Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	dataset	MUTSIG_Significant_Genes	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	context_orig	context65	gene_name	newbase	categ	categ_ignoring_null_categ
PFKM	5213	broad.mit.edu	37	12	48535522	48535523	+	Splice_Site	DNP	GG	CC	CC			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48535522_48535523GG>CC	uc001rrc.2	+	16	1583	c.1413_splice	c.e16-1	p.R471_splice	PFKM_uc001rra.1_Splice_Site_p.R156_splice|PFKM_uc001rrb.1_Splice_Site_p.R542_splice|PFKM_uc001rrd.2_Splice_Site_p.R156_splice|PFKM_uc001rre.1_Splice_Site_p.R471_splice|PFKM_uc001rrg.1_Splice_Site_p.R440_splice	NM_000289	NP_000280			phosphofructokinase, muscle						fructose 6-phosphate metabolic process|glycolysis|muscle cell homeostasis	6-phosphofructokinase complex|apical plasma membrane	6-phosphofructokinase activity|ATP binding|identical protein binding|kinase binding|metal ion binding|protein C-terminus binding			ovary(2)|upper_aerodigestive_tract(1)|kidney(1)	4																		---	---	---	---	capture		Splice_Site	DNP	48535522	48535523	12187	12	GG	CC	CC	35	35	PFKM	CC	5	3
TMEM63A	9725	broad.mit.edu	37	1	226048639	226048639	+	Frame_Shift_Del	DEL	G	-	-			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:226048639delG	uc001hpm.1	-	14	1394	c.1144delC	c.(1144-1146)CAGfs	p.Q382fs		NM_014698	NP_055513	O94886	TM63A_HUMAN	transmembrane protein 63A	382						integral to membrane|lysosomal membrane	nucleotide binding			ovary(1)|breast(1)	2	Breast(184;0.197)																	---	---	---	---	capture_indel		Frame_Shift_Del	DEL	226048639	226048639	16729	1	G	-	-	47	47	TMEM63A	-	5	5
SLC15A1	6564	broad.mit.edu	37	13	99371545	99371545	+	Frame_Shift_Del	DEL	C	-	-			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:99371545delC	uc001vno.2	-	8	663	c.586delG	c.(586-588)GCTfs	p.A196fs		NM_005073	NP_005064	P46059	S15A1_HUMAN	solute carrier family 15 (oligopeptide	196	Extracellular (Potential).				digestion|protein transport	integral to plasma membrane|membrane fraction	peptide:hydrogen symporter activity			ovary(1)	1	all_neural(89;0.101)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)				Cefadroxil(DB01140)|Ceftibuten(DB01415)|Cyclacillin(DB01000)													---	---	---	---	capture_indel		Frame_Shift_Del	DEL	99371545	99371545	14893	13	C	-	-	28	28	SLC15A1	-	5	5
FAM82A2	55177	broad.mit.edu	37	15	41029852	41029852	+	Frame_Shift_Del	DEL	C	-	-			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41029852delC	uc001zmo.1	-	10	1342	c.1198delG	c.(1198-1200)GAAfs	p.E400fs	FAM82A2_uc001zmp.1_Frame_Shift_Del_p.E400fs|FAM82A2_uc001zmq.1_Frame_Shift_Del_p.E400fs	NM_018145	NP_060615	Q96TC7	RMD3_HUMAN	family with sequence similarity 82, member A2	400					apoptosis|cell differentiation	integral to membrane|microtubule|mitochondrial membrane|nucleus|spindle pole	protein binding				0																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	41029852	41029852	5857	15	C	-	-	30	30	FAM82A2	-	5	5
TP53	7157	broad.mit.edu	37	17	7579527	7579542	+	Frame_Shift_Del	DEL	ACCATTGTTCAATATC	-	-			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7579527_7579542delACCATTGTTCAATATC	uc002gim.2	-	4	339_354	c.145_160delGATATTGAACAATGGT	c.(145-162)GATATTGAACAATGGTTCfs	p.D49fs	TP53_uc002gig.1_Frame_Shift_Del_p.D49fs|TP53_uc002gih.2_Frame_Shift_Del_p.D49fs|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_5'Flank|TP53_uc010cng.1_5'Flank|TP53_uc002gii.1_5'Flank|TP53_uc010cnh.1_Frame_Shift_Del_p.D49fs|TP53_uc010cni.1_Frame_Shift_Del_p.D49fs|TP53_uc002gij.2_Frame_Shift_Del_p.D49fs|TP53_uc010cnj.1_5'Flank|TP53_uc002gin.2_Intron|TP53_uc002gio.2_Intron|TP53_uc010vug.1_Frame_Shift_Del_p.D10fs|TP53_uc010cnk.1_Frame_Shift_Del_p.D64fs	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	49_54	TADII.|Interaction with HRMT1L2.		F -> Y (in a sporadic cancer; somatic mutation).|F -> L (in a sporadic cancer; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.W53*(10)|p.0?(7)|p.E51*(6)|p.Q52*(6)|p.D49H(4)|p.D49Y(2)|p.W53C(2)|p.Q52H(1)|p.Q52>P*(1)|p.I50fs*4(1)|p.I50fs*1(1)|p.E51fs*72(1)|p.E51fs*59(1)|p.D48fs*55(1)|p.E51_Q52insX(1)|p.E51E(1)|p.S33fs*23(1)|p.Q52fs*6(1)|p.P13fs*18(1)|p.F54fs*69(1)|p.Q52fs*67(1)|p.F54fs*3(1)|p.S46_D49delSPDD(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)			111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			---	---	---	---	capture_indel		Frame_Shift_Del	DEL	7579527	7579542	16923	17	ACCATTGTTCAATATC	-	-	2	2	TP53	-	5	5
TRAF3IP1	26146	broad.mit.edu	37	2	239237421	239237423	+	In_Frame_Del	DEL	ATA	-	-			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:239237421_239237423delATA	uc002vye.2	+	4	568_570	c.449_451delATA	c.(448-453)GATAAT>GAT	p.N151del	TRAF3IP1_uc002vyf.2_In_Frame_Del_p.N151del	NM_015650	NP_056465	Q8TDR0	MIPT3_HUMAN	TNF receptor-associated factor 3 interacting	151	Abolishes microtubules-binding when missing.					cytoplasm|cytoskeleton	protein binding			ovary(1)	1		all_epithelial(40;3.22e-10)|Breast(86;0.000523)|Renal(207;0.00571)|Ovarian(221;0.156)|all_hematologic(139;0.182)		Epithelial(121;9.92e-24)|OV - Ovarian serous cystadenocarcinoma(60;7.85e-12)|Kidney(56;3.21e-09)|KIRC - Kidney renal clear cell carcinoma(57;1.01e-07)|BRCA - Breast invasive adenocarcinoma(100;7.72e-05)|Lung(119;0.00942)|LUSC - Lung squamous cell carcinoma(224;0.0184)														---	---	---	---	capture_indel		In_Frame_Del	DEL	239237421	239237423	16984	2	ATA	-	-	12	12	TRAF3IP1	-	5	5
FBXW7	55294	broad.mit.edu	37	4	153244155	153244156	+	Frame_Shift_Ins	INS	-	C	C	rs7679116		TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:153244155_153244156insC	uc003ims.2	-	12	2150_2151	c.2001_2002insG	c.(1999-2004)GGGAGTfs	p.G667fs	FBXW7_uc011cii.1_Frame_Shift_Ins_p.G667fs|FBXW7_uc003imt.2_Frame_Shift_Ins_p.G667fs|FBXW7_uc011cih.1_Frame_Shift_Ins_p.G491fs|FBXW7_uc003imq.2_Frame_Shift_Ins_p.G587fs|FBXW7_uc003imr.2_Frame_Shift_Ins_p.G549fs	NM_033632	NP_361014	Q969H0	FBXW7_HUMAN	F-box and WD repeat domain containing 7 isoform	667_668					interspecies interaction between organisms|lipid homeostasis|negative regulation of DNA endoreduplication|negative regulation of hepatocyte proliferation|negative regulation of Notch signaling pathway|negative regulation of triglyceride biosynthetic process|positive regulation of epidermal growth factor receptor activity|positive regulation of ERK1 and ERK2 cascade|positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process|protein stabilization|protein ubiquitination|regulation of lipid storage|regulation of protein localization|SCF-dependent proteasomal ubiquitin-dependent protein catabolic process|sister chromatid cohesion|vasculature development	nucleolus|nucleolus|nucleoplasm|nucleoplasm|SCF ubiquitin ligase complex	protein binding|protein binding	p.S668fs*26(1)|p.S668fs*39(1)		haematopoietic_and_lymphoid_tissue(125)|large_intestine(99)|stomach(16)|lung(14)|endometrium(13)|ovary(9)|biliary_tract(8)|upper_aerodigestive_tract(5)|central_nervous_system(3)|kidney(3)|skin(3)|pancreas(3)|breast(2)|prostate(2)|cervix(1)|NS(1)|bone(1)	308	all_hematologic(180;0.093)	Acute lymphoblastic leukemia(8;0.000629)|all_hematologic(8;0.067)						Mis|N|D|F		colorectal|endometrial|T-ALL								---	---	---	---	capture_indel		Frame_Shift_Ins	INS	153244155	153244156	6006	4	-	C	C	54	54	FBXW7	C	5	5
