcription factor activity|regulation of cell proliferation|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|Golgi apparatus|microtubule|ruffle membrane|spindle|tight junction	microtubule binding|Rac GTPase binding|Rac guanyl-nucleotide exchange factor activity|zinc ion binding			ovary(1)	1	Hepatocellular(266;0.133)|all_hematologic(923;0.145)|all_neural(408;0.195)																	---	---	---	---	capture		Missense_Mutation	SNP	155920118	155920118	917	1	G	T	T	42	42	ARHGEF2	T	2	2
IQGAP3	128239	broad.mit.edu	37	1	156499987	156499987	+	Silent	SNP	C	A	A	rs139798063		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156499987C>A	uc001fpf.2	-	34	4389	c.4314G>T	c.(4312-4314)CGG>CGT	p.R1438R		NM_178229	NP_839943	Q86VI3	IQGA3_HUMAN	IQ motif containing GTPase activating protein 3	1438					small GTPase mediated signal transduction	intracellular	calmodulin binding|Ras GTPase activator activity			ovary(5)|skin(1)	6	all_hematologic(923;0.088)|Hepatocellular(266;0.158)																	---	---	---	---	capture		Silent	SNP	156499987	156499987	8119	1	C	A	A	26	26	IQGAP3	A	2	2
ARHGEF11	9826	broad.mit.edu	37	1	156947996	156947996	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156947996C>T	uc001fqo.2	-	6	1550	c.510G>A	c.(508-510)CAG>CAA	p.Q170Q	ARHGEF11_uc001fqn.2_Silent_p.Q170Q	NM_014784	NP_055599	O15085	ARHGB_HUMAN	Rho guanine nucleotide exchange factor (GEF) 11	170					actin cytoskeleton organization|apoptosis|axon guidance|cellular component movement|cytokinesis|establishment of cell polarity|G-protein coupled receptor protein signaling pathway|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|positive regulation of transcription, DNA-dependent|regulation of cell growth|regulation of Rho protein signal transduction|Rho protein signal transduction|striated muscle contraction	cytosol|Golgi apparatus|plasma membrane	G-protein-coupled receptor binding|GTPase activator activity|Rho guanyl-nucleotide exchange factor activity|signal transducer activity			ovary(3)|skin(2)|pleura(1)|lung(1)|kidney(1)|pancreas(1)	9	all_hematologic(923;0.0839)|Hepatocellular(266;0.158)																	---	---	---	---	capture		Silent	SNP	156947996	156947996	910	1	C	T	T	24	24	ARHGEF11	T	2	2
IFI16	3428	broad.mit.edu	37	1	158985664	158985664	+	Missense_Mutation	SNP	A	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158985664A>C	uc001ftf.1	+	4	875	c.268A>C	c.(268-270)AAA>CAA	p.K90Q	IFI16_uc001ftg.2_Missense_Mutation_p.K90Q|IFI16_uc010pis.1_Missense_Mutation_p.K90Q	NM_005531	NP_005522	Q16666	IF16_HUMAN	interferon, gamma-inducible protein 16	90	Lys-rich.				cell proliferation|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|monocyte differentiation|negative regulation of transcription, DNA-dependent|response to virus|transcription, DNA-dependent	cytoplasm|nuclear speck|nucleolus	double-stranded DNA binding|protein binding			ovary(1)	1	all_hematologic(112;0.0429)																	---	---	---	---	capture		Missense_Mutation	SNP	158985664	158985664	7812	1	A	C	C	1	1	IFI16	C	4	4
OR10J5	127385	broad.mit.edu	37	1	159505223	159505223	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:159505223G>T	uc010piw.1	-	1	575	c.575C>A	c.(574-576)ACT>AAT	p.T192N		NM_001004469	NP_001004469	Q8NHC4	O10J5_HUMAN	olfactory receptor, family 10, subfamily J,	192	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)	3	all_hematologic(112;0.0429)																	---	---	---	---	capture		Missense_Mutation	SNP	159505223	159505223	11318	1	G	T	T	36	36	OR10J5	T	2	2
NOS1AP	9722	broad.mit.edu	37	1	162335298	162335298	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:162335298C>T	uc001gbv.2	+	9	1431	c.1044C>T	c.(1042-1044)CAC>CAT	p.H348H	NOS1AP_uc010pks.1_RNA|NOS1AP_uc001gbw.2_Silent_p.H343H|NOS1AP_uc009wut.1_Silent_p.H53H	NM_014697	NP_055512	O75052	CAPON_HUMAN	nitric oxide synthase 1 (neuronal) adaptor	348	Potential.				regulation of apoptosis|regulation of nitric oxide biosynthetic process|regulation of nitric-oxide synthase activity		nitric-oxide synthase binding|PDZ domain binding			lung(2)|upper_aerodigestive_tract(1)	3	all_hematologic(112;0.203)		BRCA - Breast invasive adenocarcinoma(70;0.0537)															---	---	---	---	capture		Silent	SNP	162335298	162335298	10945	1	C	T	T	17	17	NOS1AP	T	2	2
SFT2D2	375035	broad.mit.edu	37	1	168208375	168208375	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:168208375C>T	uc001gfi.3	+	7	483	c.420C>T	c.(418-420)AGC>AGT	p.S140S	TBX19_uc001gfj.3_Intron	NM_199344	NP_955376	O95562	SFT2B_HUMAN	SFT2 domain containing 2	140	Helical; Name=4; (Potential).				protein transport|vesicle-mediated transport	integral to membrane				skin(1)	1	all_hematologic(923;0.215)																	---	---	---	---	capture		Silent	SNP	168208375	168208375	14676	1	C	T	T	26	26	SFT2D2	T	2	2
C1orf114	57821	broad.mit.edu	37	1	169391178	169391178	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169391178G>T	uc001gga.1	-	3	659	c.491C>A	c.(490-492)CCT>CAT	p.P164H	C1orf114_uc001gfz.1_Missense_Mutation_p.P164H|C1orf114_uc009wvq.1_Missense_Mutation_p.P164H|C1orf114_uc001ggb.2_Missense_Mutation_p.P164H|C1orf114_uc001ggc.1_Missense_Mutation_p.P164H	NM_021179	NP_067002	Q5TID7	CA114_HUMAN	hypothetical protein LOC57821	164											0	all_hematologic(923;0.208)																	---	---	---	---	capture		Missense_Mutation	SNP	169391178	169391178	2054	1	G	T	T	35	35	C1orf114	T	2	2
FMO4	2329	broad.mit.edu	37	1	171292329	171292329	+	Nonsense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:171292329A>T	uc001gho.2	+	4	536	c.319A>T	c.(319-321)AAG>TAG	p.K107*		NM_002022	NP_002013	P31512	FMO4_HUMAN	flavin containing monooxygenase 4	107					xenobiotic metabolic process	integral to membrane|intrinsic to endoplasmic reticulum membrane|microsome	flavin adenine dinucleotide binding|flavin-containing monooxygenase activity|NADP binding			kidney(2)|skin(1)	3	all_cancers(6;3.9e-08)|all_hematologic(923;0.088)|Acute lymphoblastic leukemia(37;0.181)																	---	---	---	---	capture		Nonsense_Mutation	SNP	171292329	171292329	6199	1	A	T	T	13	13	FMO4	T	5	4
TDRD5	163589	broad.mit.edu	37	1	179561940	179561940	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:179561940G>T	uc001gnf.1	+	2	440	c.190G>T	c.(190-192)GTT>TTT	p.V64F	TDRD5_uc010pnp.1_Missense_Mutation_p.V64F|uc010pno.1_5'Flank	NM_173533	NP_775804	Q8NAT2	TDRD5_HUMAN	tudor domain containing 5	64	Lotus/OST-HTH 1.				DNA methylation involved in gamete generation|P granule organization|spermatid development	chromatoid body|pi-body	nucleic acid binding			ovary(2)|skin(2)|central_nervous_system(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	179561940	179561940	16260	1	G	T	T	48	48	TDRD5	T	2	2
FAM5C	339479	broad.mit.edu	37	1	190067840	190067840	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:190067840A>T	uc001gse.1	-	8	1841	c.1609T>A	c.(1609-1611)TTG>ATG	p.L537M	FAM5C_uc010pot.1_Missense_Mutation_p.L435M	NM_199051	NP_950252	Q76B58	FAM5C_HUMAN	family with sequence similarity 5, member C	537						extracellular region				lung(2)|ovary(1)|kidney(1)|skin(1)	5	Prostate(682;0.198)																	---	---	---	---	capture		Missense_Mutation	SNP	190067840	190067840	5817	1	A	T	T	3	3	FAM5C	T	4	4
OPTC	26254	broad.mit.edu	37	1	203472730	203472730	+	Missense_Mutation	SNP	A	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:203472730A>C	uc001gzu.1	+	7	997	c.881A>C	c.(880-882)CAC>CCC	p.H294P		NM_014359	NP_055174	Q9UBM4	OPT_HUMAN	opticin precursor	294						proteinaceous extracellular matrix	extracellular matrix structural constituent|protein binding				0			BRCA - Breast invasive adenocarcinoma(75;0.109)															---	---	---	---	capture		Missense_Mutation	SNP	203472730	203472730	11294	1	A	C	C	6	6	OPTC	C	4	4
FLVCR1	28982	broad.mit.edu	37	1	213046038	213046038	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:213046038G>A	uc001hjt.2	+	3	1100	c.902G>A	c.(901-903)CGG>CAG	p.R301Q		NM_014053	NP_054772	Q9Y5Y0	FLVC1_HUMAN	feline leukemia virus subgroup C cellular	301					cell death|cellular iron ion homeostasis|heme export|transmembrane transport	integral to plasma membrane	heme transporter activity|protein binding|receptor activity				0				OV - Ovarian serous cystadenocarcinoma(81;0.00733)|all cancers(67;0.013)|GBM - Glioblastoma multiforme(131;0.0845)|Epithelial(68;0.11)														---	---	---	---	capture		Missense_Mutation	SNP	213046038	213046038	6187	1	G	A	A	39	39	FLVCR1	A	1	1
MOSC1	64757	broad.mit.edu	37	1	220971262	220971262	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:220971262C>G	uc001hms.2	+	4	907	c.659C>G	c.(658-660)TCG>TGG	p.S220W	MOSC1_uc001hmt.2_Missense_Mutation_p.S220W	NM_022746	NP_073583	Q5VT66	MOSC1_HUMAN	MOCO sulphurase C-terminal domain containing 1	220	MOSC.						molybdenum ion binding|oxidoreductase activity|pyridoxal phosphate binding				0				GBM - Glioblastoma multiforme(131;0.0358)														---	---	---	---	capture		Missense_Mutation	SNP	220971262	220971262	10105	1	C	G	G	31	31	MOSC1	G	3	3
TRIM11	81559	broad.mit.edu	37	1	228582761	228582761	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228582761C>A	uc001hss.2	-	6	1307	c.1052G>T	c.(1051-1053)CGC>CTC	p.R351L	TRIM11_uc010pvx.1_Missense_Mutation_p.R350L	NM_145214	NP_660215	Q96F44	TRI11_HUMAN	tripartite motif-containing 11	351	B30.2/SPRY.				response to virus	cytoplasm|nucleus	protein binding|zinc ion binding			lung(3)|ovary(1)	4		Prostate(94;0.0724)																---	---	---	---	capture		Missense_Mutation	SNP	228582761	228582761	17031	1	C	A	A	27	27	TRIM11	A	1	1
NUP133	55746	broad.mit.edu	37	1	229613401	229613401	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229613401C>G	uc001htn.2	-	13	1791	c.1699G>C	c.(1699-1701)GAC>CAC	p.D567H		NM_018230	NP_060700	Q8WUM0	NU133_HUMAN	nucleoporin 133kDa	567					carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|nuclear pore organization|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			breast(4)|skin(2)|ovary(1)	7	Breast(184;0.104)|Ovarian(103;0.249)	Prostate(94;0.167)																---	---	---	---	capture		Missense_Mutation	SNP	229613401	229613401	11159	1	C	G	G	32	32	NUP133	G	3	3
AKT3	10000	broad.mit.edu	37	1	243858999	243858999	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:243858999C>A	uc001iab.1	-	2	147	c.66G>T	c.(64-66)TGG>TGT	p.W22C	AKT3_uc001hzz.1_Missense_Mutation_p.W22C	NM_005465	NP_005456	Q9Y243	AKT3_HUMAN	AKT3 kinase isoform 1	22	PH.				signal transduction	Golgi apparatus|nucleus|plasma membrane	ATP binding|protein binding|protein serine/threonine kinase activity			stomach(1)|lung(1)|breast(1)|central_nervous_system(1)	4	all_cancers(71;0.000307)|all_epithelial(71;0.000374)|all_lung(81;0.0323)|Ovarian(71;0.0619)|all_neural(11;0.101)|Lung NSC(105;0.168)	all_cancers(173;0.0274)	all cancers(7;4.3e-08)|GBM - Glioblastoma multiforme(7;5.12e-06)|OV - Ovarian serous cystadenocarcinoma(106;0.00196)															---	---	---	---	capture		Missense_Mutation	SNP	243858999	243858999	484	1	C	A	A	30	30	AKT3	A	2	2
OR2B11	127623	broad.mit.edu	37	1	247615256	247615256	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247615256C>A	uc010pyx.1	-	1	29	c.29G>T	c.(28-30)GGG>GTG	p.G10V		NM_001004492	NP_001004492	Q5JQS5	OR2BB_HUMAN	olfactory receptor, family 2, subfamily B,	10	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			upper_aerodigestive_tract(1)	1	all_cancers(71;4.51e-05)|all_epithelial(71;1.3e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)	all_cancers(173;0.241)	OV - Ovarian serous cystadenocarcinoma(106;0.0188)															---	---	---	---	capture		Missense_Mutation	SNP	247615256	247615256	11394	1	C	A	A	22	22	OR2B11	A	2	2
OR2T1	26696	broad.mit.edu	37	1	248570299	248570299	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248570299T>C	uc010pzm.1	+	1	1004	c.1004T>C	c.(1003-1005)CTG>CCG	p.L335P		NM_030904	NP_112166	O43869	OR2T1_HUMAN	olfactory receptor, family 2, subfamily T,	335	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			pancreas(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Missense_Mutation	SNP	248570299	248570299	11422	1	T	C	C	55	55	OR2T1	C	4	4
SEC61A2	55176	broad.mit.edu	37	10	12191907	12191907	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:12191907T>A	uc001ile.2	+	6	556	c.409T>A	c.(409-411)TAT>AAT	p.Y137N	SEC61A2_uc010qbq.1_Missense_Mutation_p.Y115N|SEC61A2_uc001ilf.3_RNA|SEC61A2_uc001ilh.3_RNA|SEC61A2_uc001ilg.3_Missense_Mutation_p.Y137N	NM_018144	NP_060614	Q9H9S3	S61A2_HUMAN	Sec61 alpha form 2 isoform a	137	Helical; (Potential).					endoplasmic reticulum membrane|integral to membrane	P-P-bond-hydrolysis-driven protein transmembrane transporter activity			ovary(1)	1		Renal(717;0.228)																---	---	---	---	capture		Missense_Mutation	SNP	12191907	12191907	14487	10	T	A	A	57	57	SEC61A2	A	4	4
CACNB2	783	broad.mit.edu	37	10	18825123	18825123	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18825123C>A	uc001ipr.2	+	12	1360	c.1300C>A	c.(1300-1302)CCA>ACA	p.P434T	CACNB2_uc009xjz.1_Missense_Mutation_p.P184T|CACNB2_uc001ips.2_Missense_Mutation_p.P410T|CACNB2_uc001ipt.2_Missense_Mutation_p.P396T|CACNB2_uc001ipu.2_Missense_Mutation_p.P406T|CACNB2_uc001ipv.2_Missense_Mutation_p.P382T|CACNB2_uc009xka.1_Missense_Mutation_p.P368T|CACNB2_uc001ipw.2_Missense_Mutation_p.P341T|CACNB2_uc001ipx.2_Missense_Mutation_p.P379T|CACNB2_uc001ipz.2_Missense_Mutation_p.P356T|CACNB2_uc001ipy.2_Missense_Mutation_p.P380T|CACNB2_uc010qco.1_Missense_Mutation_p.P348T|CACNB2_uc001iqa.2_Missense_Mutation_p.P386T|NSUN6_uc001iqb.2_Intron	NM_201596	NP_963890	Q08289	CACB2_HUMAN	calcium channel, voltage-dependent, beta 2	434					axon guidance|neuromuscular junction development	integral to plasma membrane|sarcolemma|voltage-gated calcium channel complex	protein binding|voltage-gated calcium channel activity			large_intestine(1)|central_nervous_system(1)|skin(1)	3					Magnesium Sulfate(DB00653)|Verapamil(DB00661)													---	---	---	---	capture		Missense_Mutation	SNP	18825123	18825123	2669	10	C	A	A	30	30	CACNB2	A	2	2
PIP4K2A	5305	broad.mit.edu	37	10	22880610	22880610	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:22880610A>G	uc001irl.3	-	4	688	c.440T>C	c.(439-441)ATT>ACT	p.I147T	PIP4K2A_uc010qcu.1_5'UTR	NM_005028	NP_005019	P48426	PI42A_HUMAN	phosphatidylinositol-5-phosphate 4-kinase, type	147	PIPK.						1-phosphatidylinositol-4-phosphate 5-kinase activity|1-phosphatidylinositol-5-phosphate 4-kinase activity|ATP binding			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	22880610	22880610	12360	10	A	G	G	4	4	PIP4K2A	G	4	4
SVIL	6840	broad.mit.edu	37	10	29813479	29813479	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:29813479C>A	uc001iut.1	-	14	3261	c.2508G>T	c.(2506-2508)CGG>CGT	p.R836R	SVIL_uc010qdw.1_5'Flank|SVIL_uc001iuu.1_Silent_p.R410R	NM_021738	NP_068506	O95425	SVIL_HUMAN	supervillin isoform 2	836					cytoskeleton organization|skeletal muscle tissue development	cell junction|costamere|invadopodium|nucleus|podosome	actin filament binding			ovary(5)|upper_aerodigestive_tract(1)	6		Breast(68;0.103)																---	---	---	---	capture		Silent	SNP	29813479	29813479	15941	10	C	A	A	30	30	SVIL	A	2	2
ANKRD30A	91074	broad.mit.edu	37	10	37442556	37442556	+	Silent	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:37442556A>G	uc001iza.1	+	13	1695	c.1596A>G	c.(1594-1596)CAA>CAG	p.Q532Q		NM_052997	NP_443723	Q9BXX3	AN30A_HUMAN	ankyrin repeat domain 30A	588						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(7)|breast(1)|skin(1)	9																		---	---	---	---	capture		Silent	SNP	37442556	37442556	663	10	A	G	G	1	1	ANKRD30A	G	4	4
CSGALNACT2	55454	broad.mit.edu	37	10	43678762	43678762	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43678762A>T	uc001jan.2	+	8	1736	c.1401A>T	c.(1399-1401)TTA>TTT	p.L467F		NM_018590	NP_061060	Q8N6G5	CGAT2_HUMAN	chondroitin sulfate	467	Lumenal (Potential).				chondroitin sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process|dermatan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	Golgi cisterna membrane|integral to Golgi membrane	glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase activity|metal ion binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	43678762	43678762	4080	10	A	T	T	14	14	CSGALNACT2	T	4	4
ZNF488	118738	broad.mit.edu	37	10	48370751	48370751	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:48370751G>T	uc001jex.2	+	2	381	c.219G>T	c.(217-219)GAG>GAT	p.E73D	ZNF488_uc001jey.2_Intron	NM_153034	NP_694579	Q96MN9	ZN488_HUMAN	zinc finger protein 488	73					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	48370751	48370751	18534	10	G	T	T	34	34	ZNF488	T	2	2
RBP3	5949	broad.mit.edu	37	10	48390116	48390116	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:48390116C>T	uc001jez.2	-	1	876	c.762G>A	c.(760-762)GTG>GTA	p.V254V		NM_002900	NP_002891	P10745	RET3_HUMAN	retinol-binding protein 3 precursor	254	4 X approximate tandem repeats.|1.				lipid metabolic process|proteolysis|transport|visual perception	interphotoreceptor matrix	retinal binding|serine-type peptidase activity			large_intestine(1)|central_nervous_system(1)	2					Vitamin A(DB00162)													---	---	---	---	capture		Silent	SNP	48390116	48390116	13626	10	C	T	T	21	21	RBP3	T	2	2
MAPK8	5599	broad.mit.edu	37	10	49618206	49618206	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:49618206C>T	uc009xnz.2	+	5	669	c.445C>T	c.(445-447)CAT>TAT	p.H149Y	MAPK8_uc001jgl.2_Missense_Mutation_p.H149Y|MAPK8_uc001jgm.2_Missense_Mutation_p.H149Y|MAPK8_uc001jgo.2_Missense_Mutation_p.H149Y|MAPK8_uc009xoa.2_Missense_Mutation_p.H149Y|MAPK8_uc001jgn.2_Missense_Mutation_p.H149Y|MAPK8_uc010qgk.1_Missense_Mutation_p.H149Y|MAPK8_uc001jgp.2_Missense_Mutation_p.H149Y|MAPK8_uc001jgq.2_Missense_Mutation_p.H149Y	NM_139047	NP_620635	P45983	MK08_HUMAN	mitogen-activated protein kinase 8 isoform JNK1	149	Protein kinase.				activation of pro-apoptotic gene products|cellular response to mechanical stimulus|induction of apoptosis by intracellular signals|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of apoptosis|negative regulation of protein binding|nerve growth factor receptor signaling pathway|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|positive regulation of deacetylase activity|regulation of protein localization|regulation of sequence-specific DNA binding transcription factor activity|response to UV|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	ATP binding|histone deacetylase binding|histone deacetylase regulator activity|JUN kinase activity|protein binding			central_nervous_system(3)|lung(2)|stomach(1)|ovary(1)|kidney(1)	8		Ovarian(717;0.0221)|Lung SC(717;0.113)|all_neural(218;0.116)		Epithelial(53;3.46e-65)|Lung(62;0.125)														---	---	---	---	capture		Missense_Mutation	SNP	49618206	49618206	9666	10	C	T	T	29	29	MAPK8	T	2	2
CHAT	1103	broad.mit.edu	37	10	50854662	50854662	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:50854662T>A	uc001jhz.2	+	8	1376	c.1223T>A	c.(1222-1224)CTT>CAT	p.L408H	CHAT_uc001jhv.1_Missense_Mutation_p.L290H|CHAT_uc001jhx.1_Missense_Mutation_p.L290H|CHAT_uc001jhy.1_Missense_Mutation_p.L290H|CHAT_uc001jia.2_Missense_Mutation_p.L290H|CHAT_uc010qgs.1_Missense_Mutation_p.L290H	NM_020549	NP_065574	P28329	CLAT_HUMAN	choline acetyltransferase isoform 2	408					neurotransmitter biosynthetic process|neurotransmitter secretion	cytosol|nucleus	choline O-acetyltransferase activity			central_nervous_system(3)	3		all_neural(218;0.107)		GBM - Glioblastoma multiforme(2;0.000585)	Choline(DB00122)													---	---	---	---	capture		Missense_Mutation	SNP	50854662	50854662	3447	10	T	A	A	56	56	CHAT	A	4	4
MBL2	4153	broad.mit.edu	37	10	54530518	54530518	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:54530518G>T	uc001jjt.2	-	2	281	c.216C>A	c.(214-216)CCC>CCA	p.P72P		NM_000242	NP_000233	P11226	MBL2_HUMAN	soluble mannose-binding lectin precursor	72	Collagen-like.				acute-phase response|complement activation, classical pathway|complement activation, lectin pathway|defense response to Gram-positive bacterium|negative regulation of growth of symbiont in host|opsonization|response to oxidative stress	collagen|extracellular space	bacterial cell surface binding|calcium-dependent protein binding|eukaryotic cell surface binding|mannose binding|receptor binding			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	54530518	54530518	9738	10	G	T	T	43	43	MBL2	T	2	2
ANK3	288	broad.mit.edu	37	10	62029914	62029914	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:62029914C>A	uc001jky.2	-	5	680	c.488G>T	c.(487-489)GGT>GTT	p.G163V	ANK3_uc010qih.1_Missense_Mutation_p.G146V|ANK3_uc001jkz.3_Missense_Mutation_p.G157V|ANK3_uc001jlb.1_5'UTR	NM_020987	NP_066267	Q12955	ANK3_HUMAN	ankyrin 3 isoform 1	163	ANK 3.				establishment of protein localization|signal transduction	basolateral plasma membrane|cytoplasm|cytoskeleton	protein binding			skin(9)|ovary(6)|pancreas(2)|central_nervous_system(2)	19																		---	---	---	---	capture		Missense_Mutation	SNP	62029914	62029914	625	10	C	A	A	18	18	ANK3	A	2	2
CTNNA3	29119	broad.mit.edu	37	10	68040337	68040337	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:68040337G>T	uc009xpn.1	-	13	1898	c.1775C>A	c.(1774-1776)GCC>GAC	p.A592D	CTNNA3_uc001jmw.2_Missense_Mutation_p.A592D	NM_001127384	NP_001120856	Q9UI47	CTNA3_HUMAN	catenin, alpha 3	592					cell-cell adhesion	actin cytoskeleton|cytoplasm|fascia adherens	cadherin binding|structural molecule activity			skin(3)|ovary(2)|pancreas(1)|lung(1)|central_nervous_system(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	68040337	68040337	4173	10	G	T	T	42	42	CTNNA3	T	2	2
NPFFR1	64106	broad.mit.edu	37	10	72026002	72026002	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72026002C>A	uc010qjk.1	-	1	153	c.147G>T	c.(145-147)GCG>GCT	p.A49A		NM_022146	NP_071429	Q9GZQ6	NPFF1_HUMAN	neuropeptide FF receptor 1	51	Helical; Name=1; (Potential).					integral to membrane|plasma membrane	neuropeptide receptor activity				0																		---	---	---	---	capture		Silent	SNP	72026002	72026002	10981	10	C	A	A	27	27	NPFFR1	A	1	1
KIAA0913	23053	broad.mit.edu	37	10	75549948	75549948	+	Nonsense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:75549948C>G	uc009xrl.2	+	7	871	c.839C>G	c.(838-840)TCA>TGA	p.S280*	KIAA0913_uc001jve.2_Nonsense_Mutation_p.S280*|KIAA0913_uc001jvf.2_Nonsense_Mutation_p.S280*|KIAA0913_uc001jvh.2_5'Flank|KIAA0913_uc001jvi.2_5'Flank|KIAA0913_uc010qkr.1_5'Flank|KIAA0913_uc001jvj.2_5'Flank	NM_015037	NP_055852	A7E2V4	K0913_HUMAN	hypothetical protein LOC23053	280							zinc ion binding			breast(1)	1	Prostate(51;0.0112)																	---	---	---	---	capture		Nonsense_Mutation	SNP	75549948	75549948	8507	10	C	G	G	29	29	KIAA0913	G	5	3
KIAA0913	23053	broad.mit.edu	37	10	75551984	75551984	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:75551984C>G	uc009xrl.2	+	10	1719	c.1687C>G	c.(1687-1689)CCC>GCC	p.P563A	KIAA0913_uc001jve.2_Missense_Mutation_p.P563A|KIAA0913_uc001jvf.2_Missense_Mutation_p.P563A|KIAA0913_uc001jvh.2_RNA|KIAA0913_uc001jvi.2_5'UTR|KIAA0913_uc010qkr.1_5'UTR|KIAA0913_uc001jvj.2_5'UTR	NM_015037	NP_055852	A7E2V4	K0913_HUMAN	hypothetical protein LOC23053	563	Gly-rich.						zinc ion binding			breast(1)	1	Prostate(51;0.0112)																	---	---	---	---	capture		Missense_Mutation	SNP	75551984	75551984	8507	10	C	G	G	30	30	KIAA0913	G	3	3
CYP2C9	1559	broad.mit.edu	37	10	96745850	96745850	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96745850C>A	uc001kka.3	+	8	1235	c.1210C>A	c.(1210-1212)CCA>ACA	p.P404T	CYP2C9_uc009xut.2_Missense_Mutation_p.P402T	NM_000771	NP_000762	P11712	CP2C9_HUMAN	cytochrome P450, family 2, subfamily C,	404					exogenous drug catabolic process|monocarboxylic acid metabolic process|monoterpenoid metabolic process|oxidative demethylation|steroid metabolic process|urea metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	(S)-limonene 6-monooxygenase activity|(S)-limonene 7-monooxygenase activity|4-hydroxyacetophenone monooxygenase activity|caffeine oxidase activity|drug binding|electron carrier activity|heme binding|oxygen binding|steroid hydroxylase activity			skin(4)|ovary(2)	6		Colorectal(252;0.0902)		all cancers(201;6.93e-05)	Acenocoumarol(DB01418)|Alosetron(DB00969)|Amiodarone(DB01118)|Antihemophilic Factor(DB00025)|Aprepitant(DB00673)|Bosentan(DB00559)|Carprofen(DB00821)|Carvedilol(DB01136)|Celecoxib(DB00482)|Clomipramine(DB01242)|Dapsone(DB00250)|Delavirdine(DB00705)|Desloratadine(DB00967)|Desogestrel(DB00304)|Diclofenac(DB00586)|Esomeprazole(DB00736)|Etodolac(DB00749)|Fluconazole(DB00196)|Fluoxetine(DB00472)|Flurbiprofen(DB00712)|Fluvastatin(DB01095)|Fluvoxamine(DB00176)|Formoterol(DB00983)|Gemfibrozil(DB01241)|Ginkgo biloba(DB01381)|Glibenclamide(DB01016)|Glimepiride(DB00222)|Glipizide(DB01067)|Guanfacine(DB01018)|Hydromorphone(DB00327)|Ibuprofen(DB01050)|Imipramine(DB00458)|Irbesartan(DB01029)|Ketoconazole(DB01026)|Lansoprazole(DB00448)|Losartan(DB00678)|Lumiracoxib(DB01283)|Marinol(DB00470)|Mefenamic acid(DB00784)|Meloxicam(DB00814)|Mephenytoin(DB00532)|Metronidazole(DB00916)|Miconazole(DB01110)|Midazolam(DB00683)|Montelukast(DB00471)|Nateglinide(DB00731)|Nelfinavir(DB00220)|Nicardipine(DB00622)|Oxymorphone(DB01192)|Pantoprazole(DB00213)|Paramethadione(DB00617)|Phenprocoumon(DB00946)|Phenytoin(DB00252)|Pravastatin(DB00175)|Quinidine(DB00908)|Ritonavir(DB00503)|Rosiglitazone(DB00412)|Sertraline(DB01104)|Sildenafil(DB00203)|Sulfamethoxazole(DB01015)|Suprofen(DB00870)|Tamoxifen(DB00675)|Tenoxicam(DB00469)|Terfenadine(DB00342)|Tolbutamide(DB01124)|Torasemide(DB00214)|Troleandomycin(DB01361)|Valdecoxib(DB00580)|Valsartan(DB00177)|Voriconazole(DB00582)|Warfarin(DB00682)|Zafirlukast(DB00549)|Zileuton(DB00744)													---	---	---	---	capture		Missense_Mutation	SNP	96745850	96745850	4333	10	C	A	A	22	22	CYP2C9	A	2	2
SLIT1	6585	broad.mit.edu	37	10	98761031	98761031	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:98761031G>A	uc001kmw.2	-	37	4695	c.4443C>T	c.(4441-4443)CGC>CGT	p.R1481R		NM_003061	NP_003052	O75093	SLIT1_HUMAN	slit homolog 1 precursor	1481	CTCK.				axon extension involved in axon guidance|forebrain morphogenesis|motor axon guidance|negative chemotaxis|negative regulation of synaptogenesis	cytoplasm|extracellular space	calcium ion binding|Roundabout binding			ovary(4)	4		Colorectal(252;0.162)		Epithelial(162;2.02e-08)|all cancers(201;1.5e-06)														---	---	---	---	capture		Silent	SNP	98761031	98761031	15237	10	G	A	A	42	42	SLIT1	A	2	2
CNNM1	26507	broad.mit.edu	37	10	101148047	101148047	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101148047C>A	uc001kpp.3	+	9	2952	c.2663C>A	c.(2662-2664)CCC>CAC	p.P888H	CNNM1_uc010qpi.1_Missense_Mutation_p.P909H|CNNM1_uc009xwf.2_Intron|CNNM1_uc009xwg.2_Missense_Mutation_p.P288H	NM_020348	NP_065081	Q9NRU3	CNNM1_HUMAN	cyclin M1	888					ion transport	integral to membrane|plasma membrane					0		Colorectal(252;0.234)		Epithelial(162;6.82e-10)|all cancers(201;5.62e-08)														---	---	---	---	capture		Missense_Mutation	SNP	101148047	101148047	3750	10	C	A	A	22	22	CNNM1	A	2	2
C10orf2	56652	broad.mit.edu	37	10	102749641	102749641	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102749641G>T	uc001ksf.2	+	2	2159	c.1484G>T	c.(1483-1485)AGG>ATG	p.R495M	MRPL43_uc001kry.1_5'Flank|MRPL43_uc010qpu.1_5'Flank|MRPL43_uc001krz.1_5'Flank|MRPL43_uc001ksa.1_5'Flank|MRPL43_uc001ksb.1_5'Flank|MRPL43_uc001ksd.1_5'Flank|MRPL43_uc001ksc.2_5'Flank|MRPL43_uc001kse.2_5'Flank|C10orf2_uc001ksg.2_Missense_Mutation_p.R495M|C10orf2_uc001ksi.2_Missense_Mutation_p.R41M|C10orf2_uc010qpv.1_Missense_Mutation_p.R41M|C10orf2_uc001ksh.2_RNA	NM_021830	NP_068602	Q96RR1	PEO1_HUMAN	twinkle isoform A	495	SF4 helicase.				cell death|mitochondrial DNA replication|protein hexamerization|protein homooligomerization|transcription from mitochondrial promoter	mitochondrial nucleoid	5'-3' DNA helicase activity|ATP binding|protease binding|single-stranded DNA binding			ovary(1)	1		Colorectal(252;0.122)|all_hematologic(284;0.152)		Epithelial(162;7.18e-11)|all cancers(201;8.75e-09)|BRCA - Breast invasive adenocarcinoma(275;0.224)														---	---	---	---	capture		Missense_Mutation	SNP	102749641	102749641	1634	10	G	T	T	35	35	C10orf2	T	2	2
ITPRIP	85450	broad.mit.edu	37	10	106075072	106075072	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:106075072G>A	uc001kye.2	-	2	811	c.738C>T	c.(736-738)GTC>GTT	p.V246V	ITPRIP_uc001kyf.2_Silent_p.V246V|ITPRIP_uc001kyg.2_Silent_p.V246V	NM_033397	NP_203755	Q8IWB1	IPRI_HUMAN	inositol 1,4,5-triphosphate receptor interacting	246						plasma membrane					0																		---	---	---	---	capture		Silent	SNP	106075072	106075072	8227	10	G	A	A	41	41	ITPRIP	A	2	2
PNLIPRP3	119548	broad.mit.edu	37	10	118196264	118196264	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118196264G>C	uc001lcl.3	+	2	192	c.91G>C	c.(91-93)GGT>CGT	p.G31R		NM_001011709	NP_001011709	Q17RR3	LIPR3_HUMAN	pancreatic lipase-related protein 3 precursor	31					lipid catabolic process	extracellular region	triglyceride lipase activity			ovary(1)	1				all cancers(201;0.0131)														---	---	---	---	capture		Missense_Mutation	SNP	118196264	118196264	12578	10	G	C	C	47	47	PNLIPRP3	C	3	3
SLC18A2	6571	broad.mit.edu	37	10	119014834	119014834	+	Silent	SNP	G	T	T	rs139770569	by1000genomes	TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:119014834G>T	uc001ldd.1	+	7	778	c.747G>T	c.(745-747)ACG>ACT	p.T249T	SLC18A2_uc009xyy.1_Silent_p.T46T	NM_003054	NP_003045	Q05940	VMAT2_HUMAN	solute carrier family 18 (vesicular monoamine),	249	Helical; (Potential).				neurotransmitter secretion	clathrin sculpted monoamine transport vesicle membrane|integral to plasma membrane|membrane fraction	monoamine transmembrane transporter activity				0		Colorectal(252;0.19)		all cancers(201;0.029)	Alseroxylon(DB00386)|Reserpine(DB00206)|Tetrabenazine(DB04844)													---	---	---	---	capture		Silent	SNP	119014834	119014834	14922	10	G	T	T	39	39	SLC18A2	T	1	1
PDZD8	118987	broad.mit.edu	37	10	119044594	119044594	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:119044594G>A	uc001lde.1	-	5	1849	c.1650C>T	c.(1648-1650)CAC>CAT	p.H550H		NM_173791	NP_776152	Q8NEN9	PDZD8_HUMAN	PDZ domain containing 8	550					intracellular signal transduction		metal ion binding				0		Colorectal(252;0.19)		all cancers(201;0.0121)														---	---	---	---	capture		Silent	SNP	119044594	119044594	12126	10	G	A	A	44	44	PDZD8	A	2	2
SEC23IP	11196	broad.mit.edu	37	10	121692597	121692597	+	Nonsense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:121692597C>T	uc001leu.1	+	17	2911	c.2839C>T	c.(2839-2841)CGA>TGA	p.R947*	SEC23IP_uc010qtc.1_Nonsense_Mutation_p.R736*|SEC23IP_uc009xzk.1_RNA	NM_007190	NP_009121	Q9Y6Y8	S23IP_HUMAN	Sec23-interacting protein p125	947	DDHD.				Golgi organization|intracellular protein transport	endoplasmic reticulum|ER to Golgi transport vesicle membrane|ER-Golgi intermediate compartment	metal ion binding			ovary(3)	3		Lung NSC(174;0.109)|all_lung(145;0.142)|all_neural(114;0.234)		all cancers(201;0.00515)														---	---	---	---	capture		Nonsense_Mutation	SNP	121692597	121692597	14479	10	C	T	T	23	23	SEC23IP	T	5	1
TACC2	10579	broad.mit.edu	37	10	123985957	123985957	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:123985957C>T	uc001lfv.2	+	13	8045	c.7685C>T	c.(7684-7686)TCT>TTT	p.S2562F	TACC2_uc001lfw.2_Missense_Mutation_p.S708F|TACC2_uc009xzx.2_Missense_Mutation_p.S2517F|TACC2_uc010qtv.1_Missense_Mutation_p.S2566F|TACC2_uc001lfx.2_Missense_Mutation_p.S266F|TACC2_uc001lfy.2_Missense_Mutation_p.S262F|TACC2_uc001lfz.2_Missense_Mutation_p.S640F|TACC2_uc001lga.2_Missense_Mutation_p.S640F|TACC2_uc009xzy.2_Missense_Mutation_p.S652F|TACC2_uc001lgb.2_Missense_Mutation_p.S597F|TACC2_uc010qtw.1_Missense_Mutation_p.S657F	NM_206862	NP_996744	O95359	TACC2_HUMAN	transforming, acidic coiled-coil containing	2562						microtubule organizing center|nucleus	nuclear hormone receptor binding			ovary(4)|breast(3)|skin(2)|central_nervous_system(1)	10		all_neural(114;0.0656)|Lung NSC(174;0.136)|all_lung(145;0.17)|Breast(234;0.197)																---	---	---	---	capture		Missense_Mutation	SNP	123985957	123985957	16023	10	C	T	T	32	32	TACC2	T	2	2
C10orf90	118611	broad.mit.edu	37	10	128193390	128193390	+	Nonsense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:128193390C>A	uc001ljq.2	-	3	500	c.379G>T	c.(379-381)GAG>TAG	p.E127*	C10orf90_uc001ljp.2_Nonsense_Mutation_p.E80*|C10orf90_uc010qum.1_Nonsense_Mutation_p.E224*|C10orf90_uc009yao.2_Nonsense_Mutation_p.E224*|C10orf90_uc001ljs.1_Nonsense_Mutation_p.E80*	NM_001004298	NP_001004298	Q96M02	CJ090_HUMAN	hypothetical protein LOC118611	127										ovary(1)|skin(1)	2		all_epithelial(44;4.51e-05)|all_lung(145;0.0068)|Lung NSC(174;0.0105)|Colorectal(57;0.0848)|all_neural(114;0.0936)|Breast(234;0.203)		COAD - Colon adenocarcinoma(40;0.0442)|Colorectal(40;0.0479)												OREG0020616	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Nonsense_Mutation	SNP	128193390	128193390	1660	10	C	A	A	30	30	C10orf90	A	5	2
STK32C	282974	broad.mit.edu	37	10	134036456	134036456	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:134036456C>A	uc001lle.1	-	9	1168	c.1028G>T	c.(1027-1029)AGC>ATC	p.S343I	STK32C_uc001lld.1_Missense_Mutation_p.S226I|STK32C_uc010quu.1_Missense_Mutation_p.S356I|STK32C_uc001llb.2_Missense_Mutation_p.S114I|STK32C_uc001llc.1_RNA	NM_173575	NP_775846	Q86UX6	ST32C_HUMAN	serine/threonine kinase 32C	343	Protein kinase.						ATP binding|metal ion binding|protein serine/threonine kinase activity			large_intestine(2)|lung(2)|breast(1)	5		all_cancers(35;2.72e-11)|all_epithelial(44;2.33e-08)|Lung NSC(174;0.000855)|all_lung(145;0.00146)|all_neural(114;0.0299)|Breast(234;0.106)|Colorectal(31;0.112)|Melanoma(40;0.124)|Glioma(114;0.203)		Epithelial(32;3.99e-05)|all cancers(32;5.58e-05)|OV - Ovarian serous cystadenocarcinoma(35;9.96e-05)|BRCA - Breast invasive adenocarcinoma(275;0.222)														---	---	---	---	capture		Missense_Mutation	SNP	134036456	134036456	15819	10	C	A	A	28	28	STK32C	A	2	2
NKX6-2	84504	broad.mit.edu	37	10	134598853	134598853	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:134598853G>T	uc001llr.2	-	2	595	c.510C>A	c.(508-510)ACC>ACA	p.T170T		NM_177400	NP_796374	Q9C056	NKX62_HUMAN	NK6 transcription factor related, locus 2	170	Homeobox.					nucleus	sequence-specific DNA binding transcription factor activity				0		all_cancers(35;2.79e-10)|all_epithelial(44;2.07e-08)|Lung NSC(174;0.000845)|all_lung(145;0.00144)|all_neural(114;0.0299)|Colorectal(31;0.0584)|Melanoma(40;0.123)|Glioma(114;0.203)		OV - Ovarian serous cystadenocarcinoma(35;4.06e-05)|Epithelial(32;5.53e-05)|all cancers(32;5.99e-05)														---	---	---	---	capture		Silent	SNP	134598853	134598853	10861	10	G	T	T	47	47	NKX6-2	T	2	2
MUC2	4583	broad.mit.edu	37	11	1097290	1097290	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1097290G>T	uc001lsx.1	+	38	13819	c.13792G>T	c.(13792-13794)GTC>TTC	p.V4598F		NM_002457	NP_002448	Q02817	MUC2_HUMAN	mucin 2 precursor	4598	VWFD 4.					inner mucus layer|outer mucus layer	protein binding			lung(1)|breast(1)	2		all_cancers(49;1.08e-07)|all_epithelial(84;5.08e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.191)		BRCA - Breast invasive adenocarcinoma(625;0.000207)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)	Pranlukast(DB01411)													---	---	---	---	capture		Missense_Mutation	SNP	1097290	1097290	10369	11	G	T	T	40	40	MUC2	T	1	1
MUC5B	727897	broad.mit.edu	37	11	1265969	1265969	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1265969C>A	uc009ycr.1	+	48	9899	c.9773C>A	c.(9772-9774)CCC>CAC	p.P3258H	MUC5B_uc001ltb.2_Missense_Mutation_p.P2623H	NM_017511	NP_059981	Q9HC84	MUC5B_HUMAN	SubName: Full=Mucin 5AC, oligomeric mucus/gel-forming;	2620	7 X Cys-rich subdomain repeats.|11 X approximate tandem repeats, Ser/Thr- rich.|Thr-rich.			Missing (in Ref. 6; AAB61398).	cell adhesion	extracellular region	extracellular matrix structural constituent|protein binding				0		all_cancers(49;6.97e-08)|all_epithelial(84;3.45e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		BRCA - Breast invasive adenocarcinoma(625;0.00141)|Lung(200;0.0853)|LUSC - Lung squamous cell carcinoma(625;0.1)														---	---	---	---	capture		Missense_Mutation	SNP	1265969	1265969	10373	11	C	A	A	22	22	MUC5B	A	2	2
OR51A4	401666	broad.mit.edu	37	11	4967860	4967860	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4967860C>T	uc010qys.1	-	1	471	c.471G>A	c.(469-471)CTG>CTA	p.L157L		NM_001005329	NP_001005329	Q8NGJ6	O51A4_HUMAN	olfactory receptor, family 51, subfamily A,	157	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(1)	3		Medulloblastoma(188;0.0075)|all_neural(188;0.0577)|Breast(177;0.086)		Epithelial(150;3.22e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0284)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---	capture		Silent	SNP	4967860	4967860	11497	11	C	T	T	21	21	OR51A4	T	2	2
OR51A2	401667	broad.mit.edu	37	11	4976473	4976473	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4976473C>T	uc010qyt.1	-	1	471	c.471G>A	c.(469-471)CTG>CTA	p.L157L		NM_001004748	NP_001004748	Q8NGJ7	O51A2_HUMAN	olfactory receptor, family 51, subfamily A,	157	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0		Medulloblastoma(188;0.0075)|all_neural(188;0.0577)|Breast(177;0.086)		Epithelial(150;3.22e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0284)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---	capture		Silent	SNP	4976473	4976473	11496	11	C	T	T	21	21	OR51A2	T	2	2
MMP26	56547	broad.mit.edu	37	11	5013285	5013285	+	Silent	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5013285T>A	uc001lzv.2	+	5	705	c.687T>A	c.(685-687)ACT>ACA	p.T229T		NM_021801	NP_068573	Q9NRE1	MMP26_HUMAN	matrix metalloproteinase 26 preproprotein	229					collagen catabolic process|proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding				0		Medulloblastoma(188;0.0025)|Breast(177;0.0204)|all_neural(188;0.0227)		Epithelial(150;1.33e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0287)|LUSC - Lung squamous cell carcinoma(625;0.191)														---	---	---	---	capture		Silent	SNP	5013285	5013285	10054	11	T	A	A	56	56	MMP26	A	4	4
FAM160A2	84067	broad.mit.edu	37	11	6245432	6245432	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6245432C>G	uc001mcl.3	-	3	544	c.185G>C	c.(184-186)GGT>GCT	p.G62A	FAM160A2_uc001mck.3_Missense_Mutation_p.G62A|FAM160A2_uc001mcm.2_Missense_Mutation_p.G62A	NM_001098794	NP_001092264	Q8N612	F16A2_HUMAN	hypothetical protein LOC84067 isoform 2	62					early endosome to late endosome transport|endosome organization|endosome to lysosome transport|lysosome organization|protein transport	FHF complex	protein binding			skin(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	6245432	6245432	5673	11	C	G	G	18	18	FAM160A2	G	3	3
SMPD1	6609	broad.mit.edu	37	11	6412809	6412809	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6412809A>G	uc001mcw.2	+	2	688	c.514A>G	c.(514-516)ATT>GTT	p.I172V	SMPD1_uc001mcv.1_Intron|SMPD1_uc009yex.2_RNA|SMPD1_uc001mcx.2_Missense_Mutation_p.I172V|SMPD1_uc009yew.2_Missense_Mutation_p.I171V	NM_000543	NP_000534	P17405	ASM_HUMAN	sphingomyelin phosphodiesterase 1, acid	170					cell death|ceramide biosynthetic process|negative regulation of MAP kinase activity|nervous system development|positive regulation of protein dephosphorylation|signal transduction|sphingomyelin catabolic process|termination of signal transduction	lysosome	hydrolase activity, acting on glycosyl bonds|sphingomyelin phosphodiesterase activity				0		Medulloblastoma(188;0.00263)|all_neural(188;0.026)|Breast(177;0.029)		Epithelial(150;4.9e-08)|BRCA - Breast invasive adenocarcinoma(625;0.189)	Desipramine(DB01151)													---	---	---	---	capture		Missense_Mutation	SNP	6412809	6412809	15304	11	A	G	G	8	8	SMPD1	G	4	4
OR10A4	283297	broad.mit.edu	37	11	6898584	6898584	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6898584C>T	uc010rat.1	+	1	706	c.706C>T	c.(706-708)CAT>TAT	p.H236Y		NM_207186	NP_997069	Q9H209	O10A4_HUMAN	olfactory receptor, family 10, subfamily A,	236	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Medulloblastoma(188;0.0523)|all_neural(188;0.236)		Epithelial(150;4.78e-08)|BRCA - Breast invasive adenocarcinoma(625;0.129)														---	---	---	---	capture		Missense_Mutation	SNP	6898584	6898584	11298	11	C	T	T	17	17	OR10A4	T	2	2
NLRP14	338323	broad.mit.edu	37	11	7081200	7081200	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:7081200G>T	uc001mfb.1	+	9	3032	c.2709G>T	c.(2707-2709)ACG>ACT	p.T903T		NM_176822	NP_789792	Q86W24	NAL14_HUMAN	NLR family, pyrin domain containing 14	903	LRR 7.				cell differentiation|multicellular organismal development|spermatogenesis		ATP binding			ovary(3)|breast(2)|pancreas(1)|lung(1)|skin(1)	8				Epithelial(150;4.62e-08)|BRCA - Breast invasive adenocarcinoma(625;0.0871)														---	---	---	---	capture		Silent	SNP	7081200	7081200	10879	11	G	T	T	38	38	NLRP14	T	1	1
NLRP10	338322	broad.mit.edu	37	11	7981634	7981634	+	Nonsense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:7981634C>A	uc001mfv.1	-	2	1542	c.1525G>T	c.(1525-1527)GAG>TAG	p.E509*		NM_176821	NP_789791	Q86W26	NAL10_HUMAN	NLR family, pyrin domain containing 10	509							ATP binding			lung(4)|ovary(2)|pancreas(1)|kidney(1)|skin(1)	9				Epithelial(150;1.47e-07)|BRCA - Breast invasive adenocarcinoma(625;0.189)														---	---	---	---	capture		Nonsense_Mutation	SNP	7981634	7981634	10875	11	C	A	A	29	29	NLRP10	A	5	2
AMPD3	272	broad.mit.edu	37	11	10527417	10527417	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:10527417G>T	uc001mio.1	+	15	2625	c.2290G>T	c.(2290-2292)GCC>TCC	p.A764S	AMPD3_uc010rbz.1_Missense_Mutation_p.A605S|AMPD3_uc001min.1_Missense_Mutation_p.A773S|AMPD3_uc009yfw.1_RNA|AMPD3_uc009yfz.2_RNA|AMPD3_uc001mip.1_Missense_Mutation_p.A771S|AMPD3_uc009yfy.2_Missense_Mutation_p.A764S	NM_001025389	NP_001020560	Q01432	AMPD3_HUMAN	adenosine monophosphate deaminase 3 isoform 1B	764					AMP catabolic process|purine base metabolic process|purine ribonucleoside monophosphate biosynthetic process|purine-containing compound salvage	cytosol	AMP deaminase activity|metal ion binding			large_intestine(1)|ovary(1)	2				all cancers(16;1.14e-08)|Epithelial(150;2.83e-08)|BRCA - Breast invasive adenocarcinoma(625;0.0291)														---	---	---	---	capture		Missense_Mutation	SNP	10527417	10527417	590	11	G	T	T	38	38	AMPD3	T	1	1
ANO5	203859	broad.mit.edu	37	11	22297660	22297660	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22297660C>T	uc001mqi.2	+	21	2752	c.2435C>T	c.(2434-2436)CCT>CTT	p.P812L	ANO5_uc001mqj.2_Missense_Mutation_p.P811L	NM_213599	NP_998764	Q75V66	ANO5_HUMAN	anoctamin 5 isoform a	812	Extracellular (Potential).					chloride channel complex|endoplasmic reticulum membrane	chloride channel activity			central_nervous_system(3)|ovary(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	22297660	22297660	708	11	C	T	T	24	24	ANO5	T	2	2
C11orf74	119710	broad.mit.edu	37	11	36669697	36669697	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:36669697A>T	uc001mwy.1	+	5	563	c.490A>T	c.(490-492)ACG>TCG	p.T164S	C11orf74_uc010rfd.1_RNA|C11orf74_uc001mww.1_Missense_Mutation_p.T90S|C11orf74_uc001mwx.1_RNA|C11orf74_uc001mwz.1_Missense_Mutation_p.T90S|C11orf74_uc010rfe.1_RNA	NM_138787	NP_620142	Q86VG3	CK074_HUMAN	hypothetical protein LOC119710	164											0	all_lung(20;0.226)	all_hematologic(20;0.0118)																---	---	---	---	capture		Missense_Mutation	SNP	36669697	36669697	1701	11	A	T	T	10	10	C11orf74	T	4	4
DGKZ	8525	broad.mit.edu	37	11	46399764	46399764	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46399764G>T	uc001ncn.1	+	27	3048	c.2923G>T	c.(2923-2925)GCT>TCT	p.A975S	DGKZ_uc001nch.1_Missense_Mutation_p.A803S|DGKZ_uc010rgq.1_Missense_Mutation_p.A730S|DGKZ_uc001ncj.1_Missense_Mutation_p.A753S|DGKZ_uc010rgr.1_Missense_Mutation_p.A752S|DGKZ_uc001nck.1_Missense_Mutation_p.A565S|DGKZ_uc001ncl.2_Missense_Mutation_p.A787S|DGKZ_uc001ncm.2_Missense_Mutation_p.A786S|DGKZ_uc009yky.1_Missense_Mutation_p.A787S|DGKZ_uc010rgs.1_Missense_Mutation_p.A764S|MDK_uc009ykz.1_5'Flank|MDK_uc001nco.2_5'Flank	NM_001105540	NP_001099010	Q13574	DGKZ_HUMAN	diacylglycerol kinase zeta isoform 4	975					activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|cell migration|intracellular signal transduction|mitotic cell cycle G1/S transition DNA damage checkpoint|negative regulation of mitotic cell cycle|platelet activation	cytoplasm|lamellipodium|nucleus|plasma membrane	ATP binding|diacylglycerol kinase activity|diacylglycerol kinase activity|lipid kinase activity|metal ion binding|protein binding|protein C-terminus binding			pancreas(1)|central_nervous_system(1)|skin(1)	3				GBM - Glioblastoma multiforme(35;0.0259)|Lung(87;0.141)														---	---	---	---	capture		Missense_Mutation	SNP	46399764	46399764	4653	11	G	T	T	46	46	DGKZ	T	2	2
OR4X1	390113	broad.mit.edu	37	11	48285559	48285559	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48285559C>A	uc010rht.1	+	1	147	c.147C>A	c.(145-147)GCC>GCA	p.A49A		NM_001004726	NP_001004726	Q8NH49	OR4X1_HUMAN	olfactory receptor, family 4, subfamily X,	49	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3																		---	---	---	---	capture		Silent	SNP	48285559	48285559	11494	11	C	A	A	21	21	OR4X1	A	2	2
OR4C16	219428	broad.mit.edu	37	11	55340018	55340018	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55340018T>C	uc010rih.1	+	1	415	c.415T>C	c.(415-417)TGT>CGT	p.C139R		NM_001004701	NP_001004701	Q8NGL9	OR4CG_HUMAN	olfactory receptor, family 4, subfamily C,	139	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2		all_epithelial(135;0.0748)																---	---	---	---	capture		Missense_Mutation	SNP	55340018	55340018	11455	11	T	C	C	55	55	OR4C16	C	4	4
OR8H2	390151	broad.mit.edu	37	11	55872966	55872966	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55872966G>T	uc010riy.1	+	1	448	c.448G>T	c.(448-450)GTG>TTG	p.V150L		NM_001005200	NP_001005200	Q8N162	OR8H2_HUMAN	olfactory receptor, family 8, subfamily H,	150	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2	Esophageal squamous(21;0.00693)														HNSCC(53;0.14)			---	---	---	---	capture		Missense_Mutation	SNP	55872966	55872966	11649	11	G	T	T	48	48	OR8H2	T	2	2
OR9Q1	219956	broad.mit.edu	37	11	57947063	57947063	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57947063C>A	uc001nmj.2	+	3	463	c.147C>A	c.(145-147)ATC>ATA	p.I49I		NM_001005212	NP_001005212	Q8NGQ5	OR9Q1_HUMAN	olfactory receptor, family 9, subfamily Q,	49	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(21;0.222)																---	---	---	---	capture		Silent	SNP	57947063	57947063	11666	11	C	A	A	30	30	OR9Q1	A	2	2
OR9Q2	219957	broad.mit.edu	37	11	57958292	57958292	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57958292C>A	uc010rka.1	+	1	330	c.330C>A	c.(328-330)ATC>ATA	p.I110I		NM_001005283	NP_001005283	Q8NGE9	OR9Q2_HUMAN	olfactory receptor, family 9, subfamily Q,	110	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|breast(1)|central_nervous_system(1)	4		Breast(21;0.0589)																---	---	---	---	capture		Silent	SNP	57958292	57958292	11667	11	C	A	A	31	31	OR9Q2	A	1	1
OR10Q1	219960	broad.mit.edu	37	11	57995641	57995641	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57995641G>A	uc010rkd.1	-	1	707	c.707C>T	c.(706-708)GCC>GTC	p.A236V		NM_001004471	NP_001004471	Q8NGQ4	O10Q1_HUMAN	olfactory receptor, family 10, subfamily Q,	236	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2		Breast(21;0.0589)																---	---	---	---	capture		Missense_Mutation	SNP	57995641	57995641	11322	11	G	A	A	42	42	OR10Q1	A	2	2
OR10Q1	219960	broad.mit.edu	37	11	57995753	57995753	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57995753C>A	uc010rkd.1	-	1	595	c.595G>T	c.(595-597)GTG>TTG	p.V199L		NM_001004471	NP_001004471	Q8NGQ4	O10Q1_HUMAN	olfactory receptor, family 10, subfamily Q,	199	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2		Breast(21;0.0589)																---	---	---	---	capture		Missense_Mutation	SNP	57995753	57995753	11322	11	C	A	A	19	19	OR10Q1	A	1	1
OR5B3	441608	broad.mit.edu	37	11	58170746	58170746	+	Missense_Mutation	SNP	A	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58170746A>C	uc010rkf.1	-	1	137	c.137T>G	c.(136-138)TTG>TGG	p.L46W		NM_001005469	NP_001005469	Q8NH48	OR5B3_HUMAN	olfactory receptor, family 5, subfamily B,	46	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	Esophageal squamous(5;0.0027)	Breast(21;0.0778)																---	---	---	---	capture		Missense_Mutation	SNP	58170746	58170746	11562	11	A	C	C	5	5	OR5B3	C	4	4
SLC22A9	114571	broad.mit.edu	37	11	63137701	63137701	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63137701C>G	uc001nww.2	+	1	441	c.173C>G	c.(172-174)ACT>AGT	p.T58S	SLC22A9_uc001nwx.2_RNA	NM_080866	NP_543142	Q8IVM8	S22A9_HUMAN	solute carrier family 22 (organic anion/cation	58	Extracellular (Potential).				transmembrane transport	integral to membrane				breast(2)|large_intestine(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	63137701	63137701	14958	11	C	G	G	20	20	SLC22A9	G	3	3
KRTAP5-9	3846	broad.mit.edu	37	11	71259993	71259993	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:71259993G>T	uc001oqs.1	+	1	528	c.290G>T	c.(289-291)TGC>TTC	p.C97F		NM_005553	NP_005544	P26371	KRA59_HUMAN	keratin associated protein 5-9	97	8 X 4 AA repeats of C-C-X-P.				epidermis development	keratin filament					0																		---	---	---	---	capture		Missense_Mutation	SNP	71259993	71259993	8890	11	G	T	T	46	46	KRTAP5-9	T	2	2
CCDC89	220388	broad.mit.edu	37	11	85396052	85396052	+	Silent	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:85396052T>A	uc001pau.1	-	1	1269	c.1122A>T	c.(1120-1122)CCA>CCT	p.P374P		NM_152723	NP_689936	Q8N998	CCD89_HUMAN	coiled-coil domain containing 89	374						cytoplasm|nucleus					0		Acute lymphoblastic leukemia(157;4.88e-06)|all_hematologic(158;0.00572)																---	---	---	---	capture		Silent	SNP	85396052	85396052	2991	11	T	A	A	51	51	CCDC89	A	4	4
PRSS23	11098	broad.mit.edu	37	11	86519020	86519020	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:86519020G>T	uc001pcb.2	+	2	551	c.335G>T	c.(334-336)GGG>GTG	p.G112V	PRSS23_uc001pcc.1_Intron|PRSS23_uc010rts.1_Missense_Mutation_p.G80V	NM_007173	NP_009104	O95084	PRS23_HUMAN	protease, serine, 23 precursor	112					proteolysis	extracellular region|nucleus	serine-type endopeptidase activity			central_nervous_system(1)|pancreas(1)	2		Acute lymphoblastic leukemia(157;2.31e-05)|all_hematologic(158;0.00824)																---	---	---	---	capture		Missense_Mutation	SNP	86519020	86519020	13070	11	G	T	T	43	43	PRSS23	T	2	2
GRM5	2915	broad.mit.edu	37	11	88780463	88780463	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:88780463G>A	uc001pcq.2	-	1	778	c.578C>T	c.(577-579)CCT>CTT	p.P193L	GRM5_uc009yvm.2_Missense_Mutation_p.P193L|GRM5_uc009yvn.1_Missense_Mutation_p.P193L	NM_001143831	NP_001137303	P41594	GRM5_HUMAN	glutamate receptor, metabotropic 5 isoform a	193	Extracellular (Potential).				activation of phospholipase C activity by metabotropic glutamate receptor signaling pathway|synaptic transmission	integral to plasma membrane	G-protein coupled receptor activity|glutamate receptor activity			central_nervous_system(4)|ovary(2)|lung(2)|breast(1)	9		Acute lymphoblastic leukemia(157;2.54e-05)|all_hematologic(158;0.00834)			Acamprosate(DB00659)													---	---	---	---	capture		Missense_Mutation	SNP	88780463	88780463	7079	11	G	A	A	35	35	GRM5	A	2	2
MMP12	4321	broad.mit.edu	37	11	102745647	102745647	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:102745647C>A	uc001phk.2	-	1	66	c.21G>T	c.(19-21)CTG>CTT	p.L7L		NM_002426	NP_002417	P39900	MMP12_HUMAN	matrix metalloproteinase 12 preproprotein	7					positive regulation of epithelial cell proliferation involved in wound healing|proteolysis|wound healing, spreading of epidermal cells	proteinaceous extracellular matrix	calcium ion binding|metalloendopeptidase activity|zinc ion binding				0		all_hematologic(158;0.00092)|Acute lymphoblastic leukemia(157;0.000967)		BRCA - Breast invasive adenocarcinoma(274;0.014)	Acetohydroxamic Acid(DB00551)													---	---	---	---	capture		Silent	SNP	102745647	102745647	10041	11	C	A	A	25	25	MMP12	A	2	2
GUCY1A2	2977	broad.mit.edu	37	11	106558379	106558379	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:106558379C>A	uc001pjg.1	-	8	2485	c.2095G>T	c.(2095-2097)GTA>TTA	p.V699L	GUCY1A2_uc010rvo.1_Missense_Mutation_p.V720L|GUCY1A2_uc009yxn.1_Missense_Mutation_p.V730L	NM_000855	NP_000846	P33402	GCYA2_HUMAN	guanylate cyclase 1, soluble, alpha 2	699					intracellular signal transduction|platelet activation	cytoplasm	GTP binding|guanylate cyclase activity|heme binding			large_intestine(3)|lung(2)|pancreas(2)|ovary(1)	8		all_epithelial(67;3.66e-05)|Melanoma(852;0.000382)|Acute lymphoblastic leukemia(157;0.001)|all_hematologic(158;0.0017)|Breast(348;0.026)|all_neural(303;0.068)		BRCA - Breast invasive adenocarcinoma(274;8.04e-05)|Epithelial(105;0.0036)|all cancers(92;0.0476)														---	---	---	---	capture		Missense_Mutation	SNP	106558379	106558379	7173	11	C	A	A	18	18	GUCY1A2	A	2	2
APOA4	337	broad.mit.edu	37	11	116691973	116691973	+	Silent	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:116691973C>G	uc001pps.1	-	3	905	c.801G>C	c.(799-801)CTG>CTC	p.L267L		NM_000482	NP_000473			apolipoprotein A-IV precursor												0	all_hematologic(175;0.0487)	Breast(348;0.0126)|Medulloblastoma(222;0.0425)|all_hematologic(158;0.0564)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;8.54e-06)|Epithelial(105;1.62e-05)|all cancers(92;0.000165)|OV - Ovarian serous cystadenocarcinoma(223;0.148)														---	---	---	---	capture		Silent	SNP	116691973	116691973	794	11	C	G	G	21	21	APOA4	G	3	3
ZNF202	7753	broad.mit.edu	37	11	123597134	123597134	+	Silent	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123597134T>C	uc001pzd.1	-	9	1918	c.1518A>G	c.(1516-1518)GAA>GAG	p.E506E	ZNF202_uc001pzc.1_Silent_p.E282E|ZNF202_uc001pze.1_Silent_p.E506E|ZNF202_uc001pzf.1_Silent_p.E506E	NM_003455	NP_003446	O95125	ZN202_HUMAN	zinc finger protein 202	506					lipid metabolic process|negative regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter|viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1		Breast(109;0.00204)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;5.1e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.03)														---	---	---	---	capture		Silent	SNP	123597134	123597134	18354	11	T	C	C	64	64	ZNF202	C	4	4
KCNJ5	3762	broad.mit.edu	37	11	128781668	128781668	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:128781668T>C	uc001qet.2	+	2	814	c.500T>C	c.(499-501)CTC>CCC	p.L167P	KCNJ5_uc009zck.2_Missense_Mutation_p.L167P|KCNJ5_uc001qew.2_Missense_Mutation_p.L167P	NM_000890	NP_000881	P48544	IRK5_HUMAN	potassium inwardly-rectifying channel J5	167	Helical; Name=M2; (By similarity).				synaptic transmission	voltage-gated potassium channel complex	G-protein activated inward rectifier potassium channel activity|protein binding			skin(1)	1	all_hematologic(175;0.0641)	Lung NSC(97;0.00038)|all_lung(97;0.000817)|Breast(109;0.00123)|Medulloblastoma(222;0.0425)|all_neural(223;0.0837)		OV - Ovarian serous cystadenocarcinoma(99;0.0059)|LUSC - Lung squamous cell carcinoma(976;0.021)|Lung(977;0.0215)	Glibenclamide(DB01016)													---	---	---	---	capture		Missense_Mutation	SNP	128781668	128781668	8359	11	T	C	C	54	54	KCNJ5	C	4	4
OPCML	4978	broad.mit.edu	37	11	132307179	132307179	+	Missense_Mutation	SNP	C	G	G	rs148167692		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:132307179C>G	uc001qgs.2	-	4	651	c.601G>C	c.(601-603)GAA>CAA	p.E201Q	OPCML_uc001qgu.2_Missense_Mutation_p.E194Q|OPCML_uc010sck.1_Missense_Mutation_p.E201Q|OPCML_uc001qgt.2_Missense_Mutation_p.E200Q|OPCML_uc010scl.1_Missense_Mutation_p.E160Q	NM_002545	NP_002536	Q14982	OPCM_HUMAN	opioid binding protein/cell adhesion	201	Ig-like C2-type 2.				cell adhesion|neuron recognition	anchored to membrane|integral to plasma membrane	opioid receptor activity	p.E201K(1)		ovary(2)|skin(1)	3	all_hematologic(175;0.019)	all_cancers(12;5.86e-24)|all_epithelial(12;2.65e-17)|all_lung(97;2.89e-05)|Lung NSC(97;6.16e-05)|Breast(109;0.000126)|Medulloblastoma(222;0.0269)|all_neural(223;0.0326)|Esophageal squamous(93;0.129)		all cancers(11;4.61e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.012)														---	---	---	---	capture		Missense_Mutation	SNP	132307179	132307179	11280	11	C	G	G	31	31	OPCML	G	3	3
KCNA5	3741	broad.mit.edu	37	12	5154550	5154550	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:5154550C>A	uc001qni.2	+	1	1466	c.1237C>A	c.(1237-1239)CTC>ATC	p.L413I		NM_002234	NP_002225	P22460	KCNA5_HUMAN	potassium voltage-gated channel, shaker-related	413	Helical; Voltage-sensor; Name=Segment S4; (Potential).					Golgi apparatus|voltage-gated potassium channel complex	delayed rectifier potassium channel activity			ovary(2)|breast(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	5154550	5154550	8311	12	C	A	A	28	28	KCNA5	A	2	2
VWF	7450	broad.mit.edu	37	12	6184682	6184682	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6184682G>A	uc001qnn.1	-	7	943	c.693C>T	c.(691-693)ACC>ACT	p.T231T	VWF_uc010set.1_Silent_p.T231T	NM_000552	NP_000543	P04275	VWF_HUMAN	von Willebrand factor preproprotein	231	VWFD 1.				blood coagulation, intrinsic pathway|cell-substrate adhesion|platelet activation|platelet degranulation|protein homooligomerization	endoplasmic reticulum|platelet alpha granule lumen|proteinaceous extracellular matrix|Weibel-Palade body	chaperone binding|collagen binding|glycoprotein binding|immunoglobulin binding|integrin binding|protease binding|protein homodimerization activity|protein N-terminus binding			skin(4)|ovary(3)|pancreas(2)|central_nervous_system(1)|haematopoietic_and_lymphoid_tissue(1)|breast(1)	12					Antihemophilic Factor(DB00025)													---	---	---	---	capture		Silent	SNP	6184682	6184682	17818	12	G	A	A	35	35	VWF	A	2	2
CD163	9332	broad.mit.edu	37	12	7639250	7639250	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7639250G>C	uc001qsz.3	-	10	2431	c.2303C>G	c.(2302-2304)GCC>GGC	p.A768G	CD163_uc001qta.3_Missense_Mutation_p.A768G|CD163_uc009zfw.2_Missense_Mutation_p.A801G	NM_004244	NP_004235	Q86VB7	C163A_HUMAN	CD163 antigen isoform a	768	SRCR 7.|Extracellular (Potential).				acute-phase response	extracellular region|integral to plasma membrane	protein binding|scavenger receptor activity			ovary(6)|pancreas(1)|skin(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	7639250	7639250	3094	12	G	C	C	42	42	CD163	C	3	3
APOBEC1	339	broad.mit.edu	37	12	7805255	7805255	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7805255C>G	uc001qtb.2	-	3	255	c.221G>C	c.(220-222)AGA>ACA	p.R74T	APOBEC1_uc001qtc.2_Missense_Mutation_p.R29T|APOBEC1_uc010sgf.1_Missense_Mutation_p.R74T	NM_001644	NP_001635	P41238	ABEC1_HUMAN	apolipoprotein B mRNA editing enzyme	74					cytidine to uridine editing|DNA demethylation|lipid metabolic process|mRNA modification|mRNA processing|negative regulation of methylation-dependent chromatin silencing	nucleoplasm	cytidine deaminase activity|RNA binding|zinc ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	7805255	7805255	798	12	C	G	G	32	32	APOBEC1	G	3	3
GYS2	2998	broad.mit.edu	37	12	21693479	21693479	+	Silent	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21693479A>T	uc001rfb.2	-	14	1929	c.1674T>A	c.(1672-1674)CGT>CGA	p.R558R		NM_021957	NP_068776	P54840	GYS2_HUMAN	glycogen synthase 2	558					glucose metabolic process|glycogen biosynthetic process|response to glucose stimulus	cortical actin cytoskeleton|cytosol|ectoplasm|insoluble fraction|soluble fraction	glycogen (starch) synthase activity|protein homodimerization activity			lung(1)|skin(1)	2																		---	---	---	---	capture		Silent	SNP	21693479	21693479	7193	12	A	T	T	2	2	GYS2	T	4	4
GYS2	2998	broad.mit.edu	37	12	21699353	21699353	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21699353C>G	uc001rfb.2	-	12	1729	c.1474G>C	c.(1474-1476)GAC>CAC	p.D492H		NM_021957	NP_068776	P54840	GYS2_HUMAN	glycogen synthase 2	492					glucose metabolic process|glycogen biosynthetic process|response to glucose stimulus	cortical actin cytoskeleton|cytosol|ectoplasm|insoluble fraction|soluble fraction	glycogen (starch) synthase activity|protein homodimerization activity			lung(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	21699353	21699353	7193	12	C	G	G	30	30	GYS2	G	3	3
BICD1	636	broad.mit.edu	37	12	32481359	32481359	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32481359G>T	uc001rku.2	+	5	2051	c.1970G>T	c.(1969-1971)CGG>CTG	p.R657L	BICD1_uc001rkv.2_Missense_Mutation_p.R657L|BICD1_uc010skd.1_RNA	NM_001714	NP_001705	Q96G01	BICD1_HUMAN	bicaudal D homolog 1 isoform 1	657					anatomical structure morphogenesis|intracellular mRNA localization|microtubule anchoring at microtubule organizing center|minus-end-directed organelle transport along microtubule|positive regulation of receptor-mediated endocytosis|protein localization to organelle|RNA processing|stress granule assembly|viral reproduction	cytoplasmic vesicle|cytoskeleton|cytosol|host cell viral assembly compartment|membrane|perinuclear region of cytoplasm|trans-Golgi network	cytoskeletal adaptor activity|dynactin binding|dynein binding|proteinase activated receptor binding|Rab GTPase binding|structural constituent of cytoskeleton	p.R657Q(1)		large_intestine(1)|central_nervous_system(1)	2	all_cancers(9;5.13e-11)|all_epithelial(9;2.71e-11)|all_lung(12;6.66e-10)|Acute lymphoblastic leukemia(23;0.0122)|Lung SC(12;0.0213)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.204)		OV - Ovarian serous cystadenocarcinoma(6;0.0201)															---	---	---	---	capture		Missense_Mutation	SNP	32481359	32481359	1453	12	G	T	T	39	39	BICD1	T	1	1
LIMA1	51474	broad.mit.edu	37	12	50642452	50642452	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50642452T>C	uc001rwj.3	-	2	257	c.83A>G	c.(82-84)AAG>AGG	p.K28R	LIMA1_uc001rwk.3_Missense_Mutation_p.K28R|LIMA1_uc010smr.1_RNA|LIMA1_uc010sms.1_RNA	NM_016357	NP_057441	Q9UHB6	LIMA1_HUMAN	LIM domain and actin binding 1 isoform b	28					actin filament bundle assembly|negative regulation of actin filament depolymerization|ruffle organization	cytoplasm|focal adhesion|stress fiber	actin filament binding|actin monomer binding|zinc ion binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	50642452	50642452	9122	12	T	C	C	56	56	LIMA1	C	4	4
DIP2B	57609	broad.mit.edu	37	12	51089048	51089048	+	Splice_Site	SNP	A	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51089048A>C	uc001rwv.2	+	15	1876	c.1720_splice	c.e15-2	p.N574_splice	DIP2B_uc009zlt.2_Splice_Site_p.N4_splice	NM_173602	NP_775873			DIP2 disco-interacting protein 2 homolog B							nucleus	catalytic activity|transcription factor binding			ovary(4)|breast(1)|pancreas(1)	6																		---	---	---	---	capture		Splice_Site	SNP	51089048	51089048	4707	12	A	C	C	7	7	DIP2B	C	5	4
OR6C6	283365	broad.mit.edu	37	12	55688865	55688865	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:55688865G>T	uc010sph.1	-	1	152	c.152C>A	c.(151-153)CCC>CAC	p.P51H		NM_001005493	NP_001005493	A6NF89	OR6C6_HUMAN	olfactory receptor, family 6, subfamily C,	51	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	55688865	55688865	11604	12	G	T	T	43	43	OR6C6	T	2	2
LRP1	4035	broad.mit.edu	37	12	57563000	57563000	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57563000G>T	uc001snd.2	+	20	3539	c.3073G>T	c.(3073-3075)GGG>TGG	p.G1025W	LRP1_uc009zpi.1_RNA	NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	1025	LDL-receptor class A 7.|Extracellular (Potential).				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)													---	---	---	---	capture		Missense_Mutation	SNP	57563000	57563000	9324	12	G	T	T	39	39	LRP1	T	1	1
LRP1	4035	broad.mit.edu	37	12	57573861	57573861	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57573861A>T	uc001snd.2	+	31	5639	c.5173A>T	c.(5173-5175)AGC>TGC	p.S1725C		NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	1725	LDL-receptor class B 15.|Extracellular (Potential).				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)													---	---	---	---	capture		Missense_Mutation	SNP	57573861	57573861	9324	12	A	T	T	7	7	LRP1	T	4	4
IRAK3	11213	broad.mit.edu	37	12	66620557	66620557	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:66620557G>A	uc001sth.2	+	7	810	c.708G>A	c.(706-708)AAG>AAA	p.K236K	IRAK3_uc010ssy.1_Silent_p.K175K	NM_007199	NP_009130	Q9Y616	IRAK3_HUMAN	interleukin-1 receptor-associated kinase 3	236	Protein kinase.				interleukin-1-mediated signaling pathway|MyD88-dependent toll-like receptor signaling pathway|negative regulation of innate immune response|negative regulation of interleukin-12 production|negative regulation of interleukin-6 production|negative regulation of macrophage cytokine production|negative regulation of MAP kinase activity|negative regulation of NF-kappaB transcription factor activity|negative regulation of protein catabolic process|negative regulation of protein complex disassembly|negative regulation of toll-like receptor signaling pathway|negative regulation of tumor necrosis factor production|positive regulation of macrophage tolerance induction|positive regulation of NF-kappaB transcription factor activity|response to exogenous dsRNA|response to lipopolysaccharide|response to peptidoglycan	cytoplasm|nucleus	ATP binding|magnesium ion binding|protein heterodimerization activity|protein homodimerization activity|protein serine/threonine kinase activity			lung(3)|ovary(2)|breast(2)|central_nervous_system(1)	8				GBM - Glioblastoma multiforme(28;0.0203)														---	---	---	---	capture		Silent	SNP	66620557	66620557	8127	12	G	A	A	36	36	IRAK3	A	2	2
GRIP1	23426	broad.mit.edu	37	12	66788127	66788127	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:66788127G>T	uc001stk.2	-	16	2075	c.1834C>A	c.(1834-1836)CAA>AAA	p.Q612K	GRIP1_uc010sta.1_Missense_Mutation_p.Q556K|GRIP1_uc001stj.2_Missense_Mutation_p.Q394K|GRIP1_uc001stl.1_Missense_Mutation_p.Q504K|GRIP1_uc001stm.2_Missense_Mutation_p.Q612K	NM_021150	NP_066973	Q9Y3R0	GRIP1_HUMAN	glutamate receptor interacting protein 1	664					androgen receptor signaling pathway|intracellular signal transduction|positive regulation of transcription, DNA-dependent|synaptic transmission	cell junction|cytoplasmic membrane-bounded vesicle|cytosol|endoplasmic reticulum|postsynaptic membrane	androgen receptor binding|beta-catenin binding|protein C-terminus binding|receptor signaling complex scaffold activity|transcription coactivator activity			ovary(2)	2			GBM - Glioblastoma multiforme(2;0.00069)	GBM - Glioblastoma multiforme(28;0.0933)														---	---	---	---	capture		Missense_Mutation	SNP	66788127	66788127	7066	12	G	T	T	46	46	GRIP1	T	2	2
CNOT2	4848	broad.mit.edu	37	12	70732322	70732322	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:70732322G>T	uc001svv.2	+	10	1579	c.1000G>T	c.(1000-1002)GGG>TGG	p.G334W	CNOT2_uc009zro.2_Missense_Mutation_p.G334W|CNOT2_uc009zrp.2_Missense_Mutation_p.G314W|CNOT2_uc009zrq.2_Missense_Mutation_p.G334W|CNOT2_uc001svw.1_Missense_Mutation_p.G74W	NM_014515	NP_055330	Q9NZN8	CNOT2_HUMAN	CCR4-NOT transcription complex, subunit 2	334					nuclear-transcribed mRNA poly(A) tail shortening|regulation of transcription from RNA polymerase II promoter	cytosol|nucleus	protein binding|RNA polymerase II transcription cofactor activity				0	Renal(347;0.236)		GBM - Glioblastoma multiforme(1;4.77e-09)|Lung(24;0.000636)|OV - Ovarian serous cystadenocarcinoma(12;0.00243)|STAD - Stomach adenocarcinoma(21;0.0118)															---	---	---	---	capture		Missense_Mutation	SNP	70732322	70732322	3757	12	G	T	T	35	35	CNOT2	T	2	2
TMTC2	160335	broad.mit.edu	37	12	83289921	83289921	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:83289921G>T	uc001szt.2	+	3	1411	c.979G>T	c.(979-981)GGT>TGT	p.G327C	TMTC2_uc001szr.1_Missense_Mutation_p.G327C|TMTC2_uc001szs.1_Missense_Mutation_p.G327C|TMTC2_uc010suk.1_Missense_Mutation_p.G82C	NM_152588	NP_689801	Q8N394	TMTC2_HUMAN	transmembrane and tetratricopeptide repeat	327	Helical; (Potential).					endoplasmic reticulum|integral to membrane	binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	83289921	83289921	16802	12	G	T	T	47	47	TMTC2	T	2	2
NTS	4922	broad.mit.edu	37	12	86272314	86272314	+	Missense_Mutation	SNP	A	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:86272314A>C	uc001tag.2	+	3	434	c.327A>C	c.(325-327)AAA>AAC	p.K109N		NM_006183	NP_006174	P30990	NEUT_HUMAN	neurotensin/neuromedin N preproprotein	109					regulation of blood vessel size|signal transduction	extracellular region|soluble fraction|transport vesicle	neuropeptide hormone activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	86272314	86272314	11114	12	A	C	C	1	1	NTS	C	4	4
ATP2B1	490	broad.mit.edu	37	12	90020239	90020239	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:90020239C>A	uc001tbh.2	-	7	1302	c.1121G>T	c.(1120-1122)GGC>GTC	p.G374V	ATP2B1_uc001tbg.2_Missense_Mutation_p.G374V|ATP2B1_uc001tbf.2_Missense_Mutation_p.G44V	NM_001682	NP_001673	P20020	AT2B1_HUMAN	plasma membrane calcium ATPase 1 isoform 1b	374	Helical; (Potential).				ATP biosynthetic process|platelet activation	integral to plasma membrane	ATP binding|calcium-transporting ATPase activity|calmodulin binding|metal ion binding|protein binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	90020239	90020239	1158	12	C	A	A	26	26	ATP2B1	A	2	2
NDUFA12	55967	broad.mit.edu	37	12	95397373	95397373	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:95397373G>A	uc001tdl.2	-	1	139	c.84C>T	c.(82-84)TTC>TTT	p.F28F		NM_018838	NP_061326	Q9UI09	NDUAC_HUMAN	13kDa differentiation-associated protein	28					respiratory electron transport chain|respiratory gaseous exchange|response to oxidative stress|transport	mitochondrial respiratory chain complex I	electron carrier activity|NADH dehydrogenase (ubiquinone) activity				0					NADH(DB00157)													---	---	---	---	capture		Silent	SNP	95397373	95397373	10661	12	G	A	A	45	45	NDUFA12	A	2	2
ELK3	2004	broad.mit.edu	37	12	96617398	96617398	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:96617398G>A	uc001teo.1	+	2	333	c.54G>A	c.(52-54)CAG>CAA	p.Q18Q		NM_005230	NP_005221	P41970	ELK3_HUMAN	ELK3 protein	18	ETS.				negative regulation of transcription, DNA-dependent|signal transduction	mitochondrion	protein binding|purine-rich negative regulatory element binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(1)	1	all_cancers(2;0.00173)																	---	---	---	---	capture		Silent	SNP	96617398	96617398	5252	12	G	A	A	33	33	ELK3	A	2	2
C12orf48	55010	broad.mit.edu	37	12	102589749	102589749	+	Nonsense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:102589749G>T	uc001tjf.2	+	11	1532	c.1420G>T	c.(1420-1422)GGA>TGA	p.G474*	C12orf48_uc001tjg.2_Nonsense_Mutation_p.G393*|C12orf48_uc010swa.1_Nonsense_Mutation_p.G551*|C12orf48_uc001tjh.2_Nonsense_Mutation_p.G393*|C12orf48_uc010swb.1_Missense_Mutation_p.W167L|C12orf48_uc009zuc.2_Nonsense_Mutation_p.G28*|C12orf48_uc001tjj.2_Nonsense_Mutation_p.G189*|C12orf48_uc001tjk.2_3'UTR|C12orf48_uc009zud.2_Missense_Mutation_p.W281L	NM_017915	NP_060385	Q9NWS1	PR1BP_HUMAN	hypothetical protein LOC55010	474					response to DNA damage stimulus	cytoplasm|nucleus	DNA binding				0																		---	---	---	---	capture		Nonsense_Mutation	SNP	102589749	102589749	1736	12	G	T	T	47	47	C12orf48	T	5	2
HSP90B1	7184	broad.mit.edu	37	12	104327872	104327872	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104327872G>C	uc001tkb.1	+	5	655	c.550G>C	c.(550-552)GAT>CAT	p.D184H	HSP90B1_uc010swg.1_Intron|HSP90B1_uc009zui.1_Missense_Mutation_p.D184H	NM_003299	NP_003290	P14625	ENPL_HUMAN	heat shock protein 90kDa beta, member 1	184					actin rod assembly|anti-apoptosis|cellular response to ATP|ER-associated protein catabolic process|protein folding|protein transport|regulation of phosphoprotein phosphatase activity|response to hypoxia|sequestering of calcium ion	cytosol|endoplasmic reticulum lumen|endoplasmic reticulum membrane|melanosome|microsome|midbody|perinuclear region of cytoplasm	ATP binding|calcium ion binding|low-density lipoprotein particle receptor binding|protein phosphatase binding|RNA binding|unfolded protein binding|virion binding			ovary(2)|skin(1)	3					Rifabutin(DB00615)													---	---	---	---	capture		Missense_Mutation	SNP	104327872	104327872	7702	12	G	C	C	33	33	HSP90B1	C	3	3
USP30	84749	broad.mit.edu	37	12	109520495	109520495	+	Nonsense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109520495G>T	uc010sxi.1	+	10	999	c.895G>T	c.(895-897)GAA>TAA	p.E299*	USP30_uc001tnu.3_Nonsense_Mutation_p.E268*|USP30_uc001tnw.3_Nonsense_Mutation_p.E16*	NM_032663	NP_116052	Q70CQ3	UBP30_HUMAN	ubiquitin specific peptidase 30	299	Cytoplasmic (Potential).				ubiquitin-dependent protein catabolic process	integral to membrane|mitochondrial outer membrane	cysteine-type peptidase activity|ubiquitin thiolesterase activity			lung(1)	1																		---	---	---	---	capture		Nonsense_Mutation	SNP	109520495	109520495	17625	12	G	T	T	41	41	USP30	T	5	2
DDX54	79039	broad.mit.edu	37	12	113612734	113612734	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:113612734C>A	uc001tup.2	-	9	910	c.882G>T	c.(880-882)ACG>ACT	p.T294T	DDX54_uc001tuq.3_Silent_p.T294T	NM_024072	NP_076977	Q8TDD1	DDX54_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 54	294	Helicase ATP-binding.				estrogen receptor signaling pathway|regulation of transcription, DNA-dependent|RNA processing|transcription, DNA-dependent	nucleolus	ATP binding|ATP-dependent RNA helicase activity|estrogen receptor binding|RNA binding|transcription corepressor activity			skin(2)|central_nervous_system(1)	3																OREG0022139	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	113612734	113612734	4543	12	C	A	A	23	23	DDX54	A	1	1
MMP17	4326	broad.mit.edu	37	12	132335647	132335647	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132335647G>T	uc001ujc.1	+	10	1739	c.1640G>T	c.(1639-1641)GGA>GTA	p.G547V	MMP17_uc001ujd.1_Missense_Mutation_p.G463V	NM_016155	NP_057239	Q9ULZ9	MMP17_HUMAN	matrix metalloproteinase 17 preproprotein	547					proteolysis	anchored to membrane|integral to plasma membrane|proteinaceous extracellular matrix	calcium ion binding|enzyme activator activity|metalloendopeptidase activity|zinc ion binding				0	all_neural(191;0.0982)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;1.82e-07)|Epithelial(86;1.51e-06)|all cancers(50;2.35e-05)														---	---	---	---	capture		Missense_Mutation	SNP	132335647	132335647	10046	12	G	T	T	41	41	MMP17	T	2	2
BRCA2	675	broad.mit.edu	37	13	32914784	32914784	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:32914784T>A	uc001uub.1	+	11	6519	c.6292T>A	c.(6292-6294)TCT>ACT	p.S2098T		NM_000059	NP_000050	P51587	BRCA2_HUMAN	breast cancer 2, early onset	2098					cell cycle cytokinesis|centrosome duplication|double-strand break repair via homologous recombination|negative regulation of mammary gland epithelial cell proliferation|nucleotide-excision repair|positive regulation of transcription, DNA-dependent|regulation of S phase of mitotic cell cycle	BRCA2-MAGE-D1 complex|centrosome|nucleoplasm|stored secretory granule	gamma-tubulin binding|H3 histone acetyltransferase activity|H4 histone acetyltransferase activity|protease binding|single-stranded DNA binding			ovary(20)|endometrium(8)|lung(7)|breast(7)|oesophagus(5)|large_intestine(4)|central_nervous_system(3)|pancreas(3)|skin(2)|upper_aerodigestive_tract(1)|cervix(1)|salivary_gland(1)|liver(1)|kidney(1)	64		Lung SC(185;0.0262)		all cancers(112;7.13e-07)|Epithelial(112;1.59e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.000732)|BRCA - Breast invasive adenocarcinoma(63;0.0291)|GBM - Glioblastoma multiforme(144;0.0704)				D|Mis|N|F|S		breast|ovarian|pancreatic	breast|ovarian|pancreatic|leukemia  (FANCB|FANCD1)		Direct_reversal_of_damage|Homologous_recombination	Fanconi_Anemia_type_D1_bi-allelic_BRCA2_mutations|Fanconi_Anemia|Pancreatic_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_BRCA2_type|Hereditary_Prostate_Cancer|Li-Fraumeni_syndrome	TCGA Ovarian(8;0.087)			---	---	---	---	capture		Missense_Mutation	SNP	32914784	32914784	1530	13	T	A	A	58	58	BRCA2	A	4	4
PCDH17	27253	broad.mit.edu	37	13	58208879	58208879	+	Silent	SNP	G	A	A	rs150039929	byFrequency	TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:58208879G>A	uc001vhq.1	+	1	3091	c.2199G>A	c.(2197-2199)GAG>GAA	p.E733E	PCDH17_uc010aec.1_Silent_p.E733E	NM_001040429	NP_001035519	O14917	PCD17_HUMAN	protocadherin 17 precursor	733	Cytoplasmic (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding|protein binding			ovary(3)|pancreas(2)|upper_aerodigestive_tract(1)|skin(1)	7		Lung NSC(96;0.027)|Prostate(109;0.0453)|Breast(118;0.128)|Hepatocellular(98;0.132)		GBM - Glioblastoma multiforme(99;1.06e-05)														---	---	---	---	capture		Silent	SNP	58208879	58208879	11932	13	G	A	A	33	33	PCDH17	A	2	2
KLHL1	57626	broad.mit.edu	37	13	70535578	70535578	+	Splice_Site	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:70535578T>C	uc001vip.2	-	3	1475	c.681_splice	c.e3-1	p.R227_splice	KLHL1_uc010thm.1_Splice_Site_p.R166_splice	NM_020866	NP_065917			kelch-like 1 protein						actin cytoskeleton organization	cytoplasm|cytoskeleton	actin binding				0		Breast(118;0.000162)		COAD - Colon adenocarcinoma(199;0.000193)|GBM - Glioblastoma multiforme(99;0.000211)														---	---	---	---	capture		Splice_Site	SNP	70535578	70535578	8677	13	T	C	C	55	55	KLHL1	C	5	4
KLHL1	57626	broad.mit.edu	37	13	70681819	70681819	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:70681819C>A	uc001vip.2	-	1	807	c.13G>T	c.(13-15)GGG>TGG	p.G5W	KLHL1_uc010thm.1_Missense_Mutation_p.G5W|ATXN8OS_uc010aej.1_RNA	NM_020866	NP_065917	Q9NR64	KLHL1_HUMAN	kelch-like 1 protein	5					actin cytoskeleton organization	cytoplasm|cytoskeleton	actin binding				0		Breast(118;0.000162)		COAD - Colon adenocarcinoma(199;0.000193)|GBM - Glioblastoma multiforme(99;0.000211)														---	---	---	---	capture		Missense_Mutation	SNP	70681819	70681819	8677	13	C	A	A	21	21	KLHL1	A	2	2
CLYBL	171425	broad.mit.edu	37	13	100518518	100518518	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:100518518T>A	uc001vok.2	+	6	673	c.659T>A	c.(658-660)CTG>CAG	p.L220Q	CLYBL_uc010tix.1_Missense_Mutation_p.W221R|CLYBL_uc010tiy.1_Missense_Mutation_p.L186Q	NM_206808	NP_996531	Q8N0X4	CLYBL_HUMAN	citrate lyase beta like precursor	220					cellular aromatic compound metabolic process	citrate lyase complex|mitochondrion	citrate (pro-3S)-lyase activity|metal ion binding				0	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)																	---	---	---	---	capture		Missense_Mutation	SNP	100518518	100518518	3711	13	T	A	A	55	55	CLYBL	A	4	4
CLYBL	171425	broad.mit.edu	37	13	100543577	100543577	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:100543577C>A	uc001vok.2	+	8	947	c.933C>A	c.(931-933)GCC>GCA	p.A311A		NM_206808	NP_996531	Q8N0X4	CLYBL_HUMAN	citrate lyase beta like precursor	311					cellular aromatic compound metabolic process	citrate lyase complex|mitochondrion	citrate (pro-3S)-lyase activity|metal ion binding				0	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)																	---	---	---	---	capture		Silent	SNP	100543577	100543577	3711	13	C	A	A	24	24	CLYBL	A	2	2
OR4K14	122740	broad.mit.edu	37	14	20483023	20483023	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20483023C>A	uc010tky.1	-	1	330	c.330G>T	c.(328-330)GGG>GGT	p.G110G		NM_001004712	NP_001004712	Q8NGD5	OR4KE_HUMAN	olfactory receptor, family 4, subfamily K,	110	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|large_intestine(1)	3	all_cancers(95;0.00108)		Epithelial(56;4.65e-07)|all cancers(55;2e-06)	GBM - Glioblastoma multiforme(265;0.00124)														---	---	---	---	capture		Silent	SNP	20483023	20483023	11479	14	C	A	A	22	22	OR4K14	A	2	2
OR10G3	26533	broad.mit.edu	37	14	22038649	22038649	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:22038649G>T	uc010tmb.1	-	1	227	c.227C>A	c.(226-228)TCC>TAC	p.S76Y		NM_001005465	NP_001005465	Q8NGC4	O10G3_HUMAN	olfactory receptor, family 10, subfamily G,	76	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(1)|central_nervous_system(1)	2	all_cancers(95;0.000987)			GBM - Glioblastoma multiforme(265;0.0139)														---	---	---	---	capture		Missense_Mutation	SNP	22038649	22038649	11306	14	G	T	T	41	41	OR10G3	T	2	2