ADCY2	108	broad.mit.edu	37	5	7709413	7709416	+	Frame_Shift_Del	DEL	CTTG	-	-			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:7709413_7709416delCTTG	uc003jdz.1	+	10	1558_1561	c.1491_1494delCTTG	c.(1489-1494)TACTTGfs	p.Y497fs	ADCY2_uc011cmo.1_Frame_Shift_Del_p.Y317fs	NM_020546	NP_065433	Q08462	ADCY2_HUMAN	adenylate cyclase 2	497_498	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|synaptic transmission|transmembrane transport|water transport	cytoplasm|dendrite|integral to membrane|plasma membrane	ATP binding|metal ion binding			ovary(5)|pancreas(1)|skin(1)	7																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	7709413	7709416	295	5	CTTG	-	-	20	20	ADCY2	-	5	5
SLC2A7	155184	broad.mit.edu	37	1	9075206	9075206	+	Nonsense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:9075206G>A	uc009vmo.1	-	6	685	c.685C>T	c.(685-687)CAG>TAG	p.Q229*		NM_207420	NP_997303	Q6PXP3	GTR7_HUMAN	intestinal facilitative glucose transporter 7	229	Cytoplasmic (Potential).					integral to membrane|plasma membrane	sugar transmembrane transporter activity				0	Ovarian(185;0.112)|all_lung(157;0.185)	all_epithelial(116;1.34e-15)|all_lung(118;9.46e-05)|Lung NSC(185;0.000172)|Renal(390;0.000469)|Colorectal(325;0.0062)|Breast(348;0.00715)|Hepatocellular(190;0.0228)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.104)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;6.04e-07)|COAD - Colon adenocarcinoma(227;7.66e-05)|Kidney(185;0.000249)|KIRC - Kidney renal clear cell carcinoma(229;0.000911)|STAD - Stomach adenocarcinoma(132;0.00177)|BRCA - Breast invasive adenocarcinoma(304;0.00185)|READ - Rectum adenocarcinoma(331;0.0642)														---	---	---	---	capture		Nonsense_Mutation	SNP	9075206	9075206	15047	1	G	A	A	45	45	SLC2A7	A	5	2
PEX14	5195	broad.mit.edu	37	1	10689653	10689653	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:10689653C>A	uc001arn.2	+	9	764	c.743C>A	c.(742-744)CCG>CAG	p.P248Q	PEX14_uc009vmv.2_Missense_Mutation_p.P184Q|PEX14_uc010oam.1_Missense_Mutation_p.P184Q|PEX14_uc010oan.1_Missense_Mutation_p.P205Q|PEX14_uc009vmw.2_Missense_Mutation_p.P184Q	NM_004565	NP_004556	O75381	PEX14_HUMAN	peroxisomal biogenesis factor 14	248					negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of transcription, DNA-dependent|protein homooligomerization|protein import into peroxisome matrix|transmembrane transport	integral to membrane|nucleus|peroxisomal membrane|protein complex	protein N-terminus binding|transcription corepressor activity			breast(1)	1	Ovarian(185;0.203)	all_lung(284;6.02e-06)|Lung NSC(185;9.62e-06)|Renal(390;0.000147)|Breast(348;0.000932)|Colorectal(325;0.00215)|Hepatocellular(190;0.00913)|Ovarian(437;0.023)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0292)|Colorectal(212;9.13e-08)|COAD - Colon adenocarcinoma(227;2.07e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000482)|Kidney(185;0.00174)|KIRC - Kidney renal clear cell carcinoma(229;0.00457)|STAD - Stomach adenocarcinoma(132;0.0249)|READ - Rectum adenocarcinoma(331;0.0419)														---	---	---	---	capture		Missense_Mutation	SNP	10689653	10689653	12164	1	C	A	A	23	23	PEX14	A	1	1
TNFRSF8	943	broad.mit.edu	37	1	12169625	12169625	+	Missense_Mutation	SNP	A	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12169625A>C	uc001atq.2	+	5	646	c.424A>C	c.(424-426)ACG>CCG	p.T142P	TNFRSF8_uc010obc.1_Missense_Mutation_p.T31P	NM_001243	NP_001234	P28908	TNR8_HUMAN	tumor necrosis factor receptor superfamily,	142	TNFR-Cys 3.|Extracellular (Potential).				cellular response to mechanical stimulus|negative regulation of cell proliferation|positive regulation of apoptosis|positive regulation of TRAIL biosynthetic process|positive regulation of tumor necrosis factor biosynthetic process	cytoplasm|integral to membrane|plasma membrane				skin(2)|ovary(1)|pancreas(1)|central_nervous_system(1)	5	Ovarian(185;0.249)	Lung NSC(185;8.71e-05)|all_lung(284;9.89e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Ovarian(437;0.00965)|Hepatocellular(190;0.0202)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;5.66e-06)|COAD - Colon adenocarcinoma(227;0.000261)|BRCA - Breast invasive adenocarcinoma(304;0.000304)|Kidney(185;0.000777)|KIRC - Kidney renal clear cell carcinoma(229;0.00261)|STAD - Stomach adenocarcinoma(313;0.0073)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---	capture		Missense_Mutation	SNP	12169625	12169625	16840	1	A	C	C	6	6	TNFRSF8	C	4	4
KIF17	57576	broad.mit.edu	37	1	21031088	21031088	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:21031088C>T	uc001bdr.3	-	5	1093	c.975G>A	c.(973-975)ACG>ACA	p.T325T	KIF17_uc001bds.3_Silent_p.T325T	NM_020816	NP_065867	Q9P2E2	KIF17_HUMAN	kinesin family member 17 isoform a	325					microtubule-based movement|protein transport	cytoplasm|microtubule	ATP binding			ovary(3)|skin(1)	4		all_lung(284;2.99e-05)|Lung NSC(340;3.26e-05)|Colorectal(325;3.46e-05)|Renal(390;9.67e-05)|Breast(348;0.00179)|Ovarian(437;0.00327)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0185)|COAD - Colon adenocarcinoma(152;1.43e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000168)|Kidney(64;0.000221)|GBM - Glioblastoma multiforme(114;0.000651)|KIRC - Kidney renal clear cell carcinoma(64;0.0031)|STAD - Stomach adenocarcinoma(196;0.00336)|READ - Rectum adenocarcinoma(331;0.0686)|Lung(427;0.209)														---	---	---	---	capture		Silent	SNP	21031088	21031088	8590	1	C	T	T	27	27	KIF17	T	1	1
EIF2C1	26523	broad.mit.edu	37	1	36358709	36358709	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36358709G>T	uc001bzl.2	+	4	555	c.342G>T	c.(340-342)GAG>GAT	p.E114D	EIF2C1_uc001bzk.2_Missense_Mutation_p.E39D|EIF2C1_uc009vuy.2_5'Flank	NM_012199	NP_036331	Q9UL18	AGO1_HUMAN	eukaryotic translation initiation factor 2C, 1	114					negative regulation of translation involved in gene silencing by miRNA|nuclear-transcribed mRNA catabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol|micro-ribonucleoprotein complex|polysome	protein binding|RNA binding			ovary(2)|skin(1)	3		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---	capture		Missense_Mutation	SNP	36358709	36358709	5194	1	G	T	T	35	35	EIF2C1	T	2	2
GNL2	29889	broad.mit.edu	37	1	38034731	38034731	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:38034731C>A	uc001cbk.2	-	13	1752	c.1589G>T	c.(1588-1590)CGG>CTG	p.R530L		NM_013285	NP_037417	Q13823	NOG2_HUMAN	guanine nucleotide binding protein-like 2	530					ribosome biogenesis	nucleolus	GTP binding|GTPase activity|protein binding			ovary(1)|central_nervous_system(1)	2		Myeloproliferative disorder(586;0.0393)																---	---	---	---	capture		Missense_Mutation	SNP	38034731	38034731	6805	1	C	A	A	23	23	GNL2	A	1	1