C14orf93	60686	broad.mit.edu	37	14	23465173	23465173	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23465173C>T	uc001wib.1	-	3	1212	c.902G>A	c.(901-903)CGG>CAG	p.R301Q	C14orf93_uc001wic.1_Missense_Mutation_p.R121Q|C14orf93_uc001wid.1_Missense_Mutation_p.R301Q|C14orf93_uc001wig.2_Missense_Mutation_p.R301Q|C14orf93_uc001wih.2_Missense_Mutation_p.R301Q|C14orf93_uc001wie.2_Missense_Mutation_p.R301Q|C14orf93_uc001wia.3_Missense_Mutation_p.R301Q|C14orf93_uc001wif.2_Missense_Mutation_p.R121Q	NM_021944	NP_068763	Q9H972	CN093_HUMAN	hypothetical protein LOC60686 precursor	301						extracellular region				ovary(1)	1	all_cancers(95;3.3e-05)			GBM - Glioblastoma multiforme(265;0.0127)														---	---	---	---	capture		Missense_Mutation	SNP	23465173	23465173	1832	14	C	T	T	23	23	C14orf93	T	1	1
HEATR5A	25938	broad.mit.edu	37	14	31856449	31856449	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31856449A>G	uc001wrf.3	-	2	264	c.187T>C	c.(187-189)TGC>CGC	p.C63R	HEATR5A_uc010ami.2_5'UTR|HEATR5A_uc001wrg.1_5'UTR|HEATR5A_uc010tpk.1_Missense_Mutation_p.C356R	NM_015473	NP_056288	Q86XA9	HTR5A_HUMAN	HEAT repeat containing 5A	350							binding			ovary(1)	1	Hepatocellular(127;0.0877)|Breast(36;0.137)		LUAD - Lung adenocarcinoma(48;0.00292)|Lung(238;0.0164)|BRCA - Breast invasive adenocarcinoma(188;0.0797)|STAD - Stomach adenocarcinoma(7;0.173)	GBM - Glioblastoma multiforme(265;0.0059)														---	---	---	---	capture		Missense_Mutation	SNP	31856449	31856449	7314	14	A	G	G	7	7	HEATR5A	G	4	4
NUBPL	80224	broad.mit.edu	37	14	32034246	32034246	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:32034246A>T	uc001wrk.3	+	3	338	c.283A>T	c.(283-285)AAC>TAC	p.N95Y	NUBPL_uc010amj.2_RNA	NM_025152	NP_079428	Q8TB37	NUBPL_HUMAN	nucleotide binding protein-like	95					mitochondrial respiratory chain complex I assembly|mitochondrion morphogenesis	mitochondrion	4 iron, 4 sulfur cluster binding|ATP binding|metal ion binding				0	Hepatocellular(127;0.0604)|Prostate(35;0.15)|Breast(36;0.214)		LUAD - Lung adenocarcinoma(48;0.00192)|Lung(238;0.00714)|BRCA - Breast invasive adenocarcinoma(188;0.0677)|STAD - Stomach adenocarcinoma(7;0.173)	GBM - Glioblastoma multiforme(265;0.0102)														---	---	---	---	capture		Missense_Mutation	SNP	32034246	32034246	11122	14	A	T	T	9	9	NUBPL	T	4	4
NIN	51199	broad.mit.edu	37	14	51210134	51210134	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:51210134C>A	uc001wym.2	-	24	5492	c.5301G>T	c.(5299-5301)AAG>AAT	p.K1767N	NIN_uc001wyi.2_Missense_Mutation_p.K1767N|NIN_uc001wyj.2_RNA|NIN_uc001wyk.2_Missense_Mutation_p.K1054N|NIN_uc010tqp.1_Missense_Mutation_p.K1773N|NIN_uc001wyo.2_Missense_Mutation_p.K1767N	NM_182946	NP_891991	Q8N4C6	NIN_HUMAN	ninein isoform 5	1767	Potential.				centrosome localization	centrosome|microtubule	calcium ion binding|GTP binding|protein binding			skin(3)|ovary(1)|kidney(1)|central_nervous_system(1)	6	all_epithelial(31;0.00244)|Breast(41;0.127)							T	PDGFRB	MPD								---	---	---	---	capture		Missense_Mutation	SNP	51210134	51210134	10818	14	C	A	A	24	24	NIN	A	2	2
TRIM9	114088	broad.mit.edu	37	14	51446134	51446134	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:51446134G>T	uc001wyx.3	-	9	2806	c.2041C>A	c.(2041-2043)CCT>ACT	p.P681T	TRIM9_uc001wyy.2_Missense_Mutation_p.P762T	NM_015163	NP_055978	Q9C026	TRIM9_HUMAN	tripartite motif protein 9 isoform 1	681	B30.2/SPRY.				proteasomal ubiquitin-dependent protein catabolic process	cell junction|cytoskeleton|dendrite|synaptic vesicle	protein homodimerization activity|ubiquitin-protein ligase activity|zinc ion binding			skin(2)|lung(1)	3	all_epithelial(31;0.00418)|Breast(41;0.148)																	---	---	---	---	capture		Missense_Mutation	SNP	51446134	51446134	17099	14	G	T	T	43	43	TRIM9	T	2	2
TXNDC16	57544	broad.mit.edu	37	14	52907324	52907324	+	Missense_Mutation	SNP	T	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52907324T>G	uc001wzs.2	-	19	2410	c.1961A>C	c.(1960-1962)AAG>ACG	p.K654T	TXNDC16_uc010tqu.1_Missense_Mutation_p.K649T|TXNDC16_uc010aoe.2_RNA	NM_020784	NP_065835	Q9P2K2	TXD16_HUMAN	thioredoxin domain containing 16 isoform 1	654					cell redox homeostasis	extracellular region					0	Breast(41;0.0716)																	---	---	---	---	capture		Missense_Mutation	SNP	52907324	52907324	17351	14	T	G	G	56	56	TXNDC16	G	4	4
PSMC6	5706	broad.mit.edu	37	14	53178142	53178142	+	Missense_Mutation	SNP	A	G	G	rs11545962		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:53178142A>G	uc010tqx.1	+	6	383	c.383A>G	c.(382-384)GAG>GGG	p.E128G	PSMC6_uc010tqw.1_Missense_Mutation_p.E94G	NM_002806	NP_002797	P62333	PRS10_HUMAN	proteasome 26S ATPase subunit 6	114					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	cytoplasm|nucleus|proteasome complex	ATP binding|ATPase activity|protein binding, bridging			lung(1)	1	Breast(41;0.176)																	---	---	---	---	capture		Missense_Mutation	SNP	53178142	53178142	13144	14	A	G	G	11	11	PSMC6	G	4	4
SPTB	6710	broad.mit.edu	37	14	65249149	65249149	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:65249149G>A	uc001xht.2	-	19	4179	c.4125C>T	c.(4123-4125)CTC>CTT	p.L1375L	SPTB_uc001xhr.2_Silent_p.L1375L|SPTB_uc001xhs.2_Silent_p.L1375L|SPTB_uc001xhu.2_Silent_p.L1375L|SPTB_uc010aqi.2_Silent_p.L36L	NM_000347	NP_000338	P11277	SPTB1_HUMAN	spectrin beta isoform b	1375	Spectrin 11.				actin filament capping|axon guidance	cell surface|cytosol|intrinsic to internal side of plasma membrane|protein complex|spectrin|spectrin-associated cytoskeleton	actin filament binding|structural constituent of cytoskeleton			ovary(7)|skin(2)|lung(1)|central_nervous_system(1)	11		all_lung(585;4.15e-09)		all cancers(60;4.33e-34)|OV - Ovarian serous cystadenocarcinoma(108;8.32e-20)|BRCA - Breast invasive adenocarcinoma(234;0.0628)														---	---	---	---	capture		Silent	SNP	65249149	65249149	15632	14	G	A	A	33	33	SPTB	A	2	2
PCNX	22990	broad.mit.edu	37	14	71514572	71514572	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:71514572C>T	uc001xmo.2	+	22	4655	c.4209C>T	c.(4207-4209)TCC>TCT	p.S1403S	PCNX_uc010are.1_Silent_p.S1292S|PCNX_uc010arf.1_Silent_p.S263S	NM_014982	NP_055797	Q96RV3	PCX1_HUMAN	pecanex-like 1	1403						integral to membrane				ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(12;0.206)	all cancers(60;0.00835)|BRCA - Breast invasive adenocarcinoma(234;0.00951)|OV - Ovarian serous cystadenocarcinoma(108;0.0417)														---	---	---	---	capture		Silent	SNP	71514572	71514572	12011	14	C	T	T	24	24	PCNX	T	2	2
LTBP2	4053	broad.mit.edu	37	14	75019063	75019063	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75019063C>T	uc001xqa.2	-	6	1613	c.1226G>A	c.(1225-1227)CGC>CAC	p.R409H		NM_000428	NP_000419	Q14767	LTBP2_HUMAN	latent transforming growth factor beta binding	409	EGF-like 2.				protein secretion|protein targeting|transforming growth factor beta receptor signaling pathway	extracellular space|proteinaceous extracellular matrix	calcium ion binding|growth factor binding			liver(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(234;0.00219)|READ - Rectum adenocarcinoma(1;0.0649)														---	---	---	---	capture		Missense_Mutation	SNP	75019063	75019063	9450	14	C	T	T	27	27	LTBP2	T	1	1
TMEM63C	57156	broad.mit.edu	37	14	77706943	77706943	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77706943G>T	uc001xtf.2	+	13	1268	c.1056G>T	c.(1054-1056)ATG>ATT	p.M352I	TMEM63C_uc010asq.1_Missense_Mutation_p.M352I	NM_020431	NP_065164	Q9P1W3	TM63C_HUMAN	transmembrane protein 63C	352						integral to membrane					0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0342)														---	---	---	---	capture		Missense_Mutation	SNP	77706943	77706943	16731	14	G	T	T	47	47	TMEM63C	T	2	2
C14orf174	161394	broad.mit.edu	37	14	77844701	77844701	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77844701G>A	uc001xtq.1	+	1	940	c.940G>A	c.(940-942)GAC>AAC	p.D314N	TMED8_uc010ast.1_5'Flank|TMED8_uc001xto.1_5'Flank	NM_001010860	NP_001010860	Q9P1V8	SAM15_HUMAN	hypothetical protein LOC161394	314											0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0278)														---	---	---	---	capture		Missense_Mutation	SNP	77844701	77844701	1807	14	G	A	A	33	33	C14orf174	A	2	2
KCNK13	56659	broad.mit.edu	37	14	90650582	90650582	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:90650582C>A	uc001xye.1	+	2	904	c.462C>A	c.(460-462)GCC>GCA	p.A154A		NM_022054	NP_071337	Q9HB14	KCNKD_HUMAN	potassium channel, subfamily K, member 13	154	Cytoplasmic (Potential).					integral to membrane	potassium channel activity|voltage-gated ion channel activity			skin(1)	1		all_cancers(154;0.186)																---	---	---	---	capture		Silent	SNP	90650582	90650582	8366	14	C	A	A	24	24	KCNK13	A	2	2
SLC24A4	123041	broad.mit.edu	37	14	92909799	92909799	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:92909799C>A	uc001yak.2	+	7	611	c.587C>A	c.(586-588)TCT>TAT	p.S196Y	SLC24A4_uc001yai.2_Missense_Mutation_p.S149Y|SLC24A4_uc010twm.1_Missense_Mutation_p.S213Y|SLC24A4_uc001yaj.2_Missense_Mutation_p.S196Y|SLC24A4_uc010auj.2_Missense_Mutation_p.S104Y|SLC24A4_uc010twn.1_Translation_Start_Site	NM_153646	NP_705932	Q8NFF2	NCKX4_HUMAN	solute carrier family 24 member 4 isoform 1	213	Helical; (Potential).					integral to membrane|plasma membrane	calcium, potassium:sodium antiporter activity|symporter activity			breast(2)|ovary(1)	3		all_cancers(154;0.0347)|all_epithelial(191;0.163)		Colorectal(1;0.00242)|COAD - Colon adenocarcinoma(157;0.047)|Epithelial(152;0.0781)|READ - Rectum adenocarcinoma(1;0.176)|all cancers(159;0.182)														---	---	---	---	capture		Missense_Mutation	SNP	92909799	92909799	14965	14	C	A	A	32	32	SLC24A4	A	2	2
KIAA1409	57578	broad.mit.edu	37	14	94053224	94053224	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94053224C>A	uc001ybv.1	+	19	2554	c.2471C>A	c.(2470-2472)GCC>GAC	p.A824D	KIAA1409_uc001ybs.1_Missense_Mutation_p.A824D	NM_020818	NP_065869	Q9P2D8	UNC79_HUMAN	hypothetical protein LOC57578	1001						integral to membrane				ovary(10)|skin(4)|large_intestine(3)	17		all_cancers(154;0.0354)|all_epithelial(191;0.216)		Epithelial(152;0.188)														---	---	---	---	capture		Missense_Mutation	SNP	94053224	94053224	8539	14	C	A	A	26	26	KIAA1409	A	2	2
SETD3	84193	broad.mit.edu	37	14	99879360	99879360	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:99879360G>A	uc001ygc.2	-	8	947	c.777C>T	c.(775-777)CCC>CCT	p.P259P	SETD3_uc001ygd.2_Silent_p.P259P|SETD3_uc001ygf.2_Silent_p.P259P	NM_032233	NP_115609	Q86TU7	SETD3_HUMAN	SET domain containing 3 isoform a	259	SET.				peptidyl-lysine dimethylation|peptidyl-lysine monomethylation|peptidyl-lysine trimethylation|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	histone methyltransferase activity (H3-K36 specific)|transcription coactivator activity				0		all_cancers(154;0.224)|all_epithelial(191;0.0644)|Melanoma(154;0.0866)																---	---	---	---	capture		Silent	SNP	99879360	99879360	14621	14	G	A	A	47	47	SETD3	A	2	2
RYR3	6263	broad.mit.edu	37	15	33855210	33855210	+	Missense_Mutation	SNP	A	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:33855210A>C	uc001zhi.2	+	11	1215	c.1145A>C	c.(1144-1146)AAG>ACG	p.K382T	RYR3_uc010bar.2_Missense_Mutation_p.K382T	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	382	Cytoplasmic (By similarity).|MIR 5.				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---	capture		Missense_Mutation	SNP	33855210	33855210	14250	15	A	C	C	3	3	RYR3	C	4	4
RYR3	6263	broad.mit.edu	37	15	33938613	33938613	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:33938613T>A	uc001zhi.2	+	29	3897	c.3827T>A	c.(3826-3828)TTT>TAT	p.F1276Y	RYR3_uc010bar.2_Missense_Mutation_p.F1276Y	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	1276	4 X approximate repeats.|B30.2/SPRY 3.|Cytoplasmic (By similarity).				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---	capture		Missense_Mutation	SNP	33938613	33938613	14250	15	T	A	A	64	64	RYR3	A	4	4
C15orf41	84529	broad.mit.edu	37	15	36989588	36989588	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:36989588C>A	uc001zje.3	+	8	791	c.541C>A	c.(541-543)CTA>ATA	p.L181I	C15orf41_uc001zjd.2_Missense_Mutation_p.L181I|C15orf41_uc010bbb.1_Missense_Mutation_p.L83I|C15orf41_uc001zjf.2_Missense_Mutation_p.L83I|C15orf41_uc010uci.1_Missense_Mutation_p.L83I	NM_001130010	NP_001123482	Q9Y2V0	CO041_HUMAN	hypothetical protein LOC84529 isoform 1	181							protein binding			pancreas(1)	1		all_epithelial(112;3.06e-10)|Lung NSC(122;6.48e-08)|all_lung(180;8.31e-07)|Melanoma(134;0.222)		all cancers(64;1.76e-19)|GBM - Glioblastoma multiforme(113;5.03e-07)|BRCA - Breast invasive adenocarcinoma(123;0.11)														---	---	---	---	capture		Missense_Mutation	SNP	36989588	36989588	1845	15	C	A	A	24	24	C15orf41	A	2	2
BUB1B	701	broad.mit.edu	37	15	40477472	40477472	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40477472G>A	uc001zkx.3	+	7	1070	c.858G>A	c.(856-858)GAG>GAA	p.E286E	BUB1B_uc010ucl.1_Silent_p.E149E	NM_001211	NP_001202	O60566	BUB1B_HUMAN	budding uninhibited by benzimidazoles 1 beta	286					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|cell division|cell proliferation|mitotic cell cycle spindle assembly checkpoint|mitotic prometaphase|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|phosphatidylinositol-mediated signaling|protein localization to kinetochore|spindle organization	anaphase-promoting complex|condensed chromosome outer kinetochore|cytosol|microtubule organizing center|perinuclear region of cytoplasm|spindle midzone	ATP binding|protein binding|protein serine/threonine kinase activity			stomach(2)|ovary(1)|kidney(1)	4		all_cancers(109;1.12e-18)|all_epithelial(112;1.61e-15)|Lung NSC(122;5.63e-11)|all_lung(180;1.4e-09)|Melanoma(134;0.0574)|Ovarian(310;0.0822)|Colorectal(260;0.117)		GBM - Glioblastoma multiforme(113;1.83e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0556)				Mis|N|F|S			rhabdomyosarcoma			Mosaic_Variegated_Aneuploidy_Syndrome				---	---	---	---	capture		Silent	SNP	40477472	40477472	1605	15	G	A	A	36	36	BUB1B	A	2	2
PLCB2	5330	broad.mit.edu	37	15	40587238	40587238	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40587238C>T	uc001zld.2	-	18	2106	c.1805G>A	c.(1804-1806)CGC>CAC	p.R602H	PLCB2_uc010bbo.2_Missense_Mutation_p.R598H|PLCB2_uc010ucm.1_Missense_Mutation_p.R602H	NM_004573	NP_004564	Q00722	PLCB2_HUMAN	phospholipase C, beta 2	602	PI-PLC Y-box.				activation of phospholipase C activity|intracellular signal transduction|lipid catabolic process|phospholipid metabolic process|synaptic transmission	cytosol	calcium ion binding|phosphatidylinositol phospholipase C activity|signal transducer activity			ovary(3)|breast(3)|kidney(1)|pancreas(1)	8		all_cancers(109;9.35e-19)|all_epithelial(112;1.18e-15)|Lung NSC(122;2.45e-11)|all_lung(180;6.47e-10)|Melanoma(134;0.0574)|Ovarian(310;0.0822)|Colorectal(260;0.117)		GBM - Glioblastoma multiforme(113;9.38e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0508)														---	---	---	---	capture		Missense_Mutation	SNP	40587238	40587238	12454	15	C	T	T	27	27	PLCB2	T	1	1
SPTBN5	51332	broad.mit.edu	37	15	42168377	42168377	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42168377T>C	uc001zos.2	-	21	4285	c.3952A>G	c.(3952-3954)AAG>GAG	p.K1318E		NM_016642	NP_057726	Q9NRC6	SPTN5_HUMAN	spectrin, beta, non-erythrocytic 5	1353	Spectrin 10.				actin cytoskeleton organization|actin filament capping|axon guidance	cytosol|membrane|spectrin				ovary(1)|central_nervous_system(1)	2		all_cancers(109;1.84e-17)|all_epithelial(112;1.12e-15)|Lung NSC(122;7.6e-10)|all_lung(180;4.15e-09)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.173)		all cancers(2;4.33e-34)|Epithelial(2;1.72e-25)|OV - Ovarian serous cystadenocarcinoma(18;8.32e-20)|GBM - Glioblastoma multiforme(94;4.69e-07)|Colorectal(2;0.00104)|COAD - Colon adenocarcinoma(120;0.0405)|READ - Rectum adenocarcinoma(92;0.0908)														---	---	---	---	capture		Missense_Mutation	SNP	42168377	42168377	15636	15	T	C	C	63	63	SPTBN5	C	4	4
TGM5	9333	broad.mit.edu	37	15	43527824	43527824	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43527824C>A	uc001zrd.1	-	10	1565	c.1557G>T	c.(1555-1557)ATG>ATT	p.M519I	TGM5_uc001zrc.1_Missense_Mutation_p.M176I|TGM5_uc001zre.1_Missense_Mutation_p.M437I	NM_201631	NP_963925	O43548	TGM5_HUMAN	transglutaminase 5 isoform 1	519					epidermis development|peptide cross-linking	cytoplasm	acyltransferase activity|metal ion binding|protein-glutamine gamma-glutamyltransferase activity			central_nervous_system(1)	1		all_cancers(109;1.37e-14)|all_epithelial(112;1.26e-12)|Lung NSC(122;2.46e-08)|all_lung(180;2.75e-07)|Melanoma(134;0.0476)|Colorectal(260;0.216)		GBM - Glioblastoma multiforme(94;4e-07)	L-Glutamine(DB00130)													---	---	---	---	capture		Missense_Mutation	SNP	43527824	43527824	16361	15	C	A	A	21	21	TGM5	A	2	2
SLC12A1	6557	broad.mit.edu	37	15	48533761	48533761	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48533761C>A	uc001zwn.3	+	10	1481	c.1265C>A	c.(1264-1266)ACC>AAC	p.T422N	SLC12A1_uc010uew.1_Missense_Mutation_p.T228N|SLC12A1_uc010bem.2_Missense_Mutation_p.T422N|SLC12A1_uc001zwq.3_Missense_Mutation_p.T193N|SLC12A1_uc001zwr.3_Missense_Mutation_p.T149N	NM_000338	NP_000329	Q13621	S12A1_HUMAN	sodium potassium chloride cotransporter 2	422	Helical; (Potential).				potassium ion transport|sodium ion transport	integral to membrane|membrane fraction	sodium:potassium:chloride symporter activity			ovary(1)|central_nervous_system(1)	2		all_lung(180;0.00219)		all cancers(107;1.76e-09)|GBM - Glioblastoma multiforme(94;1.48e-06)	Bumetanide(DB00887)|Chlormerodrin(DB00534)|Chlorthalidone(DB00310)|Ethacrynic acid(DB00903)|Furosemide(DB00695)|Hydroflumethiazide(DB00774)|Methyclothiazide(DB00232)|Metolazone(DB00524)|Potassium Chloride(DB00761)|Torasemide(DB00214)|Trichlormethiazide(DB01021)													---	---	---	---	capture		Missense_Mutation	SNP	48533761	48533761	14877	15	C	A	A	18	18	SLC12A1	A	2	2
SCG3	29106	broad.mit.edu	37	15	51975481	51975481	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:51975481G>A	uc002abh.2	+	4	655	c.247G>A	c.(247-249)GAA>AAA	p.E83K	SCG3_uc010ufz.1_5'UTR	NM_013243	NP_037375	Q8WXD2	SCG3_HUMAN	secretogranin III isoform 1 precursor	83					platelet activation|platelet degranulation	extracellular region|stored secretory granule				ovary(1)	1				all cancers(107;0.00488)														---	---	---	---	capture		Missense_Mutation	SNP	51975481	51975481	14373	15	G	A	A	33	33	SCG3	A	2	2
CGNL1	84952	broad.mit.edu	37	15	57731420	57731420	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:57731420G>A	uc002aeg.2	+	2	1299	c.1223G>A	c.(1222-1224)AGT>AAT	p.S408N	CGNL1_uc010bfw.2_Missense_Mutation_p.S408N	NM_032866	NP_116255	Q0VF96	CGNL1_HUMAN	cingulin-like 1	408	Head.					myosin complex|tight junction	motor activity			skin(6)|ovary(4)|central_nervous_system(1)	11				all cancers(107;0.121)|GBM - Glioblastoma multiforme(80;0.186)														---	---	---	---	capture		Missense_Mutation	SNP	57731420	57731420	3437	15	G	A	A	36	36	CGNL1	A	2	2
SPG21	51324	broad.mit.edu	37	15	65273355	65273355	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65273355C>A	uc002aod.2	-	3	165	c.72G>T	c.(70-72)GTG>GTT	p.V24V	SPG21_uc002aoe.2_Silent_p.V24V|SPG21_uc010bhb.2_Silent_p.V24V|SPG21_uc010bhc.2_5'UTR	NM_001127889	NP_001121361	Q9NZD8	SPG21_HUMAN	spastic paraplegia 21 isoform a	24					cell death	cytosol|endosome membrane|trans-Golgi network transport vesicle	CD4 receptor binding				0																		---	---	---	---	capture		Silent	SNP	65273355	65273355	15555	15	C	A	A	21	21	SPG21	A	2	2
ITGA11	22801	broad.mit.edu	37	15	68661615	68661615	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:68661615C>A	uc002ari.2	-	3	259	c.172G>T	c.(172-174)GTG>TTG	p.V58L	ITGA11_uc010bib.2_Missense_Mutation_p.V58L	NM_001004439	NP_001004439	Q9UKX5	ITA11_HUMAN	integrin, alpha 11 precursor	58	FG-GAP 1.|Extracellular (Potential).				cell-matrix adhesion|integrin-mediated signaling pathway|muscle organ development	integrin complex	collagen binding|receptor activity			kidney(2)|pancreas(1)	3					Tirofiban(DB00775)													---	---	---	---	capture		Missense_Mutation	SNP	68661615	68661615	8178	15	C	A	A	19	19	ITGA11	A	1	1
NOX5	79400	broad.mit.edu	37	15	69320642	69320642	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:69320642C>A	uc002ars.1	+	3	282	c.262C>A	c.(262-264)CTG>ATG	p.L88M	NOX5_uc002arp.1_Missense_Mutation_p.L70M|NOX5_uc002arq.1_Missense_Mutation_p.L70M|NOX5_uc010bid.1_Missense_Mutation_p.L81M|NOX5_uc002arr.1_Missense_Mutation_p.L88M|NOX5_uc010bie.1_Translation_Start_Site	NM_024505	NP_078781	Q96PH1	NOX5_HUMAN	NADPH oxidase, EF-hand calcium binding domain 5	88	Cytoplasmic (Potential).|N-terminal regulatory region; interacts with the C-terminal catalytic region in a calcium-dependent manner.|EF-hand 2.				angiogenesis|angiogenesis|cytokine secretion|cytokinesis|electron transport chain|endothelial cell proliferation|induction of apoptosis|positive regulation of reactive oxygen species metabolic process|regulation of fusion of sperm to egg plasma membrane|regulation of proton transport|superoxide anion generation	endoplasmic reticulum|endoplasmic reticulum|integral to membrane	calcium ion binding|electron carrier activity|flavin adenine dinucleotide binding|heme binding|hydrogen ion channel activity|NADP binding|superoxide-generating NADPH oxidase activity			breast(1)|pancreas(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	69320642	69320642	10963	15	C	A	A	24	24	NOX5	A	2	2
ARNT2	9915	broad.mit.edu	37	15	80762560	80762560	+	Nonsense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:80762560G>T	uc002bfr.2	+	4	362	c.196G>T	c.(196-198)GAG>TAG	p.E66*	ARNT2_uc002bfq.2_Nonsense_Mutation_p.E66*|ARNT2_uc010unm.1_Nonsense_Mutation_p.E55*|ARNT2_uc002bfs.2_Nonsense_Mutation_p.E55*	NM_014862	NP_055677	Q9HBZ2	ARNT2_HUMAN	aryl hydrocarbon receptor nuclear translocator	66	Basic motif.				central nervous system development|in utero embryonic development|response to hypoxia		aryl hydrocarbon receptor binding|DNA binding|protein heterodimerization activity|sequence-specific DNA binding transcription factor activity|signal transducer activity			central_nervous_system(3)|ovary(1)|pancreas(1)	5			BRCA - Breast invasive adenocarcinoma(143;0.134)															---	---	---	---	capture		Nonsense_Mutation	SNP	80762560	80762560	984	15	G	T	T	33	33	ARNT2	T	5	2
NTRK3	4916	broad.mit.edu	37	15	88799374	88799374	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:88799374G>C	uc002bme.1	-	2	173	c.11C>G	c.(10-12)TCT>TGT	p.S4C	NTRK3_uc002bmh.2_Missense_Mutation_p.S4C|NTRK3_uc002bmf.1_Missense_Mutation_p.S4C|NTRK3_uc010bnh.1_Missense_Mutation_p.S4C|NTRK3_uc002bmg.2_Missense_Mutation_p.S4C	NM_001012338	NP_001012338	Q16288	NTRK3_HUMAN	neurotrophic tyrosine kinase, receptor, type 3	4					transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|transmembrane receptor protein tyrosine kinase activity		ETV6/NTRK3(234)	soft_tissue(85)|kidney(66)|breast(56)|salivary_gland(26)|lung(22)|large_intestine(6)|ovary(6)|stomach(5)|central_nervous_system(3)|pancreas(3)|haematopoietic_and_lymphoid_tissue(2)|skin(1)	281			BRCA - Breast invasive adenocarcinoma(143;0.211)					T	ETV6	congenital fibrosarcoma|Secretory breast 					TSP Lung(13;0.10)			---	---	---	---	capture		Missense_Mutation	SNP	88799374	88799374	11113	15	G	C	C	33	33	NTRK3	C	3	3
PKD1	5310	broad.mit.edu	37	16	2147352	2147352	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2147352G>T	uc002cos.1	-	33	10582	c.10373C>A	c.(10372-10374)CCC>CAC	p.P3458H	PKD1_uc002cot.1_Missense_Mutation_p.P3457H|PKD1_uc010bse.1_RNA	NM_001009944	NP_001009944	P98161	PKD1_HUMAN	polycystin 1 isoform 1 precursor	3458	Cytoplasmic (Potential).				calcium-independent cell-matrix adhesion|homophilic cell adhesion|neuropeptide signaling pathway	basolateral plasma membrane|integral to plasma membrane	protein domain specific binding|sugar binding			central_nervous_system(2)|skin(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	2147352	2147352	12387	16	G	T	T	43	43	PKD1	T	2	2
ACSM5	54988	broad.mit.edu	37	16	20432659	20432659	+	Missense_Mutation	SNP	G	T	T	rs142721448	byFrequency	TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20432659G>T	uc002dhe.2	+	5	850	c.703G>T	c.(703-705)GGG>TGG	p.G235W		NM_017888	NP_060358	Q6NUN0	ACSM5_HUMAN	acyl-CoA synthetase medium-chain family member 5	235	ATP (By similarity).				fatty acid metabolic process	mitochondrial matrix	ATP binding|butyrate-CoA ligase activity|GTP binding|metal ion binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	20432659	20432659	188	16	G	T	T	39	39	ACSM5	T	1	1
UQCRC2	7385	broad.mit.edu	37	16	21968570	21968570	+	Silent	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21968570C>G	uc002djx.2	+	2	184	c.48C>G	c.(46-48)CTC>CTG	p.L16L	UQCRC2_uc002djy.2_Silent_p.L16L|UQCRC2_uc010bxa.2_RNA	NM_003366	NP_003357	P22695	QCR2_HUMAN	ubiquinol-cytochrome c reductase core protein II	16					aerobic respiration|oxidative phosphorylation|proteolysis|respiratory electron transport chain|transport		metalloendopeptidase activity|zinc ion binding			large_intestine(2)	2				GBM - Glioblastoma multiforme(48;0.0264)														---	---	---	---	capture		Silent	SNP	21968570	21968570	17581	16	C	G	G	29	29	UQCRC2	G	3	3
CACNG3	10368	broad.mit.edu	37	16	24358077	24358077	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24358077G>C	uc002dmf.2	+	2	1434	c.234G>C	c.(232-234)AAG>AAC	p.K78N		NM_006539	NP_006530	O60359	CCG3_HUMAN	voltage-dependent calcium channel gamma-3	78					regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|synaptic transmission	alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex|endocytic vesicle membrane|voltage-gated calcium channel complex	voltage-gated calcium channel activity				0				GBM - Glioblastoma multiforme(48;0.0809)														---	---	---	---	capture		Missense_Mutation	SNP	24358077	24358077	2674	16	G	C	C	33	33	CACNG3	C	3	3
XPO6	23214	broad.mit.edu	37	16	28123164	28123164	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28123164G>A	uc002dpa.1	-	17	2816	c.2315C>T	c.(2314-2316)CCA>CTA	p.P772L	XPO6_uc002dpb.1_Missense_Mutation_p.P758L|XPO6_uc010vcp.1_Missense_Mutation_p.P772L	NM_015171	NP_055986	Q96QU8	XPO6_HUMAN	exportin 6	772					protein export from nucleus		protein binding|protein transporter activity			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	28123164	28123164	18031	16	G	A	A	47	47	XPO6	A	2	2
IL27	246778	broad.mit.edu	37	16	28511049	28511049	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28511049G>T	uc002dqc.2	-	5	678	c.655C>A	c.(655-657)CGG>AGG	p.R219R	uc010vct.1_Intron	NM_145659	NP_663634	Q8NEV9	IL27A_HUMAN	interleukin 27 precursor	219					inflammatory response|innate immune response|positive regulation of interferon-gamma biosynthetic process|regulation of defense response to virus|regulation of T cell proliferation|regulation of T-helper 1 cell differentiation	extracellular space	cytokine activity|interleukin-27 receptor binding				0																		---	---	---	---	capture		Silent	SNP	28511049	28511049	7981	16	G	T	T	38	38	IL27	T	1	1
ITGAX	3687	broad.mit.edu	37	16	31388586	31388586	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31388586G>T	uc002ebu.1	+	23	2856	c.2789G>T	c.(2788-2790)AGC>ATC	p.S930I	ITGAX_uc002ebt.2_Missense_Mutation_p.S930I	NM_000887	NP_000878	P20702	ITAX_HUMAN	integrin alpha X precursor	930	Extracellular (Potential).				blood coagulation|cell adhesion|integrin-mediated signaling pathway|leukocyte migration|organ morphogenesis	integrin complex	protein binding|receptor activity			ovary(2)|central_nervous_system(1)|pancreas(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	31388586	31388586	8193	16	G	T	T	35	35	ITGAX	T	2	2
ZNF267	10308	broad.mit.edu	37	16	31925796	31925796	+	Splice_Site	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31925796G>T	uc002ecs.3	+	4	436	c.227_splice	c.e4-1	p.D76_splice		NM_003414	NP_003405			zinc finger protein 267						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|breast(1)|skin(1)	4																		---	---	---	---	capture		Splice_Site	SNP	31925796	31925796	18398	16	G	T	T	33	33	ZNF267	T	5	2
PHKB	5257	broad.mit.edu	37	16	47622821	47622821	+	Silent	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:47622821A>T	uc002eev.3	+	10	928	c.876A>T	c.(874-876)ACA>ACT	p.T292T	PHKB_uc002eeu.3_Silent_p.T285T	NM_000293	NP_000284	Q93100	KPBB_HUMAN	phosphorylase kinase, beta isoform a	292					glucose metabolic process|glycogen catabolic process	cytosol|plasma membrane	calmodulin binding|glucan 1,4-alpha-glucosidase activity			ovary(1)|large_intestine(1)|breast(1)	3		all_cancers(37;0.00447)|all_lung(18;0.00616)|Lung NSC(13;0.0418)|Breast(268;0.203)																---	---	---	---	capture		Silent	SNP	47622821	47622821	12269	16	A	T	T	7	7	PHKB	T	4	4
MMP2	4313	broad.mit.edu	37	16	55523690	55523690	+	Silent	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:55523690A>T	uc002ehz.3	+	7	1445	c.1134A>T	c.(1132-1134)ACA>ACT	p.T378T	MMP2_uc010vhd.1_Silent_p.T302T|MMP2_uc010ccc.2_Silent_p.T328T	NM_004530	NP_004521	P08253	MMP2_HUMAN	matrix metalloproteinase 2 isoform a	378	Fibronectin type-II 3.|Collagen-binding.				angiogenesis|collagen catabolic process|proteolysis	extracellular space|membrane|nucleus|proteinaceous extracellular matrix	metalloendopeptidase activity|protein binding|zinc ion binding			large_intestine(3)|ovary(3)|lung(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)	11		Renal(780;0.00183)|Breast(268;0.00354)|Hepatocellular(780;0.00826)|all_neural(199;0.0189)		UCEC - Uterine corpus endometrioid carcinoma (183;0.0185)|all cancers(182;7.16e-45)|Epithelial(162;5.26e-37)|GBM - Glioblastoma multiforme(240;9e-08)|Kidney(780;0.00227)|BRCA - Breast invasive adenocarcinoma(181;0.00786)	Marimastat(DB00786)|Sulindac(DB00605)													---	---	---	---	capture		Silent	SNP	55523690	55523690	10048	16	A	T	T	7	7	MMP2	T	4	4
SLC12A3	6559	broad.mit.edu	37	16	56926012	56926012	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:56926012C>G	uc010ccm.2	+	20	2415	c.2386C>G	c.(2386-2388)CCA>GCA	p.P796A	SLC12A3_uc002ekd.3_Missense_Mutation_p.P796A|SLC12A3_uc010ccn.2_Missense_Mutation_p.P795A	NM_001126108	NP_001119580	P55017	S12A3_HUMAN	solute carrier family 12, member 3 isoform 3	796	Cytoplasmic (Potential).				sodium ion transmembrane transport	apical plasma membrane|integral to plasma membrane|membrane fraction	sodium:chloride symporter activity			ovary(2)|breast(1)	3					Bendroflumethiazide(DB00436)|Benzthiazide(DB00562)|Chlorothiazide(DB00880)|Diazoxide(DB01119)|Hydrochlorothiazide(DB00999)|Metolazone(DB00524)|Polythiazide(DB01324)|Quinethazone(DB01325)													---	---	---	---	capture		Missense_Mutation	SNP	56926012	56926012	14879	16	C	G	G	22	22	SLC12A3	G	3	3
CDH8	1006	broad.mit.edu	37	16	61859003	61859003	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:61859003C>A	uc002eog.1	-	5	1000	c.748G>T	c.(748-750)GGT>TGT	p.G250C	CDH8_uc002eoh.2_Missense_Mutation_p.G19C	NM_001796	NP_001787	P55286	CADH8_HUMAN	cadherin 8, type 2 preproprotein	250	Extracellular (Potential).|Cadherin 2.				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|skin(2)|breast(1)	9		Ovarian(137;0.0799)|Melanoma(118;0.16)		UCEC - Uterine corpus endometrioid carcinoma (183;0.196)|Epithelial(162;0.0155)|all cancers(182;0.0305)|OV - Ovarian serous cystadenocarcinoma(108;0.0499)|BRCA - Breast invasive adenocarcinoma(181;0.249)														---	---	---	---	capture		Missense_Mutation	SNP	61859003	61859003	3245	16	C	A	A	22	22	CDH8	A	2	2
CES3	23491	broad.mit.edu	37	16	66998388	66998388	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:66998388C>A	uc002eqt.2	+	5	762	c.689C>A	c.(688-690)GCC>GAC	p.A230D	CES3_uc010cdz.2_Missense_Mutation_p.A230D|CES3_uc010cea.2_RNA|CES3_uc010viw.1_5'Flank	NM_024922	NP_079198	Q6UWW8	EST3_HUMAN	carboxylesterase 3 precursor	230						endoplasmic reticulum lumen	carboxylesterase activity|methyl indole-3-acetate esterase activity|methyl jasmonate esterase activity|methyl salicylate esterase activity			ovary(3)|central_nervous_system(2)	5		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0488)|Epithelial(162;0.127)														---	---	---	---	capture		Missense_Mutation	SNP	66998388	66998388	3404	16	C	A	A	26	26	CES3	A	2	2
ATP6V0D1	9114	broad.mit.edu	37	16	67487556	67487556	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67487556G>C	uc002ete.1	-	2	293	c.193C>G	c.(193-195)CTG>GTG	p.L65V	ATP6V0D1_uc010vjo.1_Missense_Mutation_p.L65V|ATP6V0D1_uc010vjn.1_5'UTR	NM_004691	NP_004682	P61421	VA0D1_HUMAN	ATPase, H+ transporting, lysosomal, V0 subunit	65					ATP hydrolysis coupled proton transport|cellular iron ion homeostasis|insulin receptor signaling pathway|transferrin transport	endosome membrane|proton-transporting V-type ATPase, V0 domain|vacuolar proton-transporting V-type ATPase complex					0		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0439)|Epithelial(162;0.101)														---	---	---	---	capture		Missense_Mutation	SNP	67487556	67487556	1192	16	G	C	C	33	33	ATP6V0D1	C	3	3
CDH1	999	broad.mit.edu	37	16	68844241	68844241	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68844241C>T	uc002ewg.1	+	6	953	c.829C>T	c.(829-831)CCA>TCA	p.P277S	CDH1_uc010vlj.1_RNA|CDH1_uc010cfg.1_Missense_Mutation_p.P277S	NM_004360	NP_004351	P12830	CADH1_HUMAN	cadherin 1, type 1 preproprotein	277	Cadherin 2.|Extracellular (Potential).		Missing (found in gastric carcinoma cell lines).		adherens junction organization|cellular component disassembly involved in apoptosis|cellular response to indole-3-methanol|cellular response to lithium ion|homophilic cell adhesion|negative regulation of cell-cell adhesion|positive regulation of transcription factor import into nucleus|positive regulation of transcription, DNA-dependent|regulation of immune response	actin cytoskeleton|aggresome|apical junction complex|catenin complex|cell-cell adherens junction|endosome|focal adhesion|Golgi apparatus|integral to membrane|internal side of plasma membrane|lateral plasma membrane|perinuclear region of cytoplasm	cell adhesion molecule binding|gamma-catenin binding	p.G274_P277del(2)|p.?(2)		breast(148)|stomach(71)|biliary_tract(8)|endometrium(3)|soft_tissue(2)|large_intestine(2)|urinary_tract(2)|oesophagus(2)|ovary(2)|thyroid(1)|central_nervous_system(1)|lung(1)	243		all_neural(199;0.0189)|Ovarian(137;0.0563)		Epithelial(162;8.44e-05)|all cancers(182;0.000404)|OV - Ovarian serous cystadenocarcinoma(108;0.000426)|BRCA - Breast invasive adenocarcinoma(181;0.0261)				Mis|N|F|S		lobular breast|gastric	gastric			Hereditary_Diffuse_Gastric_Cancer				---	---	---	---	capture		Missense_Mutation	SNP	68844241	68844241	3224	16	C	T	T	30	30	CDH1	T	2	2
PDPR	55066	broad.mit.edu	37	16	70170101	70170101	+	Silent	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70170101T>A	uc002eyf.1	+	10	1959	c.1002T>A	c.(1000-1002)CCT>CCA	p.P334P	CLEC18C_uc002exy.2_Intron|PDPR_uc010vlr.1_Silent_p.P234P|PDPR_uc002eyg.1_Silent_p.P62P	NM_017990	NP_060460	Q8NCN5	PDPR_HUMAN	pyruvate dehydrogenase phosphatase regulatory	334					glycine catabolic process|pyruvate metabolic process|regulation of acetyl-CoA biosynthetic process from pyruvate	mitochondrial matrix	aminomethyltransferase activity|oxidoreductase activity			breast(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.124)														---	---	---	---	capture		Silent	SNP	70170101	70170101	12110	16	T	A	A	54	54	PDPR	A	4	4
KARS	3735	broad.mit.edu	37	16	75665710	75665710	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:75665710C>G	uc002feq.2	-	8	1007	c.959G>C	c.(958-960)CGC>CCC	p.R320P	KARS_uc002fer.2_Missense_Mutation_p.R348P|KARS_uc002fes.2_Missense_Mutation_p.R164P	NM_005548	NP_005539	Q15046	SYK_HUMAN	lysyl-tRNA synthetase isoform 2	320					interspecies interaction between organisms|lysyl-tRNA aminoacylation|tRNA processing	cytosol|extracellular region|mitochondrial matrix|nucleus|plasma membrane|soluble fraction	ATP binding|lysine-tRNA ligase activity|metal ion binding|tRNA binding			ovary(2)	2					L-Lysine(DB00123)													---	---	---	---	capture		Missense_Mutation	SNP	75665710	75665710	8284	16	C	G	G	27	27	KARS	G	3	3
ADAMTS18	170692	broad.mit.edu	37	16	77375636	77375636	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:77375636G>C	uc002ffc.3	-	11	2094	c.1675C>G	c.(1675-1677)CCC>GCC	p.P559A	ADAMTS18_uc010chc.1_Missense_Mutation_p.P147A|ADAMTS18_uc002ffe.1_Missense_Mutation_p.P255A	NM_199355	NP_955387	Q8TE60	ATS18_HUMAN	ADAM metallopeptidase with thrombospondin type 1	559	Disintegrin.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			large_intestine(4)|lung(4)|kidney(4)|skin(3)|breast(1)|ovary(1)|pancreas(1)	18																		---	---	---	---	capture		Missense_Mutation	SNP	77375636	77375636	264	16	G	C	C	42	42	ADAMTS18	C	3	3
VAT1L	57687	broad.mit.edu	37	16	77850859	77850859	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:77850859T>C	uc002ffg.1	+	2	372	c.275T>C	c.(274-276)ATT>ACT	p.I92T		NM_020927	NP_065978	Q9HCJ6	VAT1L_HUMAN	vesicle amine transport protein 1 homolog (T.	92							oxidoreductase activity|zinc ion binding			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	77850859	77850859	17695	16	T	C	C	52	52	VAT1L	C	4	4
FAM57A	79850	broad.mit.edu	37	17	641263	641263	+	Silent	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:641263C>G	uc002frp.2	+	3	425	c.384C>G	c.(382-384)CTC>CTG	p.L128L	FAM57A_uc002frq.2_Silent_p.L128L|FAM57A_uc002frr.2_Silent_p.L38L	NM_024792	NP_079068	Q8TBR7	FA57A_HUMAN	family with sequence similarity 57, member A	128	TLC.|Helical; (Potential).					integral to membrane|plasma membrane					0				UCEC - Uterine corpus endometrioid carcinoma (25;0.0217)														---	---	---	---	capture		Silent	SNP	641263	641263	5810	17	C	G	G	32	32	FAM57A	G	3	3
OR1G1	8390	broad.mit.edu	37	17	3030217	3030217	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3030217C>G	uc002fvc.1	-	1	629	c.629G>C	c.(628-630)TGT>TCT	p.C210S		NM_003555	NP_003546	P47890	OR1G1_HUMAN	olfactory receptor, family 1, subfamily G,	210	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	3030217	3030217	11363	17	C	G	G	17	17	OR1G1	G	3	3
DLG4	1742	broad.mit.edu	37	17	7100162	7100162	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7100162C>G	uc002get.3	-	11	2327	c.1126G>C	c.(1126-1128)GGT>CGT	p.G376R	DLG4_uc010vtm.1_RNA|DLG4_uc010vtn.1_Missense_Mutation_p.G273R|DLG4_uc010cly.2_Missense_Mutation_p.G330R|DLG4_uc010vto.1_Missense_Mutation_p.G373R	NM_001365	NP_001356	P78352	DLG4_HUMAN	post-synaptic density protein 95 isoform 1	333	PDZ 3.				axon guidance|learning|protein complex assembly|protein localization to synapse|signal transduction|synaptic transmission	cell junction|cortical cytoskeleton|endocytic vesicle membrane|neuron spine|postsynaptic density|postsynaptic membrane|synaptosome	protein binding|protein C-terminus binding			ovary(1)|breast(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	7100162	7100162	4737	17	C	G	G	23	23	DLG4	G	3	3