MACF1	23499	broad.mit.edu	37	1	39797158	39797158	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39797158C>T	uc010oiu.1	+	1	349	c.218C>T	c.(217-219)TCT>TTT	p.S73F	MACF1_uc010ois.1_Intron|MACF1_uc001cda.1_Intron|MACF1_uc001cdc.1_Intron|MACF1_uc001cdb.1_Intron	NM_033044	NP_149033	Q9UPN3	MACF1_HUMAN	microfilament and actin filament cross-linker	1638					cell cycle arrest|Golgi to plasma membrane protein transport|positive regulation of Wnt receptor signaling pathway|regulation of epithelial cell migration|regulation of focal adhesion assembly|regulation of microtubule-based process|Wnt receptor signaling pathway|wound healing	Golgi apparatus|microtubule|ruffle membrane	actin filament binding|ATPase activity|calcium ion binding|microtubule binding			ovary(8)|breast(3)|central_nervous_system(3)|skin(2)	16	Lung NSC(20;5.57e-06)|Ovarian(52;0.00769)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;7.78e-19)|Epithelial(16;1.73e-17)|all cancers(16;2.49e-16)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)															---	---	---	---	capture		Missense_Mutation	SNP	39797158	39797158	9521	1	C	T	T	32	32	MACF1	T	2	2
CTTNBP2NL	55917	broad.mit.edu	37	1	112999476	112999476	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:112999476G>A	uc001ebx.2	+	6	1590	c.1362G>A	c.(1360-1362)GGG>GGA	p.G454G	CTTNBP2NL_uc001ebz.2_RNA	NM_018704	NP_061174	Q9P2B4	CT2NL_HUMAN	CTTNBP2 N-terminal like	454						actin cytoskeleton	protein binding			central_nervous_system(2)|ovary(1)	3		all_cancers(81;0.00064)|all_epithelial(167;0.000415)|all_lung(203;0.00045)|Lung NSC(69;0.000705)		Lung(183;0.0234)|all cancers(265;0.0246)|Epithelial(280;0.0342)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---	capture		Silent	SNP	112999476	112999476	4205	1	G	A	A	41	41	CTTNBP2NL	A	2	2
ATP1A1	476	broad.mit.edu	37	1	116933482	116933482	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:116933482A>G	uc001ege.2	+	10	1640	c.1301A>G	c.(1300-1302)CAG>CGG	p.Q434R	ATP1A1_uc010owv.1_Missense_Mutation_p.Q403R|ATP1A1_uc010oww.1_Missense_Mutation_p.Q434R|ATP1A1_uc010owx.1_Missense_Mutation_p.Q403R	NM_000701	NP_000692	P05023	AT1A1_HUMAN	Na+/K+ -ATPase alpha 1 subunit isoform a	434	Cytoplasmic (Potential).				ATP biosynthetic process	melanosome|sodium:potassium-exchanging ATPase complex	ATP binding|metal ion binding|protein binding|sodium:potassium-exchanging ATPase activity			ovary(1)	1	Lung SC(450;0.225)	all_cancers(81;1.28e-06)|all_epithelial(167;3.48e-07)|all_lung(203;2.64e-06)|Lung NSC(69;1.98e-05)		Lung(183;0.0164)|LUSC - Lung squamous cell carcinoma(189;0.0548)|Colorectal(144;0.0825)|COAD - Colon adenocarcinoma(174;0.127)|all cancers(265;0.24)	Acetyldigitoxin(DB00511)|Almitrine(DB01430)|Aluminium(DB01370)|Bepridil(DB01244)|Bretylium(DB01158)|Captopril(DB01197)|Deslanoside(DB01078)|Diazoxide(DB01119)|Digitoxin(DB01396)|Digoxin(DB00390)|Esomeprazole(DB00736)|Ethacrynic acid(DB00903)|Furosemide(DB00695)|Hydroflumethiazide(DB00774)|Methyclothiazide(DB00232)|Ouabain(DB01092)|Pantoprazole(DB00213)|Trichlormethiazide(DB01021)													---	---	---	---	capture		Missense_Mutation	SNP	116933482	116933482	1147	1	A	G	G	7	7	ATP1A1	G	4	4
HMGCS2	3158	broad.mit.edu	37	1	120302554	120302554	+	Silent	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:120302554A>G	uc001eid.2	-	3	669	c.618T>C	c.(616-618)CGT>CGC	p.R206R	HMGCS2_uc010oxj.1_Intron|HMGCS2_uc001eie.2_Silent_p.R114R	NM_005518	NP_005509	P54868	HMCS2_HUMAN	hydroxymethylglutaryl-CoA synthase 2 isoform 1	206					acetoacetic acid biosynthetic process|cholesterol biosynthetic process|isoprenoid biosynthetic process|ketone body biosynthetic process	mitochondrial matrix	hydroxymethylglutaryl-CoA synthase activity			ovary(2)	2	all_cancers(5;6.38e-10)|all_epithelial(5;1.1e-10)|Melanoma(3;1.93e-05)|Breast(55;0.218)|all_neural(166;0.219)	all_lung(203;1.29e-06)|Lung NSC(69;9.35e-06)|all_epithelial(167;0.00124)		Lung(183;0.0112)|LUSC - Lung squamous cell carcinoma(189;0.0595)														---	---	---	---	capture		Silent	SNP	120302554	120302554	7524	1	A	G	G	10	10	HMGCS2	G	4	4
PDE4DIP	9659	broad.mit.edu	37	1	144873951	144873951	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144873951G>T	uc001elw.3	-	31	5297	c.5006C>A	c.(5005-5007)GCC>GAC	p.A1669D	NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|PDE4DIP_uc001elx.3_Missense_Mutation_p.A1625D|PDE4DIP_uc001elv.3_Missense_Mutation_p.A676D	NM_014644	NP_055459	Q5VU43	MYOME_HUMAN	phosphodiesterase 4D interacting protein isoform	1669					cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)				T	PDGFRB	MPD								---	---	---	---	capture		Missense_Mutation	SNP	144873951	144873951	12064	1	G	T	T	42	42	PDE4DIP	T	2	2
FCGR1A	2209	broad.mit.edu	37	1	149763061	149763061	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:149763061G>A	uc001esp.3	+	6	1163	c.1113G>A	c.(1111-1113)CAG>CAA	p.Q371Q	HIST2H2BF_uc010pbj.1_Intron|FCGR1A_uc009wlg.2_RNA	NM_000566	NP_000557	P12314	FCGR1_HUMAN	Fc fragment of IgG, high affinity Ia, receptor	371	Cytoplasmic (Potential).				interferon-gamma-mediated signaling pathway|phagocytosis, engulfment	integral to membrane|plasma membrane	IgG binding|receptor activity|receptor signaling protein activity			ovary(1)	1	Breast(34;0.0124)|all_hematologic(923;0.127)				Abciximab(DB00054)|Adalimumab(DB00051)|Alefacept(DB00092)|Alemtuzumab(DB00087)|Basiliximab(DB00074)|Bevacizumab(DB00112)|Cetuximab(DB00002)|Daclizumab(DB00111)|Efalizumab(DB00095)|Etanercept(DB00005)|Gemtuzumab ozogamicin(DB00056)|Ibritumomab(DB00078)|Immune globulin(DB00028)|Methyl aminolevulinate(DB00992)|Muromonab(DB00075)|Natalizumab(DB00108)|Palivizumab(DB00110)|Porfimer(DB00707)|Rituximab(DB00073)|Tositumomab(DB00081)|Trastuzumab(DB00072)													---	---	---	---	capture		Silent	SNP	149763061	149763061	6016	1	G	A	A	35	35	FCGR1A	A	2	2
RORC	6097	broad.mit.edu	37	1	151787643	151787643	+	Missense_Mutation	SNP	T	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151787643T>A	uc001ezh.2	-	5	665	c.557A>T	c.(556-558)TAT>TTT	p.Y186F	RORC_uc001ezg.2_Missense_Mutation_p.Y165F|RORC_uc010pdo.1_Missense_Mutation_p.Y240F|RORC_uc010pdp.1_Missense_Mutation_p.Y186F	NM_005060	NP_005051	P51449	RORG_HUMAN	RAR-related orphan receptor C isoform a	186	Hinge (Potential).				regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)|skin(1)	2	Hepatocellular(266;0.0877)|all_hematologic(923;0.127)|Melanoma(130;0.14)		LUSC - Lung squamous cell carcinoma(543;0.181)															---	---	---	---	capture		Missense_Mutation	SNP	151787643	151787643	14009	1	T	A	A	49	49	RORC	A	4	4
KIAA0907	22889	broad.mit.edu	37	1	155899625	155899625	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155899625C>A	uc001fmi.1	-	3	286	c.262G>T	c.(262-264)GCT>TCT	p.A88S	KIAA0907_uc001fmj.1_Missense_Mutation_p.A88S|KIAA0907_uc009wrk.1_Missense_Mutation_p.A88S|KIAA0907_uc009wrl.1_RNA|KIAA0907_uc001fml.1_Missense_Mutation_p.A88S|KIAA0907_uc001fmm.2_Missense_Mutation_p.A88S|KIAA0907_uc001fmo.2_Missense_Mutation_p.A88S	NM_014949	NP_055764	Q7Z7F0	K0907_HUMAN	hypothetical protein LOC22889	88											0	Hepatocellular(266;0.133)|all_hematologic(923;0.145)|all_neural(408;0.195)		OV - Ovarian serous cystadenocarcinoma(3;8.82e-06)															---	---	---	---	capture		Missense_Mutation	SNP	155899625	155899625	8506	1	C	A	A	26	26	KIAA0907	A	2	2
IGSF9	57549	broad.mit.edu	37	1	159901605	159901605	+	Silent	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:159901605G>C	uc001fur.2	-	11	1557	c.1359C>G	c.(1357-1359)ACC>ACG	p.T453T	IGSF9_uc001fuq.2_Silent_p.T437T|IGSF9_uc001fup.2_5'UTR	NM_001135050	NP_001128522	Q9P2J2	TUTLA_HUMAN	immunoglobulin superfamily, member 9 isoform a	453	Ig-like 5.|Extracellular (Potential).					cell junction|integral to membrane|synapse				ovary(2)|central_nervous_system(2)|large_intestine(1)	5	all_hematologic(112;0.0597)	Breast(1374;0.000126)	BRCA - Breast invasive adenocarcinoma(70;0.111)															---	---	---	---	capture		Silent	SNP	159901605	159901605	7906	1	G	C	C	47	47	IGSF9	C	3	3
TMCO1	54499	broad.mit.edu	37	1	165723478	165723478	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:165723478C>A	uc001gdj.3	-	4	391	c.242G>T	c.(241-243)AGA>ATA	p.R81I	TMCO1_uc001gdl.3_5'UTR|TMCO1_uc001gdm.3_5'UTR|TMCO1_uc001gdk.3_Missense_Mutation_p.R69I|TMCO1_uc001gdn.3_RNA	NM_019026	NP_061899	Q9UM00	TMCO1_HUMAN	transmembrane and coiled-coil domains 1	81	Potential.					endoplasmic reticulum membrane|Golgi membrane|integral to membrane				central_nervous_system(1)	1	all_hematologic(923;0.048)|Acute lymphoblastic leukemia(8;0.155)																	---	---	---	---	capture		Missense_Mutation	SNP	165723478	165723478	16525	1	C	A	A	32	32	TMCO1	A	2	2
FMO1	2326	broad.mit.edu	37	1	171236736	171236736	+	Missense_Mutation	SNP	T	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:171236736T>A	uc009wvz.2	+	3	323	c.187T>A	c.(187-189)TGC>AGC	p.C63S	FMO1_uc010pme.1_Intron|FMO1_uc001ghl.2_Missense_Mutation_p.C63S|FMO1_uc001ghm.2_Missense_Mutation_p.C63S|FMO1_uc001ghn.2_Missense_Mutation_p.C63S	NM_002021	NP_002012	Q01740	FMO1_HUMAN	flavin containing monooxygenase 1	63					NADPH oxidation|organic acid metabolic process|toxin metabolic process|xenobiotic metabolic process	endoplasmic reticulum lumen|integral to membrane|intrinsic to endoplasmic reticulum membrane|microsome	flavin adenine dinucleotide binding|flavin-containing monooxygenase activity|NADP binding			skin(1)	1	all_hematologic(923;0.0922)|Acute lymphoblastic leukemia(37;0.181)																	---	---	---	---	capture		Missense_Mutation	SNP	171236736	171236736	6196	1	T	A	A	55	55	FMO1	A	4	4
RALGPS2	55103	broad.mit.edu	37	1	178848052	178848052	+	Missense_Mutation	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:178848052C>G	uc001glz.2	+	10	1099	c.761C>G	c.(760-762)CCT>CGT	p.P254R	RALGPS2_uc001gly.1_Missense_Mutation_p.P254R|RALGPS2_uc010pnb.1_Missense_Mutation_p.P254R	NM_152663	NP_689876	Q86X27	RGPS2_HUMAN	Ral GEF with PH domain and SH3 binding motif 2	254	Ras-GEF.				small GTPase mediated signal transduction	cytoplasm|plasma membrane	guanyl-nucleotide exchange factor activity|protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	178848052	178848052	13478	1	C	G	G	24	24	RALGPS2	G	3	3
LAMC1	3915	broad.mit.edu	37	1	183087214	183087214	+	Silent	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183087214T>C	uc001gpy.3	+	11	2180	c.1923T>C	c.(1921-1923)CCT>CCC	p.P641P		NM_002293	NP_002284	P11047	LAMC1_HUMAN	laminin, gamma 1 precursor	641	Laminin IV type A.				axon guidance|cell migration|endoderm development|extracellular matrix disassembly|hemidesmosome assembly|positive regulation of epithelial cell proliferation|protein complex assembly|substrate adhesion-dependent cell spreading	extracellular space|laminin-1 complex|laminin-10 complex|laminin-11 complex	extracellular matrix structural constituent			ovary(3)|large_intestine(1)|kidney(1)	5					Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---	capture		Silent	SNP	183087214	183087214	8937	1	T	C	C	56	56	LAMC1	C	4	4
LAMC2	3918	broad.mit.edu	37	1	183204743	183204743	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183204743G>A	uc001gqa.2	+	16	2648	c.2334G>A	c.(2332-2334)CTG>CTA	p.L778L	LAMC2_uc001gpz.3_Silent_p.L778L|LAMC2_uc010poa.1_Silent_p.L478L	NM_005562	NP_005553	Q13753	LAMC2_HUMAN	laminin, gamma 2 isoform a precursor	778	Domain II and I.				cell adhesion|epidermis development|hemidesmosome assembly		heparin binding			skin(2)|ovary(1)	3																OREG0014042	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	183204743	183204743	8938	1	G	A	A	45	45	LAMC2	A	2	2
ADIPOR1	51094	broad.mit.edu	37	1	202911228	202911228	+	Silent	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202911228C>A	uc001gyq.3	-	7	1191	c.924G>T	c.(922-924)GTG>GTT	p.V308V	ADIPOR1_uc010pqd.1_Silent_p.V232V|ADIPOR1_uc001gyr.3_Silent_p.V107V|ADIPOR1_uc001gys.3_Silent_p.V308V	NM_015999	NP_057083	Q96A54	ADR1_HUMAN	adiponectin receptor 1	308	Helical; Name=6; (Potential).				fatty acid oxidation|hormone-mediated signaling pathway	integral to membrane|plasma membrane	hormone binding|protein kinase binding|receptor activity				0			BRCA - Breast invasive adenocarcinoma(75;0.141)															---	---	---	---	capture		Silent	SNP	202911228	202911228	319	1	C	A	A	29	29	ADIPOR1	A	2	2
CR2	1380	broad.mit.edu	37	1	207646198	207646198	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207646198C>T	uc001hfw.2	+	10	1746	c.1652C>T	c.(1651-1653)ACG>ATG	p.T551M	CR2_uc001hfv.2_Missense_Mutation_p.T551M|CR2_uc009xch.2_Missense_Mutation_p.T551M|CR2_uc009xci.1_Missense_Mutation_p.T36M	NM_001877	NP_001868	P20023	CR2_HUMAN	complement component (3d/Epstein Barr virus)	551	Sushi 9.|Extracellular (Potential).				complement activation, classical pathway|innate immune response	integral to membrane|plasma membrane	complement receptor activity|protein homodimerization activity			upper_aerodigestive_tract(3)|skin(3)|urinary_tract(1)|ovary(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	207646198	207646198	3981	1	C	T	T	19	19	CR2	T	1	1
USH2A	7399	broad.mit.edu	37	1	216062176	216062176	+	Silent	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216062176T>C	uc001hku.1	-	41	8202	c.7815A>G	c.(7813-7815)TCA>TCG	p.S2605S		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	2605	Fibronectin type-III 12.|Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---	capture		Silent	SNP	216062176	216062176	17598	1	T	C	C	63	63	USH2A	C	4	4