TP53	7157	broad.mit.edu	37	17	7578403	7578403	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7578403C>T	uc002gim.2	-	5	721	c.527G>A	c.(526-528)TGC>TAC	p.C176Y	TP53_uc002gig.1_Missense_Mutation_p.C176Y|TP53_uc002gih.2_Missense_Mutation_p.C176Y|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Missense_Mutation_p.C44Y|TP53_uc010cng.1_Missense_Mutation_p.C44Y|TP53_uc002gii.1_Missense_Mutation_p.C44Y|TP53_uc010cnh.1_Missense_Mutation_p.C176Y|TP53_uc010cni.1_Missense_Mutation_p.C176Y|TP53_uc002gij.2_Missense_Mutation_p.C176Y|TP53_uc010cnj.1_RNA|TP53_uc002gin.2_Missense_Mutation_p.C83Y|TP53_uc002gio.2_Missense_Mutation_p.C44Y|TP53_uc010vug.1_Missense_Mutation_p.C137Y	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	176	Required for interaction with FBXO42.||Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).	Zinc.	CP -> FS (in a sporadic cancer; somatic mutation).|C -> S (in sporadic cancers; somatic mutation).|C -> R (in sporadic cancers; somatic mutation).|C -> G (in sporadic cancers; somatic mutation).|C -> W (in sporadic cancers; somatic mutation).|C -> Y (in sporadic cancers; somatic mutation).|C -> F (in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.C176F(102)|p.C176Y(56)|p.C176S(19)|p.C176W(11)|p.C176R(8)|p.C176fs*71(7)|p.0?(7)|p.C176*(6)|p.C176_R181delCPHHER(3)|p.R174fs*24(3)|p.C176G(3)|p.C176fs*5(3)|p.R175_E180delRCPHHE(3)|p.V173fs*59(2)|p.R174fs*1(2)|p.V157_C176del20(1)|p.K164_P219del(1)|p.C176fs*65(1)|p.C176_P177delCP(1)|p.V173fs*69(1)|p.C176fs*68(1)|p.E171fs*61(1)|p.V173fs*23(1)|p.R174_H178>S(1)|p.C44Y(1)|p.V172_E180delVVRRCPHHE(1)|p.R174_H179delRRCPHH(1)|p.E171fs*1(1)|p.R175_H178>X(1)|p.R42fs*24(1)|p.C83Y(1)|p.C176fs*72(1)|p.R174_C176delRRC(1)|p.H168fs*69(1)|p.R174fs*70(1)|p.C176del(1)|p.E171_H179delEVVRRCPHH(1)|p.R81fs*24(1)|p.R174_E180>K(1)|p.C176fs*6(1)|p.R174fs*3(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)			111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			---	---	---	---	capture		Missense_Mutation	SNP	7578403	7578403	16923	17	C	T	T	25	25	TP53	T	2	2
CHD3	1107	broad.mit.edu	37	17	7802420	7802420	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7802420G>T	uc002gje.2	+	14	2393	c.2243G>T	c.(2242-2244)CGC>CTC	p.R748L	CHD3_uc002gjd.2_Missense_Mutation_p.R807L|CHD3_uc002gjf.2_Missense_Mutation_p.R748L	NM_001005273	NP_001005273	Q12873	CHD3_HUMAN	chromodomain helicase DNA binding protein 3	748	Helicase ATP-binding.				chromatin modification|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	microtubule organizing center|NuRD complex	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding|zinc ion binding			breast(1)	1		Prostate(122;0.202)																---	---	---	---	capture		Missense_Mutation	SNP	7802420	7802420	3460	17	G	T	T	38	38	CHD3	T	1	1
MYH8	4626	broad.mit.edu	37	17	10323421	10323421	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10323421C>A	uc002gmm.2	-	3	219	c.124G>T	c.(124-126)GTG>TTG	p.V42L	uc002gml.1_Intron	NM_002472	NP_002463	P13535	MYH8_HUMAN	myosin, heavy chain 8, skeletal muscle,	42	Myosin head-like.				muscle filament sliding	cytosol|muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			skin(6)|ovary(3)|breast(2)	11														Trismus-Pseudocamptodactyly_Syndrome_with_Cardiac_Myxoma_and_Freckling				---	---	---	---	capture		Missense_Mutation	SNP	10323421	10323421	10436	17	C	A	A	17	17	MYH8	A	2	2
MAP2K3	5606	broad.mit.edu	37	17	21204287	21204287	+	Nonsense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:21204287C>G	uc002gys.2	+	5	646	c.381C>G	c.(379-381)TAC>TAG	p.Y127*	MAP2K3_uc002gyt.2_Nonsense_Mutation_p.Y98*|MAP2K3_uc002gyu.2_Nonsense_Mutation_p.Y98*	NM_145109	NP_659731	P46734	MP2K3_HUMAN	mitogen-activated protein kinase kinase 3	127	Protein kinase.				activation of MAPK activity|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of transcription, DNA-dependent|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	ATP binding|MAP kinase kinase activity|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity				0				COAD - Colon adenocarcinoma(3;0.0131)|Colorectal(15;0.0553)														---	---	---	---	capture		Nonsense_Mutation	SNP	21204287	21204287	9621	17	C	G	G	19	19	MAP2K3	G	5	3
NOS2	4843	broad.mit.edu	37	17	26114756	26114756	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26114756G>T	uc002gzu.2	-	5	679	c.415C>A	c.(415-417)CTT>ATT	p.L139I	NOS2_uc010crh.1_Missense_Mutation_p.L139I|NOS2_uc010wab.1_Missense_Mutation_p.L139I	NM_000625	NP_000616	P35228	NOS2_HUMAN	nitric oxide synthase 2A	139					arginine catabolic process|defense response to Gram-negative bacterium|innate immune response in mucosa|nitric oxide biosynthetic process|peptidyl-cysteine S-nitrosylation|platelet activation|positive regulation of killing of cells of other organism|positive regulation of leukocyte mediated cytotoxicity|regulation of cellular respiration|regulation of insulin secretion|superoxide metabolic process	cytosol|nucleus	arginine binding|calmodulin binding|flavin adenine dinucleotide binding|FMN binding|heme binding|NADP binding|nitric-oxide synthase activity|protein homodimerization activity|tetrahydrobiopterin binding			skin(2)|ovary(1)|breast(1)	4					Dexamethasone(DB01234)|Hydrocortisone(DB00741)|L-Arginine(DB00125)|L-Citrulline(DB00155)													---	---	---	---	capture		Missense_Mutation	SNP	26114756	26114756	10946	17	G	T	T	34	34	NOS2	T	2	2
ACACA	31	broad.mit.edu	37	17	35487034	35487034	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:35487034G>T	uc002hnm.2	-	46	5870	c.5679C>A	c.(5677-5679)TTC>TTA	p.F1893L	ACACA_uc002hnk.2_Missense_Mutation_p.F1815L|ACACA_uc002hnl.2_Missense_Mutation_p.F1835L|ACACA_uc002hnn.2_Missense_Mutation_p.F1893L|ACACA_uc002hno.2_Missense_Mutation_p.F1930L|ACACA_uc010cuy.2_Missense_Mutation_p.F538L|ACACA_uc010wdc.1_Missense_Mutation_p.F19L	NM_198836	NP_942133	Q13085	ACACA_HUMAN	acetyl-Coenzyme A carboxylase alpha isoform 2	1893	Carboxyltransferase.				acetyl-CoA metabolic process|energy reserve metabolic process|fatty acid biosynthetic process|long-chain fatty-acyl-CoA biosynthetic process|positive regulation of cellular metabolic process|protein homotetramerization|triglyceride biosynthetic process	cytosol	acetyl-CoA carboxylase activity|ATP binding|biotin carboxylase activity|metal ion binding|protein binding			large_intestine(1)|ovary(1)	2		Breast(25;0.00157)|Ovarian(249;0.15)			Biotin(DB00121)													---	---	---	---	capture		Missense_Mutation	SNP	35487034	35487034	107	17	G	T	T	45	45	ACACA	T	2	2
SYNRG	11276	broad.mit.edu	37	17	35913322	35913322	+	Nonsense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:35913322G>A	uc002hoa.2	-	14	2586	c.2503C>T	c.(2503-2505)CAG>TAG	p.Q835*	SYNRG_uc010wde.1_Nonsense_Mutation_p.Q757*|SYNRG_uc010wdf.1_Nonsense_Mutation_p.Q757*|SYNRG_uc002hoc.2_Nonsense_Mutation_p.Q756*|SYNRG_uc002hoe.2_Nonsense_Mutation_p.Q757*|SYNRG_uc002hod.2_Nonsense_Mutation_p.Q757*|SYNRG_uc010wdg.1_Nonsense_Mutation_p.Q674*|SYNRG_uc002hob.2_Nonsense_Mutation_p.Q835*|SYNRG_uc002hof.2_Nonsense_Mutation_p.Q547*|SYNRG_uc010cvd.1_Nonsense_Mutation_p.Q635*	NM_007247	NP_009178	Q9UMZ2	SYNRG_HUMAN	synergin, gamma isoform 1	835					endocytosis|intracellular protein transport	AP-1 adaptor complex	calcium ion binding			ovary(2)	2																		---	---	---	---	capture		Nonsense_Mutation	SNP	35913322	35913322	15981	17	G	A	A	45	45	SYNRG	A	5	2
HOXB3	3213	broad.mit.edu	37	17	46629778	46629778	+	Nonsense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:46629778G>T	uc002inn.2	-	1	459	c.59C>A	c.(58-60)TCG>TAG	p.S20*	HOXB3_uc010wlm.1_Intron|HOXB3_uc010dbf.2_Nonsense_Mutation_p.S20*|HOXB3_uc010dbg.2_Nonsense_Mutation_p.S20*|HOXB3_uc002ino.2_Nonsense_Mutation_p.S20*|HOXB3_uc010wlk.1_Intron|HOXB3_uc010wll.1_Intron	NM_002146	NP_002137	P14651	HXB3_HUMAN	homeobox B3	20					angiogenesis	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---	capture		Nonsense_Mutation	SNP	46629778	46629778	7594	17	G	T	T	37	37	HOXB3	T	5	1
HOXB13	10481	broad.mit.edu	37	17	46805521	46805521	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:46805521G>T	uc002ioa.2	-	1	591	c.435C>A	c.(433-435)GAC>GAA	p.D145E		NM_006361	NP_006352	Q92826	HXB13_HUMAN	homeobox B13	145					angiogenesis|epidermis development|response to wounding		sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	46805521	46805521	7592	17	G	T	T	40	40	HOXB13	T	1	1
KIF2B	84643	broad.mit.edu	37	17	51902221	51902221	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:51902221C>A	uc002iua.2	+	1	1983	c.1827C>A	c.(1825-1827)ACC>ACA	p.T609T	uc010wna.1_RNA	NM_032559	NP_115948	Q8N4N8	KIF2B_HUMAN	kinesin family member 2B	609					blood coagulation|cell division|microtubule depolymerization|microtubule-based movement|mitotic prometaphase|regulation of chromosome segregation	condensed chromosome kinetochore|cytosol|microtubule|microtubule organizing center|nucleolus|spindle	ATP binding|microtubule motor activity			ovary(5)|skin(3)	8																		---	---	---	---	capture		Silent	SNP	51902221	51902221	8609	17	C	A	A	21	21	KIF2B	A	2	2
KIF2B	84643	broad.mit.edu	37	17	51902243	51902243	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:51902243A>G	uc002iua.2	+	1	2005	c.1849A>G	c.(1849-1851)AGC>GGC	p.S617G	uc010wna.1_RNA	NM_032559	NP_115948	Q8N4N8	KIF2B_HUMAN	kinesin family member 2B	617					blood coagulation|cell division|microtubule depolymerization|microtubule-based movement|mitotic prometaphase|regulation of chromosome segregation	condensed chromosome kinetochore|cytosol|microtubule|microtubule organizing center|nucleolus|spindle	ATP binding|microtubule motor activity			ovary(5)|skin(3)	8																		---	---	---	---	capture		Missense_Mutation	SNP	51902243	51902243	8609	17	A	G	G	15	15	KIF2B	G	4	4
SDK2	54549	broad.mit.edu	37	17	71389744	71389744	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:71389744C>A	uc010dfm.2	-	27	3853	c.3853G>T	c.(3853-3855)GGC>TGC	p.G1285C	SDK2_uc002jjt.3_Missense_Mutation_p.G444C|SDK2_uc010dfn.2_Missense_Mutation_p.G964C	NM_001144952	NP_001138424	Q58EX2	SDK2_HUMAN	sidekick 2	1285	Fibronectin type-III 7.|Extracellular (Potential).				cell adhesion	integral to membrane				ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	71389744	71389744	14455	17	C	A	A	23	23	SDK2	A	1	1
CBX2	84733	broad.mit.edu	37	17	77757695	77757695	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:77757695G>T	uc002jxc.2	+	5	495	c.453G>T	c.(451-453)GTG>GTT	p.V151V		NM_005189	NP_005180	Q14781	CBX2_HUMAN	chromobox homolog 2 isoform 1	151					cell differentiation|chromatin modification|development of primary sexual characteristics|negative regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	PcG protein complex	DNA binding				0			OV - Ovarian serous cystadenocarcinoma(97;0.0102)|BRCA - Breast invasive adenocarcinoma(99;0.0224)															---	---	---	---	capture		Silent	SNP	77757695	77757695	2837	17	G	T	T	47	47	CBX2	T	2	2
LAMA1	284217	broad.mit.edu	37	18	6978311	6978311	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:6978311G>A	uc002knm.2	-	43	6168	c.6074C>T	c.(6073-6075)ACG>ATG	p.T2025M	LAMA1_uc010wzj.1_Missense_Mutation_p.T1501M	NM_005559	NP_005550	P25391	LAMA1_HUMAN	laminin, alpha 1 precursor	2025	Domain II and I.				axon guidance|cell adhesion|cell surface receptor linked signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	extracellular space|laminin-1 complex|laminin-3 complex	extracellular matrix structural constituent|receptor binding			ovary(8)|large_intestine(4)|upper_aerodigestive_tract(2)|breast(2)|skin(2)|pancreas(2)|central_nervous_system(1)	21		Colorectal(10;0.172)			Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---	capture		Missense_Mutation	SNP	6978311	6978311	8928	18	G	A	A	40	40	LAMA1	A	1	1
CEP192	55125	broad.mit.edu	37	18	13059268	13059268	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13059268G>A	uc010xac.1	+	21	4525	c.4445G>A	c.(4444-4446)AGC>AAC	p.S1482N	CEP192_uc010dlf.1_RNA|CEP192_uc010xad.1_Missense_Mutation_p.S1007N|CEP192_uc002kru.2_RNA|CEP192_uc002krv.2_5'UTR|CEP192_uc002krs.1_Missense_Mutation_p.S1223N	NM_032142	NP_115518	E9PF99	E9PF99_HUMAN	centrosomal protein 192kDa	1482										ovary(4)|pancreas(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	13059268	13059268	3384	18	G	A	A	34	34	CEP192	A	2	2
GALNT1	2589	broad.mit.edu	37	18	33271056	33271056	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:33271056G>A	uc010dmu.2	+	8	1112	c.1059G>A	c.(1057-1059)ACG>ACA	p.T353T	GALNT1_uc002kyz.3_Silent_p.T293T|GALNT1_uc002kzb.2_Silent_p.T353T	NM_020474	NP_065207	Q10472	GALT1_HUMAN	polypeptide N-acetylgalactosaminyltransferase 1	353	Lumenal (Potential).				protein O-linked glycosylation via serine|protein O-linked glycosylation via threonine	extracellular region|Golgi cisterna membrane|integral to membrane|perinuclear region of cytoplasm	manganese ion binding|polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			ovary(2)	2																		---	---	---	---	capture		Silent	SNP	33271056	33271056	6471	18	G	A	A	40	40	GALNT1	A	1	1
DCC	1630	broad.mit.edu	37	18	50976950	50976950	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:50976950G>C	uc002lfe.1	+	23	3897	c.3310G>C	c.(3310-3312)GTC>CTC	p.V1104L	DCC_uc010dpf.1_Missense_Mutation_p.V739L	NM_005215	NP_005206	P43146	DCC_HUMAN	netrin receptor DCC precursor	1104	Helical; (Potential).				apoptosis|induction of apoptosis|negative regulation of collateral sprouting|negative regulation of dendrite development	cytosol|integral to membrane				skin(8)|ovary(6)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	17		all_cancers(7;0.11)|all_epithelial(6;0.00126)		Colorectal(16;0.0251)|COAD - Colon adenocarcinoma(17;0.0942)														---	---	---	---	capture		Missense_Mutation	SNP	50976950	50976950	4453	18	G	C	C	44	44	DCC	C	3	3
VPS4B	9525	broad.mit.edu	37	18	61071041	61071041	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:61071041C>A	uc002lix.2	-	5	643	c.383G>T	c.(382-384)CGA>CTA	p.R128L	VPS4B_uc010dpx.2_Missense_Mutation_p.R128L|VPS4B_uc010dpy.2_Missense_Mutation_p.R10L|VPS4B_uc010dpz.1_Missense_Mutation_p.R10L	NM_004869	NP_004860	O75351	VPS4B_HUMAN	vacuolar protein sorting factor 4B	128					cell cycle|cell division|cellular membrane organization|endosome to lysosome transport via multivesicular body sorting pathway|intracellular cholesterol transport|protein transport|response to lipid	cytosol|early endosome|late endosome membrane|lysosome|nucleus|vacuolar membrane	ATP binding|ATPase activity, coupled|protein C-terminus binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	61071041	61071041	17780	18	C	A	A	31	31	VPS4B	A	1	1
RTTN	25914	broad.mit.edu	37	18	67813010	67813010	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:67813010C>T	uc002lkp.2	-	18	2387	c.2319G>A	c.(2317-2319)TCG>TCA	p.S773S	RTTN_uc002lko.2_RNA|RTTN_uc010xfb.1_5'UTR	NM_173630	NP_775901	Q86VV8	RTTN_HUMAN	rotatin	773							binding			ovary(3)|pancreas(2)|skin(1)|breast(1)|central_nervous_system(1)	8		Esophageal squamous(42;0.129)																---	---	---	---	capture		Silent	SNP	67813010	67813010	14217	18	C	T	T	27	27	RTTN	T	1	1
FBXO15	201456	broad.mit.edu	37	18	71740710	71740710	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:71740710C>A	uc002lle.2	-	10	1627	c.1291G>T	c.(1291-1293)GGG>TGG	p.G431W	FBXO15_uc002lld.2_RNA|FBXO15_uc002llf.2_Missense_Mutation_p.G507W	NM_152676	NP_689889	Q8NCQ5	FBX15_HUMAN	F-box protein 15 isoform 1	431										ovary(2)|pancreas(1)	3		Esophageal squamous(42;0.103)|Prostate(75;0.173)		BRCA - Breast invasive adenocarcinoma(31;0.143)														---	---	---	---	capture		Missense_Mutation	SNP	71740710	71740710	5965	18	C	A	A	21	21	FBXO15	A	2	2
NFATC1	4772	broad.mit.edu	37	18	77211765	77211765	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77211765G>T	uc010xfg.1	+	6	2305	c.1852G>T	c.(1852-1854)GGC>TGC	p.G618C	NFATC1_uc002lnc.1_Missense_Mutation_p.G618C|NFATC1_uc010xff.1_Silent_p.L589L|NFATC1_uc002lnd.2_Missense_Mutation_p.G618C|NFATC1_uc002lne.2_Missense_Mutation_p.G146C|NFATC1_uc010xfh.1_Missense_Mutation_p.G618C|NFATC1_uc010xfi.1_Missense_Mutation_p.G605C|NFATC1_uc010xfj.1_Missense_Mutation_p.G146C|NFATC1_uc002lnf.2_Missense_Mutation_p.G605C|NFATC1_uc002lng.2_Missense_Mutation_p.G605C|NFATC1_uc010xfk.1_Missense_Mutation_p.G605C	NM_006162	NP_006153	O95644	NFAC1_HUMAN	nuclear factor of activated T-cells, cytosolic	618					intracellular signal transduction|positive regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	cytoplasm|nucleus	FK506 binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			large_intestine(1)|ovary(1)	2		Esophageal squamous(42;0.0157)|Melanoma(33;0.144)		OV - Ovarian serous cystadenocarcinoma(15;3.73e-07)|BRCA - Breast invasive adenocarcinoma(31;0.0257)														---	---	---	---	capture		Missense_Mutation	SNP	77211765	77211765	10761	18	G	T	T	47	47	NFATC1	T	2	2
GRIN3B	116444	broad.mit.edu	37	19	1008638	1008638	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1008638C>A	uc002lqo.1	+	7	2488	c.2488C>A	c.(2488-2490)CAC>AAC	p.H830N	uc002lqp.1_RNA	NM_138690	NP_619635	O60391	NMD3B_HUMAN	glutamate receptor, ionotropic,	830	Extracellular (Potential).				ionotropic glutamate receptor signaling pathway|protein insertion into membrane|regulation of calcium ion transport	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|neuronal cell body|outer membrane-bounded periplasmic space|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|glycine binding|ionotropic glutamate receptor activity|neurotransmitter receptor activity				0		Acute lymphoblastic leukemia(61;4.36e-14)|all_hematologic(61;4.84e-09)|Lung NSC(49;0.000226)|all_lung(49;0.000353)|Breast(49;0.00066)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)	Glycine(DB00145)|L-Glutamic Acid(DB00142)|Orphenadrine(DB01173)													---	---	---	---	capture		Missense_Mutation	SNP	1008638	1008638	7063	19	C	A	A	21	21	GRIN3B	A	2	2
PCSK4	54760	broad.mit.edu	37	19	1483315	1483315	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1483315G>A	uc002ltb.1	-	12	1601	c.1539C>T	c.(1537-1539)CCC>CCT	p.P513P	PCSK4_uc002lsz.2_5'UTR|PCSK4_uc002lta.2_Silent_p.P325P	NM_017573	NP_060043	Q6UW60	PCSK4_HUMAN	proprotein convertase subtilisin/kexin type 4	513					proteolysis	integral to membrane	serine-type endopeptidase activity				0		Acute lymphoblastic leukemia(61;3.02e-13)|all_hematologic(61;4.32e-09)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Silent	SNP	1483315	1483315	12023	19	G	A	A	47	47	PCSK4	A	2	2
ZNF554	115196	broad.mit.edu	37	19	2834379	2834379	+	Silent	SNP	C	T	T	rs151263242	by1000genomes	TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2834379C>T	uc002lwm.2	+	5	1344	c.1146C>T	c.(1144-1146)TGC>TGT	p.C382C	ZNF554_uc002lwl.2_Silent_p.C331C	NM_001102651	NP_001096121	Q86TJ5	ZN554_HUMAN	zinc finger protein 554	382	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Silent	SNP	2834379	2834379	18580	19	C	T	T	27	27	ZNF554	T	1	1
TIMM44	10469	broad.mit.edu	37	19	7997724	7997724	+	Splice_Site	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7997724C>G	uc002miz.2	-	8	864	c.862_splice	c.e8+1	p.G288_splice	TIMM44_uc002mja.2_Splice_Site_p.G28_splice|TIMM44_uc010dvx.1_Splice_Site	NM_006351	NP_006342			translocase of inner mitochondrial membrane 44						protein targeting to mitochondrion	mitochondrial inner membrane presequence translocase complex|mitochondrial matrix	ATP binding|P-P-bond-hydrolysis-driven protein transmembrane transporter activity			ovary(1)	1																		---	---	---	---	capture		Splice_Site	SNP	7997724	7997724	16441	19	C	G	G	18	18	TIMM44	G	5	3
MUC16	94025	broad.mit.edu	37	19	9000454	9000454	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9000454G>T	uc002mkp.2	-	54	40734	c.40530C>A	c.(40528-40530)GTC>GTA	p.V13510V	MUC16_uc010dwi.2_RNA|MUC16_uc010dwj.2_Silent_p.V327V|MUC16_uc010xki.1_RNA	NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	13512	SEA 10.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---	capture		Silent	SNP	9000454	9000454	10367	19	G	T	T	41	41	MUC16	T	2	2
MUC16	94025	broad.mit.edu	37	19	9006411	9006411	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9006411G>A	uc002mkp.2	-	45	39811	c.39607C>T	c.(39607-39609)CTC>TTC	p.L13203F	MUC16_uc010dwi.2_RNA|MUC16_uc010dwj.2_Missense_Mutation_p.L20F|MUC16_uc010xki.1_Intron	NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	13205	SEA 8.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---	capture		Missense_Mutation	SNP	9006411	9006411	10367	19	G	A	A	34	34	MUC16	A	2	2
MUC16	94025	broad.mit.edu	37	19	9065064	9065064	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9065064G>T	uc002mkp.2	-	3	22586	c.22382C>A	c.(22381-22383)ACC>AAC	p.T7461N		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	7463	Ser-rich.|Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---	capture		Missense_Mutation	SNP	9065064	9065064	10367	19	G	T	T	44	44	MUC16	T	2	2
OR7D4	125958	broad.mit.edu	37	19	9325318	9325318	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9325318G>T	uc002mla.1	-	1	196	c.196C>A	c.(196-198)CTG>ATG	p.L66M		NM_001005191	NP_001005191	Q8NG98	OR7D4_HUMAN	olfactory receptor, family 7, subfamily D,	66	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|central_nervous_system(1)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	9325318	9325318	11631	19	G	T	T	35	35	OR7D4	T	2	2
CALR	811	broad.mit.edu	37	19	13049502	13049502	+	Silent	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:13049502A>G	uc002mvu.2	+	1	89	c.9A>G	c.(7-9)CTA>CTG	p.L3L		NM_004343	NP_004334	P27797	CALR_HUMAN	calreticulin precursor	3					cell cycle arrest|cellular senescence|glucocorticoid receptor signaling pathway|negative regulation of neuron differentiation|negative regulation of retinoic acid receptor signaling pathway|negative regulation of steroid hormone receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|negative regulation of translation|peptide antigen assembly with MHC class I protein complex|positive regulation of cell cycle|positive regulation of cell proliferation|positive regulation of DNA replication|positive regulation of phagocytosis|post-translational protein modification|protein export from nucleus|protein maturation by protein folding|protein N-linked glycosylation via asparagine|protein stabilization|regulation of apoptosis|sequestering of calcium ion	cytosol|endoplasmic reticulum lumen|extracellular space|MHC class I peptide loading complex|nucleus|perinuclear region of cytoplasm|polysome|proteinaceous extracellular matrix	androgen receptor binding|calcium ion binding|chaperone binding|complement component C1q binding|DNA binding|integrin binding|mRNA binding|protein binding involved in protein folding|sugar binding|ubiquitin protein ligase binding|unfolded protein binding|zinc ion binding			ovary(1)	1					Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Reteplase(DB00015)|Tenecteplase(DB00031)											OREG0025278	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	13049502	13049502	2709	19	A	G	G	16	16	CALR	G	4	4
IL27RA	9466	broad.mit.edu	37	19	14159970	14159970	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:14159970C>T	uc002mxx.2	+	10	1669	c.1246C>T	c.(1246-1248)CCC>TCC	p.P416S		NM_004843	NP_004834	Q6UWB1	I27RA_HUMAN	class I cytokine receptor precursor	416	Extracellular (Potential).|Fibronectin type-III 3.				cell surface receptor linked signaling pathway|immune response	integral to plasma membrane	transmembrane receptor activity				0																OREG0025303	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	14159970	14159970	7982	19	C	T	T	18	18	IL27RA	T	2	2
OR10H5	284433	broad.mit.edu	37	19	15905094	15905094	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15905094C>G	uc010xos.1	+	1	236	c.236C>G	c.(235-237)CCG>CGG	p.P79R		NM_001004466	NP_001004466	Q8NGA6	O10H5_HUMAN	olfactory receptor, family 10, subfamily H,	79	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	15905094	15905094	11315	19	C	G	G	23	23	OR10H5	G	3	3
LRRC25	126364	broad.mit.edu	37	19	18507777	18507777	+	Translation_Start_Site	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:18507777A>T	uc002niw.2	-	1	639	c.-3T>A	c.(-5--1)GCTTG>GCATG		LRRC25_uc002nix.2_Translation_Start_Site	NM_145256	NP_660299			leucine rich repeat containing 25 precursor							integral to membrane					0																		---	---	---	---	capture		Translation_Start_Site	SNP	18507777	18507777	9354	19	A	T	T	3	3	LRRC25	T	4	4
ZNF676	163223	broad.mit.edu	37	19	22364156	22364156	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22364156G>T	uc002nqs.1	-	3	681	c.363C>A	c.(361-363)GTC>GTA	p.V121V		NM_001001411	NP_001001411	Q8N7Q3	ZN676_HUMAN	zinc finger protein 676	121					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Lung NSC(12;0.0207)|all_lung(12;0.0214)|all_epithelial(12;0.114)																---	---	---	---	capture		Silent	SNP	22364156	22364156	18678	19	G	T	T	33	33	ZNF676	T	2	2
C19orf2	8725	broad.mit.edu	37	19	30500150	30500150	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:30500150G>T	uc002nsr.2	+	8	955	c.925G>T	c.(925-927)GAC>TAC	p.D309Y	C19orf2_uc002nsq.2_Missense_Mutation_p.D291Y|C19orf2_uc002nss.2_Missense_Mutation_p.D269Y|C19orf2_uc002nst.2_Missense_Mutation_p.D233Y	NM_003796	NP_003787	O94763	RMP_HUMAN	RPB5-mediating protein isoform a	309	Poly-Asp.				protein folding|regulation of transcription from RNA polymerase II promoter|response to virus	DNA-directed RNA polymerase II, core complex|prefoldin complex	transcription corepressor activity|unfolded protein binding			ovary(1)|kidney(1)	2	Ovarian(5;0.000902)|Breast(6;0.0203)|Esophageal squamous(110;0.195)	Hepatocellular(1079;0.137)|Renal(1328;0.228)	STAD - Stomach adenocarcinoma(5;5.36e-06)|Lung(7;0.0144)|LUAD - Lung adenocarcinoma(5;0.115)	STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Missense_Mutation	SNP	30500150	30500150	1973	19	G	T	T	37	37	C19orf2	T	1	1
ZNF536	9745	broad.mit.edu	37	19	30935706	30935706	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:30935706G>T	uc002nsu.1	+	2	1375	c.1237G>T	c.(1237-1239)GTG>TTG	p.V413L	ZNF536_uc010edd.1_Missense_Mutation_p.V413L	NM_014717	NP_055532	O15090	ZN536_HUMAN	zinc finger protein 536	413					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(7)|large_intestine(2)|skin(2)	11	Esophageal squamous(110;0.0834)																	---	---	---	---	capture		Missense_Mutation	SNP	30935706	30935706	18568	19	G	T	T	48	48	ZNF536	T	2	2
FXYD1	5348	broad.mit.edu	37	19	35632052	35632052	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35632052G>T	uc002nyc.2	+	4	182	c.111G>T	c.(109-111)CAG>CAT	p.Q37H	LGI4_uc002nxy.1_Intron|FXYD1_uc002nyb.1_RNA|FXYD1_uc002nyd.2_Missense_Mutation_p.Q37H|FXYD7_uc010xsp.1_5'Flank|FXYD7_uc002nye.1_5'Flank|FXYD7_uc002nyf.1_5'Flank	NM_021902	NP_068702	O00168	PLM_HUMAN	phospholemman precursor	37	Helical; (Potential).				muscle contraction	chloride channel complex|integral to plasma membrane	chloride channel activity				0	all_lung(56;7.56e-09)|Lung NSC(56;1.1e-08)|Esophageal squamous(110;0.162)		Epithelial(14;2.32e-21)|OV - Ovarian serous cystadenocarcinoma(14;3.17e-20)|all cancers(14;2.43e-18)|LUSC - Lung squamous cell carcinoma(66;0.0849)															---	---	---	---	capture		Missense_Mutation	SNP	35632052	35632052	6368	19	G	T	T	33	33	FXYD1	T	2	2
ZNF540	163255	broad.mit.edu	37	19	38103481	38103481	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38103481A>T	uc002ogq.2	+	5	1632	c.1300A>T	c.(1300-1302)ACT>TCT	p.T434S	ZNF540_uc002ogu.2_Missense_Mutation_p.T434S|ZNF540_uc010efq.2_Missense_Mutation_p.T402S	NM_152606	NP_689819	Q8NDQ6	ZN540_HUMAN	zinc finger protein 540	434					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			large_intestine(1)	1			COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)															---	---	---	---	capture		Missense_Mutation	SNP	38103481	38103481	18569	19	A	T	T	14	14	ZNF540	T	4	4
ZNF607	84775	broad.mit.edu	37	19	38189147	38189147	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38189147C>A	uc002ohc.1	-	5	2481	c.1885G>T	c.(1885-1887)GCC>TCC	p.A629S	ZNF607_uc002ohb.1_Missense_Mutation_p.A628S	NM_032689	NP_116078	Q96SK3	ZN607_HUMAN	zinc finger protein 607	629	C2H2-type 18.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0			UCEC - Uterine corpus endometrioid carcinoma (49;0.0775)															---	---	---	---	capture		Missense_Mutation	SNP	38189147	38189147	18628	19	C	A	A	25	25	ZNF607	A	2	2
FCGBP	8857	broad.mit.edu	37	19	40367841	40367841	+	Silent	SNP	T	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40367841T>G	uc002omp.3	-	29	13127	c.13119A>C	c.(13117-13119)GCA>GCC	p.A4373A		NM_003890	NP_003881	Q9Y6R7	FCGBP_HUMAN	Fc fragment of IgG binding protein precursor	4373	TIL 10.					extracellular region	protein binding			ovary(4)|skin(4)|central_nervous_system(1)	9	all_cancers(60;6.03e-06)|all_lung(34;5.58e-08)|Lung NSC(34;6.62e-08)|Ovarian(47;0.06)		Epithelial(26;6.25e-23)|all cancers(26;1.13e-20)															---	---	---	---	capture		Silent	SNP	40367841	40367841	6015	19	T	G	G	59	59	FCGBP	G	4	4
ZNF780A	284323	broad.mit.edu	37	19	40581570	40581570	+	Missense_Mutation	SNP	C	T	T	rs143775764	by1000genomes	TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40581570C>T	uc002omy.2	-	6	1004	c.779G>A	c.(778-780)CGT>CAT	p.R260H	ZNF780A_uc002omw.3_Intron|ZNF780A_uc002omz.2_Missense_Mutation_p.R260H|ZNF780A_uc010xvh.1_Missense_Mutation_p.R261H	NM_001010880	NP_001010880	O75290	Z780A_HUMAN	zinc finger protein 780A isoform b	260	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(60;9.55e-06)|all_lung(34;1.17e-07)|Lung NSC(34;1.41e-07)|Ovarian(47;0.0925)																	---	---	---	---	capture		Missense_Mutation	SNP	40581570	40581570	18750	19	C	T	T	19	19	ZNF780A	T	1	1
ATP1A3	478	broad.mit.edu	37	19	42485656	42485656	+	Nonsense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42485656G>A	uc002osg.2	-	11	1589	c.1435C>T	c.(1435-1437)CAG>TAG	p.Q479*	ATP1A3_uc010xwf.1_Nonsense_Mutation_p.Q490*|ATP1A3_uc010xwg.1_Nonsense_Mutation_p.Q449*|ATP1A3_uc010xwh.1_Nonsense_Mutation_p.Q492*|ATP1A3_uc002osh.2_Nonsense_Mutation_p.Q479*	NM_152296	NP_689509	P13637	AT1A3_HUMAN	Na+/K+ -ATPase alpha 3 subunit	479	Cytoplasmic (Potential).				ATP biosynthetic process	endoplasmic reticulum|Golgi apparatus	ATP binding|metal ion binding|sodium:potassium-exchanging ATPase activity			ovary(1)|pancreas(1)	2																		---	---	---	---	capture		Nonsense_Mutation	SNP	42485656	42485656	1149	19	G	A	A	47	47	ATP1A3	A	5	2
ZNF233	353355	broad.mit.edu	37	19	44777881	44777881	+	Nonsense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44777881T>A	uc002oyz.1	+	5	1195	c.1068T>A	c.(1066-1068)TGT>TGA	p.C356*	ZNF235_uc002oyx.1_Intron|ZNF235_uc010eji.2_Intron|ZNF233_uc002oyy.1_Nonsense_Mutation_p.C171*	NM_181756	NP_861421	A6NK53	ZN233_HUMAN	zinc finger protein 233	356	C2H2-type 3; degenerate.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(2)	2		Prostate(69;0.0435)|all_neural(266;0.226)																---	---	---	---	capture		Nonsense_Mutation	SNP	44777881	44777881	18377	19	T	A	A	58	58	ZNF233	A	5	4
APOC1	341	broad.mit.edu	37	19	45422442	45422442	+	Silent	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45422442A>T	uc002pac.1	+	5	459	c.207A>T	c.(205-207)TCA>TCT	p.S69S	APOC1_uc002pad.1_Silent_p.S69S|APOC1_uc002pae.1_Silent_p.S69S|APOC1_uc002paf.1_RNA	NM_001645	NP_001636	P02654	APOC1_HUMAN	apolipoprotein C-I precursor	69					cholesterol efflux|chylomicron remnant clearance|high-density lipoprotein particle remodeling|lipoprotein metabolic process|negative regulation of cholesterol transport|negative regulation of fatty acid biosynthetic process|negative regulation of lipoprotein lipase activity|negative regulation of phosphatidylcholine catabolic process|negative regulation of receptor-mediated endocytosis|negative regulation of very-low-density lipoprotein particle clearance|phospholipid efflux|positive regulation of cholesterol esterification|very-low-density lipoprotein particle assembly|very-low-density lipoprotein particle clearance	chylomicron|endoplasmic reticulum|high-density lipoprotein particle|very-low-density lipoprotein particle	fatty acid binding|phosphatidylcholine binding|phosphatidylcholine-sterol O-acyltransferase activator activity|phospholipase inhibitor activity				0	Lung NSC(12;0.0018)|all_lung(12;0.00481)	Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.00327)|Epithelial(262;0.174)														---	---	---	---	capture		Silent	SNP	45422442	45422442	808	19	A	T	T	7	7	APOC1	T	4	4
SFRS16	11129	broad.mit.edu	37	19	45567390	45567390	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45567390C>T	uc002pak.2	+	12	1124	c.1026C>T	c.(1024-1026)GCC>GCT	p.A342A	SFRS16_uc002pal.2_RNA|SFRS16_uc010xxh.1_Silent_p.A280A|SFRS16_uc002pam.2_Silent_p.A342A|SFRS16_uc002pan.1_RNA	NM_007056	NP_008987	Q8N2M8	CLASR_HUMAN	splicing factor, arginine/serine-rich 16	342					mRNA processing|RNA splicing	nucleus					0		Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0102)														---	---	---	---	capture		Silent	SNP	45567390	45567390	14662	19	C	T	T	23	23	SFRS16	T	1	1
NUCB1	4924	broad.mit.edu	37	19	49422505	49422505	+	Nonsense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49422505C>T	uc002plb.3	+	10	1036	c.964C>T	c.(964-966)CAG>TAG	p.Q322*	NUCB1_uc002pla.2_Nonsense_Mutation_p.Q322*|NUCB1_uc002plc.2_Nonsense_Mutation_p.Q322*|NUCB1_uc002pld.2_5'UTR	NM_006184	NP_006175	Q02818	NUCB1_HUMAN	nucleobindin 1 precursor	322	EF-hand 2.					ER-Golgi intermediate compartment|extracellular space|Golgi apparatus|membrane|microtubule cytoskeleton	calcium ion binding|DNA binding				0		all_lung(116;4.89e-05)|Lung NSC(112;8.3e-05)|all_epithelial(76;8.64e-05)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.000171)|all cancers(93;0.000333)|Epithelial(262;0.0174)|GBM - Glioblastoma multiforme(486;0.0244)														---	---	---	---	capture		Nonsense_Mutation	SNP	49422505	49422505	11123	19	C	T	T	29	29	NUCB1	T	5	2
ALDH16A1	126133	broad.mit.edu	37	19	49962966	49962966	+	Nonsense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49962966G>A	uc002pnt.2	+	4	476	c.360G>A	c.(358-360)TGG>TGA	p.W120*	ALDH16A1_uc010yar.1_Nonsense_Mutation_p.W120*|ALDH16A1_uc010yas.1_5'UTR|ALDH16A1_uc010yat.1_Intron	NM_153329	NP_699160	Q8IZ83	A16A1_HUMAN	aldehyde dehydrogenase 16 family, member A1	120							oxidoreductase activity|protein binding			skin(1)	1		all_lung(116;5.39e-06)|Lung NSC(112;1.97e-05)|all_neural(266;0.0966)|Ovarian(192;0.15)		OV - Ovarian serous cystadenocarcinoma(262;0.00156)|GBM - Glioblastoma multiforme(486;0.0251)														---	---	---	---	capture		Nonsense_Mutation	SNP	49962966	49962966	491	19	G	A	A	41	41	ALDH16A1	A	5	2
MED25	81857	broad.mit.edu	37	19	50331706	50331706	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50331706G>C	uc002ppw.1	+	4	359	c.306G>C	c.(304-306)AAG>AAC	p.K102N	MED25_uc010ybe.1_Intron|MED25_uc002ppx.1_5'Flank	NM_030973	NP_112235	Q71SY5	MED25_HUMAN	mediator complex subunit 25	102	Interaction with the Mediator complex.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm				ovary(1)	1		all_lung(116;3.24e-07)|Lung NSC(112;1.6e-06)|all_neural(266;0.0459)|Ovarian(192;0.0728)		OV - Ovarian serous cystadenocarcinoma(262;0.00822)|GBM - Glioblastoma multiforme(134;0.0122)														---	---	---	---	capture		Missense_Mutation	SNP	50331706	50331706	9832	19	G	C	C	44	44	MED25	C	3	3
SYT3	84258	broad.mit.edu	37	19	51140631	51140631	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:51140631G>T	uc002pst.2	-	1	672	c.38C>A	c.(37-39)GCA>GAA	p.A13E	SYT3_uc002psv.2_Missense_Mutation_p.A13E|SYT3_uc010ycd.1_Missense_Mutation_p.A13E	NM_032298	NP_115674	Q9BQG1	SYT3_HUMAN	synaptotagmin III	13	Vesicular (Potential).					cell junction|endosome|integral to membrane|synaptic vesicle membrane	metal ion binding|transporter activity			ovary(2)|breast(1)	3		all_neural(266;0.131)		OV - Ovarian serous cystadenocarcinoma(262;0.00462)|GBM - Glioblastoma multiforme(134;0.0188)														---	---	---	---	capture		Missense_Mutation	SNP	51140631	51140631	15996	19	G	T	T	46	46	SYT3	T	2	2
VN1R4	317703	broad.mit.edu	37	19	53770079	53770079	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53770079G>T	uc010ydu.1	-	1	840	c.840C>A	c.(838-840)CTC>CTA	p.L280L		NM_173857	NP_776256	Q7Z5H5	VN1R4_HUMAN	vomeronasal 1 receptor 4	280	Helical; Name=7; (Potential).				response to pheromone	actin cytoskeleton|cytoplasm|integral to membrane|plasma membrane	pheromone receptor activity			ovary(2)	2				GBM - Glioblastoma multiforme(134;0.00294)											HNSCC(26;0.072)			---	---	---	---	capture		Silent	SNP	53770079	53770079	17747	19	G	T	T	45	45	VN1R4	T	2	2
LILRB1	10859	broad.mit.edu	37	19	55144088	55144088	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55144088C>A	uc002qgj.2	+	7	1175	c.835C>A	c.(835-837)CAG>AAG	p.Q279K	LILRB1_uc010erp.1_Intron|LILRB1_uc002qgl.2_Missense_Mutation_p.Q279K|LILRB1_uc002qgk.2_Missense_Mutation_p.Q279K|LILRB1_uc002qgm.2_Missense_Mutation_p.Q279K|LILRB1_uc010erq.2_Missense_Mutation_p.Q279K|LILRB1_uc010err.2_RNA	NM_006669	NP_006660	Q8NHL6	LIRB1_HUMAN	leukocyte immunoglobulin-like receptor,	279	Ig-like C2-type 3.|Extracellular (Potential).				regulation of immune response|response to virus	integral to membrane|plasma membrane	protein phosphatase 1 binding|receptor activity			large_intestine(1)|ovary(1)|skin(1)	3				GBM - Glioblastoma multiforme(193;0.0188)											HNSCC(37;0.09)			---	---	---	---	capture		Missense_Mutation	SNP	55144088	55144088	9116	19	C	A	A	21	21	LILRB1	A	2	2
SBK2	646643	broad.mit.edu	37	19	56042609	56042609	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56042609G>A	uc010ygc.1	-	2	357	c.357C>T	c.(355-357)ATC>ATT	p.I119I		NM_001101401	NP_001094871	P0C263	SBK2_HUMAN	SH3-binding domain kinase family, member 2	119	Protein kinase.						ATP binding|protein serine/threonine kinase activity				0																		---	---	---	---	capture		Silent	SNP	56042609	56042609	14342	19	G	A	A	37	37	SBK2	A	1	1
ZNF773	374928	broad.mit.edu	37	19	58017855	58017855	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58017855G>A	uc002qox.2	+	4	532	c.392G>A	c.(391-393)AGG>AAG	p.R131K	ZNF547_uc002qpm.3_Intron|ZNF773_uc002qoy.2_Missense_Mutation_p.R130K|ZNF773_uc002qoz.2_Intron	NM_198542	NP_940944	Q6PK81	ZN773_HUMAN	zinc finger protein 773	131					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.221)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0254)														---	---	---	---	capture		Missense_Mutation	SNP	58017855	58017855	18744	19	G	A	A	35	35	ZNF773	A	2	2
ZNF256	10172	broad.mit.edu	37	19	58453295	58453295	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58453295G>T	uc002qqu.2	-	3	1116	c.881C>A	c.(880-882)CCT>CAT	p.P294H	ZNF256_uc010euj.2_Missense_Mutation_p.P141H	NM_005773	NP_005764	Q9Y2P7	ZN256_HUMAN	zinc finger protein 256	294					multicellular organismal development|negative regulation of transcription, DNA-dependent	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			upper_aerodigestive_tract(1)|skin(1)	2		Colorectal(82;5.46e-05)|all_neural(62;0.0218)|Breast(46;0.0389)|Ovarian(87;0.0443)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0155)														---	---	---	---	capture		Missense_Mutation	SNP	58453295	58453295	18390	19	G	T	T	35	35	ZNF256	T	2	2
ZSCAN1	284312	broad.mit.edu	37	19	58549348	58549348	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58549348G>T	uc002qrc.1	+	3	391	c.144G>T	c.(142-144)GTG>GTT	p.V48V	ZSCAN1_uc002qra.1_Silent_p.V48V|ZSCAN1_uc002qrb.1_Silent_p.V48V	NM_182572	NP_872378	Q8NBB4	ZSCA1_HUMAN	zinc finger and SCAN domain containing 1	48	SCAN box.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2		Colorectal(82;5.46e-05)|all_neural(62;0.0182)|Breast(46;0.0389)|Ovarian(87;0.0443)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0152)														---	---	---	---	capture		Silent	SNP	58549348	58549348	18830	19	G	T	T	47	47	ZSCAN1	T	2	2
SNTG2	54221	broad.mit.edu	37	2	1079263	1079263	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1079263G>T	uc002qwq.2	+	2	260	c.132G>T	c.(130-132)CGG>CGT	p.R44R	SNTG2_uc002qwp.2_RNA|SNTG2_uc010ewi.2_Silent_p.R44R	NM_018968	NP_061841	Q9NY99	SNTG2_HUMAN	syntrophin, gamma 2	44					central nervous system development	cytoplasm|cytoskeleton|sarcolemma|syntrophin complex	actin binding|PDZ domain binding			ovary(1)|large_intestine(1)|breast(1)	3	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.00469)		all cancers(51;0.0178)|OV - Ovarian serous cystadenocarcinoma(76;0.07)|Epithelial(75;0.0864)|GBM - Glioblastoma multiforme(21;0.173)														---	---	---	---	capture		Silent	SNP	1079263	1079263	15375	2	G	T	T	42	42	SNTG2	T	2	2
SNTG2	54221	broad.mit.edu	37	2	1251115	1251115	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1251115G>T	uc002qwq.2	+	12	1033	c.905G>T	c.(904-906)TGG>TTG	p.W302L	SNTG2_uc010ewi.2_Missense_Mutation_p.W175L	NM_018968	NP_061841	Q9NY99	SNTG2_HUMAN	syntrophin, gamma 2	302	PH.				central nervous system development	cytoplasm|cytoskeleton|sarcolemma|syntrophin complex	actin binding|PDZ domain binding			ovary(1)|large_intestine(1)|breast(1)	3	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.00469)		all cancers(51;0.0178)|OV - Ovarian serous cystadenocarcinoma(76;0.07)|Epithelial(75;0.0864)|GBM - Glioblastoma multiforme(21;0.173)														---	---	---	---	capture		Missense_Mutation	SNP	1251115	1251115	15375	2	G	T	T	47	47	SNTG2	T	2	2