MIA3	375056	broad.mit.edu	37	1	222801365	222801365	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222801365A>G	uc001hnl.2	+	4	812	c.803A>G	c.(802-804)AAA>AGA	p.K268R	MIA3_uc009xea.1_Missense_Mutation_p.K104R	NM_198551	NP_940953	Q5JRA6	MIA3_HUMAN	melanoma inhibitory activity family, member 3	268	Extracellular (Potential).				exocytosis|negative regulation of cell adhesion|negative regulation of cell migration|positive regulation of leukocyte migration|protein transport|wound healing	endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(4)|central_nervous_system(1)	5				GBM - Glioblastoma multiforme(131;0.0199)														---	---	---	---	capture		Missense_Mutation	SNP	222801365	222801365	9955	1	A	G	G	1	1	MIA3	G	4	4
MIA3	375056	broad.mit.edu	37	1	222835656	222835656	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222835656G>A	uc001hnl.2	+	26	5253	c.5244G>A	c.(5242-5244)AGG>AGA	p.R1748R	MIA3_uc001hnm.2_Silent_p.R626R	NM_198551	NP_940953	Q5JRA6	MIA3_HUMAN	melanoma inhibitory activity family, member 3	1748	Pro-rich.|Cytoplasmic (Potential).				exocytosis|negative regulation of cell adhesion|negative regulation of cell migration|positive regulation of leukocyte migration|protein transport|wound healing	endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(4)|central_nervous_system(1)	5				GBM - Glioblastoma multiforme(131;0.0199)														---	---	---	---	capture		Silent	SNP	222835656	222835656	9955	1	G	A	A	43	43	MIA3	A	2	2
KIAA1804	84451	broad.mit.edu	37	1	233497881	233497881	+	Missense_Mutation	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:233497881A>T	uc001hvt.3	+	5	1655	c.1394A>T	c.(1393-1395)CAG>CTG	p.Q465L	KIAA1804_uc001hvs.1_Missense_Mutation_p.Q465L	NM_032435	NP_115811	Q5TCX8	M3KL4_HUMAN	mixed lineage kinase 4	465	Leucine-zipper 2.				activation of JUN kinase activity|protein autophosphorylation		ATP binding|MAP kinase kinase kinase activity|protein homodimerization activity			lung(5)|central_nervous_system(2)|skin(1)	8		all_cancers(173;0.000405)|all_epithelial(177;0.0345)|Prostate(94;0.122)																---	---	---	---	capture		Missense_Mutation	SNP	233497881	233497881	8570	1	A	T	T	7	7	KIAA1804	T	4	4
TARBP1	6894	broad.mit.edu	37	1	234534202	234534202	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:234534202G>A	uc001hwd.2	-	26	4169	c.4169C>T	c.(4168-4170)GCG>GTG	p.A1390V		NM_005646	NP_005637	Q13395	TARB1_HUMAN	TAR RNA binding protein 1	1390					regulation of transcription from RNA polymerase II promoter|RNA processing	nucleus	RNA binding|RNA methyltransferase activity			ovary(2)|skin(1)	3	Ovarian(103;0.0339)	all_cancers(173;0.00995)|Prostate(94;0.0115)|all_epithelial(177;0.172)	OV - Ovarian serous cystadenocarcinoma(106;0.000263)															---	---	---	---	capture		Missense_Mutation	SNP	234534202	234534202	16076	1	G	A	A	38	38	TARBP1	A	1	1
OR2W3	343171	broad.mit.edu	37	1	248059182	248059182	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248059182C>T	uc001idp.1	+	3	563	c.294C>T	c.(292-294)GCC>GCT	p.A98A	OR2W3_uc010pzb.1_Silent_p.A98A	NM_001001957	NP_001001957	Q7Z3T1	OR2W3_HUMAN	olfactory receptor, family 2, subfamily W,	98	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|breast(1)|pancreas(1)	3	all_cancers(71;0.000139)|all_epithelial(71;1.58e-05)|Breast(184;0.0117)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0319)															---	---	---	---	capture		Silent	SNP	248059182	248059182	11439	1	C	T	T	21	21	OR2W3	T	2	2
MLLT10	8028	broad.mit.edu	37	10	22021984	22021984	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:22021984C>T	uc001iqs.2	+	19	2771	c.2423C>T	c.(2422-2424)TCT>TTT	p.S808F	MLLT10_uc001iqt.2_Missense_Mutation_p.S792F|MLLT10_uc001iqv.2_RNA|MLLT10_uc001iqy.2_Missense_Mutation_p.S792F|MLLT10_uc001ira.2_Missense_Mutation_p.S249F|MLLT10_uc001irb.2_RNA	NM_004641	NP_004632	P55197	AF10_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	808					positive regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(1)|skin(1)	2								T	MLL|PICALM|CDK6	AL								---	---	---	---	capture		Missense_Mutation	SNP	22021984	22021984	10016	10	C	T	T	32	32	MLLT10	T	2	2
ANK3	288	broad.mit.edu	37	10	61898760	61898760	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:61898760C>A	uc001jky.2	-	24	2892	c.2700G>T	c.(2698-2700)GAG>GAT	p.E900D	ANK3_uc001jkw.2_Missense_Mutation_p.E34D|ANK3_uc009xpa.2_Missense_Mutation_p.E34D|ANK3_uc001jkx.2_Missense_Mutation_p.E78D|ANK3_uc010qih.1_Missense_Mutation_p.E901D|ANK3_uc001jkz.3_Missense_Mutation_p.E894D|ANK3_uc001jlb.1_Missense_Mutation_p.E408D|ANK3_uc001jlc.1_Missense_Mutation_p.E540D	NM_020987	NP_066267	Q12955	ANK3_HUMAN	ankyrin 3 isoform 1	900					establishment of protein localization|signal transduction	basolateral plasma membrane|cytoplasm|cytoskeleton	protein binding			skin(9)|ovary(6)|pancreas(2)|central_nervous_system(2)	19																		---	---	---	---	capture		Missense_Mutation	SNP	61898760	61898760	625	10	C	A	A	24	24	ANK3	A	2	2
PDE6C	5146	broad.mit.edu	37	10	95422928	95422928	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95422928C>T	uc001kiu.3	+	21	2649	c.2511C>T	c.(2509-2511)GCC>GCT	p.A837A		NM_006204	NP_006195	P51160	PDE6C_HUMAN	phosphodiesterase 6C	837					visual perception	plasma membrane	3',5'-cyclic-GMP phosphodiesterase activity|cGMP binding|metal ion binding			ovary(2)|kidney(1)|skin(1)	4		Colorectal(252;0.123)																---	---	---	---	capture		Silent	SNP	95422928	95422928	12068	10	C	T	T	23	23	PDE6C	T	1	1
TRIM21	6737	broad.mit.edu	37	11	4407427	4407427	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4407427G>A	uc001lyy.1	-	6	932	c.819C>T	c.(817-819)TGC>TGT	p.C273C		NM_003141	NP_003132	P19474	RO52_HUMAN	tripartite motif protein 21	273	B30.2/SPRY.				cell cycle|negative regulation of NF-kappaB transcription factor activity|negative regulation of protein deubiquitination|positive regulation of cell cycle|protein autoubiquitination|protein destabilization|protein monoubiquitination|protein polyubiquitination|protein trimerization	cytoplasmic mRNA processing body|nucleus	DNA binding|protein binding|RNA binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(3)|lung(1)	4		Medulloblastoma(188;0.0025)|Breast(177;0.0101)|all_neural(188;0.0227)		Epithelial(150;2.08e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0851)|LUSC - Lung squamous cell carcinoma(625;0.194)														---	---	---	---	capture		Silent	SNP	4407427	4407427	17039	11	G	A	A	42	42	TRIM21	A	2	2
COPB1	1315	broad.mit.edu	37	11	14501234	14501234	+	Silent	SNP	G	A	A	rs149921106	by1000genomes	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:14501234G>A	uc001mli.2	-	11	1546	c.1239C>T	c.(1237-1239)AAC>AAT	p.N413N	COPB1_uc001mlg.2_Silent_p.N413N|COPB1_uc001mlh.2_Silent_p.N413N	NM_016451	NP_057535	P53618	COPB_HUMAN	coatomer protein complex, subunit beta 1	413	HEAT 6.				COPI coating of Golgi vesicle|interspecies interaction between organisms|intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat|cytosol|ER-Golgi intermediate compartment|plasma membrane	protein binding|structural molecule activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	14501234	14501234	3866	11	G	A	A	40	40	COPB1	A	1	1
DCDC1	341019	broad.mit.edu	37	11	31327799	31327799	+	Missense_Mutation	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31327799T>C	uc001msv.2	-	5	773	c.571A>G	c.(571-573)ACT>GCT	p.T191A	DCDC1_uc001msu.1_5'UTR	NM_181807	NP_861523	P59894	DCDC1_HUMAN	doublecortin domain containing 1	191	Doublecortin.				intracellular signal transduction					skin(1)	1	Lung SC(675;0.225)																	---	---	---	---	capture		Missense_Mutation	SNP	31327799	31327799	4455	11	T	C	C	57	57	DCDC1	C	4	4
OR5M9	390162	broad.mit.edu	37	11	56230130	56230130	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56230130A>G	uc010rjj.1	-	1	748	c.748T>C	c.(748-750)TAT>CAT	p.Y250H		NM_001004743	NP_001004743	Q8NGP3	OR5M9_HUMAN	olfactory receptor, family 5, subfamily M,	250	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)|central_nervous_system(1)	4	Esophageal squamous(21;0.00448)																	---	---	---	---	capture		Missense_Mutation	SNP	56230130	56230130	11587	11	A	G	G	13	13	OR5M9	G	4	4
OR5B12	390191	broad.mit.edu	37	11	58206696	58206696	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58206696A>G	uc010rkh.1	-	1	929	c.929T>C	c.(928-930)ATA>ACA	p.I310T		NM_001004733	NP_001004733	Q96R08	OR5BC_HUMAN	olfactory receptor, family 5, subfamily B,	310	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	Esophageal squamous(5;0.0027)	Breast(21;0.0778)																---	---	---	---	capture		Missense_Mutation	SNP	58206696	58206696	11558	11	A	G	G	16	16	OR5B12	G	4	4
MS4A15	219995	broad.mit.edu	37	11	60540959	60540959	+	Splice_Site	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60540959T>C	uc009ynf.1	+	5	718	c.498_splice	c.e5+2	p.R166_splice	MS4A15_uc001npx.2_Splice_Site_p.R73_splice|MS4A15_uc001npy.2_Splice_Site|MS4A15_uc009yng.1_Splice_Site_p.R125_splice	NM_001098835	NP_001092305			membrane-spanning 4-domains, subfamily A, member							integral to membrane	receptor activity			lung(1)	1																		---	---	---	---	capture		Splice_Site	SNP	60540959	60540959	10252	11	T	C	C	59	59	MS4A15	C	5	4
PC	5091	broad.mit.edu	37	11	66620276	66620276	+	Silent	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66620276C>A	uc001ojn.1	-	12	1594	c.1545G>T	c.(1543-1545)CCG>CCT	p.P515P	PC_uc001ojo.1_Silent_p.P515P|PC_uc001ojp.1_Silent_p.P515P|PC_uc001ojm.1_5'Flank	NM_022172	NP_071504	P11498	PYC_HUMAN	pyruvate carboxylase precursor	515					gluconeogenesis|lipid biosynthetic process	mitochondrial matrix	ATP binding|biotin binding|biotin carboxylase activity|metal ion binding|pyruvate carboxylase activity			ovary(2)|lung(1)|kidney(1)	4		Melanoma(852;0.0525)		Lung(977;0.153)|LUSC - Lung squamous cell carcinoma(976;0.227)	Biotin(DB00121)|Pyruvic acid(DB00119)													---	---	---	---	capture		Silent	SNP	66620276	66620276	11917	11	C	A	A	31	31	PC	A	1	1
TPCN2	219931	broad.mit.edu	37	11	68848948	68848948	+	Missense_Mutation	SNP	G	A	A	rs146072177	by1000genomes	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68848948G>A	uc001oos.2	+	18	1786	c.1670G>A	c.(1669-1671)CGT>CAT	p.R557H	TPCN2_uc010rqg.1_Intron|TPCN2_uc001oot.2_RNA|hsa-mir-3164|MI0014194_5'Flank	NM_139075	NP_620714	Q8NHX9	TPC2_HUMAN	two pore segment channel 2	557	Helical; Name=S4 of repeat II; (Potential).				cellular calcium ion homeostasis|smooth muscle contraction	endosome membrane|integral to membrane|lysosomal membrane	NAADP-sensitive calcium-release channel activity|voltage-gated calcium channel activity				0			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)															---	---	---	---	capture		Missense_Mutation	SNP	68848948	68848948	16940	11	G	A	A	40	40	TPCN2	A	1	1
NOX4	50507	broad.mit.edu	37	11	89133542	89133542	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:89133542C>A	uc001pct.2	-	10	1091	c.852G>T	c.(850-852)TGG>TGT	p.W284C	NOX4_uc009yvr.2_Missense_Mutation_p.W259C|NOX4_uc001pcu.2_Missense_Mutation_p.W210C|NOX4_uc001pcw.2_Intron|NOX4_uc001pcx.2_Intron|NOX4_uc001pcv.2_Missense_Mutation_p.W284C|NOX4_uc009yvo.2_Intron|NOX4_uc010rtu.1_Missense_Mutation_p.W118C|NOX4_uc009yvp.2_Intron|NOX4_uc010rtv.1_Missense_Mutation_p.W260C|NOX4_uc009yvq.2_Missense_Mutation_p.W260C	NM_016931	NP_058627	Q9NPH5	NOX4_HUMAN	NADPH oxidase 4 isoform a	284	Extracellular (Potential).|Ferric oxidoreductase.|Mediates interaction with TLR4.				cell aging|cell morphogenesis|inflammatory response|negative regulation of cell proliferation|superoxide anion generation	endoplasmic reticulum membrane|focal adhesion|integral to membrane|nucleus	electron carrier activity|flavin adenine dinucleotide binding|heme binding|NAD(P)H oxidase activity|nucleotide binding|oxygen sensor activity			ovary(1)|central_nervous_system(1)	2		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.011)																---	---	---	---	capture		Missense_Mutation	SNP	89133542	89133542	10962	11	C	A	A	26	26	NOX4	A	2	2
TULP3	7289	broad.mit.edu	37	12	3039413	3039413	+	Splice_Site	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:3039413G>C	uc010seh.1	+	5	476	c.395_splice	c.e5-1	p.D132_splice	TULP3_uc010sef.1_Splice_Site|TULP3_uc009zec.1_Splice_Site|TULP3_uc010seg.1_Splice_Site|TULP3_uc001qlj.2_Splice_Site_p.D132_splice|TULP3_uc010sei.1_Intron	NM_003324	NP_003315			tubby like protein 3 isoform 1						G-protein coupled receptor protein signaling pathway|regulation of transcription, DNA-dependent	cytoplasm|extracellular region|nucleus|plasma membrane	phosphatidylinositol-4,5-bisphosphate binding				0			OV - Ovarian serous cystadenocarcinoma(31;0.000818)															---	---	---	---	capture		Splice_Site	SNP	3039413	3039413	17330	12	G	C	C	33	33	TULP3	C	5	3
PRB3	5544	broad.mit.edu	37	12	11420269	11420269	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:11420269G>C	uc001qzs.2	-	4	825	c.787C>G	c.(787-789)CCA>GCA	p.P263A	PRB4_uc001qzf.1_Intron	NM_006249	NP_006240	Q04118	PRB3_HUMAN	proline-rich protein BstNI subfamily 3	263	Pro-rich.					extracellular region	Gram-negative bacterial cell surface binding			skin(1)	1			OV - Ovarian serous cystadenocarcinoma(49;0.201)															---	---	---	---	capture		Missense_Mutation	SNP	11420269	11420269	12886	12	G	C	C	41	41	PRB3	C	3	3
PIK3C2G	5288	broad.mit.edu	37	12	18691219	18691219	+	Missense_Mutation	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:18691219C>G	uc001rdt.2	+	24	3446	c.3330C>G	c.(3328-3330)AGC>AGG	p.S1110R	PIK3C2G_uc010sia.1_RNA|PIK3C2G_uc010sib.1_Missense_Mutation_p.S1151R|PIK3C2G_uc010sic.1_Missense_Mutation_p.S929R	NM_004570	NP_004561	O75747	P3C2G_HUMAN	phosphoinositide-3-kinase, class 2 gamma	1110	PI3K/PI4K.				cell communication|phosphatidylinositol-mediated signaling	membrane|phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol binding|phosphatidylinositol-4-phosphate 3-kinase activity			lung(8)|central_nervous_system(6)|breast(3)|stomach(2)|ovary(2)	21		Hepatocellular(102;0.194)																---	---	---	---	capture		Missense_Mutation	SNP	18691219	18691219	12335	12	C	G	G	26	26	PIK3C2G	G	3	3