KLF11	8462	broad.mit.edu	37	2	10188590	10188590	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:10188590A>T	uc002raf.1	+	3	1288	c.1126A>T	c.(1126-1128)ATC>TTC	p.I376F	KLF11_uc010yjc.1_Missense_Mutation_p.I359F	NM_003597	NP_003588	O14901	KLF11_HUMAN	Kruppel-like factor 11	376					apoptosis|negative regulation of cell proliferation|negative regulation of transcription from RNA polymerase II promoter|positive regulation of apoptosis|regulation of transcription involved in S phase of mitotic cell cycle	nucleus	sequence-specific DNA binding RNA polymerase II transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(2)	2	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.133)|OV - Ovarian serous cystadenocarcinoma(76;0.228)												OREG0014425	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	10188590	10188590	8651	2	A	T	T	8	8	KLF11	T	4	4
NTSR2	23620	broad.mit.edu	37	2	11802343	11802343	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:11802343C>A	uc002rbq.3	-	2	722	c.648G>T	c.(646-648)GTG>GTT	p.V216V		NM_012344	NP_036476	O95665	NTR2_HUMAN	neurotensin receptor 2	216	Extracellular (Potential).				sensory perception	integral to plasma membrane					0	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.129)|OV - Ovarian serous cystadenocarcinoma(76;0.24)	Levocabastine(DB01106)													---	---	---	---	capture		Silent	SNP	11802343	11802343	11116	2	C	A	A	25	25	NTSR2	A	2	2
VSNL1	7447	broad.mit.edu	37	2	17773402	17773402	+	Nonsense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:17773402G>T	uc002rcm.2	+	2	445	c.61G>T	c.(61-63)GAG>TAG	p.E21*		NM_003385	NP_003376	P62760	VISL1_HUMAN	visinin-like 1	21							calcium ion binding			ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.158)																	---	---	---	---	capture		Nonsense_Mutation	SNP	17773402	17773402	17795	2	G	T	T	33	33	VSNL1	T	5	2
APOB	338	broad.mit.edu	37	2	21229833	21229833	+	Nonsense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:21229833C>A	uc002red.2	-	26	10035	c.9907G>T	c.(9907-9909)GAG>TAG	p.E3303*		NM_000384	NP_000375	P04114	APOB_HUMAN	apolipoprotein B precursor	3303					cholesterol homeostasis|cholesterol metabolic process|leukocyte migration|low-density lipoprotein particle clearance|low-density lipoprotein particle remodeling|platelet activation|positive regulation of cholesterol storage|positive regulation of macrophage derived foam cell differentiation|receptor-mediated endocytosis|response to virus	chylomicron remnant|clathrin-coated endocytic vesicle membrane|endoplasmic reticulum lumen|endoplasmic reticulum membrane|endosome lumen|endosome membrane|intermediate-density lipoprotein particle|low-density lipoprotein particle|mature chylomicron|microsome|plasma membrane|very-low-density lipoprotein particle	cholesterol transporter activity|enzyme binding|heparin binding|low-density lipoprotein particle receptor binding|phospholipid binding|protein heterodimerization activity			ovary(11)|skin(9)|central_nervous_system(3)|large_intestine(2)|upper_aerodigestive_tract(1)|pancreas(1)	27	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				Atorvastatin(DB01076)													---	---	---	---	capture		Nonsense_Mutation	SNP	21229833	21229833	796	2	C	A	A	32	32	APOB	A	5	2
RAB10	10890	broad.mit.edu	37	2	26350784	26350784	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:26350784G>A	uc002rgv.2	+	5	1232	c.483G>A	c.(481-483)AAG>AAA	p.K161K		NM_016131	NP_057215	P61026	RAB10_HUMAN	ras-related GTP-binding protein RAB10	161					protein transport|small GTPase mediated signal transduction	plasma membrane	GTP binding|protein binding			ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---	capture		Silent	SNP	26350784	26350784	13349	2	G	A	A	35	35	RAB10	A	2	2
BIRC6	57448	broad.mit.edu	37	2	32820204	32820204	+	Silent	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32820204A>G	uc010ezu.2	+	68	13739	c.13605A>G	c.(13603-13605)TTA>TTG	p.L4535L		NM_016252	NP_057336	Q9NR09	BIRC6_HUMAN	baculoviral IAP repeat-containing 6	4535					anti-apoptosis|apoptosis	intracellular	acid-amino acid ligase activity|cysteine-type endopeptidase inhibitor activity|protein binding			ovary(5)|skin(4)|lung(2)|central_nervous_system(1)|breast(1)|pancreas(1)	14	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---	capture		Silent	SNP	32820204	32820204	1463	2	A	G	G	14	14	BIRC6	G	4	4
CALM2	805	broad.mit.edu	37	2	47388885	47388885	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:47388885C>G	uc002rvt.2	-	5	556	c.398G>C	c.(397-399)GGT>GCT	p.G133A	C2orf61_uc010fbd.2_Intron|CALM2_uc010fbe.2_RNA	NM_001743	NP_001734	P62158	CALM_HUMAN	calmodulin 2	133	4.|EF-hand 4.				activation of phospholipase C activity|G-protein coupled receptor protein signaling pathway|glucose metabolic process|glycogen catabolic process|muscle contraction|negative regulation of ryanodine-sensitive calcium-release channel activity|nerve growth factor receptor signaling pathway|nitric oxide metabolic process|platelet activation|platelet degranulation|positive regulation of ryanodine-sensitive calcium-release channel activity|regulation of cytokinesis|regulation of nitric-oxide synthase activity|regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to calcium ion|synaptic transmission	centrosome|cytosol|extracellular region|nucleoplasm|plasma membrane|spindle microtubule|spindle pole	calcium ion binding|N-terminal myristoylation domain binding|phospholipase binding|protein domain specific binding|thioesterase binding|titin binding	p.0?(2)			0		all_hematologic(82;0.166)|Acute lymphoblastic leukemia(82;0.17)	Lung(47;0.0792)|LUSC - Lung squamous cell carcinoma(58;0.114)		Aprindine(DB01429)|Bepridil(DB01244)|Dibucaine(DB00527)|Felodipine(DB01023)|Flunarizine(DB04841)|Fluphenazine(DB00623)|Isoflurane(DB00753)|Loperamide(DB00836)|Miconazole(DB01110)|Perphenazine(DB00850)|Phenoxybenzamine(DB00925)|Pimozide(DB01100)|Promethazine(DB01069)													---	---	---	---	capture		Missense_Mutation	SNP	47388885	47388885	2702	2	C	G	G	18	18	CALM2	G	3	3
VRK2	7444	broad.mit.edu	37	2	58312046	58312046	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:58312046G>C	uc002rzo.2	+	7	962	c.217G>C	c.(217-219)GAA>CAA	p.E73Q	VRK2_uc010fcb.2_Missense_Mutation_p.E73Q|VRK2_uc002rzs.2_Missense_Mutation_p.E73Q|VRK2_uc002rzr.2_Missense_Mutation_p.E73Q|VRK2_uc010fcc.2_Intron|VRK2_uc002rzv.2_Missense_Mutation_p.E73Q|VRK2_uc010fcd.2_Missense_Mutation_p.E50Q|VRK2_uc002rzp.2_Missense_Mutation_p.E73Q|VRK2_uc010ypg.1_Missense_Mutation_p.E73Q|VRK2_uc002rzq.2_Missense_Mutation_p.E73Q|VRK2_uc002rzu.2_Missense_Mutation_p.E73Q|VRK2_uc002rzt.2_5'UTR|VRK2_uc010yph.1_5'Flank	NM_001130482	NP_001123954	Q86Y07	VRK2_HUMAN	vaccinia related kinase 2 isoform 2	73	Protein kinase.					integral to membrane	ATP binding|protein binding|protein serine/threonine kinase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	58312046	58312046	17787	2	G	C	C	33	33	VRK2	C	3	3
C2orf86	51057	broad.mit.edu	37	2	63609202	63609202	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:63609202A>G	uc002sch.2	-	11	1909	c.1463T>C	c.(1462-1464)CTG>CCG	p.L488P	C2orf86_uc002sce.2_RNA|C2orf86_uc002scf.2_Missense_Mutation_p.L329P|C2orf86_uc010ypu.1_RNA|C2orf86_uc002scg.2_Missense_Mutation_p.L296P|C2orf86_uc002sci.1_Missense_Mutation_p.L464P	NM_015910	NP_056994	O95876	FRITZ_HUMAN	hypothetical protein LOC51057 isoform 2	488					cilium morphogenesis|regulation of embryonic cell shape|regulation of protein localization|septin cytoskeleton organization	cilium axoneme|cytoplasm|cytoskeleton|plasma membrane					0																		---	---	---	---	capture		Missense_Mutation	SNP	63609202	63609202	2293	2	A	G	G	7	7	C2orf86	G	4	4
MDH1	4190	broad.mit.edu	37	2	63824696	63824696	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:63824696G>T	uc002scj.1	+	4	419	c.363G>T	c.(361-363)AAG>AAT	p.K121N	MDH1_uc010ypv.1_Missense_Mutation_p.K139N|MDH1_uc010ypw.1_Missense_Mutation_p.K26N	NM_005917	NP_005908	P40925	MDHC_HUMAN	cytosolic malate dehydrogenase	121					gluconeogenesis|tricarboxylic acid cycle	centrosome|cytosol	L-malate dehydrogenase activity|malic enzyme activity			kidney(2)	2					NADH(DB00157)													---	---	---	---	capture		Missense_Mutation	SNP	63824696	63824696	9797	2	G	T	T	33	33	MDH1	T	2	2
DYSF	8291	broad.mit.edu	37	2	71817372	71817372	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71817372G>T	uc002sie.2	+	32	3850	c.3474G>T	c.(3472-3474)ATG>ATT	p.M1158I	DYSF_uc010feg.2_Missense_Mutation_p.M1189I|DYSF_uc010feh.2_Missense_Mutation_p.M1144I|DYSF_uc002sig.3_Missense_Mutation_p.M1144I|DYSF_uc010yqx.1_RNA|DYSF_uc010fee.2_Missense_Mutation_p.M1158I|DYSF_uc010fef.2_Missense_Mutation_p.M1175I|DYSF_uc010fei.2_Missense_Mutation_p.M1175I|DYSF_uc010fek.2_Missense_Mutation_p.M1176I|DYSF_uc010fej.2_Missense_Mutation_p.M1145I|DYSF_uc010fel.2_Missense_Mutation_p.M1145I|DYSF_uc010feo.2_Missense_Mutation_p.M1190I|DYSF_uc010fem.2_Missense_Mutation_p.M1159I|DYSF_uc010fen.2_Missense_Mutation_p.M1176I|DYSF_uc002sif.2_Missense_Mutation_p.M1159I|DYSF_uc010yqy.1_Missense_Mutation_p.M39I	NM_003494	NP_003485	O75923	DYSF_HUMAN	dysferlin isoform 8	1158	Cytoplasmic (Potential).|C2 4.					cytoplasmic vesicle membrane|integral to membrane|sarcolemma	calcium-dependent phospholipid binding			ovary(3)|breast(2)|pancreas(1)|skin(1)	7																		---	---	---	---	capture		Missense_Mutation	SNP	71817372	71817372	5045	2	G	T	T	48	48	DYSF	T	2	2
LRRTM4	80059	broad.mit.edu	37	2	77746335	77746335	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:77746335G>C	uc002snr.2	-	3	1075	c.660C>G	c.(658-660)ATC>ATG	p.I220M	LRRTM4_uc002snq.2_Missense_Mutation_p.I220M|LRRTM4_uc002sns.2_Missense_Mutation_p.I220M|LRRTM4_uc002snt.2_Missense_Mutation_p.I221M	NM_001134745	NP_001128217	Q86VH4	LRRT4_HUMAN	leucine rich repeat transmembrane neuronal 4	220	LRR 7.|Extracellular (Potential).					integral to membrane				pancreas(3)|ovary(1)	4				Colorectal(11;0.059)														---	---	---	---	capture		Missense_Mutation	SNP	77746335	77746335	9418	2	G	C	C	45	45	LRRTM4	C	3	3
CTNNA2	1496	broad.mit.edu	37	2	80772182	80772182	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:80772182G>T	uc010ysh.1	+	9	1371	c.1366G>T	c.(1366-1368)GAC>TAC	p.D456Y	CTNNA2_uc010yse.1_Missense_Mutation_p.D456Y|CTNNA2_uc010ysf.1_Missense_Mutation_p.D456Y|CTNNA2_uc010ysg.1_Missense_Mutation_p.D456Y|CTNNA2_uc010ysi.1_Missense_Mutation_p.D88Y	NM_004389	NP_004380	P26232	CTNA2_HUMAN	catenin, alpha 2 isoform 1	456					axonogenesis|brain morphogenesis|cell-cell adhesion|dendrite morphogenesis|muscle cell differentiation|positive regulation of muscle cell differentiation|prepulse inhibition|radial glia guided migration of Purkinje cell|regulation of synapse structural plasticity	actin cytoskeleton|axon|cytosol	cadherin binding|structural constituent of cytoskeleton			pancreas(4)|lung(3)|breast(1)|skin(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	80772182	80772182	4172	2	G	T	T	45	45	CTNNA2	T	2	2
SH2D6	284948	broad.mit.edu	37	2	85663660	85663660	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:85663660C>T	uc002spq.2	+	4	644	c.483C>T	c.(481-483)AGC>AGT	p.S161S	SH2D6_uc002spo.2_RNA|SH2D6_uc002spp.2_RNA	NM_198482	NP_940884	Q7Z4S9	SH2D6_HUMAN	SH2 domain containing 6	161	SH2.									central_nervous_system(1)	1																		---	---	---	---	capture		Silent	SNP	85663660	85663660	14729	2	C	T	T	27	27	SH2D6	T	1	1
PROM2	150696	broad.mit.edu	37	2	95943263	95943263	+	Silent	SNP	A	G	G	rs139763415	byFrequency	TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:95943263A>G	uc002suh.1	+	7	1057	c.924A>G	c.(922-924)GCA>GCG	p.A308A	PROM2_uc002sui.2_Silent_p.A308A|PROM2_uc002suj.2_Intron|PROM2_uc002suk.2_Silent_p.A308A|PROM2_uc002sul.2_Intron	NM_144707	NP_653308	Q8N271	PROM2_HUMAN	prominin 2 precursor	308	Extracellular (Potential).					apical plasma membrane|basolateral plasma membrane|cilium membrane|integral to membrane|microvillus membrane				ovary(1)	1																		---	---	---	---	capture		Silent	SNP	95943263	95943263	12999	2	A	G	G	7	7	PROM2	G	4	4
NCKAP5	344148	broad.mit.edu	37	2	133540314	133540314	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:133540314C>A	uc002ttp.2	-	14	4444	c.4070G>T	c.(4069-4071)AGC>ATC	p.S1357I	NCKAP5_uc002ttq.2_Intron	NM_207363	NP_997246	O14513	NCKP5_HUMAN	Nck-associated protein 5 isoform 1	1357							protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	133540314	133540314	10622	2	C	A	A	28	28	NCKAP5	A	2	2
THSD7B	80731	broad.mit.edu	37	2	137814067	137814067	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:137814067G>T	uc002tva.1	+	2	124	c.124G>T	c.(124-126)GGG>TGG	p.G42W	THSD7B_uc010zbj.1_RNA|THSD7B_uc002tvb.2_5'UTR	NM_001080427	NP_001073896			thrombospondin, type I, domain containing 7B											ovary(4)|central_nervous_system(2)|pancreas(1)	7				BRCA - Breast invasive adenocarcinoma(221;0.19)														---	---	---	---	capture		Missense_Mutation	SNP	137814067	137814067	16408	2	G	T	T	39	39	THSD7B	T	1	1
NEB	4703	broad.mit.edu	37	2	152520222	152520222	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152520222G>A	uc010fnx.2	-	45	5794	c.5603C>T	c.(5602-5604)TCC>TTC	p.S1868F		NM_004543	NP_004534	P20929	NEBU_HUMAN	nebulin isoform 3	1868					muscle filament sliding|muscle organ development|regulation of actin filament length|somatic muscle development	actin cytoskeleton|cytosol|Z disc	actin binding|structural constituent of muscle			ovary(8)|large_intestine(5)|breast(3)|central_nervous_system(2)|skin(1)|pancreas(1)	20				BRCA - Breast invasive adenocarcinoma(221;0.219)														---	---	---	---	capture		Missense_Mutation	SNP	152520222	152520222	10701	2	G	A	A	41	41	NEB	A	2	2
GALNT13	114805	broad.mit.edu	37	2	155098644	155098644	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:155098644T>A	uc002tyr.3	+	5	980	c.413T>A	c.(412-414)GTG>GAG	p.V138E	GALNT13_uc002tyt.3_Missense_Mutation_p.V138E|GALNT13_uc010foc.1_5'UTR	NM_052917	NP_443149	Q8IUC8	GLT13_HUMAN	UDP-N-acetyl-alpha-D-galactosamine:polypeptide	138	Lumenal (Potential).|Catalytic subdomain A.					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			ovary(2)|pancreas(2)|central_nervous_system(1)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	155098644	155098644	6475	2	T	A	A	59	59	GALNT13	A	4	4
FIGN	55137	broad.mit.edu	37	2	164467453	164467453	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:164467453C>A	uc002uck.1	-	3	1200	c.889G>T	c.(889-891)GGC>TGC	p.G297C		NM_018086	NP_060556	Q5HY92	FIGN_HUMAN	fidgetin	297						nuclear matrix	ATP binding|nucleoside-triphosphatase activity			large_intestine(2)|ovary(1)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	164467453	164467453	6129	2	C	A	A	22	22	FIGN	A	2	2
SCN3A	6328	broad.mit.edu	37	2	165947258	165947258	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:165947258G>T	uc002ucx.2	-	28	5897	c.5405C>A	c.(5404-5406)CCC>CAC	p.P1802H	SCN3A_uc010zcy.1_Missense_Mutation_p.P285H|SCN3A_uc002ucy.2_Missense_Mutation_p.P1753H|SCN3A_uc002ucz.2_Missense_Mutation_p.P1753H	NM_006922	NP_008853	Q9NY46	SCN3A_HUMAN	sodium channel, voltage-gated, type III, alpha	1802						voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(4)|breast(3)|skin(2)|central_nervous_system(1)	10					Lamotrigine(DB00555)													---	---	---	---	capture		Missense_Mutation	SNP	165947258	165947258	14400	2	G	T	T	43	43	SCN3A	T	2	2
SCN2A	6326	broad.mit.edu	37	2	166166936	166166936	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:166166936G>T	uc002udc.2	+	7	1091	c.801G>T	c.(799-801)TTG>TTT	p.L267F	SCN2A_uc002udd.2_Missense_Mutation_p.L267F|SCN2A_uc002ude.2_Missense_Mutation_p.L267F	NM_001040142	NP_001035232	Q99250	SCN2A_HUMAN	sodium channel, voltage-gated, type II, alpha	267	I.|Helical; Name=S5 of repeat I; (Potential).				myelination	node of Ranvier|voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(6)|breast(1)|pancreas(1)	8					Lamotrigine(DB00555)													---	---	---	---	capture		Missense_Mutation	SNP	166166936	166166936	14398	2	G	T	T	46	46	SCN2A	T	2	2
SCN7A	6332	broad.mit.edu	37	2	167262800	167262800	+	Missense_Mutation	SNP	T	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:167262800T>G	uc002udu.1	-	25	4466	c.4339A>C	c.(4339-4341)AAA>CAA	p.K1447Q		NM_002976	NP_002967	Q01118	SCN7A_HUMAN	sodium channel, voltage-gated, type VII, alpha	1447					muscle contraction	voltage-gated sodium channel complex	voltage-gated sodium channel activity			large_intestine(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	167262800	167262800	14405	2	T	G	G	61	61	SCN7A	G	4	4
PPIG	9360	broad.mit.edu	37	2	170488342	170488342	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170488342G>T	uc002uez.2	+	11	1048	c.828G>T	c.(826-828)GAG>GAT	p.E276D	PPIG_uc010fpx.2_Missense_Mutation_p.E261D|PPIG_uc010fpy.2_Missense_Mutation_p.E269D|PPIG_uc002ufa.2_Missense_Mutation_p.E276D|PPIG_uc002ufb.2_Missense_Mutation_p.E276D|PPIG_uc002ufd.2_Missense_Mutation_p.E273D	NM_004792	NP_004783	Q13427	PPIG_HUMAN	peptidylprolyl isomerase G	276					protein folding|RNA splicing	nuclear matrix|nuclear speck	cyclosporin A binding|peptidyl-prolyl cis-trans isomerase activity			ovary(2)|central_nervous_system(1)	3					L-Proline(DB00172)													---	---	---	---	capture		Missense_Mutation	SNP	170488342	170488342	12759	2	G	T	T	33	33	PPIG	T	2	2
PDE11A	50940	broad.mit.edu	37	2	178762881	178762881	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:178762881G>T	uc002ulq.2	-	4	1524	c.1206C>A	c.(1204-1206)GAC>GAA	p.D402E	PDE11A_uc002ulr.2_Missense_Mutation_p.D152E|PDE11A_uc002uls.1_Missense_Mutation_p.D44E|PDE11A_uc002ult.1_Missense_Mutation_p.D152E|PDE11A_uc002ulu.1_Missense_Mutation_p.D44E	NM_016953	NP_058649	Q9HCR9	PDE11_HUMAN	phosphodiesterase 11A isoform 4	402	GAF 2.				platelet activation|signal transduction	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding			ovary(3)|large_intestine(1)	4			OV - Ovarian serous cystadenocarcinoma(117;0.00121)|Epithelial(96;0.00455)|all cancers(119;0.02)											Primary_Pigmented_Nodular_Adrenocortical_Disease_Familial				---	---	---	---	capture		Missense_Mutation	SNP	178762881	178762881	12052	2	G	T	T	44	44	PDE11A	T	2	2
TTN	7273	broad.mit.edu	37	2	179613060	179613060	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179613060C>T	uc002unb.2	-	46	14291	c.14067G>A	c.(14065-14067)GAG>GAA	p.E4689E	TTN_uc010zfg.1_Intron|TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Intron	NM_133379	NP_596870	Q8WZ42	TITIN_HUMAN	titin isoform novex-3	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Silent	SNP	179613060	179613060	17290	2	C	T	T	32	32	TTN	T	2	2
DNAH7	56171	broad.mit.edu	37	2	196723359	196723359	+	Nonsense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196723359C>A	uc002utj.3	-	43	8007	c.7906G>T	c.(7906-7908)GAA>TAA	p.E2636*		NM_018897	NP_061720	Q8WXX0	DYH7_HUMAN	dynein, axonemal, heavy chain 7	2636	Stalk (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(10)|ovary(2)	12																		---	---	---	---	capture		Nonsense_Mutation	SNP	196723359	196723359	4789	2	C	A	A	32	32	DNAH7	A	5	2
GTF3C3	9330	broad.mit.edu	37	2	197631415	197631415	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197631415G>A	uc002uts.2	-	17	2502	c.2412C>T	c.(2410-2412)CTC>CTT	p.L804L	GTF3C3_uc010zgu.1_Silent_p.L775L	NM_012086	NP_036218	Q9Y5Q9	TF3C3_HUMAN	general transcription factor IIIC, polypeptide	804						transcription factor TFIIIC complex	DNA binding|protein binding			ovary(3)|breast(3)|pancreas(1)	7																		---	---	---	---	capture		Silent	SNP	197631415	197631415	7154	2	G	A	A	45	45	GTF3C3	A	2	2
MPP4	58538	broad.mit.edu	37	2	202519560	202519560	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202519560G>T	uc002uyk.3	-	18	1589	c.1381C>A	c.(1381-1383)CAC>AAC	p.H461N	MPP4_uc002uyi.3_Missense_Mutation_p.H79N|MPP4_uc010ftj.2_Missense_Mutation_p.H454N|MPP4_uc010zhq.1_Missense_Mutation_p.H430N|MPP4_uc010zhr.1_Missense_Mutation_p.H437N|MPP4_uc010zhs.1_Missense_Mutation_p.H386N|MPP4_uc002uyj.3_Missense_Mutation_p.H426N|MPP4_uc010zht.1_Missense_Mutation_p.H403N|MPP4_uc002uyl.3_RNA|MPP4_uc010ftk.2_Missense_Mutation_p.H417N	NM_033066	NP_149055	Q96JB8	MPP4_HUMAN	membrane protein, palmitoylated 4	461	Guanylate kinase-like.					cytoplasm	protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	202519560	202519560	10128	2	G	T	T	40	40	MPP4	T	1	1
PARD3B	117583	broad.mit.edu	37	2	206165406	206165406	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:206165406A>T	uc002var.1	+	17	2545	c.2338A>T	c.(2338-2340)AGC>TGC	p.S780C	PARD3B_uc010fub.1_Missense_Mutation_p.S780C|PARD3B_uc002vao.1_Missense_Mutation_p.S780C|PARD3B_uc002vap.1_Missense_Mutation_p.S718C|PARD3B_uc002vaq.1_Intron	NM_152526	NP_689739	Q8TEW8	PAR3L_HUMAN	par-3 partitioning defective 3 homolog B isoform	780					cell cycle|cell division	endomembrane system|tight junction				skin(2)|ovary(1)|breast(1)	4		all_cancers(1;2.88e-06)|all_epithelial(1;3.23e-06)		Epithelial(149;0.0739)														---	---	---	---	capture		Missense_Mutation	SNP	206165406	206165406	11861	2	A	T	T	11	11	PARD3B	T	4	4
INO80D	54891	broad.mit.edu	37	2	206927738	206927738	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:206927738C>A	uc002vaz.3	-	3	408	c.3G>T	c.(1-3)ATG>ATT	p.M1I		NM_017759	NP_060229	Q53TQ3	IN80D_HUMAN	INO80 complex subunit D	1					DNA recombination|DNA repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	206927738	206927738	8050	2	C	A	A	17	17	INO80D	A	2	2
ABCA12	26154	broad.mit.edu	37	2	215840712	215840712	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:215840712C>T	uc002vew.2	-	34	5398	c.5178G>A	c.(5176-5178)CTG>CTA	p.L1726L	ABCA12_uc002vev.2_Silent_p.L1408L|ABCA12_uc010zjn.1_Silent_p.L653L	NM_173076	NP_775099	Q86UK0	ABCAC_HUMAN	ATP-binding cassette, sub-family A, member 12	1726					cellular homeostasis|lipid transport	integral to membrane	ATP binding|ATPase activity			ovary(6)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	11		Renal(323;0.127)		Epithelial(149;1.01e-05)|all cancers(144;0.00112)|LUSC - Lung squamous cell carcinoma(224;0.00829)|Lung(261;0.011)														---	---	---	---	capture		Silent	SNP	215840712	215840712	31	2	C	T	T	29	29	ABCA12	T	2	2
DOCK10	55619	broad.mit.edu	37	2	225642886	225642886	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:225642886T>A	uc010fwz.1	-	51	6010	c.5771A>T	c.(5770-5772)GAC>GTC	p.D1924V	DOCK10_uc002vob.2_Missense_Mutation_p.D1918V|DOCK10_uc002voa.2_Missense_Mutation_p.D580V	NM_014689	NP_055504	Q96BY6	DOC10_HUMAN	dedicator of cytokinesis 10	1924	DHR-2.						GTP binding			ovary(2)	2		Renal(207;0.0113)|all_lung(227;0.0486)|Lung NSC(271;0.0653)|all_hematologic(139;0.14)		Epithelial(121;2.37e-10)|all cancers(144;2.26e-07)|Lung(261;0.0143)|LUSC - Lung squamous cell carcinoma(224;0.0178)														---	---	---	---	capture		Missense_Mutation	SNP	225642886	225642886	4869	2	T	A	A	58	58	DOCK10	A	4	4
ALPP	250	broad.mit.edu	37	2	233246046	233246046	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233246046C>A	uc002vsq.2	+	10	1443	c.1278C>A	c.(1276-1278)GGC>GGA	p.G426G	ALPP_uc002vsr.2_RNA	NM_001632	NP_001623	P05187	PPB1_HUMAN	placental alkaline phosphatase preproprotein	426						anchored to membrane|cell surface|integral to membrane|plasma membrane	alkaline phosphatase activity|metal ion binding			ovary(1)	1		all_hematologic(139;0.00793)|Renal(207;0.0112)|Acute lymphoblastic leukemia(138;0.0182)|all_lung(227;0.0449)|Lung NSC(271;0.132)		Epithelial(121;4.45e-22)|Kidney(3;4.42e-11)|KIRC - Kidney renal clear cell carcinoma(3;1.9e-09)|BRCA - Breast invasive adenocarcinoma(100;0.000767)|Lung(119;0.00566)|LUSC - Lung squamous cell carcinoma(224;0.00746)|STAD - Stomach adenocarcinoma(3;0.0181)|GBM - Glioblastoma multiforme(43;0.196)														---	---	---	---	capture		Silent	SNP	233246046	233246046	551	2	C	A	A	27	27	ALPP	A	1	1
CAPN10	11132	broad.mit.edu	37	2	241536337	241536337	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:241536337C>T	uc002vzk.1	+	9	1905	c.1721C>T	c.(1720-1722)CCC>CTC	p.P574L	CAPN10_uc002vzl.1_Intron|CAPN10_uc002vzm.1_Intron|CAPN10_uc002vzn.1_Missense_Mutation_p.P446L|CAPN10_uc002vzo.1_RNA|CAPN10_uc010fzg.1_Intron|CAPN10_uc002vzp.1_RNA|CAPN10_uc002vzq.1_Intron	NM_023083	NP_075571	Q9HC96	CAN10_HUMAN	calpain 10 isoform a	574	Domain III 2.				actin cytoskeleton reorganization|cellular response to insulin stimulus|positive regulation of apoptosis|positive regulation of glucose import|positive regulation of insulin secretion|positive regulation of intracellular transport|proteolysis	cytosol|plasma membrane	calcium-dependent cysteine-type endopeptidase activity|cytoskeletal protein binding|SNARE binding			ovary(3)|large_intestine(2)|lung(1)	6		all_epithelial(40;1.72e-15)|Breast(86;2.14e-05)|Renal(207;0.00183)|Ovarian(221;0.0228)|all_lung(227;0.0294)|all_neural(83;0.0459)|Lung NSC(271;0.094)|all_hematologic(139;0.158)|Melanoma(123;0.16)|Hepatocellular(293;0.244)		Epithelial(32;1.13e-31)|all cancers(36;3.24e-29)|OV - Ovarian serous cystadenocarcinoma(60;2.82e-15)|Kidney(56;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;5.1e-06)|Lung(119;0.00168)|Colorectal(34;0.00495)|LUSC - Lung squamous cell carcinoma(224;0.00813)|COAD - Colon adenocarcinoma(134;0.032)														---	---	---	---	capture		Missense_Mutation	SNP	241536337	241536337	2740	2	C	T	T	22	22	CAPN10	T	2	2
PDYN	5173	broad.mit.edu	37	20	1961244	1961244	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:1961244C>G	uc010gaj.2	-	3	732	c.490G>C	c.(490-492)GCT>CCT	p.A164P	uc002wfu.1_Intron|PDYN_uc002wfv.2_Missense_Mutation_p.A164P|PDYN_uc010zpt.1_Missense_Mutation_p.A9P	NM_024411	NP_077722	P01213	PDYN_HUMAN	beta-neoendorphin-dynorphin preproprotein	164					cell death|neuropeptide signaling pathway|synaptic transmission	extracellular region|plasma membrane	opioid peptide activity			upper_aerodigestive_tract(1)|ovary(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	1961244	1961244	12120	20	C	G	G	27	27	PDYN	G	3	3
ADRA1D	146	broad.mit.edu	37	20	4202246	4202246	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:4202246T>A	uc002wkr.2	-	2	1698	c.1643A>T	c.(1642-1644)CAC>CTC	p.H548L		NM_000678	NP_000669	P25100	ADA1D_HUMAN	alpha-1D-adrenergic receptor	548	Cytoplasmic (By similarity).			KPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRA EAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRET DI -> SHPAPSASGGCWGRSGDPRPSCAPKSPACRTRSPP GARSAQRQRAPSAQRWRLCP (in Ref. 1).	cell proliferation|cell-cell signaling|DNA metabolic process|G-protein signaling, coupled to cAMP nucleotide second messenger|multicellular organismal development|positive regulation of cell proliferation	integral to plasma membrane	alpha1-adrenergic receptor activity				0					Alfuzosin(DB00346)|Bethanidine(DB00217)|Dapiprazole(DB00298)|Debrisoquin(DB04840)|Doxazosin(DB00590)|Guanadrel Sulfate(DB00226)|Guanethidine(DB01170)|Methotrimeprazine(DB01403)|Norepinephrine(DB00368)|Promazine(DB00420)|Propericiazine(DB01608)|Propiomazine(DB00777)|Sertindole(DB06144)|Tamsulosin(DB00706)|Terazosin(DB01162)													---	---	---	---	capture		Missense_Mutation	SNP	4202246	4202246	337	20	T	A	A	59	59	ADRA1D	A	4	4
CHGB	1114	broad.mit.edu	37	20	5903358	5903358	+	Nonsense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:5903358G>T	uc002wmg.2	+	4	874	c.568G>T	c.(568-570)GAG>TAG	p.E190*	CHGB_uc010zqz.1_5'UTR	NM_001819	NP_001810	P05060	SCG1_HUMAN	chromogranin B precursor	190						extracellular region	hormone activity			breast(3)|skin(2)|ovary(1)	6																		---	---	---	---	capture		Nonsense_Mutation	SNP	5903358	5903358	3473	20	G	T	T	33	33	CHGB	T	5	2
SPTLC3	55304	broad.mit.edu	37	20	12989918	12989918	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:12989918G>T	uc002wod.1	+	1	292	c.3G>T	c.(1-3)ATG>ATT	p.M1I	SPTLC3_uc002wob.1_RNA|SPTLC3_uc002woc.2_Missense_Mutation_p.M1I	NM_018327	NP_060797	Q9NUV7	SPTC3_HUMAN	serine palmitoyltransferase, long chain base	1					sphingoid biosynthetic process	integral to membrane|serine C-palmitoyltransferase complex	pyridoxal phosphate binding|serine C-palmitoyltransferase activity|transferase activity, transferring nitrogenous groups				0					Pyridoxal Phosphate(DB00114)													---	---	---	---	capture		Missense_Mutation	SNP	12989918	12989918	15639	20	G	T	T	47	47	SPTLC3	T	2	2
PCSK2	5126	broad.mit.edu	37	20	17417378	17417378	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:17417378C>T	uc002wpm.2	+	8	1055	c.735C>T	c.(733-735)TTC>TTT	p.F245F	PCSK2_uc002wpl.2_Silent_p.F226F|PCSK2_uc010zrm.1_Silent_p.F210F	NM_002594	NP_002585	P16519	NEC2_HUMAN	proprotein convertase subtilisin/kexin type 2	245	Catalytic.				enkephalin processing|insulin processing|islet amyloid polypeptide processing	extracellular space|membrane|soluble fraction|transport vesicle	serine-type endopeptidase activity			ovary(3)|central_nervous_system(2)|large_intestine(1)|pancreas(1)	7					Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)													---	---	---	---	capture		Silent	SNP	17417378	17417378	12022	20	C	T	T	29	29	PCSK2	T	2	2
SLC24A3	57419	broad.mit.edu	37	20	19677556	19677556	+	Splice_Site	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:19677556G>T	uc002wrl.2	+	14	1803	c.1606_splice	c.e14+1	p.G536_splice		NM_020689	NP_065740			solute carrier family 24							integral to membrane|plasma membrane	calcium, potassium:sodium antiporter activity|symporter activity			ovary(1)	1																		---	---	---	---	capture		Splice_Site	SNP	19677556	19677556	14964	20	G	T	T	44	44	SLC24A3	T	5	2
PYGB	5834	broad.mit.edu	37	20	25255237	25255237	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:25255237G>T	uc002wup.2	+	5	647	c.538G>T	c.(538-540)GCC>TCC	p.A180S		NM_002862	NP_002853	P11216	PYGB_HUMAN	brain glycogen phosphorylase	180					glucose metabolic process|glycogen catabolic process	cytoplasm	glycogen phosphorylase activity|pyridoxal phosphate binding			central_nervous_system(1)|skin(1)	2					Pyridoxal Phosphate(DB00114)													---	---	---	---	capture		Missense_Mutation	SNP	25255237	25255237	13318	20	G	T	T	42	42	PYGB	T	2	2
C20orf186	149954	broad.mit.edu	37	20	31673958	31673958	+	Missense_Mutation	SNP	A	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31673958A>C	uc010zue.1	+	5	929	c.914A>C	c.(913-915)AAG>ACG	p.K305T		NM_182519	NP_872325	P59827	LPLC4_HUMAN	antimicrobial peptide RY2G5 precursor	305						cytoplasm|extracellular region	lipid binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	31673958	31673958	2176	20	A	C	C	3	3	C20orf186	C	4	4
GDF5	8200	broad.mit.edu	37	20	34022581	34022581	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34022581T>A	uc002xck.1	-	2	951	c.632A>T	c.(631-633)GAT>GTT	p.D211V	GDF5_uc010gfc.1_Missense_Mutation_p.D211V|uc002xcj.2_Missense_Mutation_p.I331N|GDF5_uc010zvc.1_Missense_Mutation_p.D211V	NM_000557	NP_000548	P43026	GDF5_HUMAN	growth differentiation factor 5 preproprotein	211					cartilage development|cell-cell signaling|growth|transforming growth factor beta receptor signaling pathway	extracellular space	cytokine activity|growth factor activity				0	Lung NSC(9;0.00642)|all_lung(11;0.0094)		BRCA - Breast invasive adenocarcinoma(18;0.00663)															---	---	---	---	capture		Missense_Mutation	SNP	34022581	34022581	6584	20	T	A	A	50	50	GDF5	A	4	4
SAMHD1	25939	broad.mit.edu	37	20	35569506	35569506	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35569506C>A	uc002xgh.1	-	3	414	c.284G>T	c.(283-285)GGG>GTG	p.G95V		NM_015474	NP_056289	Q9Y3Z3	SAMH1_HUMAN	SAM domain- and HD domain-containing protein 1	95	SAM.				defense response to virus|innate immune response|regulation of innate immune response	nucleus	metal ion binding|phosphoric diester hydrolase activity				0		Myeloproliferative disorder(115;0.00878)																---	---	---	---	capture		Missense_Mutation	SNP	35569506	35569506	14308	20	C	A	A	22	22	SAMHD1	A	2	2
PTPRT	11122	broad.mit.edu	37	20	40747043	40747043	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:40747043C>T	uc002xkg.2	-	21	3166	c.2982G>A	c.(2980-2982)AGG>AGA	p.R994R	PTPRT_uc010ggj.2_Silent_p.R1013R|PTPRT_uc010ggi.2_Silent_p.R197R	NM_007050	NP_008981	O14522	PTPRT_HUMAN	protein tyrosine phosphatase, receptor type, T	994	Tyrosine-protein phosphatase 1.|Cytoplasmic (Potential).				homophilic cell adhesion|transmembrane receptor protein tyrosine kinase signaling pathway	cell surface|integral to membrane|plasma membrane	alpha-catenin binding|beta-catenin binding|cadherin binding|delta-catenin binding|gamma-catenin binding|protein tyrosine phosphatase activity|receptor activity			skin(8)|ovary(7)|lung(5)	20		Myeloproliferative disorder(115;0.00452)|Lung NSC(126;0.0573)|all_lung(126;0.0783)																---	---	---	---	capture		Silent	SNP	40747043	40747043	13270	20	C	T	T	22	22	PTPRT	T	2	2
NEURL2	140825	broad.mit.edu	37	20	44519371	44519371	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44519371G>A	uc002xqg.1	-	1	531	c.260C>T	c.(259-261)GCG>GTG	p.A87V	CTSA_uc002xqh.2_5'Flank|CTSA_uc002xqj.3_5'Flank|CTSA_uc002xqi.2_5'Flank|CTSA_uc010zxi.1_5'Flank|CTSA_uc002xqk.3_5'Flank	NM_080749	NP_542787	Q9BR09	NEUL2_HUMAN	neuralized-like protein 2	87	NHR.				intracellular signal transduction						0		Myeloproliferative disorder(115;0.0122)																---	---	---	---	capture		Missense_Mutation	SNP	44519371	44519371	10746	20	G	A	A	38	38	NEURL2	A	1	1
SLC2A10	81031	broad.mit.edu	37	20	45353939	45353939	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:45353939C>A	uc002xsl.2	+	2	361	c.264C>A	c.(262-264)GGC>GGA	p.G88G		NM_030777	NP_110404	O95528	GTR10_HUMAN	solute carrier family 2 member 10	88	Helical; Name=3; (Potential).					endomembrane system|integral to membrane|perinuclear region of cytoplasm|plasma membrane	D-glucose transmembrane transporter activity|sugar:hydrogen symporter activity			ovary(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---	capture		Silent	SNP	45353939	45353939	15036	20	C	A	A	25	25	SLC2A10	A	2	2
CYP24A1	1591	broad.mit.edu	37	20	52782348	52782348	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:52782348T>C	uc002xwv.2	-	5	1063	c.665A>G	c.(664-666)AAG>AGG	p.K222R	CYP24A1_uc002xwu.1_Missense_Mutation_p.K80R|CYP24A1_uc002xww.2_Missense_Mutation_p.K222R	NM_000782	NP_000773	Q07973	CP24A_HUMAN	cytochrome P450 family 24 subfamily A	222					hormone biosynthetic process|osteoblast differentiation|vitamin D catabolic process|vitamin D receptor signaling pathway|xenobiotic metabolic process	mitochondrial inner membrane	1-alpha,25-dihydroxyvitamin D3 24-hydroxylase activity|electron carrier activity|heme binding|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen			upper_aerodigestive_tract(1)|ovary(1)|lung(1)	3	Lung NSC(4;1.08e-05)|all_lung(4;2.7e-05)		STAD - Stomach adenocarcinoma(23;0.206)		Calcidiol(DB00146)|Calcitriol(DB00136)|Cholecalciferol(DB00169)|Ergocalciferol(DB00153)|Paricalcitol(DB00910)													---	---	---	---	capture		Missense_Mutation	SNP	52782348	52782348	4319	20	T	C	C	56	56	CYP24A1	C	4	4
BMP7	655	broad.mit.edu	37	20	55803413	55803413	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:55803413G>T	uc010gip.1	-	2	1012	c.483C>A	c.(481-483)TCC>TCA	p.S161S	BMP7_uc010giq.1_Silent_p.S161S|BMP7_uc002xyc.2_Silent_p.S161S	NM_001719	NP_001710	P18075	BMP7_HUMAN	bone morphogenetic protein 7 precursor	161					BMP signaling pathway|cartilage development|cellular response to hypoxia|epithelial to mesenchymal transition|growth|mesonephros development|negative regulation of glomerular mesangial cell proliferation|negative regulation of MAP kinase activity|negative regulation of mitosis|negative regulation of neuron differentiation|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|negative regulation of phosphorylation|negative regulation of striated muscle cell apoptosis|negative regulation of transcription, DNA-dependent|ossification|pathway-restricted SMAD protein phosphorylation|positive regulation of bone mineralization|positive regulation of osteoblast differentiation|positive regulation of pathway-restricted SMAD protein phosphorylation|protein localization to nucleus|regulation of removal of superoxide radicals|SMAD protein signal transduction|steroid hormone mediated signaling pathway|ureteric bud development	extracellular space	cytokine activity|growth factor activity			skin(1)	1	all_lung(29;0.0133)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(4;2.49e-13)|Epithelial(14;1.74e-08)|all cancers(14;2.05e-07)															---	---	---	---	capture		Silent	SNP	55803413	55803413	1490	20	G	T	T	47	47	BMP7	T	2	2
KCNQ2	3785	broad.mit.edu	37	20	62065176	62065176	+	Silent	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62065176G>C	uc002yey.1	-	8	1281	c.1104C>G	c.(1102-1104)ACC>ACG	p.T368T	KCNQ2_uc002yez.1_Silent_p.T368T|KCNQ2_uc002yfa.1_Silent_p.T368T|KCNQ2_uc002yfb.1_Silent_p.T368T|KCNQ2_uc011aax.1_Silent_p.T368T|KCNQ2_uc002yfc.1_Silent_p.T368T	NM_172107	NP_742105	O43526	KCNQ2_HUMAN	potassium voltage-gated channel KQT-like protein	368	Cytoplasmic (Potential).				axon guidance|synaptic transmission	voltage-gated potassium channel complex	voltage-gated potassium channel activity			upper_aerodigestive_tract(1)|ovary(1)	2	all_cancers(38;1.24e-11)		BRCA - Breast invasive adenocarcinoma(10;1.04e-05)		Amitriptyline(DB00321)													---	---	---	---	capture		Silent	SNP	62065176	62065176	8388	20	G	C	C	39	39	KCNQ2	C	3	3
RTEL1	51750	broad.mit.edu	37	20	62326724	62326724	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62326724C>T	uc002yfu.1	+	34	3886	c.3543C>T	c.(3541-3543)ATC>ATT	p.I1181I	RTEL1_uc002yft.1_Silent_p.I1181I|RTEL1_uc011abd.1_Silent_p.I1205I|RTEL1_uc011abe.1_Silent_p.I958I|RTEL1_uc002yfw.2_RNA|RTEL1_uc002yfx.1_Silent_p.I426I|TNFRSF6B_uc002yfy.2_5'UTR|TNFRSF6B_uc002yfz.2_5'Flank	NM_016434	NP_057518	Q9NZ71	RTEL1_HUMAN	regulator of telomere elongation helicase 1	1181					DNA repair|regulation of double-strand break repair via homologous recombination|telomere maintenance	nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|iron-sulfur cluster binding|metal ion binding				0	all_cancers(38;6.47e-12)|all_epithelial(29;3.75e-13)		Epithelial(9;1.25e-09)|all cancers(9;5.13e-09)|BRCA - Breast invasive adenocarcinoma(10;7.26e-05)|OV - Ovarian serous cystadenocarcinoma(5;0.00223)|Colorectal(105;0.107)															---	---	---	---	capture		Silent	SNP	62326724	62326724	14200	20	C	T	T	32	32	RTEL1	T	2	2
KRTAP19-6	337973	broad.mit.edu	37	21	31914084	31914084	+	Silent	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:31914084A>G	uc002yok.1	-	1	98	c.69T>C	c.(67-69)TAT>TAC	p.Y23Y		NM_181612	NP_853643	Q3LI70	KR196_HUMAN	keratin associated protein 19-6	23						intermediate filament					0																		---	---	---	---	capture		Silent	SNP	31914084	31914084	8848	21	A	G	G	8	8	KRTAP19-6	G	4	4
TIAM1	7074	broad.mit.edu	37	21	32502633	32502633	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:32502633C>A	uc002yow.1	-	26	4415	c.3943G>T	c.(3943-3945)GTA>TTA	p.V1315L	TIAM1_uc011adk.1_Missense_Mutation_p.V1315L|TIAM1_uc011adl.1_Missense_Mutation_p.V1255L	NM_003253	NP_003244	Q13009	TIAM1_HUMAN	T-cell lymphoma invasion and metastasis 1	1315	PH 2.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cell-cell junction|cytosol	receptor signaling protein activity|Rho guanyl-nucleotide exchange factor activity			lung(3)|breast(3)|ovary(2)|large_intestine(2)	10																		---	---	---	---	capture		Missense_Mutation	SNP	32502633	32502633	16418	21	C	A	A	18	18	TIAM1	A	2	2
HUNK	30811	broad.mit.edu	37	21	33296969	33296969	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:33296969A>G	uc002yph.2	+	2	811	c.451A>G	c.(451-453)AAG>GAG	p.K151E		NM_014586	NP_055401	P57058	HUNK_HUMAN	hormonally upregulated Neu-associated kinase	151	Protein kinase.				multicellular organismal development|signal transduction		ATP binding|protein serine/threonine kinase activity			stomach(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	33296969	33296969	7758	21	A	G	G	5	5	HUNK	G	4	4