DDX11	1663	broad.mit.edu	37	12	31237922	31237922	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31237922G>C	uc001rjt.1	+	5	751	c.500G>C	c.(499-501)AGA>ACA	p.R167T	DDX11_uc010sjw.1_Missense_Mutation_p.R167T|DDX11_uc010sjx.1_RNA|DDX11_uc001rjr.1_Missense_Mutation_p.R167T|DDX11_uc001rjs.1_Missense_Mutation_p.R167T|DDX11_uc001rju.1_5'UTR|DDX11_uc001rjv.1_Missense_Mutation_p.R167T|DDX11_uc001rjw.1_Missense_Mutation_p.R141T|DDX11_uc001rjx.1_5'Flank	NM_152438	NP_689651	Q96FC9	DDX11_HUMAN	DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11	167	Glu-rich.|Helicase ATP-binding.				G2/M transition of mitotic cell cycle|interspecies interaction between organisms|mitotic sister chromatid segregation|positive regulation of cell proliferation|S phase of mitotic cell cycle|sister chromatid cohesion	midbody|nuclear chromatin|nucleolus|spindle pole	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding|RNA binding			breast(3)	3	all_cancers(9;1.77e-11)|all_lung(12;6.21e-11)|all_epithelial(9;6.49e-11)|Lung NSC(12;1.06e-08)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Lung SC(12;0.0592)|Esophageal squamous(101;0.233)														Multiple Myeloma(12;0.14)			---	---	---	---	capture		Missense_Mutation	SNP	31237922	31237922	4514	12	G	C	C	33	33	DDX11	C	3	3
KCNH3	23416	broad.mit.edu	37	12	49938088	49938088	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49938088C>T	uc001ruh.1	+	7	1372	c.1112C>T	c.(1111-1113)GCG>GTG	p.A371V	KCNH3_uc010smj.1_Missense_Mutation_p.A311V	NM_012284	NP_036416	Q9ULD8	KCNH3_HUMAN	potassium voltage-gated channel, subfamily H	371	Helical; Name=Segment S5; (Potential).				regulation of transcription, DNA-dependent	integral to membrane	two-component sensor activity|voltage-gated potassium channel activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	49938088	49938088	8338	12	C	T	T	27	27	KCNH3	T	1	1
MFSD5	84975	broad.mit.edu	37	12	53647205	53647205	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53647205A>G	uc001sci.1	+	2	777	c.586A>G	c.(586-588)ATA>GTA	p.I196V	MFSD5_uc001sch.1_Missense_Mutation_p.I303V	NM_032889	NP_116278	Q6N075	MFSD5_HUMAN	major facilitator superfamily domain containing	196	Helical; (Potential).				transport	integral to membrane				skin(2)|ovary(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	53647205	53647205	9924	12	A	G	G	12	12	MFSD5	G	4	4
NCKAP1L	3071	broad.mit.edu	37	12	54903646	54903646	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54903646C>T	uc001sgc.3	+	7	691	c.612C>T	c.(610-612)GCC>GCT	p.A204A	NCKAP1L_uc010sox.1_5'UTR|NCKAP1L_uc010soy.1_Silent_p.A154A	NM_005337	NP_005328	P55160	NCKPL_HUMAN	NCK-associated protein 1-like	204					actin polymerization-dependent cell motility|B cell homeostasis|B cell receptor signaling pathway|cortical actin cytoskeleton organization|erythrocyte development|maintenance of cell polarity|myeloid cell homeostasis|negative regulation of apoptosis|negative regulation of interleukin-17 production|negative regulation of interleukin-6 production|negative regulation of myosin-light-chain-phosphatase activity|neutrophil chemotaxis|positive regulation of actin filament polymerization|positive regulation of B cell differentiation|positive regulation of B cell proliferation|positive regulation of CD4-positive, alpha-beta T cell differentiation|positive regulation of CD8-positive, alpha-beta T cell differentiation|positive regulation of cell adhesion mediated by integrin|positive regulation of erythrocyte differentiation|positive regulation of gamma-delta T cell differentiation|positive regulation of neutrophil chemotaxis|positive regulation of phagocytosis, engulfment|positive regulation of T cell proliferation|protein complex assembly|response to drug|T cell homeostasis	cytosol|integral to plasma membrane|membrane fraction|SCAR complex	protein complex binding|protein kinase activator activity|Rac GTPase activator activity			ovary(3)|central_nervous_system(1)	4																		---	---	---	---	capture		Silent	SNP	54903646	54903646	10621	12	C	T	T	22	22	NCKAP1L	T	2	2
RAB5B	5869	broad.mit.edu	37	12	56384546	56384546	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56384546G>A	uc001siv.2	+	4	513	c.396G>A	c.(394-396)GGG>GGA	p.G132G	RAB5B_uc001siw.2_Silent_p.G132G|RAB5B_uc009zog.2_Silent_p.G72G|RAB5B_uc010spz.1_Intron	NM_002868	NP_002859	P61020	RAB5B_HUMAN	RAB5B, member RAS oncogene family	132					protein transport|small GTPase mediated signal transduction	early endosome membrane|melanosome|membrane fraction|plasma membrane	GTP binding|GTP-dependent protein binding|GTPase activity				0			UCEC - Uterine corpus endometrioid carcinoma (6;0.0471)|OV - Ovarian serous cystadenocarcinoma(18;0.235)															---	---	---	---	capture		Silent	SNP	56384546	56384546	13408	12	G	A	A	41	41	RAB5B	A	2	2
LRP1	4035	broad.mit.edu	37	12	57570994	57570994	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57570994C>T	uc001snd.2	+	25	4628	c.4162C>T	c.(4162-4164)CAC>TAC	p.H1388Y		NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	1388	Extracellular (Potential).|LDL-receptor class B 9.				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)													---	---	---	---	capture		Missense_Mutation	SNP	57570994	57570994	9324	12	C	T	T	25	25	LRP1	T	2	2
NXPH4	11247	broad.mit.edu	37	12	57619107	57619107	+	Silent	SNP	G	T	T	rs147287568	byFrequency	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57619107G>T	uc010srf.1	+	2	679	c.504G>T	c.(502-504)CTG>CTT	p.L168L	NXPH4_uc009zpj.2_5'UTR	NM_007224	NP_009155	O95158	NXPH4_HUMAN	neurexophilin 4 precursor	168	IV (linker domain).				neuropeptide signaling pathway	extracellular region					0																		---	---	---	---	capture		Silent	SNP	57619107	57619107	11198	12	G	T	T	46	46	NXPH4	T	2	2
GRIP1	23426	broad.mit.edu	37	12	66849249	66849249	+	Missense_Mutation	SNP	T	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:66849249T>A	uc001stk.2	-	10	1379	c.1138A>T	c.(1138-1140)ACC>TCC	p.T380S	GRIP1_uc010sta.1_Missense_Mutation_p.T324S|GRIP1_uc001stj.2_Missense_Mutation_p.T162S|GRIP1_uc001stl.1_Intron|GRIP1_uc001stm.2_Missense_Mutation_p.T380S	NM_021150	NP_066973	Q9Y3R0	GRIP1_HUMAN	glutamate receptor interacting protein 1	432					androgen receptor signaling pathway|intracellular signal transduction|positive regulation of transcription, DNA-dependent|synaptic transmission	cell junction|cytoplasmic membrane-bounded vesicle|cytosol|endoplasmic reticulum|postsynaptic membrane	androgen receptor binding|beta-catenin binding|protein C-terminus binding|receptor signaling complex scaffold activity|transcription coactivator activity			ovary(2)	2			GBM - Glioblastoma multiforme(2;0.00069)	GBM - Glioblastoma multiforme(28;0.0933)														---	---	---	---	capture		Missense_Mutation	SNP	66849249	66849249	7066	12	T	A	A	59	59	GRIP1	A	4	4
PLXNC1	10154	broad.mit.edu	37	12	94649068	94649068	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:94649068C>T	uc001tdc.2	+	17	3332	c.3083C>T	c.(3082-3084)CCT>CTT	p.P1028L	PLXNC1_uc010sut.1_Missense_Mutation_p.P75L	NM_005761	NP_005752	O60486	PLXC1_HUMAN	plexin C1 precursor	1028	Cytoplasmic (Potential).				axon guidance|cell adhesion	integral to membrane|intracellular|plasma membrane	receptor activity|receptor binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	94649068	94649068	12552	12	C	T	T	24	24	PLXNC1	T	2	2