DYRK1A	1859	broad.mit.edu	37	21	38878446	38878446	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:38878446C>T	uc002ywk.2	+	10	1666	c.1591C>T	c.(1591-1593)CCG>TCG	p.P531S	DYRK1A_uc002ywi.2_Missense_Mutation_p.P531S|DYRK1A_uc002ywj.2_Missense_Mutation_p.P522S|DYRK1A_uc002ywl.2_Intron|DYRK1A_uc002ywm.2_Intron|DYRK1A_uc011aei.1_Missense_Mutation_p.P292S	NM_001396	NP_001387	Q13627	DYR1A_HUMAN	dual-specificity tyrosine-(Y)-phosphorylation	531					nervous system development|peptidyl-tyrosine phosphorylation|protein autophosphorylation	nuclear speck	ATP binding|non-membrane spanning protein tyrosine kinase activity|protein binding|protein self-association|protein serine/threonine kinase activity			ovary(2)|lung(1)|breast(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	38878446	38878446	5040	21	C	T	T	30	30	DYRK1A	T	2	2
ISX	91464	broad.mit.edu	37	22	35463099	35463099	+	Missense_Mutation	SNP	C	A	A	rs138420595		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:35463099C>A	uc003anj.2	+	1	970	c.19C>A	c.(19-21)CCT>ACT	p.P7T	ISX_uc011amg.1_5'UTR	NM_001008494	NP_001008494	Q2M1V0	ISX_HUMAN	intestine-specific homeobox	7						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(3)|skin(2)	5																		---	---	---	---	capture		Missense_Mutation	SNP	35463099	35463099	8169	22	C	A	A	22	22	ISX	A	2	2
TRMU	55687	broad.mit.edu	37	22	46751480	46751480	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:46751480C>T	uc003bhp.2	+	9	1377	c.1013C>T	c.(1012-1014)GCA>GTA	p.A338V	TRMU_uc003bhq.2_Missense_Mutation_p.A120V|TRMU_uc003bhs.2_Missense_Mutation_p.A338V|TRMU_uc003bhr.2_Missense_Mutation_p.A224V|TRMU_uc003bht.2_Missense_Mutation_p.A191V|TRMU_uc003bhu.2_Missense_Mutation_p.A120V|TRMU_uc003bhv.2_Missense_Mutation_p.A191V	NM_018006	NP_060476	O75648	MTU1_HUMAN	tRNA 5-methylaminomethyl-2-thiouridylate	338						mitochondrion	ATP binding|sulfurtransferase activity|tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity|tRNA binding			ovary(1)	1		Ovarian(80;0.00965)|Breast(42;0.0194)|all_neural(38;0.0416)		UCEC - Uterine corpus endometrioid carcinoma (28;0.00449)|LUAD - Lung adenocarcinoma(64;0.248)												OREG0026654	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	46751480	46751480	17121	22	C	T	T	25	25	TRMU	T	2	2
CHL1	10752	broad.mit.edu	37	3	391221	391221	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:391221T>A	uc003bou.2	+	9	1251	c.980T>A	c.(979-981)GTA>GAA	p.V327E	CHL1_uc003bot.2_Missense_Mutation_p.V343E|CHL1_uc003bow.1_Missense_Mutation_p.V327E|CHL1_uc011asi.1_Missense_Mutation_p.V343E	NM_006614	NP_006605	O00533	CHL1_HUMAN	cell adhesion molecule with homology to L1CAM	327	Ig-like C2-type 3.|Extracellular (Potential).				axon guidance|cell adhesion|signal transduction	integral to membrane|plasma membrane|proteinaceous extracellular matrix				skin(5)|central_nervous_system(4)|large_intestine(2)|ovary(1)	12		all_cancers(2;1.14e-06)|all_epithelial(2;0.00367)|all_lung(1;0.061)|Lung NSC(2;0.201)		Epithelial(13;5.36e-06)|all cancers(10;1.4e-05)|OV - Ovarian serous cystadenocarcinoma(96;0.00323)|COAD - Colon adenocarcinoma(1;0.00925)|Colorectal(20;0.0198)														---	---	---	---	capture		Missense_Mutation	SNP	391221	391221	3483	3	T	A	A	57	57	CHL1	A	4	4
CHL1	10752	broad.mit.edu	37	3	404903	404903	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:404903G>T	uc003bou.2	+	13	1645	c.1374G>T	c.(1372-1374)CAG>CAT	p.Q458H	CHL1_uc003bot.2_Missense_Mutation_p.Q474H|CHL1_uc003bow.1_Missense_Mutation_p.Q458H|CHL1_uc011asi.1_Missense_Mutation_p.Q474H	NM_006614	NP_006605	O00533	CHL1_HUMAN	cell adhesion molecule with homology to L1CAM	458	Ig-like C2-type 5.|Extracellular (Potential).				axon guidance|cell adhesion|signal transduction	integral to membrane|plasma membrane|proteinaceous extracellular matrix				skin(5)|central_nervous_system(4)|large_intestine(2)|ovary(1)	12		all_cancers(2;1.14e-06)|all_epithelial(2;0.00367)|all_lung(1;0.061)|Lung NSC(2;0.201)		Epithelial(13;5.36e-06)|all cancers(10;1.4e-05)|OV - Ovarian serous cystadenocarcinoma(96;0.00323)|COAD - Colon adenocarcinoma(1;0.00925)|Colorectal(20;0.0198)														---	---	---	---	capture		Missense_Mutation	SNP	404903	404903	3483	3	G	T	T	33	33	CHL1	T	2	2
CHL1	10752	broad.mit.edu	37	3	432834	432834	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:432834C>T	uc003bou.2	+	21	3006	c.2735C>T	c.(2734-2736)CCA>CTA	p.P912L	CHL1_uc003bot.2_Missense_Mutation_p.P928L|CHL1_uc003bow.1_Missense_Mutation_p.P912L|CHL1_uc011asi.1_Missense_Mutation_p.P928L	NM_006614	NP_006605	O00533	CHL1_HUMAN	cell adhesion molecule with homology to L1CAM	912	Extracellular (Potential).				axon guidance|cell adhesion|signal transduction	integral to membrane|plasma membrane|proteinaceous extracellular matrix				skin(5)|central_nervous_system(4)|large_intestine(2)|ovary(1)	12		all_cancers(2;1.14e-06)|all_epithelial(2;0.00367)|all_lung(1;0.061)|Lung NSC(2;0.201)		Epithelial(13;5.36e-06)|all cancers(10;1.4e-05)|OV - Ovarian serous cystadenocarcinoma(96;0.00323)|COAD - Colon adenocarcinoma(1;0.00925)|Colorectal(20;0.0198)														---	---	---	---	capture		Missense_Mutation	SNP	432834	432834	3483	3	C	T	T	21	21	CHL1	T	2	2
GRM7	2917	broad.mit.edu	37	3	7494373	7494373	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:7494373G>T	uc003bqm.2	+	6	1528	c.1254G>T	c.(1252-1254)ATG>ATT	p.M418I	GRM7_uc011ata.1_RNA|GRM7_uc011atb.1_RNA|GRM7_uc010hcf.2_RNA|GRM7_uc011atc.1_RNA|GRM7_uc010hcg.2_Missense_Mutation_p.M418I|GRM7_uc003bql.2_Missense_Mutation_p.M418I|GRM7_uc003bqn.1_Missense_Mutation_p.M1I|GRM7_uc010hch.1_5'UTR	NM_000844	NP_000835	Q14831	GRM7_HUMAN	glutamate receptor, metabotropic 7 isoform a	418	Extracellular (Potential).				negative regulation of adenylate cyclase activity|negative regulation of cAMP biosynthetic process|negative regulation of glutamate secretion|sensory perception of smell|sensory perception of sound|synaptic transmission	asymmetric synapse|axon|cell cortex|dendritic shaft|integral to plasma membrane|postsynaptic membrane|presynaptic active zone	adenylate cyclase inhibitor activity|calcium ion binding|glutamate binding|group III metabotropic glutamate receptor activity|PDZ domain binding|serine binding			ovary(4)|lung(3)	7					L-Glutamic Acid(DB00142)													---	---	---	---	capture		Missense_Mutation	SNP	7494373	7494373	7081	3	G	T	T	47	47	GRM7	T	2	2
RARB	5915	broad.mit.edu	37	3	25611395	25611395	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:25611395G>T	uc011awl.1	+	4	682	c.616G>T	c.(616-618)GGT>TGT	p.G206C	RARB_uc003cdi.1_Missense_Mutation_p.G87C|RARB_uc003cdh.2_Missense_Mutation_p.G199C	NM_016152	NP_057236	P10826	RARB_HUMAN	retinoic acid receptor, beta isoform 2	206	Ligand-binding.			G -> A (in Ref. 2; CAA68398).	embryonic digestive tract development|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	cytoplasm|nucleoplasm	protein binding|retinoic acid receptor activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)|large_intestine(1)|pancreas(1)	3					Acitretin(DB00459)|Adapalene(DB00210)|Alitretinoin(DB00523)|Etretinate(DB00926)|Tamibarotene(DB04942)|Tazarotene(DB00799)													---	---	---	---	capture		Missense_Mutation	SNP	25611395	25611395	13513	3	G	T	T	43	43	RARB	T	2	2
RPL14	9045	broad.mit.edu	37	3	40503622	40503622	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:40503622G>A	uc003ckg.2	+	6	598	c.547G>A	c.(547-549)GCC>ACC	p.A183T	RPL14_uc003ckh.2_Missense_Mutation_p.A183T|RPL14_uc003cki.2_Missense_Mutation_p.A134T	NM_003973	NP_003964	P50914	RL14_HUMAN	ribosomal protein L14	183	4 X 5 AA tandem repeats of Q-K-A-[PAS]-X.|1-3.				endocrine pancreas development|ribosomal large subunit biogenesis|rRNA processing|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit	protein binding|RNA binding|structural constituent of ribosome				0				KIRC - Kidney renal clear cell carcinoma(284;0.0517)|Kidney(284;0.065)														---	---	---	---	capture		Missense_Mutation	SNP	40503622	40503622	14040	3	G	A	A	34	34	RPL14	A	2	2
KIF9	64147	broad.mit.edu	37	3	47307259	47307259	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:47307259G>A	uc010hjp.2	-	9	1481	c.877C>T	c.(877-879)CGG>TGG	p.R293W	KIF9_uc003cqx.2_Missense_Mutation_p.R293W|KIF9_uc003cqy.2_Missense_Mutation_p.R293W|KIF9_uc011bat.1_RNA|KIF9_uc011bau.1_RNA	NM_001134878	NP_001128350	Q9HAQ2	KIF9_HUMAN	kinesin family member 9 isoform 2	293					blood coagulation|microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(1)	1		Acute lymphoblastic leukemia(5;0.164)		BRCA - Breast invasive adenocarcinoma(193;0.000284)|KIRC - Kidney renal clear cell carcinoma(197;0.00609)|Kidney(197;0.007)														---	---	---	---	capture		Missense_Mutation	SNP	47307259	47307259	8621	3	G	A	A	37	37	KIF9	A	1	1
BSN	8927	broad.mit.edu	37	3	49662655	49662655	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49662655G>T	uc003cxe.3	+	2	586	c.472G>T	c.(472-474)GTC>TTC	p.V158F		NM_003458	NP_003449	Q9UPA5	BSN_HUMAN	bassoon protein	158					synaptic transmission	cell junction|cytoplasm|cytoskeleton|nucleus|synaptosome	metal ion binding			ovary(5)|pancreas(1)|central_nervous_system(1)|skin(1)	8				BRCA - Breast invasive adenocarcinoma(193;6.66e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.0032)|Kidney(197;0.00336)														---	---	---	---	capture		Missense_Mutation	SNP	49662655	49662655	1561	3	G	T	T	40	40	BSN	T	1	1
PARP3	10039	broad.mit.edu	37	3	51980220	51980220	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51980220G>T	uc003dby.2	+	9	1508	c.1137G>T	c.(1135-1137)CGG>CGT	p.R379R	PARP3_uc003dbz.2_Silent_p.R386R	NM_005485	NP_005476	Q9Y6F1	PARP3_HUMAN	poly (ADP-ribose) polymerase family, member 3	379	PARP catalytic.				DNA repair|protein ADP-ribosylation	centriole|nucleus	NAD+ ADP-ribosyltransferase activity|protein binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.000541)|KIRC - Kidney renal clear cell carcinoma(197;0.000716)														---	---	---	---	capture		Silent	SNP	51980220	51980220	11879	3	G	T	T	41	41	PARP3	T	2	2
ERC2	26059	broad.mit.edu	37	3	55984525	55984525	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:55984525C>G	uc003dhr.1	-	13	2587	c.2331G>C	c.(2329-2331)AAG>AAC	p.K777N	ERC2_uc003dhq.1_RNA|ERC2_uc003dht.1_Missense_Mutation_p.K256N	NM_015576	NP_056391	O15083	ERC2_HUMAN	cytomatrix protein p110	777	Potential.					cell junction|cytoplasm|cytoskeleton|growth cone|presynaptic membrane|synaptosome	protein binding			ovary(2)	2				KIRC - Kidney renal clear cell carcinoma(284;0.0667)|Kidney(284;0.0873)|OV - Ovarian serous cystadenocarcinoma(275;0.219)														---	---	---	---	capture		Missense_Mutation	SNP	55984525	55984525	5404	3	C	G	G	32	32	ERC2	G	3	3
CADPS	8618	broad.mit.edu	37	3	62423866	62423866	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:62423866G>T	uc003dll.2	-	28	4050	c.3690C>A	c.(3688-3690)GCC>GCA	p.A1230A	CADPS_uc003dlj.1_Silent_p.A185A|CADPS_uc003dlk.1_Silent_p.A678A|CADPS_uc003dlm.2_Silent_p.A1191A|CADPS_uc003dln.2_Silent_p.A1151A	NM_003716	NP_003707	Q9ULU8	CAPS1_HUMAN	Ca2+-dependent secretion activator isoform 1	1230	Mediates targeting and association with DCVs (By similarity).			A -> P (in Ref. 6; AAA79701).	exocytosis|protein transport	cell junction|cytoplasmic vesicle membrane|cytosol|synapse	lipid binding|metal ion binding			central_nervous_system(2)|ovary(1)	3		Lung SC(41;0.0452)		BRCA - Breast invasive adenocarcinoma(55;5.98e-05)|KIRC - Kidney renal clear cell carcinoma(15;0.0246)|Kidney(15;0.0334)														---	---	---	---	capture		Silent	SNP	62423866	62423866	2686	3	G	T	T	39	39	CADPS	T	1	1
PDZRN3	23024	broad.mit.edu	37	3	73433323	73433323	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:73433323C>T	uc003dpl.1	-	10	2490	c.2394G>A	c.(2392-2394)ACG>ACA	p.T798T	PDZRN3_uc011bgh.1_Silent_p.T455T|PDZRN3_uc010hoe.1_Silent_p.T496T|PDZRN3_uc011bgf.1_Silent_p.T515T|PDZRN3_uc011bgg.1_Silent_p.T518T	NM_015009	NP_055824	Q9UPQ7	PZRN3_HUMAN	PDZ domain containing ring finger 3	798							ubiquitin-protein ligase activity|zinc ion binding			pancreas(2)|ovary(2)|skin(2)|large_intestine(1)	7		Prostate(10;0.114)|Lung NSC(201;0.187)|Lung SC(41;0.236)		BRCA - Breast invasive adenocarcinoma(55;0.00041)|Epithelial(33;0.0023)|LUSC - Lung squamous cell carcinoma(21;0.0048)|Lung(16;0.0105)|KIRC - Kidney renal clear cell carcinoma(39;0.111)|Kidney(39;0.134)														---	---	---	---	capture		Silent	SNP	73433323	73433323	12130	3	C	T	T	23	23	PDZRN3	T	1	1
OR5H15	403274	broad.mit.edu	37	3	97888265	97888265	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97888265G>A	uc011bgu.1	+	1	722	c.722G>A	c.(721-723)TGT>TAT	p.C241Y		NM_001005515	NP_001005515	A6NDH6	O5H15_HUMAN	olfactory receptor, family 5, subfamily H,	241	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	97888265	97888265	11571	3	G	A	A	48	48	OR5H15	A	2	2
FILIP1L	11259	broad.mit.edu	37	3	99552094	99552094	+	Silent	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:99552094A>T	uc003dtm.2	-	6	3856	c.3393T>A	c.(3391-3393)CTT>CTA	p.L1131L	C3orf26_uc003dtk.1_Intron|C3orf26_uc003dtl.2_Intron|FILIP1L_uc010hpf.2_Silent_p.L707L|FILIP1L_uc010hpg.2_Silent_p.L891L	NM_182909	NP_878913	Q4L180	FIL1L_HUMAN	filamin A interacting protein 1-like isoform 1	1131						cytoplasm|membrane|myosin complex|nucleus				ovary(1)	1																		---	---	---	---	capture		Silent	SNP	99552094	99552094	6133	3	A	T	T	9	9	FILIP1L	T	4	4
B4GALT4	8702	broad.mit.edu	37	3	118948703	118948703	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:118948703G>C	uc003ecg.2	-	3	885	c.244C>G	c.(244-246)CCT>GCT	p.P82A	B4GALT4_uc003ece.1_Missense_Mutation_p.P82A|B4GALT4_uc003ecf.2_RNA|B4GALT4_uc003ech.2_Missense_Mutation_p.P82A|B4GALT4_uc003eci.2_Missense_Mutation_p.P82A|B4GALT4_uc011biy.1_Intron	NM_212543	NP_997708	O60513	B4GT4_HUMAN	UDP-Gal:betaGlcNAc beta 1,4-	82	Lumenal (Potential).				membrane lipid metabolic process|post-translational protein modification|protein N-linked glycosylation via asparagine	Golgi cisterna membrane|integral to membrane	metal ion binding|N-acetyllactosamine synthase activity				0				GBM - Glioblastoma multiforme(114;0.222)	N-Acetyl-D-glucosamine(DB00141)													---	---	---	---	capture		Missense_Mutation	SNP	118948703	118948703	1294	3	G	C	C	41	41	B4GALT4	C	3	3
KALRN	8997	broad.mit.edu	37	3	124437893	124437893	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124437893T>A	uc003ehg.2	+	60	8664	c.8537T>A	c.(8536-8538)TTT>TAT	p.F2846Y	KALRN_uc003ehk.2_Missense_Mutation_p.F1149Y	NM_001024660	NP_001019831	O60229	KALRN_HUMAN	kalirin, RhoGEF kinase isoform 1	2845	Protein kinase.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|nervous system development|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|vesicle-mediated transport	actin cytoskeleton|cytosol	ATP binding|GTPase activator activity|metal ion binding|protein binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(2)|ovary(2)|central_nervous_system(1)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	124437893	124437893	8279	3	T	A	A	64	64	KALRN	A	4	4
KIAA1257	57501	broad.mit.edu	37	3	128712011	128712011	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128712011G>C	uc003elj.3	-	2	333	c.137C>G	c.(136-138)TCT>TGT	p.S46C	KIAA1257_uc003elg.1_Missense_Mutation_p.S46C|KIAA1257_uc003eli.3_5'Flank	NM_020741	NP_065792	Q9ULG3	K1257_HUMAN	hypothetical protein LOC57501	46											0																		---	---	---	---	capture		Missense_Mutation	SNP	128712011	128712011	8527	3	G	C	C	33	33	KIAA1257	C	3	3
KY	339855	broad.mit.edu	37	3	134322631	134322631	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:134322631G>T	uc010hty.2	-	11	1838	c.1776C>A	c.(1774-1776)AAC>AAA	p.N592K	KY_uc011blw.1_3'UTR|KY_uc011blx.1_Missense_Mutation_p.N571K	NM_178554	NP_848649	Q8NBH2	KY_HUMAN	kyphoscoliosis peptidase	Error:Variant_position_missing_in_Q8NBH2_after_alignment						cytoskeleton|Z disc	peptidase activity			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	134322631	134322631	8909	3	G	T	T	44	44	KY	T	2	2
SLC9A9	285195	broad.mit.edu	37	3	143412110	143412110	+	Silent	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:143412110A>G	uc003evn.2	-	5	755	c.573T>C	c.(571-573)GCT>GCC	p.A191A	SLC9A9_uc011bnk.1_Silent_p.A65A	NM_173653	NP_775924	Q8IVB4	SL9A9_HUMAN	solute carrier family 9 (sodium/hydrogen	191					regulation of pH	integral to membrane|late endosome membrane|recycling endosome	sodium:hydrogen antiporter activity			ovary(2)|skin(1)	3																		---	---	---	---	capture		Silent	SNP	143412110	143412110	15218	3	A	G	G	7	7	SLC9A9	G	4	4
PLCH1	23007	broad.mit.edu	37	3	155200017	155200017	+	Silent	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:155200017A>G	uc011bok.1	-	23	4099	c.3822T>C	c.(3820-3822)GTT>GTC	p.V1274V	PLCH1_uc011boj.1_3'UTR|PLCH1_uc011bol.1_Silent_p.V1236V	NM_001130960	NP_001124432	Q4KWH8	PLCH1_HUMAN	phospholipase C eta 1 isoform a	1274					lipid catabolic process|phosphatidylinositol-mediated signaling	membrane	calcium ion binding|calcium-dependent phospholipase C activity|phosphatidylinositol phospholipase C activity|signal transducer activity			skin(3)|ovary(1)	4			Lung(72;0.11)|LUSC - Lung squamous cell carcinoma(72;0.114)															---	---	---	---	capture		Silent	SNP	155200017	155200017	12463	3	A	G	G	1	1	PLCH1	G	4	4
SI	6476	broad.mit.edu	37	3	164700802	164700802	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164700802A>T	uc003fei.2	-	46	5297	c.5235T>A	c.(5233-5235)TTT>TTA	p.F1745L		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	1745	Sucrase.|Lumenal.		F -> C (in CSID).		carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---	capture		Missense_Mutation	SNP	164700802	164700802	14792	3	A	T	T	13	13	SI	T	4	4
SI	6476	broad.mit.edu	37	3	164767661	164767661	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164767661G>T	uc003fei.2	-	14	1577	c.1515C>A	c.(1513-1515)GAC>GAA	p.D505E		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	505	Lumenal.|Isomaltase.	Nucleophile.			carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---	capture		Missense_Mutation	SNP	164767661	164767661	14792	3	G	T	T	48	48	SI	T	2	2
SI	6476	broad.mit.edu	37	3	164780170	164780170	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164780170G>T	uc003fei.2	-	9	1071	c.1009C>A	c.(1009-1011)CAG>AAG	p.Q337K		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	337	Lumenal.|Isomaltase.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---	capture		Missense_Mutation	SNP	164780170	164780170	14792	3	G	T	T	48	48	SI	T	2	2
SI	6476	broad.mit.edu	37	3	164793779	164793779	+	Nonsense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164793779C>A	uc003fei.2	-	2	84	c.22G>T	c.(22-24)GGA>TGA	p.G8*		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	8	Cytoplasmic.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---	capture		Nonsense_Mutation	SNP	164793779	164793779	14792	3	C	A	A	21	21	SI	A	5	2
ZMAT3	64393	broad.mit.edu	37	3	178785487	178785487	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:178785487C>A	uc003fjg.2	-	2	313	c.54G>T	c.(52-54)TCG>TCT	p.S18S	ZMAT3_uc010hxa.2_Silent_p.S18S|ZMAT3_uc003fji.2_Silent_p.S18S	NM_022470	NP_071915	Q9HA38	ZMAT3_HUMAN	p53 target zinc finger protein isoform 1	18					apoptosis|protein transport|regulation of growth|response to DNA damage stimulus|transmembrane transport	nucleolus	RNA binding|zinc ion binding			ovary(2)	2	all_cancers(143;3.31e-18)|Ovarian(172;0.00769)|Breast(254;0.155)		OV - Ovarian serous cystadenocarcinoma(80;6.74e-27)|GBM - Glioblastoma multiforme(14;0.00448)|BRCA - Breast invasive adenocarcinoma(182;0.0527)															---	---	---	---	capture		Silent	SNP	178785487	178785487	18284	3	C	A	A	27	27	ZMAT3	A	1	1
BDH1	622	broad.mit.edu	37	3	197238900	197238900	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:197238900C>T	uc003fxr.2	-	8	1300	c.898G>A	c.(898-900)GAT>AAT	p.D300N	BDH1_uc003fxs.2_Missense_Mutation_p.D300N|BDH1_uc003fxt.2_Missense_Mutation_p.D213N|BDH1_uc003fxu.2_Missense_Mutation_p.D300N	NM_203314	NP_976059	Q02338	BDH_HUMAN	3-hydroxybutyrate dehydrogenase, type 1	300					cellular lipid metabolic process|ketone body biosynthetic process|ketone body catabolic process	mitochondrial matrix	3-hydroxybutyrate dehydrogenase activity			ovary(1)	1	all_cancers(143;3.35e-10)|Ovarian(172;0.0418)|Breast(254;0.0437)	Lung NSC(153;0.118)	Epithelial(36;3.52e-24)|all cancers(36;1.79e-22)|OV - Ovarian serous cystadenocarcinoma(49;2.32e-19)|LUSC - Lung squamous cell carcinoma(58;1.02e-06)|Lung(62;1.34e-06)	GBM - Glioblastoma multiforme(93;0.0977)	NADH(DB00157)													---	---	---	---	capture		Missense_Mutation	SNP	197238900	197238900	1412	3	C	T	T	31	31	BDH1	T	1	1
ZNF595	152687	broad.mit.edu	37	4	86363	86363	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:86363G>C	uc003fzv.1	+	6	1125	c.969G>C	c.(967-969)CAG>CAC	p.Q323H	ZNF595_uc003fzu.1_Intron|ZNF718_uc003fzt.3_Intron|ZNF595_uc011bus.1_Missense_Mutation_p.Q91H|ZNF595_uc011but.1_Missense_Mutation_p.Q91H	NM_182524	NP_872330	Q7Z3I0	Q7Z3I0_HUMAN	zinc finger protein 595	323					regulation of transcription, DNA-dependent	intracellular	nucleic acid binding|zinc ion binding				0		all_cancers(4;0.0738)|all_epithelial(65;0.139)		Lung(54;0.0654)|Epithelial(2;0.0921)|all cancers(2;0.146)|LUSC - Lung squamous cell carcinoma(95;0.173)														---	---	---	---	capture		Missense_Mutation	SNP	86363	86363	18620	4	G	C	C	36	36	ZNF595	C	3	3
PIGG	54872	broad.mit.edu	37	4	493149	493149	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:493149G>A	uc003gak.3	+	1	161	c.25G>A	c.(25-27)GCT>ACT	p.A9T	PIGG_uc003gaj.3_Missense_Mutation_p.A9T|PIGG_uc011bux.1_RNA|PIGG_uc010ibf.2_Missense_Mutation_p.A9T|PIGG_uc003gal.3_Intron|ZNF721_uc003gag.2_5'UTR|ZNF721_uc010ibe.2_5'UTR|ZNF721_uc003gah.1_RNA|PIGG_uc003gai.2_RNA|PIGG_uc011buw.1_5'UTR|PIGG_uc003gam.2_5'UTR|PIGG_uc003gan.2_5'UTR	NM_001127178	NP_001120650	Q5H8A4	PIGG_HUMAN	phosphatidylinositol glycan anchor biosynthesis,	9	Lumenal (Potential).				C-terminal protein lipidation|preassembly of GPI anchor in ER membrane	endoplasmic reticulum membrane|integral to membrane	CP2 mannose-ethanolamine phosphotransferase activity			central_nervous_system(2)|ovary(1)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	493149	493149	12312	4	G	A	A	38	38	PIGG	A	1	1
PIGG	54872	broad.mit.edu	37	4	499606	499606	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:499606G>C	uc003gak.3	+	3	596	c.460G>C	c.(460-462)GCT>CCT	p.A154P	PIGG_uc003gaj.3_Missense_Mutation_p.A154P|PIGG_uc011bux.1_RNA|PIGG_uc010ibf.2_Intron|PIGG_uc003gal.3_Missense_Mutation_p.A65P|PIGG_uc003gai.2_RNA|PIGG_uc011buw.1_Missense_Mutation_p.A32P|PIGG_uc003gam.2_Missense_Mutation_p.A65P|PIGG_uc003gan.2_Missense_Mutation_p.A65P	NM_001127178	NP_001120650	Q5H8A4	PIGG_HUMAN	phosphatidylinositol glycan anchor biosynthesis,	154	Lumenal (Potential).				C-terminal protein lipidation|preassembly of GPI anchor in ER membrane	endoplasmic reticulum membrane|integral to membrane	CP2 mannose-ethanolamine phosphotransferase activity			central_nervous_system(2)|ovary(1)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	499606	499606	12312	4	G	C	C	34	34	PIGG	C	3	3
DHX15	1665	broad.mit.edu	37	4	24556484	24556484	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:24556484C>A	uc003gqx.2	-	5	1112	c.944G>T	c.(943-945)CGT>CTT	p.R315L		NM_001358	NP_001349	O43143	DHX15_HUMAN	DEAH (Asp-Glu-Ala-His) box polypeptide 15	315					mRNA processing	U12-type spliceosomal complex	ATP binding|ATP-dependent helicase activity|nucleic acid binding|RNA helicase activity			ovary(1)	1		Breast(46;0.0503)																---	---	---	---	capture		Missense_Mutation	SNP	24556484	24556484	4680	4	C	A	A	19	19	DHX15	A	1	1
ANAPC4	29945	broad.mit.edu	37	4	25391798	25391798	+	Nonsense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:25391798G>T	uc003gro.2	+	8	685	c.556G>T	c.(556-558)GAG>TAG	p.E186*	ANAPC4_uc003grp.2_Nonsense_Mutation_p.E71*|ANAPC4_uc010iet.1_5'UTR|ANAPC4_uc010ieu.1_5'UTR	NM_013367	NP_037499	Q9UJX5	APC4_HUMAN	anaphase-promoting complex subunit 4	186					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell division|G2/M transition of mitotic cell cycle|mitotic anaphase|mitotic cell cycle spindle assembly checkpoint|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|cytosol|nucleoplasm	protein phosphatase binding|ubiquitin-protein ligase activity			ovary(2)|large_intestine(1)|pancreas(1)|skin(1)	5		Breast(46;0.0503)																---	---	---	---	capture		Nonsense_Mutation	SNP	25391798	25391798	607	4	G	T	T	45	45	ANAPC4	T	5	2
PGM2	55276	broad.mit.edu	37	4	37841787	37841787	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:37841787G>A	uc011byb.1	+	6	698	c.625G>A	c.(625-627)GAT>AAT	p.D209N	PGM2_uc011bya.1_Missense_Mutation_p.D70N|PGM2_uc011byc.1_Missense_Mutation_p.D49N	NM_018290	NP_060760	Q96G03	PGM2_HUMAN	phosphoglucomutase 2	209					glucose 1-phosphate metabolic process|glycogen biosynthetic process|glycogen catabolic process	cytosol	magnesium ion binding|phosphoglucomutase activity|phosphopentomutase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	37841787	37841787	12221	4	G	A	A	37	37	PGM2	A	1	1
BEND4	389206	broad.mit.edu	37	4	42145769	42145769	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:42145769C>A	uc003gwn.2	-	3	1310	c.730G>T	c.(730-732)GCC>TCC	p.A244S	BEND4_uc003gwm.2_Missense_Mutation_p.A244S|BEND4_uc011byy.1_Missense_Mutation_p.A244S	NM_207406	NP_997289	Q6ZU67	BEND4_HUMAN	BEN domain containing 4 isoform a	244											0																		---	---	---	---	capture		Missense_Mutation	SNP	42145769	42145769	1423	4	C	A	A	25	25	BEND4	A	2	2
GABRG1	2565	broad.mit.edu	37	4	46043106	46043106	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:46043106G>C	uc003gxb.2	-	9	1449	c.1297C>G	c.(1297-1299)CAC>GAC	p.H433D		NM_173536	NP_775807	Q8N1C3	GBRG1_HUMAN	gamma-aminobutyric acid A receptor, gamma 1	433	Cytoplasmic (Probable).				gamma-aminobutyric acid signaling pathway	cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity			ovary(2)	2				Lung(65;0.106)|LUSC - Lung squamous cell carcinoma(721;0.23)														---	---	---	---	capture		Missense_Mutation	SNP	46043106	46043106	6422	4	G	C	C	48	48	GABRG1	C	3	3
GABRA4	2557	broad.mit.edu	37	4	46967068	46967068	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:46967068G>T	uc003gxg.2	-	8	1192	c.1053C>A	c.(1051-1053)GCC>GCA	p.A351A		NM_000809	NP_000800	P48169	GBRA4_HUMAN	gamma-aminobutyric acid A receptor, alpha 4	351	Cytoplasmic (Probable).				gamma-aminobutyric acid signaling pathway	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	benzodiazepine receptor activity|chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)|upper_aerodigestive_tract(1)|breast(1)	4					Alprazolam(DB00404)|Ethchlorvynol(DB00189)|Flunitrazepam(DB01544)|Flurazepam(DB00690)|Lorazepam(DB00186)|Meprobamate(DB00371)|Midazolam(DB00683)													---	---	---	---	capture		Silent	SNP	46967068	46967068	6414	4	G	T	T	47	47	GABRA4	T	2	2
GABRA4	2557	broad.mit.edu	37	4	46973213	46973213	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:46973213C>A	uc003gxg.2	-	7	900	c.761G>T	c.(760-762)CGG>CTG	p.R254L		NM_000809	NP_000800	P48169	GBRA4_HUMAN	gamma-aminobutyric acid A receptor, alpha 4	254	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	benzodiazepine receptor activity|chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)|upper_aerodigestive_tract(1)|breast(1)	4					Alprazolam(DB00404)|Ethchlorvynol(DB00189)|Flunitrazepam(DB01544)|Flurazepam(DB00690)|Lorazepam(DB00186)|Meprobamate(DB00371)|Midazolam(DB00683)													---	---	---	---	capture		Missense_Mutation	SNP	46973213	46973213	6414	4	C	A	A	23	23	GABRA4	A	1	1
CORIN	10699	broad.mit.edu	37	4	47655610	47655610	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47655610G>A	uc003gxm.2	-	13	1896	c.1803C>T	c.(1801-1803)GGC>GGT	p.G601G	CORIN_uc011bzf.1_Silent_p.G462G|CORIN_uc011bzg.1_Silent_p.G534G|CORIN_uc011bzh.1_Silent_p.G564G	NM_006587	NP_006578	Q9Y5Q5	CORIN_HUMAN	corin	601	Extracellular (Potential).|LDL-receptor class A 5.				peptide hormone processing|regulation of systemic arterial blood pressure by atrial natriuretic peptide	integral to membrane|plasma membrane	scavenger receptor activity|serine-type endopeptidase activity|serine-type exopeptidase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	47655610	47655610	3890	4	G	A	A	42	42	CORIN	A	2	2
SGCB	6443	broad.mit.edu	37	4	52890241	52890241	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:52890241C>A	uc003gzj.2	-	6	899	c.839G>T	c.(838-840)GGT>GTT	p.G280V	SGCB_uc011bzp.1_Missense_Mutation_p.G210V	NM_000232	NP_000223	Q16585	SGCB_HUMAN	sarcoglycan, beta	280	Extracellular (Potential).|Cys-rich.				cytoskeleton organization|muscle organ development	cytoplasm|cytoskeleton|integral to plasma membrane|sarcoglycan complex|sarcolemma					0			GBM - Glioblastoma multiforme(4;7.63e-12)|LUSC - Lung squamous cell carcinoma(32;0.00204)															---	---	---	---	capture		Missense_Mutation	SNP	52890241	52890241	14691	4	C	A	A	18	18	SGCB	A	2	2
SPATA18	132671	broad.mit.edu	37	4	52926996	52926996	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:52926996G>T	uc003gzl.2	+	3	520	c.242G>T	c.(241-243)TGG>TTG	p.W81L	SPATA18_uc010igl.1_RNA|SPATA18_uc011bzq.1_Missense_Mutation_p.W81L|SPATA18_uc003gzk.1_Missense_Mutation_p.W81L	NM_145263	NP_660306	Q8TC71	MIEAP_HUMAN	spermatogenesis associated 18 homolog	81					mitochondrial protein catabolic process|mitochondrion degradation by induced vacuole formation|response to DNA damage stimulus	mitochondrial outer membrane	protein binding			ovary(2)|skin(2)	4			GBM - Glioblastoma multiforme(4;1.77e-13)|LUSC - Lung squamous cell carcinoma(32;0.00204)															---	---	---	---	capture		Missense_Mutation	SNP	52926996	52926996	15511	4	G	T	T	47	47	SPATA18	T	2	2
PDGFRA	5156	broad.mit.edu	37	4	54257635	54257635	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:54257635G>C	uc003haa.2	+	9	861	c.675G>C	c.(673-675)GAG>GAC	p.E225D	FIP1L1_uc003gzx.3_Missense_Mutation_p.E210D|FIP1L1_uc011bzt.1_Missense_Mutation_p.E225D|FIP1L1_uc003gzy.2_Missense_Mutation_p.E225D|FIP1L1_uc011bzu.1_Missense_Mutation_p.E210D|FIP1L1_uc003gzz.2_Intron|FIP1L1_uc003hab.2_Intron|FIP1L1_uc003hac.2_Intron	NM_006206	NP_006197	P16234	PGFRA_HUMAN	platelet-derived growth factor receptor alpha	Error:Variant_position_missing_in_P16234_after_alignment					cardiac myofibril assembly|cell activation|luteinization|metanephric glomerular capillary formation|peptidyl-tyrosine phosphorylation|positive regulation of cell migration|positive regulation of DNA replication|positive regulation of fibroblast proliferation|protein autophosphorylation|retina vasculature development in camera-type eye	cytoplasm|integral to plasma membrane|nucleus	ATP binding|platelet-derived growth factor alpha-receptor activity|platelet-derived growth factor binding|platelet-derived growth factor receptor binding|protein homodimerization activity|vascular endothelial growth factor receptor activity			soft_tissue(572)|small_intestine(40)|stomach(16)|lung(16)|central_nervous_system(13)|haematopoietic_and_lymphoid_tissue(7)|skin(3)|ovary(3)|gastrointestinal_tract_(site_indeterminate)(1)|autonomic_ganglia(1)|prostate(1)|bone(1)	674	all_cancers(7;0.000425)|all_lung(4;0.000343)|Lung NSC(11;0.000467)|all_epithelial(27;0.0131)|all_neural(26;0.0209)|Glioma(25;0.08)		GBM - Glioblastoma multiforme(1;4.18e-71)|all cancers(1;4.76e-45)|LUSC - Lung squamous cell carcinoma(32;0.00256)		Becaplermin(DB00102)|Imatinib(DB00619)|Sunitinib(DB01268)			Mis|O|T	FIP1L1	GIST|idiopathic hypereosinophilic syndrome				Gastrointestinal_Stromal_Tumors_Sporadic_Multiple_Primary|Familial_Intestinal_Neurofibromatosis	TSP Lung(21;0.16)			---	---	---	---	capture		Missense_Mutation	SNP	54257635	54257635	12082	4	G	C	C	33	33	PDGFRA	C	3	3
KIAA1211	57482	broad.mit.edu	37	4	57182429	57182429	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57182429G>T	uc003hbk.2	+	8	3152	c.2761G>T	c.(2761-2763)GCT>TCT	p.A921S	KIAA1211_uc010iha.2_Missense_Mutation_p.A914S|KIAA1211_uc011bzz.1_Missense_Mutation_p.A831S|KIAA1211_uc003hbm.1_Missense_Mutation_p.A807S	NM_020722	NP_065773	Q6ZU35	K1211_HUMAN	hypothetical protein LOC57482	921										ovary(1)|skin(1)	2	Glioma(25;0.08)|all_neural(26;0.101)																	---	---	---	---	capture		Missense_Mutation	SNP	57182429	57182429	8523	4	G	T	T	38	38	KIAA1211	T	1	1
UNC5C	8633	broad.mit.edu	37	4	96127913	96127913	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:96127913G>T	uc003htp.1	-	11	1922	c.1768C>A	c.(1768-1770)CCT>ACT	p.P590T	UNC5C_uc010ilc.1_Missense_Mutation_p.P609T	NM_003728	NP_003719	O95185	UNC5C_HUMAN	unc5C precursor	590	Cytoplasmic (Potential).|ZU5.				apoptosis|axon guidance|brain development	integral to membrane	netrin receptor activity			ovary(3)|pancreas(1)	4		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;8.72e-10)														---	---	---	---	capture		Missense_Mutation	SNP	96127913	96127913	17551	4	G	T	T	43	43	UNC5C	T	2	2
ANK2	287	broad.mit.edu	37	4	114195682	114195682	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:114195682G>A	uc003ibe.3	+	15	1660	c.1560G>A	c.(1558-1560)ATG>ATA	p.M520I	ANK2_uc003ibd.3_Missense_Mutation_p.M499I|ANK2_uc003ibf.3_Missense_Mutation_p.M520I|ANK2_uc003ibc.2_Missense_Mutation_p.M496I|ANK2_uc011cgb.1_Missense_Mutation_p.M535I	NM_001148	NP_001139	Q01484	ANK2_HUMAN	ankyrin 2 isoform 1	520	ANK 15.				axon guidance|signal transduction	apical plasma membrane|basolateral plasma membrane|cytoskeleton|cytosol|sarcomere	protein binding|protein binding			central_nervous_system(7)|ovary(3)|large_intestine(2)|breast(1)|skin(1)	14		Ovarian(17;0.0448)|Hepatocellular(203;0.218)		OV - Ovarian serous cystadenocarcinoma(123;4.92e-05)														---	---	---	---	capture		Missense_Mutation	SNP	114195682	114195682	624	4	G	A	A	47	47	ANK2	A	2	2
SLC25A31	83447	broad.mit.edu	37	4	128651829	128651829	+	Silent	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:128651829G>C	uc003ifl.2	+	1	275	c.129G>C	c.(127-129)CGG>CGC	p.R43R		NM_031291	NP_112581	Q9H0C2	ADT4_HUMAN	solute carrier family 25 (mitochondrial carrier;	43	Solcar 1.|Helical; Name=1; (Potential).				transmembrane transport	cilium|flagellum|integral to membrane|mitochondrial inner membrane	binding|transporter activity				0																		---	---	---	---	capture		Silent	SNP	128651829	128651829	14992	4	G	C	C	43	43	SLC25A31	C	3	3
POU4F2	5458	broad.mit.edu	37	4	147561554	147561554	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:147561554C>A	uc003ikv.2	+	2	1072	c.824C>A	c.(823-825)ACC>AAC	p.T275N		NM_004575	NP_004566	Q12837	PO4F2_HUMAN	Brn3b POU domain transcription factor	275	POU-specific.				estrogen receptor signaling pathway|MAPKKK cascade|negative regulation of transcription from RNA polymerase II promoter	nuclear speck	RNA polymerase II core promoter proximal region sequence-specific DNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription			breast(1)	1	all_hematologic(180;0.151)																	---	---	---	---	capture		Missense_Mutation	SNP	147561554	147561554	12709	4	C	A	A	18	18	POU4F2	A	2	2
LRBA	987	broad.mit.edu	37	4	151771880	151771880	+	Nonsense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:151771880T>A	uc010ipj.2	-	24	4474	c.4000A>T	c.(4000-4002)AGA>TGA	p.R1334*	LRBA_uc003ilt.3_5'Flank|LRBA_uc003ilu.3_Nonsense_Mutation_p.R1334*	NM_006726	NP_006717	P50851	LRBA_HUMAN	LPS-responsive vesicle trafficking, beach and	1334	WD 1.					endoplasmic reticulum|Golgi apparatus|integral to membrane|lysosome|plasma membrane	protein binding			ovary(3)|breast(3)|skin(1)	7	all_hematologic(180;0.151)																	---	---	---	---	capture		Nonsense_Mutation	SNP	151771880	151771880	9304	4	T	A	A	54	54	LRBA	A	5	4
ODZ3	55714	broad.mit.edu	37	4	183714418	183714418	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:183714418G>T	uc003ivd.1	+	25	6630	c.6593G>T	c.(6592-6594)CGT>CTT	p.R2198L		NM_001080477	NP_001073946	Q9P273	TEN3_HUMAN	odz, odd Oz/ten-m homolog 3	2198	Extracellular (Potential).				signal transduction	integral to membrane					0		all_lung(41;2.69e-14)|Lung NSC(41;1.92e-11)|Melanoma(52;1.74e-05)|Colorectal(36;0.0062)|Breast(14;0.00748)|all_hematologic(60;0.0162)|Renal(120;0.0246)|Hepatocellular(41;0.0268)|Prostate(90;0.0283)|all_neural(102;0.155)|Medulloblastoma(177;0.184)		all cancers(43;1.42e-24)|Epithelial(43;6.86e-23)|OV - Ovarian serous cystadenocarcinoma(60;2.16e-11)|Colorectal(24;9.75e-06)|STAD - Stomach adenocarcinoma(60;2.96e-05)|COAD - Colon adenocarcinoma(29;0.00103)|GBM - Glioblastoma multiforme(59;0.00462)|LUSC - Lung squamous cell carcinoma(40;0.0391)|READ - Rectum adenocarcinoma(43;0.0487)														---	---	---	---	capture		Missense_Mutation	SNP	183714418	183714418	11241	4	G	T	T	40	40	ODZ3	T	1	1
CTNND2	1501	broad.mit.edu	37	5	11364909	11364909	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:11364909T>C	uc003jfa.1	-	8	1416	c.1271A>G	c.(1270-1272)TAT>TGT	p.Y424C	CTNND2_uc010itt.2_Missense_Mutation_p.Y333C|CTNND2_uc011cmy.1_Missense_Mutation_p.Y87C|CTNND2_uc011cmz.1_5'UTR|CTNND2_uc010itu.1_RNA|CTNND2_uc011cmx.1_5'UTR	NM_001332	NP_001323	Q9UQB3	CTND2_HUMAN	catenin (cadherin-associated protein), delta 2	424	ARM 1.				multicellular organismal development|neuron cell-cell adhesion|regulation of transcription, DNA-dependent|signal transduction|transcription, DNA-dependent	adherens junction|cytoplasm|nucleus	protein binding			large_intestine(2)|ovary(2)|skin(2)|pancreas(1)|lung(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	11364909	11364909	4179	5	T	C	C	49	49	CTNND2	C	4	4
CDH12	1010	broad.mit.edu	37	5	22078761	22078761	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:22078761G>T	uc010iuc.2	-	2	483	c.25C>A	c.(25-27)CTG>ATG	p.L9M	CDH12_uc011cno.1_Missense_Mutation_p.L9M|CDH12_uc003jgk.2_Missense_Mutation_p.L9M	NM_004061	NP_004052	P55289	CAD12_HUMAN	cadherin 12, type 2 preproprotein	9					adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2															HNSCC(59;0.17)			---	---	---	---	capture		Missense_Mutation	SNP	22078761	22078761	3227	5	G	T	T	35	35	CDH12	T	2	2
PRDM9	56979	broad.mit.edu	37	5	23510028	23510028	+	Splice_Site	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:23510028G>C	uc003jgo.2	+	4	376	c.194_splice	c.e4-1	p.G65_splice		NM_020227	NP_064612			PR domain containing 9						meiosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nucleoplasm	histone-lysine N-methyltransferase activity|nucleic acid binding|zinc ion binding			ovary(3)|large_intestine(2)|pancreas(1)	6															HNSCC(3;0.000094)			---	---	---	---	capture		Splice_Site	SNP	23510028	23510028	12906	5	G	C	C	35	35	PRDM9	C	5	3
CDH10	1008	broad.mit.edu	37	5	24487815	24487815	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:24487815A>G	uc003jgr.1	-	12	2656	c.2324T>C	c.(2323-2325)CTA>CCA	p.L775P	CDH10_uc011cnu.1_RNA	NM_006727	NP_006718	Q9Y6N8	CAD10_HUMAN	cadherin 10, type 2 preproprotein	775	Cytoplasmic (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|pancreas(4)|breast(2)	12				STAD - Stomach adenocarcinoma(35;0.0556)											HNSCC(23;0.051)			---	---	---	---	capture		Missense_Mutation	SNP	24487815	24487815	3225	5	A	G	G	15	15	CDH10	G	4	4
UGT3A1	133688	broad.mit.edu	37	5	35965778	35965778	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35965778G>A	uc003jjv.1	-	4	710	c.553C>T	c.(553-555)CCA>TCA	p.P185S	UGT3A1_uc003jjw.1_RNA|UGT3A1_uc011coq.1_Missense_Mutation_p.P185S|UGT3A1_uc011cor.1_Missense_Mutation_p.P151S|UGT3A1_uc003jjy.1_Missense_Mutation_p.P131S	NM_152404	NP_689617	Q6NUS8	UD3A1_HUMAN	UDP glycosyltransferase 3 family, polypeptide A1	185	Extracellular (Potential).					integral to membrane	glucuronosyltransferase activity			ovary(2)|central_nervous_system(1)	3	all_lung(31;0.000197)		Epithelial(62;0.107)|Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---	capture		Missense_Mutation	SNP	35965778	35965778	17521	5	G	A	A	41	41	UGT3A1	A	2	2
C6	729	broad.mit.edu	37	5	41186173	41186173	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41186173T>A	uc003jmk.2	-	6	935	c.725A>T	c.(724-726)GAG>GTG	p.E242V	C6_uc003jml.1_Missense_Mutation_p.E242V	NM_000065	NP_000056	P13671	CO6_HUMAN	complement component 6 precursor	242	MACPF.				complement activation, classical pathway|cytolysis|innate immune response	membrane attack complex	protein binding			ovary(3)|central_nervous_system(2)|skin(2)	7		Breast(839;1.07e-05)|Ovarian(839;0.0228)|Lung SC(612;0.0548)|Lung NSC(810;0.128)|all_neural(839;0.157)																---	---	---	---	capture		Missense_Mutation	SNP	41186173	41186173	2416	5	T	A	A	54	54	C6	A	4	4
FBXO4	26272	broad.mit.edu	37	5	41927343	41927343	+	Missense_Mutation	SNP	A	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41927343A>C	uc003jmq.2	+	2	474	c.418A>C	c.(418-420)ATG>CTG	p.M140L	FBXO4_uc003jmp.2_Missense_Mutation_p.M140L|FBXO4_uc003jmr.2_Missense_Mutation_p.M140L	NM_012176	NP_036308	Q9UKT5	FBX4_HUMAN	F-box only protein 4 isoform 1	140					positive regulation of protein ubiquitination|protein polyubiquitination|SCF-dependent proteasomal ubiquitin-dependent protein catabolic process|telomere maintenance|ubiquitin-dependent protein catabolic process	cytoplasm|SCF ubiquitin ligase complex	protein binding|protein homodimerization activity|ubiquitin-protein ligase activity			liver(1)	1		Lung NSC(810;4.15e-05)|Breast(839;0.00093)|Ovarian(839;0.00965)|Myeloproliferative disorder(839;0.0255)|all_neural(839;0.0604)																---	---	---	---	capture		Missense_Mutation	SNP	41927343	41927343	5985	5	A	C	C	8	8	FBXO4	C	4	4
HCN1	348980	broad.mit.edu	37	5	45262757	45262757	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:45262757G>T	uc003jok.2	-	8	1964	c.1939C>A	c.(1939-1941)CTG>ATG	p.L647M		NM_021072	NP_066550	O60741	HCN1_HUMAN	hyperpolarization activated cyclic	647	Cytoplasmic (Potential).					integral to membrane	cAMP binding|sodium channel activity|voltage-gated potassium channel activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	45262757	45262757	7278	5	G	T	T	35	35	HCN1	T	2	2
HCN1	348980	broad.mit.edu	37	5	45645705	45645705	+	Missense_Mutation	SNP	T	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:45645705T>G	uc003jok.2	-	2	456	c.431A>C	c.(430-432)TAC>TCC	p.Y144S		NM_021072	NP_066550	O60741	HCN1_HUMAN	hyperpolarization activated cyclic	144	Cytoplasmic (Potential).					integral to membrane	cAMP binding|sodium channel activity|voltage-gated potassium channel activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	45645705	45645705	7278	5	T	G	G	57	57	HCN1	G	4	4
VCAN	1462	broad.mit.edu	37	5	82837984	82837984	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:82837984G>T	uc003kii.3	+	8	9518	c.9162G>T	c.(9160-9162)GAG>GAT	p.E3054D	VCAN_uc003kij.3_Missense_Mutation_p.E2067D|VCAN_uc010jau.2_Intron|VCAN_uc003kik.3_Intron|VCAN_uc003kil.3_Missense_Mutation_p.E1718D	NM_004385	NP_004376	P13611	CSPG2_HUMAN	versican isoform 1 precursor	3054	GAG-beta.				cell adhesion|cell recognition|glial cell migration	extracellular space|proteinaceous extracellular matrix	calcium ion binding|hyaluronic acid binding|sugar binding			ovary(7)|skin(6)|lung(2)|central_nervous_system(1)	16		Lung NSC(167;0.0216)|all_lung(232;0.0251)|Ovarian(174;0.142)		OV - Ovarian serous cystadenocarcinoma(54;2.47e-41)|Epithelial(54;2.51e-34)|all cancers(79;5.19e-29)														---	---	---	---	capture		Missense_Mutation	SNP	82837984	82837984	17703	5	G	T	T	35	35	VCAN	T	2	2
KCNN2	3781	broad.mit.edu	37	5	113740484	113740484	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:113740484G>T	uc003kqo.2	+	3	1389	c.932G>T	c.(931-933)GGA>GTA	p.G311V		NM_021614	NP_067627	Q9H2S1	KCNN2_HUMAN	small conductance calcium-activated potassium	311	Helical; Name=Segment S5; (Potential).					integral to membrane	calmodulin binding|small conductance calcium-activated potassium channel activity			ovary(2)	2		all_cancers(142;2.86e-05)|all_epithelial(76;9.33e-06)|Prostate(80;0.00955)|Ovarian(225;0.0444)|Breast(839;0.159)|Lung NSC(810;0.174)|all_lung(232;0.206)		OV - Ovarian serous cystadenocarcinoma(64;1.89e-08)|Epithelial(69;2.04e-08)|all cancers(49;3.74e-06)|COAD - Colon adenocarcinoma(37;0.142)|Colorectal(14;0.195)														---	---	---	---	capture		Missense_Mutation	SNP	113740484	113740484	8384	5	G	T	T	41	41	KCNN2	T	2	2
KDM3B	51780	broad.mit.edu	37	5	137726770	137726770	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137726770G>C	uc003lcy.1	+	8	1649	c.1449G>C	c.(1447-1449)TTG>TTC	p.L483F	KDM3B_uc010jew.1_Missense_Mutation_p.L139F|KDM3B_uc011cys.1_Intron	NM_016604	NP_057688	Q7LBC6	KDM3B_HUMAN	jumonji domain containing 1B	483					chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			ovary(3)|upper_aerodigestive_tract(2)|lung(2)|kidney(2)|central_nervous_system(1)|skin(1)	11																		---	---	---	---	capture		Missense_Mutation	SNP	137726770	137726770	8433	5	G	C	C	45	45	KDM3B	C	3	3
PCDHA4	56144	broad.mit.edu	37	5	140188233	140188233	+	Silent	SNP	C	T	T	rs139246893		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140188233C>T	uc003lhi.2	+	1	1562	c.1461C>T	c.(1459-1461)AAC>AAT	p.N487N	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhh.1_Silent_p.N487N|PCDHA4_uc011daa.1_Silent_p.N487N	NM_018907	NP_061730	Q9UN74	PCDA4_HUMAN	protocadherin alpha 4 isoform 1 precursor	487	Cadherin 5.|Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding			ovary(4)|skin(2)	6			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---	capture		Silent	SNP	140188233	140188233	11946	5	C	T	T	19	19	PCDHA4	T	1	1
PCDHB14	56122	broad.mit.edu	37	5	140604611	140604611	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140604611C>A	uc003ljb.2	+	1	1534	c.1534C>A	c.(1534-1536)CAC>AAC	p.H512N	PCDHB14_uc011dal.1_Missense_Mutation_p.H359N	NM_018934	NP_061757	Q9Y5E9	PCDBE_HUMAN	protocadherin beta 14 precursor	512	Extracellular (Potential).|Cadherin 5.				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to membrane|plasma membrane	calcium ion binding			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---	capture		Missense_Mutation	SNP	140604611	140604611	11959	5	C	A	A	21	21	PCDHB14	A	2	2
C5orf46	389336	broad.mit.edu	37	5	147281261	147281261	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:147281261A>G	uc010jgp.2	-	2	183	c.146T>C	c.(145-147)CTA>CCA	p.L49P	C5orf46_uc003lou.2_Missense_Mutation_p.L49P|C5orf46_uc003lov.3_Missense_Mutation_p.L49P	NM_206966	NP_996849	Q6UWT4	CE046_HUMAN	hypothetical protein LOC389336 precursor	49						extracellular region					0																		---	---	---	---	capture		Missense_Mutation	SNP	147281261	147281261	2403	5	A	G	G	15	15	C5orf46	G	4	4
HTR4	3360	broad.mit.edu	37	5	147889347	147889347	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:147889347G>A	uc003lpn.2	-	6	912	c.748C>T	c.(748-750)CGC>TGC	p.R250C	HTR4_uc010jgu.1_RNA|HTR4_uc003lpi.1_Missense_Mutation_p.R250C|HTR4_uc003lpj.1_Missense_Mutation_p.R250C|HTR4_uc003lpk.2_Missense_Mutation_p.R250C|HTR4_uc011dby.1_Missense_Mutation_p.R250C|HTR4_uc003lpl.2_Missense_Mutation_p.R264C|HTR4_uc003lpm.2_Missense_Mutation_p.R250C|HTR4_uc010jgv.2_RNA|HTR4_uc003lpo.1_Missense_Mutation_p.R250C	NM_000870	NP_000861	Q13639	5HT4R_HUMAN	serotonin 5-HT4 receptor isoform b	250	Cytoplasmic (By similarity).				G-protein signaling, coupled to cyclic nucleotide second messenger|positive regulation of cell proliferation	endosome|integral to plasma membrane|membrane fraction	serotonin receptor activity			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)		Cisapride(DB00604)|Rizatriptan(DB00953)|Tegaserod(DB01079)|Zolmitriptan(DB00315)													---	---	---	---	capture		Missense_Mutation	SNP	147889347	147889347	7749	5	G	A	A	37	37	HTR4	A	1	1
ARSI	340075	broad.mit.edu	37	5	149676932	149676932	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:149676932C>A	uc003lrv.2	-	2	2144	c.1555G>T	c.(1555-1557)GCT>TCT	p.A519S		NM_001012301	NP_001012301	Q5FYB1	ARSI_HUMAN	arylsulfatase family, member I precursor	519						endoplasmic reticulum|extracellular region	arylsulfatase activity|metal ion binding			ovary(1)|pancreas(1)	2			KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)															---	---	---	---	capture		Missense_Mutation	SNP	149676932	149676932	1012	5	C	A	A	25	25	ARSI	A	2	2
TIMD4	91937	broad.mit.edu	37	5	156346549	156346549	+	Silent	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156346549T>C	uc003lwh.2	-	9	1113	c.1056A>G	c.(1054-1056)CTA>CTG	p.L352L	TIMD4_uc010jii.2_Silent_p.L324L|TIMD4_uc003lwg.2_Silent_p.L54L	NM_138379	NP_612388	Q96H15	TIMD4_HUMAN	T-cell immunoglobulin and mucin domain	352	Cytoplasmic (Potential).					integral to membrane				ovary(2)	2	Renal(175;0.00488)	Medulloblastoma(196;0.0523)|all_neural(177;0.21)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)															---	---	---	---	capture		Silent	SNP	156346549	156346549	16432	5	T	C	C	53	53	TIMD4	C	4	4
TIMD4	91937	broad.mit.edu	37	5	156378573	156378573	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156378573G>A	uc003lwh.2	-	3	686	c.629C>T	c.(628-630)ACA>ATA	p.T210I	TIMD4_uc010jii.2_Missense_Mutation_p.T210I	NM_138379	NP_612388	Q96H15	TIMD4_HUMAN	T-cell immunoglobulin and mucin domain	210	Extracellular (Potential).|Thr-rich.					integral to membrane				ovary(2)	2	Renal(175;0.00488)	Medulloblastoma(196;0.0523)|all_neural(177;0.21)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)															---	---	---	---	capture		Missense_Mutation	SNP	156378573	156378573	16432	5	G	A	A	48	48	TIMD4	A	2	2
DOCK2	1794	broad.mit.edu	37	5	169188602	169188602	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:169188602G>T	uc003maf.2	+	25	2607	c.2527G>T	c.(2527-2529)GTC>TTC	p.V843F	DOCK2_uc011der.1_RNA|DOCK2_uc010jjm.2_Missense_Mutation_p.V335F	NM_004946	NP_004937	Q92608	DOCK2_HUMAN	dedicator of cytokinesis 2	843					actin cytoskeleton organization|regulation of defense response to virus by virus|viral reproduction	cytoskeleton|cytosol|endomembrane system|membrane	electron carrier activity|GTP binding|GTPase binding|heme binding|Rac guanyl-nucleotide exchange factor activity|T cell receptor binding			ovary(5)|pancreas(2)	7	Renal(175;0.000159)|Lung NSC(126;0.0221)|all_lung(126;0.0337)	Medulloblastoma(196;0.0399)|all_neural(177;0.0966)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)															---	---	---	---	capture		Missense_Mutation	SNP	169188602	169188602	4871	5	G	T	T	36	36	DOCK2	T	2	2
LCP2	3937	broad.mit.edu	37	5	169697761	169697761	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:169697761G>A	uc003man.1	-	7	692	c.485C>T	c.(484-486)CCT>CTT	p.P162L	LCP2_uc011det.1_5'UTR|LCP2_uc010jjo.1_5'Flank	NM_005565	NP_005556	Q13094	LCP2_HUMAN	lymphocyte cytosolic protein 2	162					immune response|platelet activation|T cell receptor signaling pathway|transmembrane receptor protein tyrosine kinase signaling pathway	cytosol	protein binding			ovary(1)	1	Renal(175;0.000159)|Lung NSC(126;0.0221)|all_lung(126;0.0337)	Medulloblastoma(196;0.0109)|all_neural(177;0.0146)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	OV - Ovarian serous cystadenocarcinoma(192;0.247)														---	---	---	---	capture		Missense_Mutation	SNP	169697761	169697761	9016	5	G	A	A	35	35	LCP2	A	2	2
UNC5A	90249	broad.mit.edu	37	5	176295812	176295812	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176295812G>T	uc003mey.2	+	5	760	c.568G>T	c.(568-570)GTG>TTG	p.V190L	UNC5A_uc003mex.1_Missense_Mutation_p.V190L|UNC5A_uc010jkg.1_Missense_Mutation_p.V150L	NM_133369	NP_588610	Q6ZN44	UNC5A_HUMAN	netrin receptor Unc5h1 precursor	190	Ig-like C2-type.|Extracellular (Potential).				apoptosis|axon guidance|regulation of apoptosis	integral to membrane|plasma membrane				skin(1)	1	all_cancers(89;0.000119)|Renal(175;0.000269)|Lung NSC(126;0.00696)|all_lung(126;0.0115)	Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---	capture		Missense_Mutation	SNP	176295812	176295812	17549	5	G	T	T	44	44	UNC5A	T	2	2
HK3	3101	broad.mit.edu	37	5	176314654	176314654	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176314654C>A	uc003mfa.2	-	11	1490	c.1398G>T	c.(1396-1398)GTG>GTT	p.V466V	HK3_uc003mez.2_Silent_p.V22V	NM_002115	NP_002106	P52790	HXK3_HUMAN	hexokinase 3	466	Regulatory.				glucose transport|glycolysis|transmembrane transport	cytosol|membrane	ATP binding|glucokinase activity			ovary(3)|large_intestine(1)|haematopoietic_and_lymphoid_tissue(1)|breast(1)|skin(1)	7	all_cancers(89;0.000104)|Renal(175;0.000269)|Lung NSC(126;0.00696)|all_lung(126;0.0115)	Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---	capture		Silent	SNP	176314654	176314654	7483	5	C	A	A	21	21	HK3	A	2	2
UIMC1	51720	broad.mit.edu	37	5	176334156	176334156	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176334156C>A	uc011dfp.1	-	13	2038	c.1871G>T	c.(1870-1872)CGA>CTA	p.R624L	UIMC1_uc003mfc.1_Missense_Mutation_p.R501L|UIMC1_uc003mfd.1_Missense_Mutation_p.R254L	NM_016290	NP_057374	Q96RL1	UIMC1_HUMAN	ubiquitin interaction motif containing 1	624					double-strand break repair|G2/M transition DNA damage checkpoint|histone H2A K63-linked deubiquitination|negative regulation of transcription, DNA-dependent|positive regulation of DNA repair|response to ionizing radiation|transcription, DNA-dependent	BRCA1-A complex	histone binding|K63-linked polyubiquitin binding			ovary(3)|skin(1)	4	all_cancers(89;7.96e-05)|Renal(175;0.000269)|Lung NSC(126;0.00476)|all_lung(126;0.00806)	Medulloblastoma(196;0.0145)|all_neural(177;0.0325)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---	capture		Missense_Mutation	SNP	176334156	176334156	17529	5	C	A	A	31	31	UIMC1	A	1	1
FAM50B	26240	broad.mit.edu	37	6	3850460	3850460	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:3850460G>T	uc003mvu.2	+	2	527	c.415G>T	c.(415-417)GCC>TCC	p.A139S		NM_012135	NP_036267	Q9Y247	FA50B_HUMAN	family with sequence similarity 50, member B	139						nucleus				pancreas(1)	1	Ovarian(93;0.0925)	all_hematologic(90;0.108)																---	---	---	---	capture		Missense_Mutation	SNP	3850460	3850460	5800	6	G	T	T	38	38	FAM50B	T	1	1
C6orf146	222826	broad.mit.edu	37	6	4070123	4070123	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:4070123A>T	uc003mvx.2	-	7	674	c.334T>A	c.(334-336)TTT>ATT	p.F112I	C6orf146_uc010jnq.1_Intron|C6orf146_uc003mvy.2_Missense_Mutation_p.F49I	NM_173563	NP_775834	Q8IXS0	CF146_HUMAN	hypothetical protein LOC222826	112										ovary(1)	1	Ovarian(93;0.0925)	all_hematologic(90;0.108)																---	---	---	---	capture		Missense_Mutation	SNP	4070123	4070123	2439	6	A	T	T	3	3	C6orf146	T	4	4
HIST1H4K	8362	broad.mit.edu	37	6	27799002	27799002	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27799002C>A	uc003njr.2	-	1	304	c.304G>T	c.(304-306)GGT>TGT	p.G102C		NM_003541	NP_003532	P62805	H4_HUMAN	histone cluster 1, H4k	102					CenH3-containing nucleosome assembly at centromere|negative regulation of megakaryocyte differentiation|phosphatidylinositol-mediated signaling|telomere maintenance	nucleoplasm|nucleosome	DNA binding|protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	27799002	27799002	7460	6	C	A	A	23	23	HIST1H4K	A	1	1
HIST1H2AK	8330	broad.mit.edu	37	6	27806029	27806029	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27806029C>G	uc003njs.2	-	1	89	c.89G>C	c.(88-90)CGA>CCA	p.R30P	HIST1H2BN_uc003njt.1_5'Flank|HIST1H2BN_uc003nju.1_5'Flank|HIST1H2BN_uc003njv.2_5'Flank	NM_003510	NP_003501	P0C0S8	H2A1_HUMAN	histone cluster 1, H2ak	30					nucleosome assembly	nucleosome|nucleus	DNA binding|enzyme binding			upper_aerodigestive_tract(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	27806029	27806029	7422	6	C	G	G	31	31	HIST1H2AK	G	3	3
CDSN	1041	broad.mit.edu	37	6	31084548	31084548	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31084548G>A	uc003nsm.1	-	2	871	c.844C>T	c.(844-846)CCC>TCC	p.P282S	PSORS1C1_uc003nsl.1_Intron|PSORS1C1_uc010jsj.1_Intron	NM_001264	NP_001255	Q15517	CDSN_HUMAN	corneodesmosin precursor	282	Ser-rich.				cell-cell adhesion|keratinocyte differentiation|skin morphogenesis	cornified envelope|desmosome|extracellular region	protein homodimerization activity			ovary(1)|pancreas(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	31084548	31084548	3308	6	G	A	A	42	42	CDSN	A	2	2
UHRF1BP1	54887	broad.mit.edu	37	6	34839685	34839685	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34839685G>C	uc003oju.3	+	20	4414	c.4180G>C	c.(4180-4182)GAG>CAG	p.E1394Q	UHRF1BP1_uc010jvm.1_RNA|UHRF1BP1_uc010jvn.2_RNA|UHRF1BP1_uc010jvo.2_RNA	NM_017754	NP_060224	Q6BDS2	URFB1_HUMAN	ICBP90 binding protein 1	1394										ovary(3)	3																		---	---	---	---	capture		Missense_Mutation	SNP	34839685	34839685	17526	6	G	C	C	33	33	UHRF1BP1	C	3	3
FRS3	10817	broad.mit.edu	37	6	41738623	41738623	+	Missense_Mutation	SNP	G	A	A	rs142682061		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41738623G>A	uc003orc.1	-	7	1457	c.1213C>T	c.(1213-1215)CGC>TGC	p.R405C		NM_006653	NP_006644	O43559	FRS3_HUMAN	fibroblast growth factor receptor substrate 3	405					fibroblast growth factor receptor signaling pathway	plasma membrane	fibroblast growth factor receptor binding|insulin receptor binding			ovary(2)	2	Ovarian(28;0.0355)|Colorectal(47;0.121)		Epithelial(12;8.38e-05)|STAD - Stomach adenocarcinoma(11;0.000204)|Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)															---	---	---	---	capture		Missense_Mutation	SNP	41738623	41738623	6312	6	G	A	A	39	39	FRS3	A	1	1
HSP90AB1	3326	broad.mit.edu	37	6	44218232	44218232	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44218232A>T	uc003oxa.1	+	6	937	c.853A>T	c.(853-855)ACC>TCC	p.T285S	HSP90AB1_uc011dvr.1_Missense_Mutation_p.T275S|HSP90AB1_uc003oxb.1_Missense_Mutation_p.T285S|HSP90AB1_uc011dvs.1_Missense_Mutation_p.T105S|HSP90AB1_uc003oxc.1_5'UTR	NM_007355	NP_031381	P08238	HS90B_HUMAN	heat shock 90kDa protein 1, beta	285					axon guidance|negative regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of nitric oxide biosynthetic process|protein folding|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|response to unfolded protein	cytosol|melanosome	ATP binding|nitric-oxide synthase regulator activity|TPR domain binding|unfolded protein binding			lung(3)|breast(1)	4	all_cancers(18;1.7e-05)|all_lung(25;0.00747)|Hepatocellular(11;0.00908)|Ovarian(13;0.0273)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)															---	---	---	---	capture		Missense_Mutation	SNP	44218232	44218232	7701	6	A	T	T	10	10	HSP90AB1	T	4	4
TDRD6	221400	broad.mit.edu	37	6	46661523	46661523	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:46661523C>T	uc003oyj.2	+	1	5658	c.5658C>T	c.(5656-5658)GGC>GGT	p.G1886G	TDRD6_uc010jze.2_Silent_p.G1880G	NM_001010870	NP_001010870	O60522	TDRD6_HUMAN	tudor domain containing 6	1886					cell differentiation|multicellular organismal development|spermatogenesis	chromatoid body	nucleic acid binding			breast(3)|ovary(2)|skin(1)	6			Lung(136;0.192)															---	---	---	---	capture		Silent	SNP	46661523	46661523	16261	6	C	T	T	27	27	TDRD6	T	1	1
GPR111	222611	broad.mit.edu	37	6	47647862	47647862	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47647862C>A	uc010jzj.1	+	5	528	c.527C>A	c.(526-528)ACT>AAT	p.T176N	GPR111_uc010jzk.1_Missense_Mutation_p.T108N|GPR111_uc003oyy.2_RNA	NM_153839	NP_722581	Q8IZF7	GP111_HUMAN	G-protein coupled receptor 111	176	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	47647862	47647862	6902	6	C	A	A	20	20	GPR111	A	2	2
GPR111	222611	broad.mit.edu	37	6	47649302	47649302	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47649302C>A	uc010jzj.1	+	6	1008	c.1007C>A	c.(1006-1008)CCT>CAT	p.P336H	GPR111_uc010jzk.1_Missense_Mutation_p.P268H|GPR111_uc003oyy.2_RNA	NM_153839	NP_722581	Q8IZF7	GP111_HUMAN	G-protein coupled receptor 111	336	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	47649302	47649302	6902	6	C	A	A	24	24	GPR111	A	2	2
CRISP3	10321	broad.mit.edu	37	6	49696558	49696558	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49696558T>C	uc003ozs.2	-	8	638	c.623A>G	c.(622-624)AAG>AGG	p.K208R		NM_006061	NP_006052	P54108	CRIS3_HUMAN	cysteine-rich secretory protein 3 precursor	208					innate immune response	proteinaceous extracellular matrix|specific granule				skin(2)	2	Lung NSC(77;0.0161)		KIRC - Kidney renal clear cell carcinoma(2;0.106)|Kidney(12;0.156)															---	---	---	---	capture		Missense_Mutation	SNP	49696558	49696558	4020	6	T	C	C	56	56	CRISP3	C	4	4
FAM83B	222584	broad.mit.edu	37	6	54735284	54735284	+	Silent	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:54735284T>C	uc003pck.2	+	2	356	c.240T>C	c.(238-240)GAT>GAC	p.D80D		NM_001010872	NP_001010872	Q5T0W9	FA83B_HUMAN	hypothetical protein LOC222584	80										ovary(6)	6	Lung NSC(77;0.0178)|Renal(3;0.122)																	---	---	---	---	capture		Silent	SNP	54735284	54735284	5860	6	T	C	C	51	51	FAM83B	C	4	4
FAM83B	222584	broad.mit.edu	37	6	54805042	54805042	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:54805042G>T	uc003pck.2	+	5	1389	c.1273G>T	c.(1273-1275)GTG>TTG	p.V425L		NM_001010872	NP_001010872	Q5T0W9	FA83B_HUMAN	hypothetical protein LOC222584	425										ovary(6)	6	Lung NSC(77;0.0178)|Renal(3;0.122)																	---	---	---	---	capture		Missense_Mutation	SNP	54805042	54805042	5860	6	G	T	T	48	48	FAM83B	T	2	2
FAM83B	222584	broad.mit.edu	37	6	54805695	54805695	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:54805695G>C	uc003pck.2	+	5	2042	c.1926G>C	c.(1924-1926)TTG>TTC	p.L642F		NM_001010872	NP_001010872	Q5T0W9	FA83B_HUMAN	hypothetical protein LOC222584	642										ovary(6)	6	Lung NSC(77;0.0178)|Renal(3;0.122)																	---	---	---	---	capture		Missense_Mutation	SNP	54805695	54805695	5860	6	G	C	C	47	47	FAM83B	C	3	3
GFRAL	389400	broad.mit.edu	37	6	55198715	55198715	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:55198715C>A	uc003pcm.1	+	3	375	c.289C>A	c.(289-291)CTT>ATT	p.L97I		NM_207410	NP_997293	Q6UXV0	GFRAL_HUMAN	GDNF family receptor alpha like precursor	97	Extracellular (Potential).					integral to membrane	receptor activity			ovary(1)|breast(1)	2	Lung NSC(77;0.0875)|Renal(3;0.122)		LUSC - Lung squamous cell carcinoma(124;0.23)															---	---	---	---	capture		Missense_Mutation	SNP	55198715	55198715	6619	6	C	A	A	28	28	GFRAL	A	2	2
DST	667	broad.mit.edu	37	6	56350150	56350150	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56350150C>A	uc003pdf.2	-	82	14838	c.14810G>T	c.(14809-14811)GGA>GTA	p.G4937V	DST_uc003pcz.3_Missense_Mutation_p.G4759V|DST_uc011dxj.1_Missense_Mutation_p.G4788V|DST_uc011dxk.1_Missense_Mutation_p.G4799V|DST_uc003pcy.3_Missense_Mutation_p.G4433V|DST_uc003pda.3_Missense_Mutation_p.G129V	NM_001144769	NP_001138241	Q03001	DYST_HUMAN	dystonin isoform 2	6845	Spectrin 19.				cell adhesion|cell cycle arrest|cell motility|hemidesmosome assembly|integrin-mediated signaling pathway|intermediate filament cytoskeleton organization|maintenance of cell polarity|microtubule cytoskeleton organization|response to wounding	actin cytoskeleton|axon|axon part|basement membrane|cell cortex|cell leading edge|cytoplasmic membrane-bounded vesicle|endoplasmic reticulum membrane|hemidesmosome|hemidesmosome|integral to membrane|intermediate filament|intermediate filament cytoskeleton|microtubule cytoskeleton|microtubule plus end|nuclear envelope|sarcomere|Z disc	actin binding|calcium ion binding|integrin binding|microtubule plus-end binding|protein binding|protein C-terminus binding|protein homodimerization activity			ovary(7)|central_nervous_system(6)|upper_aerodigestive_tract(1)	14	Lung NSC(77;0.103)		LUSC - Lung squamous cell carcinoma(124;0.0485)|Lung(124;0.0956)															---	---	---	---	capture		Missense_Mutation	SNP	56350150	56350150	4967	6	C	A	A	30	30	DST	A	2	2
BAI3	577	broad.mit.edu	37	6	69758173	69758173	+	Nonsense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:69758173C>G	uc003pev.3	+	14	2652	c.2204C>G	c.(2203-2205)TCA>TGA	p.S735*	BAI3_uc010kak.2_Nonsense_Mutation_p.S735*	NM_001704	NP_001695	O60242	BAI3_HUMAN	brain-specific angiogenesis inhibitor 3	735	Extracellular (Potential).				negative regulation of angiogenesis|neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(27)|ovary(8)|skin(6)|pancreas(4)|central_nervous_system(3)|urinary_tract(1)|breast(1)	50		all_lung(197;0.212)																---	---	---	---	capture		Nonsense_Mutation	SNP	69758173	69758173	1321	6	C	G	G	29	29	BAI3	G	5	3
COL12A1	1303	broad.mit.edu	37	6	75814930	75814930	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:75814930C>A	uc003phs.2	-	54	8423	c.8257G>T	c.(8257-8259)GGC>TGC	p.G2753C	COL12A1_uc003pht.2_Missense_Mutation_p.G1589C	NM_004370	NP_004361	Q99715	COCA1_HUMAN	collagen, type XII, alpha 1 long isoform	2753	Triple-helical region (COL2) with 1 imperfection.				cell adhesion|collagen fibril organization|skeletal system development	collagen type XII|extracellular space	extracellular matrix structural constituent conferring tensile strength			ovary(6)|large_intestine(1)|breast(1)|skin(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	75814930	75814930	3807	6	C	A	A	24	24	COL12A1	A	2	2
ME1	4199	broad.mit.edu	37	6	84055988	84055988	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:84055988G>A	uc003pjy.2	-	5	610	c.504C>T	c.(502-504)GGC>GGT	p.G168G	ME1_uc011dzb.1_Silent_p.G93G|ME1_uc011dzc.1_Silent_p.G2G	NM_002395	NP_002386	P48163	MAOX_HUMAN	cytosolic malic enzyme 1	168					carbohydrate metabolic process|cellular lipid metabolic process|malate metabolic process|NADP biosynthetic process|response to carbohydrate stimulus|response to hormone stimulus	cytosol	ADP binding|electron carrier activity|malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activity|manganese ion binding|NAD binding|NADP binding			upper_aerodigestive_tract(1)|ovary(1)	2		all_cancers(76;1.28e-06)|Acute lymphoblastic leukemia(125;5.03e-07)|all_hematologic(105;0.000238)|all_epithelial(107;0.00218)		BRCA - Breast invasive adenocarcinoma(397;0.0641)	NADH(DB00157)													---	---	---	---	capture		Silent	SNP	84055988	84055988	9806	6	G	A	A	46	46	ME1	A	2	2
CNR1	1268	broad.mit.edu	37	6	88854435	88854435	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:88854435T>A	uc011dzq.1	-	2	4122	c.559A>T	c.(559-561)AAC>TAC	p.N187Y	CNR1_uc010kbz.2_Missense_Mutation_p.N187Y|CNR1_uc011dzr.1_Missense_Mutation_p.N187Y|CNR1_uc011dzs.1_Missense_Mutation_p.N187Y|CNR1_uc003pmq.3_Missense_Mutation_p.N187Y|CNR1_uc011dzt.1_Missense_Mutation_p.N187Y|CNR1_uc010kca.2_Missense_Mutation_p.N154Y	NM_001160260	NP_001153732	P21554	CNR1_HUMAN	cannabinoid receptor 1 isoform a	187	Extracellular (Potential).				G-protein signaling, coupled to cAMP nucleotide second messenger	integral to plasma membrane	cannabinoid receptor activity|protein binding			skin(2)	2		all_cancers(76;8.24e-09)|Acute lymphoblastic leukemia(125;2.15e-10)|Prostate(29;4.11e-10)|all_hematologic(105;1.08e-06)|all_epithelial(107;0.00011)		BRCA - Breast invasive adenocarcinoma(108;0.15)	Marinol(DB00470)|Nabilone(DB00486)|Rimonabant(DB06155)													---	---	---	---	capture		Missense_Mutation	SNP	88854435	88854435	3769	6	T	A	A	63	63	CNR1	A	4	4
MDN1	23195	broad.mit.edu	37	6	90499535	90499535	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90499535G>C	uc003pnn.1	-	7	1310	c.1194C>G	c.(1192-1194)ATC>ATG	p.I398M	MDN1_uc003pnp.1_Missense_Mutation_p.I398M	NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	398					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---	capture		Missense_Mutation	SNP	90499535	90499535	9804	6	G	C	C	41	41	MDN1	C	3	3
GJA10	84694	broad.mit.edu	37	6	90604410	90604410	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90604410A>T	uc011eaa.1	+	1	223	c.223A>T	c.(223-225)ATC>TTC	p.I75F		NM_032602	NP_115991	Q969M2	CXA10_HUMAN	gap junction protein, alpha 10	75	Extracellular (Potential).				synaptic transmission	connexon complex|integral to membrane	gap junction channel activity				0		all_cancers(76;5.71e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00527)		BRCA - Breast invasive adenocarcinoma(108;0.0915)														---	---	---	---	capture		Missense_Mutation	SNP	90604410	90604410	6669	6	A	T	T	12	12	GJA10	T	4	4
SIM1	6492	broad.mit.edu	37	6	100896435	100896435	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:100896435G>T	uc003pqj.3	-	6	870	c.663C>A	c.(661-663)GCC>GCA	p.A221A	SIM1_uc010kcu.2_Silent_p.A221A	NM_005068	NP_005059	P81133	SIM1_HUMAN	single-minded homolog 1	221	PAS 2.				cell differentiation|nervous system development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|signal transducer activity			ovary(4)	4		all_cancers(76;9.88e-06)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0248)|Colorectal(196;0.13)		BRCA - Breast invasive adenocarcinoma(108;0.0774)														---	---	---	---	capture		Silent	SNP	100896435	100896435	14818	6	G	T	T	39	39	SIM1	T	1	1
HEY2	23493	broad.mit.edu	37	6	126080274	126080274	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:126080274G>C	uc003qad.2	+	5	531	c.340G>C	c.(340-342)GCA>CCA	p.A114P	HEY2_uc011ebr.1_Missense_Mutation_p.A68P	NM_012259	NP_036391	Q9UBP5	HEY2_HUMAN	hairy/enhancer-of-split related with YRPW motif	114	Transcriptional repression and interaction with NCOR1 and SIN3A (By similarity).				negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription initiation from RNA polymerase II promoter|negative regulation of transcription regulatory region DNA binding|Notch signaling pathway|smooth muscle cell differentiation|transcription, DNA-dependent	transcriptional repressor complex	histone deacetylase binding|RNA polymerase II activating transcription factor binding|sequence-specific DNA binding			breast(1)	1				UCEC - Uterine corpus endometrioid carcinoma (4;0.0608)|GBM - Glioblastoma multiforme(226;0.0361)|all cancers(137;0.193)														---	---	---	---	capture		Missense_Mutation	SNP	126080274	126080274	7362	6	G	C	C	38	38	HEY2	C	3	3
C6orf97	80129	broad.mit.edu	37	6	151857477	151857477	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151857477G>T	uc003qol.2	+	2	171	c.82G>T	c.(82-84)GTC>TTC	p.V28F		NM_025059	NP_079335	Q8IYT3	CF097_HUMAN	hypothetical protein LOC80129	28											0		Ovarian(120;0.126)	BRCA - Breast invasive adenocarcinoma(37;0.111)	OV - Ovarian serous cystadenocarcinoma(155;1.48e-10)														---	---	---	---	capture		Missense_Mutation	SNP	151857477	151857477	2481	6	G	T	T	36	36	C6orf97	T	2	2
PARK2	5071	broad.mit.edu	37	6	162394435	162394435	+	Missense_Mutation	SNP	T	G	G	rs137853060		TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:162394435T>G	uc003qtx.3	-	6	767	c.633A>C	c.(631-633)AAA>AAC	p.K211N	PARK2_uc003qtv.3_RNA|PARK2_uc010kkd.2_Missense_Mutation_p.K20N|PARK2_uc003qtw.3_Missense_Mutation_p.K20N|PARK2_uc003qty.3_Missense_Mutation_p.K183N|PARK2_uc003qtz.3_Missense_Mutation_p.K62N|PARK2_uc010kke.1_Missense_Mutation_p.K211N	NM_004562	NP_004553	O60260	PRKN2_HUMAN	parkin isoform 1	211	SYT11 binding 1.		K -> R (in PARK; early onset).|K -> N (in PARK; early and late onset; severely compromises the mitochondrial localization).		aggresome assembly|central nervous system development|mitochondrion degradation|negative regulation of actin filament bundle assembly|negative regulation of cell death|negative regulation of protein phosphorylation|negative regulation of release of cytochrome c from mitochondria|neuron death|positive regulation of I-kappaB kinase/NF-kappaB cascade|protein autoubiquitination|protein K48-linked ubiquitination|protein K63-linked ubiquitination|protein monoubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|regulation of autophagy|regulation of reactive oxygen species metabolic process	aggresome|cytosol|endoplasmic reticulum|Golgi apparatus|mitochondrion|nucleus|perinuclear region of cytoplasm	chaperone binding|PDZ domain binding|protein kinase binding|ubiquitin protein ligase binding|ubiquitin-protein ligase activity|zinc ion binding			upper_aerodigestive_tract(1)	1		all_cancers(1;8.13e-65)|all_epithelial(1;5.77e-64)|Colorectal(1;9.65e-15)|all_lung(1;1.66e-13)|Lung NSC(1;7.54e-11)|Melanoma(1;1.75e-09)|Breast(66;7.81e-05)|Ovarian(120;0.000981)|Prostate(117;0.0288)|Esophageal squamous(34;0.102)		UCEC - Uterine corpus endometrioid carcinoma (4;0.0663)|all cancers(1;1.9e-63)|Epithelial(1;1.5e-59)|Colorectal(1;2.16e-23)|OV - Ovarian serous cystadenocarcinoma(65;3.53e-20)|COAD - Colon adenocarcinoma(1;2.11e-15)|STAD - Stomach adenocarcinoma(1;4.64e-07)|BRCA - Breast invasive adenocarcinoma(81;1.49e-06)|READ - Rectum adenocarcinoma(1;2.95e-06)|GBM - Glioblastoma multiforme(2;7.23e-06)|Lung(1;0.00163)|KIRC - Kidney renal clear cell carcinoma(4;0.00371)|LUSC - Lung squamous cell carcinoma(1;0.00442)|Kidney(4;0.0046)														---	---	---	---	capture		Missense_Mutation	SNP	162394435	162394435	11866	6	T	G	G	52	52	PARK2	G	4	4
THBS2	7058	broad.mit.edu	37	6	169637402	169637402	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:169637402G>T	uc003qwt.2	-	10	1588	c.1340C>A	c.(1339-1341)TCT>TAT	p.S447Y		NM_003247	NP_003238	P35442	TSP2_HUMAN	thrombospondin 2 precursor	447	TSP type-1 2.				cell adhesion	extracellular region	calcium ion binding|heparin binding|protein binding|structural molecule activity			ovary(5)	5		Breast(66;1.78e-05)|Ovarian(120;0.0728)|Esophageal squamous(34;0.247)		OV - Ovarian serous cystadenocarcinoma(33;1.85e-21)|BRCA - Breast invasive adenocarcinoma(81;1.43e-06)|GBM - Glioblastoma multiforme(31;0.000379)														---	---	---	---	capture		Missense_Mutation	SNP	169637402	169637402	16382	6	G	T	T	33	33	THBS2	T	2	2
CYP2W1	54905	broad.mit.edu	37	7	1024653	1024653	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:1024653C>A	uc003sjq.1	+	3	418	c.405C>A	c.(403-405)AGC>AGA	p.S135R	CYP2W1_uc003sjr.1_Missense_Mutation_p.S135R	NM_017781	NP_060251	Q8TAV3	CP2W1_HUMAN	cytochrome P450, family 2, subfamily W,	135					xenobiotic metabolic process	endoplasmic reticulum membrane	electron carrier activity|heme binding|monooxygenase activity|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen				0		Ovarian(82;0.0112)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0178)|OV - Ovarian serous cystadenocarcinoma(56;1.74e-15)														---	---	---	---	capture		Missense_Mutation	SNP	1024653	1024653	4341	7	C	A	A	26	26	CYP2W1	A	2	2
BAZ1B	9031	broad.mit.edu	37	7	72865210	72865210	+	Nonsense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72865210C>A	uc003tyc.2	-	14	3892	c.3547G>T	c.(3547-3549)GAA>TAA	p.E1183*		NM_032408	NP_115784	Q9UIG0	BAZ1B_HUMAN	bromodomain adjacent to zinc finger domain, 1B	1183					ATP-dependent chromatin remodeling|chromatin-mediated maintenance of transcription|DNA replication-dependent nucleosome disassembly|double-strand break repair|heart morphogenesis|transcription, DNA-dependent	WINAC complex	ATP binding|chromatin binding|histone acetyl-lysine binding|histone kinase activity|non-membrane spanning protein tyrosine kinase activity|protein complex scaffold|vitamin D receptor activator activity|vitamin D receptor binding|zinc ion binding			ovary(4)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	7		Lung NSC(55;0.0659)|all_lung(88;0.152)																---	---	---	---	capture		Nonsense_Mutation	SNP	72865210	72865210	1351	7	C	A	A	32	32	BAZ1B	A	5	2
SEMA3C	10512	broad.mit.edu	37	7	80387723	80387723	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:80387723C>T	uc003uhj.2	-	15	2129	c.1567G>A	c.(1567-1569)GAC>AAC	p.D523N	SEMA3C_uc011kgw.1_Missense_Mutation_p.D541N	NM_006379	NP_006370	Q99985	SEM3C_HUMAN	semaphorin 3C precursor	523					immune response|response to drug	membrane	receptor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	80387723	80387723	14512	7	C	T	T	29	29	SEMA3C	T	2	2
ZNF804B	219578	broad.mit.edu	37	7	88965180	88965180	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:88965180C>T	uc011khi.1	+	4	3422	c.2884C>T	c.(2884-2886)CCA>TCA	p.P962S		NM_181646	NP_857597	A4D1E1	Z804B_HUMAN	zinc finger protein 804B	962						intracellular	zinc ion binding			ovary(5)|skin(3)|pancreas(2)|upper_aerodigestive_tract(1)	11	all_hematologic(106;0.125)|Lung NSC(181;0.15)|all_lung(186;0.151)		STAD - Stomach adenocarcinoma(171;0.0513)												HNSCC(36;0.09)			---	---	---	---	capture		Missense_Mutation	SNP	88965180	88965180	18769	7	C	T	T	22	22	ZNF804B	T	2	2
SAMD9	54809	broad.mit.edu	37	7	92731247	92731247	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92731247G>A	uc003umf.2	-	3	4420	c.4164C>T	c.(4162-4164)TTC>TTT	p.F1388F	SAMD9_uc003umg.2_Silent_p.F1388F	NM_017654	NP_060124	Q5K651	SAMD9_HUMAN	sterile alpha motif domain containing 9	1388						cytoplasm				ovary(3)|skin(2)|breast(1)|central_nervous_system(1)	7	all_cancers(62;5.71e-11)|all_epithelial(64;3.25e-10)|Breast(17;0.000675)|Lung NSC(181;0.0969)|all_lung(186;0.125)		STAD - Stomach adenocarcinoma(171;0.000302)															---	---	---	---	capture		Silent	SNP	92731247	92731247	14306	7	G	A	A	45	45	SAMD9	A	2	2
LRRN3	54674	broad.mit.edu	37	7	110763333	110763333	+	Missense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:110763333C>G	uc003vft.3	+	4	1551	c.505C>G	c.(505-507)CTT>GTT	p.L169V	IMMP2L_uc003vfq.1_Intron|IMMP2L_uc010ljr.1_Intron|IMMP2L_uc003vfr.2_Intron|LRRN3_uc003vfu.3_Missense_Mutation_p.L169V|LRRN3_uc003vfs.3_Missense_Mutation_p.L169V	NM_001099660	NP_001093130	Q9H3W5	LRRN3_HUMAN	leucine rich repeat neuronal 3 precursor	169	Extracellular (Potential).|LRR 5.					integral to membrane				skin(3)|ovary(2)|pancreas(2)|central_nervous_system(1)	8				UCEC - Uterine corpus endometrioid carcinoma (4;0.245)|LUSC - Lung squamous cell carcinoma(290;0.0715)|Lung(3;0.0864)|STAD - Stomach adenocarcinoma(3;0.125)														---	---	---	---	capture		Missense_Mutation	SNP	110763333	110763333	9412	7	C	G	G	20	20	LRRN3	G	3	3
DOCK4	9732	broad.mit.edu	37	7	111430539	111430539	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:111430539G>T	uc003vfx.2	-	31	3558	c.3289C>A	c.(3289-3291)CAG>AAG	p.Q1097K	DOCK4_uc011kmm.1_5'Flank|DOCK4_uc003vfw.2_Missense_Mutation_p.Q538K|DOCK4_uc003vfy.2_Missense_Mutation_p.Q1133K	NM_014705	NP_055520	Q8N1I0	DOCK4_HUMAN	dedicator of cytokinesis 4	1097	DHR-2.				cell chemotaxis	cytosol|endomembrane system|membrane|stereocilium	GTP binding|guanyl-nucleotide exchange factor activity|PDZ domain binding|Rac GTPase activator activity|Rac GTPase binding|receptor tyrosine kinase binding|SH3 domain binding			ovary(2)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)	4		Acute lymphoblastic leukemia(1;0.0441)																---	---	---	---	capture		Missense_Mutation	SNP	111430539	111430539	4873	7	G	T	T	46	46	DOCK4	T	2	2
MET	4233	broad.mit.edu	37	7	116415134	116415134	+	Silent	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:116415134G>C	uc003vij.2	+	15	3415	c.3228G>C	c.(3226-3228)CTG>CTC	p.L1076L	MET_uc010lkh.2_Silent_p.L1094L|MET_uc011knj.1_Silent_p.L646L	NM_000245	NP_000236	P08581	MET_HUMAN	met proto-oncogene isoform b precursor	1076	Cytoplasmic (Potential).				axon guidance|cell proliferation	basal plasma membrane|integral to plasma membrane	ATP binding|hepatocyte growth factor receptor activity|protein binding	p.Q1029_G1105del(1)		upper_aerodigestive_tract(63)|lung(41)|kidney(18)|NS(10)|ovary(5)|thyroid(4)|central_nervous_system(4)|stomach(3)|liver(3)|pleura(2)|large_intestine(2)|breast(2)|testis(1)|skin(1)	159	all_cancers(3;1.25e-07)|all_epithelial(6;4.07e-08)|Lung NSC(10;0.00108)|all_lung(10;0.00125)	Ovarian(593;0.133)	GBM - Glioblastoma multiforme(2;2.31e-07)|all cancers(2;0.000419)|STAD - Stomach adenocarcinoma(10;0.000512)					Mis		papillary renal|head-neck squamous cell 	papillary renal			Hereditary_Papillary_Renal_Carcinoma_(type_1)				---	---	---	---	capture		Silent	SNP	116415134	116415134	9874	7	G	C	C	45	45	MET	C	3	3
NAA38	51691	broad.mit.edu	37	7	117828398	117828398	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117828398A>T	uc003vjg.2	+	3	331	c.139A>T	c.(139-141)AGC>TGC	p.S47C		NM_016200	NP_057284	O95777	NAA38_HUMAN	U6 snRNA-associated Sm-like protein LSm8	47					nuclear mRNA splicing, via spliceosome	nucleus|ribonucleoprotein complex	protein binding|U6 snRNA binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	117828398	117828398	10519	7	A	T	T	7	7	NAA38	T	4	4
POT1	25913	broad.mit.edu	37	7	124493080	124493080	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:124493080C>A	uc003vlm.2	-	10	1416	c.815G>T	c.(814-816)GGT>GTT	p.G272V	POT1_uc011koe.1_RNA|POT1_uc003vlk.2_RNA|POT1_uc003vll.2_RNA|POT1_uc003vlo.2_Missense_Mutation_p.G141V|POT1_uc003vln.2_RNA	NM_015450	NP_056265	Q9NUX5	POTE1_HUMAN	protection of telomeres 1 isoform 1	272	DNA binding.				DNA duplex unwinding|negative regulation of telomere maintenance via telomerase|positive regulation of DNA strand elongation|positive regulation of helicase activity|positive regulation of telomerase activity|positive regulation of telomere maintenance via telomerase|telomere capping|telomere formation via telomerase|telomere maintenance via telomerase	nuclear telomere cap complex|nucleoplasm	DEAD/H-box RNA helicase binding|single-stranded telomeric DNA binding|telomerase inhibitor activity			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	124493080	124493080	12689	7	C	A	A	18	18	POT1	A	2	2
OPN1SW	611	broad.mit.edu	37	7	128415662	128415662	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128415662G>T	uc003vnt.3	-	1	183	c.183C>A	c.(181-183)CGC>CGA	p.R61R		NM_001708	NP_001699	P03999	OPSB_HUMAN	opsin 1 (cone pigments), short-wave-sensitive	61	Cytoplasmic (Potential).				phototransduction|protein-chromophore linkage|visual perception	integral to plasma membrane	G-protein coupled receptor activity|photoreceptor activity				0																		---	---	---	---	capture		Silent	SNP	128415662	128415662	11286	7	G	T	T	34	34	OPN1SW	T	2	2
FLNC	2318	broad.mit.edu	37	7	128492756	128492756	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128492756C>T	uc003vnz.3	+	36	6163	c.5954C>T	c.(5953-5955)TCG>TTG	p.S1985L	FLNC_uc003voa.3_Missense_Mutation_p.S1952L	NM_001458	NP_001449	Q14315	FLNC_HUMAN	gamma filamin isoform a	1985	Filamin 18.				cell junction assembly	cytoskeleton|cytosol|plasma membrane|sarcomere	actin binding			breast(5)|large_intestine(3)|ovary(2)|central_nervous_system(1)|skin(1)	12																		---	---	---	---	capture		Missense_Mutation	SNP	128492756	128492756	6177	7	C	T	T	31	31	FLNC	T	1	1
KLHDC10	23008	broad.mit.edu	37	7	129736794	129736794	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:129736794G>T	uc003vpj.1	+	2	335	c.200G>T	c.(199-201)AGG>ATG	p.R67M	KLHDC10_uc003vpk.1_Intron|KLHDC10_uc010lmb.1_Intron	NM_014997	NP_055812	Q6PID8	KLD10_HUMAN	kelch domain containing 10	67											0																		---	---	---	---	capture		Missense_Mutation	SNP	129736794	129736794	8667	7	G	T	T	35	35	KLHDC10	T	2	2
PTN	5764	broad.mit.edu	37	7	136938369	136938369	+	Missense_Mutation	SNP	T	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:136938369T>G	uc003vtq.2	-	3	494	c.131A>C	c.(130-132)AAG>ACG	p.K44T	PTN_uc010lmx.2_Missense_Mutation_p.K44T|PTN_uc003vtr.1_Missense_Mutation_p.K44T	NM_002825	NP_002816	P21246	PTN_HUMAN	pleiotrophin	44					nervous system development|positive regulation of cell division|positive regulation of cell proliferation|transmembrane receptor protein tyrosine phosphatase signaling pathway	endoplasmic reticulum|extracellular space	growth factor activity|heparin binding|protein phosphatase inhibitor activity			upper_aerodigestive_tract(1)|pancreas(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	136938369	136938369	13223	7	T	G	G	56	56	PTN	G	4	4
KIAA1549	57670	broad.mit.edu	37	7	138546004	138546004	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138546004C>T	uc011kql.1	-	16	5177	c.5128G>A	c.(5128-5130)GTA>ATA	p.V1710I	KIAA1549_uc011kqi.1_Missense_Mutation_p.V494I|KIAA1549_uc003vuk.3_Missense_Mutation_p.V1660I|KIAA1549_uc011kqj.1_Missense_Mutation_p.V1710I|KIAA1549_uc011kqk.1_Missense_Mutation_p.V494I	NM_020910	NP_065961	Q9HCM3	K1549_HUMAN	hypothetical protein LOC57670 isoform 1	1710						integral to membrane			KIAA1549/BRAF(229)	central_nervous_system(229)|pancreas(1)	230								O	BRAF	pilocytic astrocytoma								---	---	---	---	capture		Missense_Mutation	SNP	138546004	138546004	8553	7	C	T	T	17	17	KIAA1549	T	2	2
BRAF	673	broad.mit.edu	37	7	140481403	140481403	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:140481403C>T	uc003vwc.3	-	11	1466	c.1405G>A	c.(1405-1407)GGA>AGA	p.G469R		NM_004333	NP_004324	P15056	BRAF_HUMAN	B-Raf	469	ATP (By similarity).|Protein kinase.		G -> A (in NHL; also in a lung adenocarcinoma sample; somatic mutation; elevated kinase activity; efficiently induces cell transformation).|G -> E (in CFC syndrome and colon cancer).|G -> R (in NHL).|G -> V (in a colorectal adenocarcinoma sample; somatic mutation).		activation of MAPKK activity|anti-apoptosis|nerve growth factor receptor signaling pathway|organ morphogenesis|positive regulation of peptidyl-serine phosphorylation|small GTPase mediated signal transduction|synaptic transmission	cytosol|nucleus|plasma membrane	ATP binding|metal ion binding	p.G469A(19)|p.G469V(12)|p.G469S(6)|p.G469R(6)|p.G469E(5)	KIAA1549/BRAF(229)|AKAP9_ENST00000356239/BRAF(10)|AGTRAP/BRAF(2)|FCHSD1/BRAF(2)|SLC45A3/BRAF(2)	thyroid(8166)|large_intestine(5052)|skin(3798)|NS(368)|central_nervous_system(284)|ovary(236)|lung(78)|eye(53)|prostate(44)|endometrium(30)|biliary_tract(28)|soft_tissue(27)|haematopoietic_and_lymphoid_tissue(22)|breast(18)|upper_aerodigestive_tract(13)|stomach(13)|pancreas(10)|small_intestine(10)|testis(7)|bone(6)|cervix(5)|genital_tract(4)|oesophagus(3)|urinary_tract(3)|adrenal_gland(3)|gastrointestinal_tract_(site_indeterminate)(2)|liver(2)|meninges(1)|kidney(1)|autonomic_ganglia(1)|pituitary(1)|salivary_gland(1)	18290	Melanoma(164;0.00956)				Sorafenib(DB00398)		61	Mis|T|O	AKAP9|KIAA1549	melanoma|colorectal|papillary thyroid|borderline ov|Non small-cell lung cancer (NSCLC)|cholangiocarcinoma|pilocytic astrocytoma		Cardio-facio-cutaneous syndrome		Cardiofaciocutaneous_syndrome				---	---	---	---	capture		Missense_Mutation	SNP	140481403	140481403	1527	7	C	T	T	21	21	BRAF	T	2	2
MGAM	8972	broad.mit.edu	37	7	141754598	141754598	+	Silent	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141754598G>C	uc003vwy.2	+	27	3258	c.3204G>C	c.(3202-3204)CTG>CTC	p.L1068L		NM_004668	NP_004659	O43451	MGA_HUMAN	maltase-glucoamylase	1068	Glucoamylase.|Lumenal (Potential).				polysaccharide digestion|starch catabolic process	apical plasma membrane|integral to membrane	carbohydrate binding|glucan 1,4-alpha-glucosidase activity|maltose alpha-glucosidase activity			ovary(2)	2	Melanoma(164;0.0272)				Acarbose(DB00284)|Miglitol(DB00491)|Voglibose(DB04878)													---	---	---	---	capture		Silent	SNP	141754598	141754598	9931	7	G	C	C	45	45	MGAM	C	3	3
CNTNAP2	26047	broad.mit.edu	37	7	146536824	146536824	+	Nonsense_Mutation	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:146536824C>G	uc003weu.1	+	3	746	c.230C>G	c.(229-231)TCA>TGA	p.S77*		NM_014141	NP_054860	Q9UHC6	CNTP2_HUMAN	cell recognition molecule Caspr2 precursor	77	F5/8 type C.|Extracellular (Potential).				behavior|cell adhesion|clustering of voltage-gated potassium channels|limbic system development|neuron recognition|signal transduction|striatum development|superior temporal gyrus development|thalamus development|transmission of nerve impulse	axolemma|cell body fiber|dendrite|juxtaparanode region of axon|voltage-gated potassium channel complex	receptor binding			ovary(9)|central_nervous_system(1)|pancreas(1)	11	Melanoma(164;0.153)	all_cancers(3;3.51e-10)|all_epithelial(3;1.4e-05)|Myeloproliferative disorder(3;0.00452)|Lung NSC(3;0.0067)|all_lung(3;0.00794)	OV - Ovarian serous cystadenocarcinoma(82;0.0319)												HNSCC(39;0.1)			---	---	---	---	capture		Nonsense_Mutation	SNP	146536824	146536824	3785	7	C	G	G	29	29	CNTNAP2	G	5	3
ASB10	136371	broad.mit.edu	37	7	150873367	150873367	+	Silent	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150873367G>A	uc003wjm.1	-	5	1497	c.1371C>T	c.(1369-1371)TAC>TAT	p.Y457Y	ASB10_uc003wjl.1_Silent_p.Y419Y|ASB10_uc003wjn.1_Silent_p.Y397Y	NM_001142459	NP_001135931	Q8WXI3	ASB10_HUMAN	ankyrin repeat and SOCS box-containing 10	412	SOCS box.				intracellular signal transduction						0			OV - Ovarian serous cystadenocarcinoma(82;0.00448)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---	capture		Silent	SNP	150873367	150873367	1032	7	G	A	A	36	36	ASB10	A	2	2
ESYT2	57488	broad.mit.edu	37	7	158590750	158590750	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:158590750C>A	uc003wob.1	-	3	600	c.534G>T	c.(532-534)TGG>TGT	p.W178C	ESYT2_uc003woc.1_Missense_Mutation_p.W2C|ESYT2_uc003wod.1_Missense_Mutation_p.W178C	NM_020728	NP_065779	A0FGR8	ESYT2_HUMAN	family with sequence similarity 62 (C2 domain	206						integral to membrane|plasma membrane				central_nervous_system(2)|kidney(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	158590750	158590750	5458	7	C	A	A	26	26	ESYT2	A	2	2
NRG1	3084	broad.mit.edu	37	8	32621848	32621848	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:32621848C>A	uc003xiv.2	+	12	2368	c.1851C>A	c.(1849-1851)CGC>CGA	p.R617R	NRG1_uc010lvo.2_3'UTR|NRG1_uc003xiu.2_Silent_p.R622R|NRG1_uc003xiw.2_Silent_p.R614R|NRG1_uc003xit.2_3'UTR|NRG1_uc010lvr.2_Silent_p.R359R|NRG1_uc010lvs.2_Silent_p.R359R|NRG1_uc010lvp.2_Silent_p.R571R|NRG1_uc010lvq.2_Silent_p.R554R|NRG1_uc011lbg.1_3'UTR|NRG1_uc011lbh.1_Silent_p.R460R|NRG1_uc003xja.2_Silent_p.R428R	NM_013964	NP_039258	Q02297	NRG1_HUMAN	neuregulin 1 isoform HRG-alpha	617	Cytoplasmic (Potential).				activation of transmembrane receptor protein tyrosine kinase activity|anti-apoptosis|cardiac muscle cell differentiation|cell communication|cell proliferation|cellular protein complex disassembly|embryo development|mammary gland development|negative regulation of cardiac muscle cell apoptosis|negative regulation of secretion|negative regulation of transcription, DNA-dependent|nervous system development|neural crest cell development|Notch signaling pathway|positive regulation of cardiac muscle cell proliferation|positive regulation of cell adhesion|positive regulation of cell growth|positive regulation of striated muscle cell differentiation|regulation of protein heterodimerization activity|regulation of protein homodimerization activity|transmembrane receptor protein tyrosine kinase signaling pathway|ventricular cardiac muscle cell differentiation|wound healing|wound healing	apical plasma membrane|extracellular region|extracellular space|integral to membrane|nucleus|plasma membrane	cytokine activity|ErbB-3 class receptor binding|growth factor activity|growth factor activity|protein binding|protein tyrosine kinase activator activity|receptor tyrosine kinase binding|transcription cofactor activity|transmembrane receptor protein tyrosine kinase activator activity				0		Breast(100;0.203)		KIRC - Kidney renal clear cell carcinoma(67;0.0768)|Kidney(114;0.0943)														---	---	---	---	capture		Silent	SNP	32621848	32621848	11052	8	C	A	A	28	28	NRG1	A	2	2
CHRNA6	8973	broad.mit.edu	37	8	42623538	42623538	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:42623538C>A	uc003xpj.2	-	1	82	c.36G>T	c.(34-36)GGG>GGT	p.G12G	CHRNA6_uc011lcw.1_Silent_p.G12G	NM_004198	NP_004189	Q15825	ACHA6_HUMAN	cholinergic receptor, nicotinic, alpha 6	12						cell junction|nicotinic acetylcholine-gated receptor-channel complex|postsynaptic membrane	acetylcholine receptor activity|nicotinic acetylcholine-activated cation-selective channel activity				0	all_lung(13;3.33e-12)|Lung NSC(13;9.17e-11)|Ovarian(28;0.01)|Prostate(17;0.0119)|Lung SC(25;0.184)	all_lung(54;0.00439)|Lung NSC(58;0.0124)|Esophageal squamous(32;0.131)|Hepatocellular(245;0.133)|Renal(179;0.151)	Lung(22;0.0252)|LUSC - Lung squamous cell carcinoma(45;0.0869)															---	---	---	---	capture		Silent	SNP	42623538	42623538	3521	8	C	A	A	22	22	CHRNA6	A	2	2
POTEA	340441	broad.mit.edu	37	8	43155726	43155726	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:43155726C>A	uc003xpz.1	+	4	697	c.654C>A	c.(652-654)ATC>ATA	p.I218I	POTEA_uc003xqa.1_Silent_p.I218I	NM_001005365	NP_001005365	Q6S8J7	POTEA_HUMAN	POTE ankyrin domain family, member A isoform 2	218	ANK 4.									ovary(1)	1																		---	---	---	---	capture		Silent	SNP	43155726	43155726	12690	8	C	A	A	29	29	POTEA	A	2	2
UBE2V2	7336	broad.mit.edu	37	8	48955617	48955617	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:48955617G>T	uc003xqm.2	+	2	62	c.41G>T	c.(40-42)CGC>CTC	p.R14L		NM_003350	NP_003341	Q15819	UB2V2_HUMAN	ubiquitin-conjugating enzyme E2v2	14					cell proliferation|DNA double-strand break processing|protein polyubiquitination|regulation of DNA repair	cytoplasm|nucleus|UBC13-MMS2 complex	acid-amino acid ligase activity|protein binding				0		all_cancers(86;0.026)|all_epithelial(80;0.000748)|Lung NSC(129;0.00171)|all_lung(136;0.00196)											Direct_reversal_of_damage|Rad6_pathway					---	---	---	---	capture		Missense_Mutation	SNP	48955617	48955617	17434	8	G	T	T	38	38	UBE2V2	T	1	1
SNAI2	6591	broad.mit.edu	37	8	49832788	49832788	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:49832788C>A	uc003xqp.2	-	2	456	c.292G>T	c.(292-294)GAC>TAC	p.D98Y		NM_003068	NP_003059	O43623	SNAI2_HUMAN	snail 2	98					canonical Wnt receptor signaling pathway|ectoderm and mesoderm interaction|multicellular organismal development|negative regulation of transcription from RNA polymerase II promoter|osteoblast differentiation|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2		all_cancers(86;0.0368)|all_epithelial(80;0.000624)|Lung NSC(129;0.0019)|all_lung(136;0.00502)																---	---	---	---	capture		Missense_Mutation	SNP	49832788	49832788	15327	8	C	A	A	30	30	SNAI2	A	2	2
PXDNL	137902	broad.mit.edu	37	8	52322064	52322064	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:52322064G>T	uc003xqu.3	-	17	2221	c.2120C>A	c.(2119-2121)TCT>TAT	p.S707Y	PXDNL_uc003xqt.3_RNA	NM_144651	NP_653252	A1KZ92	PXDNL_HUMAN	peroxidasin homolog-like precursor	707					hydrogen peroxide catabolic process	extracellular space	heme binding|peroxidase activity			ovary(1)|pancreas(1)	2		all_cancers(86;0.107)|Lung NSC(129;0.00641)|all_epithelial(80;0.00716)|all_lung(136;0.015)																---	---	---	---	capture		Missense_Mutation	SNP	52322064	52322064	13306	8	G	T	T	33	33	PXDNL	T	2	2
IL7	3574	broad.mit.edu	37	8	79650857	79650857	+	Nonsense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:79650857A>T	uc003ybg.2	-	4	843	c.242T>A	c.(241-243)TTA>TAA	p.L81*	IL7_uc003ybe.2_Intron|IL7_uc011lfm.1_Intron|IL7_uc003ybh.2_RNA|IL7_uc003ybi.3_RNA	NM_000880	NP_000871	P13232	IL7_HUMAN	interleukin 7 precursor	81					bone resorption|cell-cell signaling|humoral immune response|organ morphogenesis|positive regulation of B cell proliferation|positive regulation of T cell differentiation	extracellular space	cytokine activity|growth factor activity|interleukin-7 receptor binding				0																		---	---	---	---	capture		Nonsense_Mutation	SNP	79650857	79650857	8005	8	A	T	T	13	13	IL7	T	5	4
STMN2	11075	broad.mit.edu	37	8	80577099	80577099	+	Missense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:80577099T>A	uc003ybj.2	+	5	581	c.530T>A	c.(529-531)CTG>CAG	p.L177Q	STMN2_uc010lzp.2_RNA|STMN2_uc011lfn.1_Intron|STMN2_uc003ybk.2_RNA	NM_007029	NP_008960	Q93045	STMN2_HUMAN	superiorcervical ganglia, neural specific 10	177	Potential.				intracellular signal transduction|negative regulation of microtubule depolymerization|negative regulation of microtubule polymerization|negative regulation of neuron projection development|neuron differentiation|positive regulation of microtubule depolymerization|positive regulation of neuron projection development	axon|growth cone|membrane|membrane fraction|perinuclear region of cytoplasm|soluble fraction	protein binding			ovary(1)|central_nervous_system(1)	2	all_lung(9;8.34e-05)		Epithelial(68;0.0229)|all cancers(69;0.0874)															---	---	---	---	capture		Missense_Mutation	SNP	80577099	80577099	15829	8	T	A	A	55	55	STMN2	A	4	4
FABP12	646486	broad.mit.edu	37	8	82441723	82441723	+	Nonsense_Mutation	SNP	T	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:82441723T>A	uc011lfp.1	-	2	196	c.196A>T	c.(196-198)AAG>TAG	p.K66*	FABP12_uc003ycg.3_RNA	NM_001105281	NP_001098751	A6NFH5	FBP12_HUMAN	fatty acid binding protein 12	66							lipid binding|transporter activity				0																		---	---	---	---	capture		Nonsense_Mutation	SNP	82441723	82441723	5553	8	T	A	A	61	61	FABP12	A	5	4
OSR2	116039	broad.mit.edu	37	8	99962918	99962918	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:99962918C>A	uc003yir.2	+	3	1226	c.691C>A	c.(691-693)CAG>AAG	p.Q231K	OSR2_uc010mbn.2_Missense_Mutation_p.Q231K|OSR2_uc003yiq.2_Missense_Mutation_p.Q231K|OSR2_uc011lgx.1_Missense_Mutation_p.Q352K	NM_001142462	NP_001135934	Q8N2R0	OSR2_HUMAN	odd-skipped related 2 isoform a	231	C2H2-type 3.				bone morphogenesis|chondrocyte differentiation|embryonic digit morphogenesis|embryonic forelimb morphogenesis|embryonic hindlimb morphogenesis|embryonic leg joint morphogenesis|embryonic skeletal joint morphogenesis|eyelid development in camera-type eye|head development|mesonephros development|metanephros development|middle ear morphogenesis|negative regulation of transcription from RNA polymerase II promoter|odontogenesis|osteoblast proliferation|palate development|positive regulation of bone mineralization|positive regulation of epithelial cell proliferation|positive regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|zinc ion binding			central_nervous_system(1)	1	Breast(36;4.14e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.0136)															---	---	---	---	capture		Missense_Mutation	SNP	99962918	99962918	11705	8	C	A	A	29	29	OSR2	A	2	2
OSR2	116039	broad.mit.edu	37	8	99963890	99963890	+	Silent	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:99963890G>C	uc003yir.2	+	4	1435	c.900G>C	c.(898-900)CGG>CGC	p.R300R	OSR2_uc003yiq.2_Missense_Mutation_p.G273A|OSR2_uc011lgx.1_Silent_p.R421R	NM_001142462	NP_001135934	Q8N2R0	OSR2_HUMAN	odd-skipped related 2 isoform a	300	C2H2-type 5; degenerate.				bone morphogenesis|chondrocyte differentiation|embryonic digit morphogenesis|embryonic forelimb morphogenesis|embryonic hindlimb morphogenesis|embryonic leg joint morphogenesis|embryonic skeletal joint morphogenesis|eyelid development in camera-type eye|head development|mesonephros development|metanephros development|middle ear morphogenesis|negative regulation of transcription from RNA polymerase II promoter|odontogenesis|osteoblast proliferation|palate development|positive regulation of bone mineralization|positive regulation of epithelial cell proliferation|positive regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|zinc ion binding			central_nervous_system(1)	1	Breast(36;4.14e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.0136)															---	---	---	---	capture		Silent	SNP	99963890	99963890	11705	8	G	C	C	42	42	OSR2	C	3	3
ZFPM2	23414	broad.mit.edu	37	8	106811149	106811149	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:106811149C>A	uc003ymd.2	+	7	960	c.937C>A	c.(937-939)CTA>ATA	p.L313I	ZFPM2_uc011lhs.1_Missense_Mutation_p.L44I|uc003yme.1_5'Flank	NM_012082	NP_036214	Q8WW38	FOG2_HUMAN	zinc finger protein, multitype 2	313	C2H2-type 1.				blood coagulation|negative regulation of fat cell differentiation|outflow tract septum morphogenesis|right ventricular cardiac muscle tissue morphogenesis|ventricular septum morphogenesis	nucleoplasm	DNA binding|RNA polymerase II transcription coactivator activity|transcription corepressor activity|transcription factor binding|zinc ion binding			ovary(4)|large_intestine(1)	5			OV - Ovarian serous cystadenocarcinoma(57;8.28e-08)															---	---	---	---	capture		Missense_Mutation	SNP	106811149	106811149	18248	8	C	A	A	32	32	ZFPM2	A	2	2
ZFPM2	23414	broad.mit.edu	37	8	106814663	106814663	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:106814663C>A	uc003ymd.2	+	8	2376	c.2353C>A	c.(2353-2355)CAC>AAC	p.H785N	ZFPM2_uc011lhs.1_Missense_Mutation_p.H516N	NM_012082	NP_036214	Q8WW38	FOG2_HUMAN	zinc finger protein, multitype 2	785					blood coagulation|negative regulation of fat cell differentiation|outflow tract septum morphogenesis|right ventricular cardiac muscle tissue morphogenesis|ventricular septum morphogenesis	nucleoplasm	DNA binding|RNA polymerase II transcription coactivator activity|transcription corepressor activity|transcription factor binding|zinc ion binding			ovary(4)|large_intestine(1)	5			OV - Ovarian serous cystadenocarcinoma(57;8.28e-08)															---	---	---	---	capture		Missense_Mutation	SNP	106814663	106814663	18248	8	C	A	A	21	21	ZFPM2	A	2	2
CSMD3	114788	broad.mit.edu	37	8	113697955	113697955	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113697955C>T	uc003ynu.2	-	15	2321	c.2162G>A	c.(2161-2163)TGC>TAC	p.C721Y	CSMD3_uc003yns.2_5'UTR|CSMD3_uc003ynt.2_Missense_Mutation_p.C681Y|CSMD3_uc011lhx.1_Missense_Mutation_p.C617Y	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	721	Extracellular (Potential).|CUB 4.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---	capture		Missense_Mutation	SNP	113697955	113697955	4087	8	C	T	T	25	25	CSMD3	T	2	2
MTSS1	9788	broad.mit.edu	37	8	125565595	125565595	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:125565595C>T	uc003yrk.2	-	14	2440	c.1906G>A	c.(1906-1908)GGG>AGG	p.G636R	NDUFB9_uc011lim.1_Intron|MTSS1_uc003yrh.2_Missense_Mutation_p.G285R|MTSS1_uc011lin.1_Missense_Mutation_p.G410R|MTSS1_uc011lio.1_Missense_Mutation_p.G526R|MTSS1_uc003yri.2_Missense_Mutation_p.G354R|MTSS1_uc003yrj.2_Missense_Mutation_p.G611R|MTSS1_uc003yrl.2_Missense_Mutation_p.G640R	NM_014751	NP_055566	O43312	MTSS1_HUMAN	metastasis suppressor 1	636	Pro-rich.				actin cytoskeleton organization|cell adhesion|cellular component movement|filopodium assembly|transmembrane receptor protein tyrosine kinase signaling pathway	actin cytoskeleton|endocytic vesicle|ruffle	actin monomer binding|cytoskeletal adaptor activity|receptor binding|SH3 domain binding			ovary(1)	1	Ovarian(258;0.00438)|all_neural(195;0.00459)|Hepatocellular(40;0.108)		STAD - Stomach adenocarcinoma(47;0.00288)															---	---	---	---	capture		Missense_Mutation	SNP	125565595	125565595	10355	8	C	T	T	21	21	MTSS1	T	2	2
COL22A1	169044	broad.mit.edu	37	8	139611078	139611078	+	Nonsense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139611078C>A	uc003yvd.2	-	61	4696	c.4249G>T	c.(4249-4251)GGA>TGA	p.G1417*	COL22A1_uc011ljo.1_Nonsense_Mutation_p.G697*	NM_152888	NP_690848	Q8NFW1	COMA1_HUMAN	collagen, type XXII, alpha 1	1417	Pro-rich.|Gly-rich.|Collagen-like 14.				cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)												HNSCC(7;0.00092)			---	---	---	---	capture		Nonsense_Mutation	SNP	139611078	139611078	3819	8	C	A	A	21	21	COL22A1	A	5	2
SLC45A4	57210	broad.mit.edu	37	8	142231724	142231724	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142231724C>A	uc003ywd.1	-	2	537	c.229G>T	c.(229-231)GTT>TTT	p.V77F	SLC45A4_uc003ywc.1_Missense_Mutation_p.V77F|SLC45A4_uc010meq.1_Missense_Mutation_p.V75F	NM_001080431	NP_001073900	Q5BKX6	S45A4_HUMAN	solute carrier family 45, member 4	128	Helical; (Potential).				transport	integral to membrane				ovary(2)	2	all_cancers(97;1.52e-15)|all_epithelial(106;2.92e-14)|Lung NSC(106;1.23e-05)|all_lung(105;1.75e-05)|Ovarian(258;0.01)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0493)															---	---	---	---	capture		Missense_Mutation	SNP	142231724	142231724	15140	8	C	A	A	19	19	SLC45A4	A	1	1
CYP11B1	1584	broad.mit.edu	37	8	143960541	143960541	+	Missense_Mutation	SNP	T	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:143960541T>G	uc003yxi.2	-	2	309	c.302A>C	c.(301-303)CAA>CCA	p.Q101P	CYP11B1_uc003yxh.2_5'Flank|CYP11B1_uc003yxj.2_Missense_Mutation_p.Q101P|CYP11B1_uc010mey.2_Missense_Mutation_p.Q146P	NM_000497	NP_000488	P15538	C11B1_HUMAN	cytochrome P450, family 11, subfamily B,	101					aldosterone biosynthetic process|cellular response to hormone stimulus|cellular response to potassium ion|cortisol biosynthetic process|glucose homeostasis|immune response|regulation of blood pressure|response to stress|xenobiotic metabolic process	mitochondrial inner membrane	electron carrier activity|steroid 11-beta-monooxygenase activity			ovary(3)	3	all_cancers(97;4.74e-11)|all_epithelial(106;2.06e-08)|Lung NSC(106;0.000228)|all_lung(105;0.000633)|Medulloblastoma(13;0.00276)|all_neural(13;0.00559)|Ovarian(258;0.0254)|Acute lymphoblastic leukemia(118;0.155)				Mitotane(DB00648)									Familial_Hyperaldosteronism_type_I				---	---	---	---	capture		Missense_Mutation	SNP	143960541	143960541	4310	8	T	G	G	63	63	CYP11B1	G	4	4
EXOSC4	54512	broad.mit.edu	37	8	145135440	145135440	+	Missense_Mutation	SNP	A	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145135440A>T	uc003zau.2	+	3	784	c.674A>T	c.(673-675)CAC>CTC	p.H225L	GPAA1_uc003zav.1_5'Flank|GPAA1_uc003zaw.1_5'Flank|GPAA1_uc003zax.2_5'Flank	NM_019037	NP_061910	Q9NPD3	EXOS4_HUMAN	exosome component 4	225					DNA deamination|exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay|histone mRNA catabolic process|maturation of 5.8S rRNA|nuclear mRNA surveillance|positive regulation of cell growth	cytosol|exosome (RNase complex)|nucleolus|transcriptionally active chromatin	3'-5'-exoribonuclease activity|AU-rich element binding|protein binding				0	all_cancers(97;2.87e-11)|all_epithelial(106;2.16e-09)|Lung NSC(106;5.89e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;6.79e-41)|Epithelial(56;1.02e-39)|all cancers(56;3.48e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)															---	---	---	---	capture		Missense_Mutation	SNP	145135440	145135440	5510	8	A	T	T	6	6	EXOSC4	T	4	4
FOXH1	8928	broad.mit.edu	37	8	145699739	145699739	+	Missense_Mutation	SNP	A	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145699739A>G	uc003zdc.2	-	3	1559	c.980T>C	c.(979-981)CTA>CCA	p.L327P		NM_003923	NP_003914	O75593	FOXH1_HUMAN	forkhead box H1	327	SMAD-interaction domain (SID).|SMAD interaction motif (SIM).				axial mesoderm development|blood vessel development|cell migration involved in gastrulation|embryonic heart tube anterior/posterior pattern formation|floor plate formation|heart looping|positive regulation of transcription from RNA polymerase II promoter|regulation of sequence-specific DNA binding transcription factor activity|specification of organ position|transforming growth factor beta receptor signaling pathway	activin responsive factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|protein domain specific binding|R-SMAD binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription factor binding				0	all_cancers(97;4.61e-11)|all_epithelial(106;2.89e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.08e-41)|Epithelial(56;8.67e-41)|all cancers(56;1.76e-35)|BRCA - Breast invasive adenocarcinoma(115;0.035)|Colorectal(110;0.055)															---	---	---	---	capture		Missense_Mutation	SNP	145699739	145699739	6253	8	A	G	G	15	15	FOXH1	G	4	4
KIAA2026	158358	broad.mit.edu	37	9	5968861	5968861	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:5968861C>A	uc003zjq.3	-	3	1586	c.1370G>T	c.(1369-1371)AGG>ATG	p.R457M		NM_001017969	NP_001017969	Q5HYC2	K2026_HUMAN	hypothetical protein LOC158358	457								p.V457F(1)		ovary(2)|central_nervous_system(1)	3		Acute lymphoblastic leukemia(23;0.158)		GBM - Glioblastoma multiforme(50;0.00155)|Lung(218;0.124)														---	---	---	---	capture		Missense_Mutation	SNP	5968861	5968861	8581	9	C	A	A	24	24	KIAA2026	A	2	2
HAUS6	54801	broad.mit.edu	37	9	19089422	19089422	+	Missense_Mutation	SNP	T	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:19089422T>C	uc003znk.2	-	5	825	c.572A>G	c.(571-573)CAG>CGG	p.Q191R	HAUS6_uc003znl.1_Missense_Mutation_p.Q55R	NM_017645	NP_060115	Q7Z4H7	HAUS6_HUMAN	HAUS augmin-like complex, subunit 6	191	Potential.				cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|nucleus|spindle				ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	19089422	19089422	7252	9	T	C	C	55	55	HAUS6	C	4	4
DMRTA1	63951	broad.mit.edu	37	9	22451417	22451417	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:22451417G>T	uc003zpp.1	+	2	1247	c.1022G>T	c.(1021-1023)AGG>ATG	p.R341M		NM_022160	NP_071443	Q5VZB9	DMRTA_HUMAN	DMRT-like family A1	341					cell differentiation|sex differentiation	nucleus	DNA binding|metal ion binding|sequence-specific DNA binding transcription factor activity			large_intestine(1)|skin(1)	2		all_cancers(5;4.09e-243)|Acute lymphoblastic leukemia(3;8.25e-150)|all_hematologic(3;4.25e-147)|Esophageal squamous(3;2.32e-09)|Renal(3;1.71e-07)|Breast(3;2.07e-06)|Hepatocellular(5;0.00563)		GBM - Glioblastoma multiforme(1;5.12e-278)|Lung(24;8.2e-52)|LUSC - Lung squamous cell carcinoma(38;1.46e-37)|OV - Ovarian serous cystadenocarcinoma(39;0.0517)														---	---	---	---	capture		Missense_Mutation	SNP	22451417	22451417	4768	9	G	T	T	35	35	DMRTA1	T	2	2
ELAVL2	1993	broad.mit.edu	37	9	23692818	23692818	+	Missense_Mutation	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:23692818C>T	uc003zpu.2	-	7	1092	c.817G>A	c.(817-819)GGA>AGA	p.G273R	ELAVL2_uc003zps.2_Missense_Mutation_p.G260R|ELAVL2_uc003zpt.2_Missense_Mutation_p.G260R|ELAVL2_uc003zpv.2_Missense_Mutation_p.G273R|ELAVL2_uc003zpw.2_Missense_Mutation_p.G260R	NM_004432	NP_004423	Q12926	ELAV2_HUMAN	ELAV (embryonic lethal, abnormal vision,	273					regulation of transcription, DNA-dependent		mRNA 3'-UTR binding|nucleotide binding|protein binding			ovary(2)|central_nervous_system(1)	3				GBM - Glioblastoma multiforme(1;2.18e-156)|Lung(42;2.15e-28)|LUSC - Lung squamous cell carcinoma(38;1.02e-19)														---	---	---	---	capture		Missense_Mutation	SNP	23692818	23692818	5241	9	C	T	T	21	21	ELAVL2	T	2	2
B4GALT1	2683	broad.mit.edu	37	9	33166879	33166879	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33166879C>A	uc003zsg.2	-	1	478	c.289G>T	c.(289-291)GGT>TGT	p.G97C		NM_001497	NP_001488	P15291	B4GT1_HUMAN	UDP-Gal:betaGlcNAc beta 1,4-	97	Lumenal (Potential).			SSQPRPGGDSSPVVDSGPGPASNLT -> GKHAKSSFKQFL LQIKELSNPIDLD (in Ref. 6; AAA68219).	oligosaccharide biosynthetic process|post-translational protein modification|protein N-linked glycosylation via asparagine	basolateral plasma membrane|brush border membrane|desmosome|external side of plasma membrane|extracellular region|glycocalyx|Golgi cisterna membrane|Golgi trans cisterna|integral to membrane	alpha-tubulin binding|beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity|beta-tubulin binding|lactose synthase activity|metal ion binding|N-acetyllactosamine synthase activity|protein binding|protein homodimerization activity				0			LUSC - Lung squamous cell carcinoma(29;0.0084)	GBM - Glioblastoma multiforme(74;0.121)	N-Acetyl-D-glucosamine(DB00141)													---	---	---	---	capture		Missense_Mutation	SNP	33166879	33166879	1291	9	C	A	A	22	22	B4GALT1	A	2	2
C9orf89	84270	broad.mit.edu	37	9	95872957	95872957	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95872957C>T	uc004atd.2	+	3	436	c.258C>T	c.(256-258)ATC>ATT	p.I86I	C9orf89_uc004ate.2_RNA|C9orf89_uc004atf.2_RNA	NM_032310	NP_115686	Q96LW7	BINCA_HUMAN	chromosome 9 open reading frame 89	86	CARD.				negative regulation of I-kappaB kinase/NF-kappaB cascade	cytosol|nucleus	CARD domain binding				0																		---	---	---	---	capture		Silent	SNP	95872957	95872957	2619	9	C	T	T	30	30	C9orf89	T	2	2
GRIN3A	116443	broad.mit.edu	37	9	104433081	104433081	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:104433081G>T	uc004bbp.1	-	3	2214	c.1613C>A	c.(1612-1614)CCT>CAT	p.P538H	GRIN3A_uc004bbq.1_Missense_Mutation_p.P538H	NM_133445	NP_597702	Q8TCU5	NMD3A_HUMAN	glutamate receptor, ionotropic,	538	Extracellular (Potential).				response to ethanol	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|neuron projection|neuronal cell body|outer membrane-bounded periplasmic space|postsynaptic density|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|glycine binding|identical protein binding|N-methyl-D-aspartate selective glutamate receptor activity|protein phosphatase 2A binding			ovary(4)|pancreas(1)|central_nervous_system(1)|skin(1)	7		Acute lymphoblastic leukemia(62;0.0568)			Acamprosate(DB00659)|Chloroprocaine(DB01161)|Dextromethorphan(DB00514)|Ethanol(DB00898)|Ethopropazine(DB00392)|Felbamate(DB00949)|Ketamine(DB01221)|L-Glutamic Acid(DB00142)|Memantine(DB01043)|Meperidine(DB00454)|Methadone(DB00333)|Orphenadrine(DB01173)|Procaine(DB00721)|Riluzole(DB00740)													---	---	---	---	capture		Missense_Mutation	SNP	104433081	104433081	7062	9	G	T	T	35	35	GRIN3A	T	2	2
ZNF462	58499	broad.mit.edu	37	9	109773256	109773256	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:109773256G>T	uc004bcz.2	+	13	7755	c.7466G>T	c.(7465-7467)TGT>TTT	p.C2489F	ZNF462_uc010mto.2_Missense_Mutation_p.C2398F|ZNF462_uc004bda.2_Missense_Mutation_p.C2397F|ZNF462_uc011lvz.1_Missense_Mutation_p.C446F|uc004bdc.1_Intron	NM_021224	NP_067047	Q96JM2	ZN462_HUMAN	zinc finger protein 462	2489					transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(5)	5																		---	---	---	---	capture		Missense_Mutation	SNP	109773256	109773256	18519	9	G	T	T	48	48	ZNF462	T	2	2
DBC1	1620	broad.mit.edu	37	9	121929944	121929944	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:121929944G>C	uc004bkc.2	-	8	2160	c.1704C>G	c.(1702-1704)AGC>AGG	p.S568R		NM_014618	NP_055433	O60477	DBC1_HUMAN	deleted in bladder cancer 1 precursor	568					cell cycle arrest|cell death	cytoplasm	protein binding			skin(3)|ovary(2)|central_nervous_system(2)|large_intestine(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	121929944	121929944	4418	9	G	C	C	38	38	DBC1	C	3	3
NUP188	23511	broad.mit.edu	37	9	131730888	131730888	+	Missense_Mutation	SNP	G	C	C			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131730888G>C	uc004bws.1	+	9	711	c.689G>C	c.(688-690)AGT>ACT	p.S230T		NM_015354	NP_056169	Q5SRE5	NU188_HUMAN	nucleoporin 188kDa	230					carbohydrate metabolic process|glucose transport|mRNA transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	nuclear pore	protein binding			ovary(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)|kidney(1)|breast(1)	7																		---	---	---	---	capture		Missense_Mutation	SNP	131730888	131730888	11163	9	G	C	C	36	36	NUP188	C	3	3
POMT1	10585	broad.mit.edu	37	9	134394307	134394307	+	Silent	SNP	C	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134394307C>T	uc004cav.2	+	15	1717	c.1515C>T	c.(1513-1515)AGC>AGT	p.S505S	POMT1_uc004cax.2_Silent_p.S483S|POMT1_uc011mcj.1_Silent_p.S261S|POMT1_uc004cau.2_Silent_p.S483S|POMT1_uc004caw.2_Silent_p.S429S|POMT1_uc011mck.1_Silent_p.S366S|POMT1_uc011mcl.1_Silent_p.S331S|POMT1_uc011mcm.1_Silent_p.S453S|POMT1_uc011mcn.1_3'UTR	NM_007171	NP_009102	Q9Y6A1	POMT1_HUMAN	protein-O-mannosyltransferase 1 isoform a	505	MIR 3.				multicellular organismal development|protein O-linked glycosylation	endoplasmic reticulum membrane|integral to membrane	dolichyl-phosphate-mannose-protein mannosyltransferase activity|metal ion binding			upper_aerodigestive_tract(1)	1		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;2.65e-05)|Epithelial(140;0.000259)														---	---	---	---	capture		Silent	SNP	134394307	134394307	12674	9	C	T	T	25	25	POMT1	T	2	2
KCNT1	57582	broad.mit.edu	37	9	138669247	138669247	+	Missense_Mutation	SNP	G	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:138669247G>A	uc011mdq.1	+	21	2487	c.2413G>A	c.(2413-2415)GTC>ATC	p.V805I	KCNT1_uc011mdr.1_Missense_Mutation_p.V632I|KCNT1_uc010nbf.2_Missense_Mutation_p.V760I|KCNT1_uc004cgo.1_Missense_Mutation_p.V554I	NM_020822	NP_065873	Q5JUK3	KCNT1_HUMAN	potassium channel, subfamily T, member 1	805						membrane	binding|calcium-activated potassium channel activity			large_intestine(2)|ovary(1)|pancreas(1)	4		Myeloproliferative disorder(178;0.0821)		OV - Ovarian serous cystadenocarcinoma(145;2.11e-07)|Epithelial(140;1.57e-06)|all cancers(34;9.22e-05)														---	---	---	---	capture		Missense_Mutation	SNP	138669247	138669247	8396	9	G	A	A	40	40	KCNT1	A	1	1
NOTCH1	4851	broad.mit.edu	37	9	139405214	139405214	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139405214C>A	uc004chz.2	-	17	2631	c.2631G>T	c.(2629-2631)CCG>CCT	p.P877P	NOTCH1_uc004cia.1_Silent_p.P107P	NM_017617	NP_060087	P46531	NOTC1_HUMAN	notch1 preproprotein	877	Extracellular (Potential).|EGF-like 23; calcium-binding (Potential).				aortic valve morphogenesis|immune response|negative regulation of BMP signaling pathway|negative regulation of cell-substrate adhesion|negative regulation of myoblast differentiation|negative regulation of osteoblast differentiation|negative regulation of transcription, DNA-dependent|Notch receptor processing	cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to membrane|nucleoplasm|plasma membrane	calcium ion binding|protein binding|receptor activity			haematopoietic_and_lymphoid_tissue(791)|upper_aerodigestive_tract(29)|lung(13)|central_nervous_system(10)|breast(9)|large_intestine(1)|skin(1)|oesophagus(1)|pancreas(1)	856	all_cancers(76;0.223)	Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;5.34e-06)|Epithelial(140;7.77e-06)				T|Mis|O	TRB@	T-ALL					HNSCC(8;0.001)			---	---	---	---	capture		Silent	SNP	139405214	139405214	10950	9	C	A	A	19	19	NOTCH1	A	1	1
NHS	4810	broad.mit.edu	37	X	17746085	17746085	+	Missense_Mutation	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:17746085G>T	uc004cxx.2	+	6	4134	c.3796G>T	c.(3796-3798)GGT>TGT	p.G1266C	NHS_uc011mix.1_Missense_Mutation_p.G1287C|NHS_uc004cxy.2_Missense_Mutation_p.G1110C|NHS_uc004cxz.2_Missense_Mutation_p.G1089C|NHS_uc004cya.2_Missense_Mutation_p.G989C	NM_198270	NP_938011	Q6T4R5	NHS_HUMAN	Nance-Horan syndrome protein isoform 1	1266						nucleus				skin(3)|ovary(2)|breast(1)|central_nervous_system(1)	7	Hepatocellular(33;0.183)																	---	---	---	---	capture		Missense_Mutation	SNP	17746085	17746085	10811	23	G	T	T	47	47	NHS	T	2	2
MAGEB18	286514	broad.mit.edu	37	X	26157249	26157249	+	Silent	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:26157249C>A	uc004dbq.1	+	2	334	c.147C>A	c.(145-147)CCC>CCA	p.P49P		NM_173699	NP_775970	Q96M61	MAGBI_HUMAN	melanoma antigen family B, 18	49							protein binding			central_nervous_system(1)	1																		---	---	---	---	capture		Silent	SNP	26157249	26157249	9556	23	C	A	A	22	22	MAGEB18	A	2	2
ZNF711	7552	broad.mit.edu	37	X	84502614	84502614	+	Silent	SNP	G	T	T			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:84502614G>T	uc004eeo.2	+	3	383	c.36G>T	c.(34-36)ACG>ACT	p.T12T	ZNF711_uc004eep.2_Silent_p.T12T|ZNF711_uc004eeq.2_Silent_p.T12T	NM_021998	NP_068838	Q9Y462	ZN711_HUMAN	zinc finger protein 711	12					positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding|sequence-specific DNA binding|zinc ion binding			ovary(3)|skin(1)	4																		---	---	---	---	capture		Silent	SNP	84502614	84502614	18712	23	G	T	T	38	38	ZNF711	T	1	1
IRS4	8471	broad.mit.edu	37	X	107977058	107977058	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107977058C>A	uc004eoc.2	-	1	2550	c.2517G>T	c.(2515-2517)AGG>AGT	p.R839S		NM_003604	NP_003595	O14654	IRS4_HUMAN	insulin receptor substrate 4	839						plasma membrane	insulin receptor binding|SH3/SH2 adaptor activity|signal transducer activity			ovary(4)|large_intestine(2)|lung(1)|breast(1)|skin(1)|pancreas(1)	10																		---	---	---	---	capture		Missense_Mutation	SNP	107977058	107977058	8146	23	C	A	A	22	22	IRS4	A	2	2
RGAG1	57529	broad.mit.edu	37	X	109694517	109694517	+	Silent	SNP	C	G	G			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:109694517C>G	uc004eor.1	+	3	918	c.672C>G	c.(670-672)CCC>CCG	p.P224P	RGAG1_uc011msr.1_Silent_p.P224P	NM_020769	NP_065820	Q8NET4	RGAG1_HUMAN	retrotransposon gag domain containing 1	224										lung(2)|upper_aerodigestive_tract(1)|ovary(1)	4																		---	---	---	---	capture		Silent	SNP	109694517	109694517	13747	23	C	G	G	21	21	RGAG1	G	3	3
RGAG1	57529	broad.mit.edu	37	X	109694617	109694617	+	Missense_Mutation	SNP	C	A	A			TCGA-21-5787-01	TCGA-21-5787-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:109694617C>A	uc004eor.1	+	3	1018	c.772C>A	c.(772-774)CTG>ATG	p.L258M	RGAG1_uc011msr.1_Missense_Mutation_p.L258M	NM_020769	NP_065820	Q8NET4	RGAG1_HUMAN	retrotransposon gag domain containing 1	258										lung(2)|upper_aerodigestive_tract(1)|ovary(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	109694617	109694617	13747	23	C	A	A	28	28	RGAG1	A	2	2