ANKS1B	56899	broad.mit.edu	37	12	99640175	99640175	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:99640175G>A	uc001tge.1	-	13	2641	c.2224C>T	c.(2224-2226)CTC>TTC	p.L742F	ANKS1B_uc001tgf.1_Missense_Mutation_p.L322F|ANKS1B_uc001tgk.2_Missense_Mutation_p.L39F|ANKS1B_uc009ztt.1_Missense_Mutation_p.L708F	NM_152788	NP_690001	Q7Z6G8	ANS1B_HUMAN	cajalin 2 isoform a	742						Cajal body|cell junction|cytoplasm|dendritic spine|postsynaptic density|postsynaptic membrane					0		all_cancers(3;0.0197)|all_epithelial(3;0.0101)|Esophageal squamous(3;0.0559)|Breast(359;0.209)		OV - Ovarian serous cystadenocarcinoma(2;2.89e-08)|Epithelial(2;6.12e-08)|all cancers(2;4.07e-06)														---	---	---	---	capture		Missense_Mutation	SNP	99640175	99640175	697	12	G	A	A	33	33	ANKS1B	A	2	2
GNPTAB	79158	broad.mit.edu	37	12	102155097	102155097	+	Silent	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:102155097T>C	uc001tit.2	-	15	3122	c.2943A>G	c.(2941-2943)TCA>TCG	p.S981S		NM_024312	NP_077288	Q3T906	GNPTA_HUMAN	N-acetylglucosamine-1-phosphate transferase	981					cell differentiation	Golgi membrane|integral to membrane|nucleus	metal ion binding|transcription factor binding|UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase activity			ovary(1)|skin(1)	2																		---	---	---	---	capture		Silent	SNP	102155097	102155097	6814	12	T	C	C	51	51	GNPTAB	C	4	4
STAB2	55576	broad.mit.edu	37	12	103984757	103984757	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:103984757C>T	uc001tjw.2	+	2	350	c.164C>T	c.(163-165)CCG>CTG	p.P55L		NM_017564	NP_060034	Q8WWQ8	STAB2_HUMAN	stabilin 2 precursor	55	Extracellular (Potential).				angiogenesis|cell adhesion|defense response to bacterium|receptor-mediated endocytosis	cytoplasm|external side of plasma membrane|integral to plasma membrane	Gram-negative bacterial cell surface binding|hyaluronic acid binding|low-density lipoprotein receptor activity|protein disulfide oxidoreductase activity|scavenger receptor activity			ovary(9)|skin(5)	14																		---	---	---	---	capture		Missense_Mutation	SNP	103984757	103984757	15756	12	C	T	T	23	23	STAB2	T	1	1
SACS	26278	broad.mit.edu	37	13	23928866	23928866	+	Missense_Mutation	SNP	C	T	T	rs149638449	byFrequency	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:23928866C>T	uc001uon.2	-	8	2474	c.1885G>A	c.(1885-1887)GCG>ACG	p.A629T	SACS_uc001uoo.2_Missense_Mutation_p.A482T|SACS_uc001uop.1_Missense_Mutation_p.A416T|SACS_uc001uoq.1_Missense_Mutation_p.A482T	NM_014363	NP_055178	Q9NZJ4	SACS_HUMAN	sacsin	629					cell death|negative regulation of inclusion body assembly|protein folding	axon|cell body fiber|dendrite|mitochondrion|nucleus	ATP binding|chaperone binding|Hsp70 protein binding|proteasome binding			ovary(7)|skin(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	12		all_cancers(29;1.51e-22)|all_epithelial(30;7.82e-19)|all_lung(29;4.71e-18)|Lung SC(185;0.0225)|Breast(139;0.128)		all cancers(112;0.00197)|Epithelial(112;0.00854)|OV - Ovarian serous cystadenocarcinoma(117;0.0298)|Lung(94;0.189)														---	---	---	---	capture		Missense_Mutation	SNP	23928866	23928866	14284	13	C	T	T	27	27	SACS	T	1	1
SPATA13	221178	broad.mit.edu	37	13	24876899	24876899	+	Silent	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:24876899C>A	uc001upg.1	+	12	2354	c.1947C>A	c.(1945-1947)CCC>CCA	p.P649P	SPATA13_uc001upd.1_Silent_p.P1274P|C1QTNF9_uc001upe.2_Intron|SPATA13_uc010tcy.1_Missense_Mutation_p.L597I|SPATA13_uc010tcz.1_Silent_p.P533P|SPATA13_uc010tda.1_Silent_p.P593P|SPATA13_uc001uph.2_Silent_p.P571P|SPATA13_uc010tdb.1_Silent_p.P509P|SPATA13_uc009zzz.1_Missense_Mutation_p.L207I	NM_153023	NP_694568	Q96N96	SPT13_HUMAN	spermatogenesis associated 13	649	C-terminal tail.				cell migration|filopodium assembly|lamellipodium assembly|regulation of cell migration|regulation of Rho protein signal transduction	cytoplasm|filopodium|lamellipodium|ruffle membrane	protein binding|Rac guanyl-nucleotide exchange factor activity			skin(2)|ovary(1)	3		all_cancers(29;4.05e-15)|all_lung(29;2.77e-14)|all_epithelial(30;7.77e-13)|Lung SC(185;0.0279)		all cancers(112;0.00616)|Epithelial(112;0.0195)|OV - Ovarian serous cystadenocarcinoma(117;0.0705)|Lung(94;0.231)														---	---	---	---	capture		Silent	SNP	24876899	24876899	15508	13	C	A	A	24	24	SPATA13	A	2	2
RNF17	56163	broad.mit.edu	37	13	25341415	25341415	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25341415C>T	uc001upr.2	+	2	177	c.136C>T	c.(136-138)CAT>TAT	p.H46Y	RNF17_uc010tdd.1_5'UTR|RNF17_uc010aab.2_RNA|RNF17_uc010tde.1_Missense_Mutation_p.H46Y|RNF17_uc001ups.2_5'UTR|RNF17_uc001upq.1_Missense_Mutation_p.H46Y	NM_031277	NP_112567	Q9BXT8	RNF17_HUMAN	ring finger protein 17	46	RING-type.				multicellular organismal development	cytoplasm|nucleus	hydrolase activity, acting on ester bonds|nucleic acid binding|zinc ion binding			ovary(1)|skin(1)	2		Lung SC(185;0.0225)|Breast(139;0.077)		all cancers(112;0.0114)|OV - Ovarian serous cystadenocarcinoma(117;0.0311)|Epithelial(112;0.0524)														---	---	---	---	capture		Missense_Mutation	SNP	25341415	25341415	13938	13	C	T	T	21	21	RNF17	T	2	2
COG6	57511	broad.mit.edu	37	13	40261703	40261703	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:40261703G>A	uc001uxh.2	+	9	952	c.852G>A	c.(850-852)GCG>GCA	p.A284A	COG6_uc001uxi.2_Silent_p.A232A|COG6_uc010acb.2_Silent_p.A284A	NM_020751	NP_065802	Q9Y2V7	COG6_HUMAN	component of oligomeric golgi complex 6 isoform	284					protein transport	Golgi membrane|Golgi transport complex				kidney(1)|skin(1)	2		Lung NSC(96;0.000124)|Breast(139;0.0199)|Prostate(109;0.0233)|Lung SC(185;0.0367)		all cancers(112;6.03e-09)|Epithelial(112;7e-07)|OV - Ovarian serous cystadenocarcinoma(117;0.00015)|BRCA - Breast invasive adenocarcinoma(63;0.00438)|GBM - Glioblastoma multiforme(144;0.0168)														---	---	---	---	capture		Silent	SNP	40261703	40261703	3800	13	G	A	A	38	38	COG6	A	1	1
OR4M1	441670	broad.mit.edu	37	14	20249180	20249180	+	Missense_Mutation	SNP	G	T	T	rs142051783	byFrequency	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20249180G>T	uc010tku.1	+	1	699	c.699G>T	c.(697-699)GAG>GAT	p.E233D		NM_001005500	NP_001005500	Q8NGD0	OR4M1_HUMAN	olfactory receptor, family 4, subfamily M,	233	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;2.95e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---	capture		Missense_Mutation	SNP	20249180	20249180	11485	14	G	T	T	33	33	OR4M1	T	2	2
TBPL2	387332	broad.mit.edu	37	14	55903639	55903639	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:55903639G>A	uc001xby.2	-	2	248	c.248C>T	c.(247-249)TCG>TTG	p.S83L		NM_199047	NP_950248	Q6SJ96	TBPL2_HUMAN	TATA box binding protein like 2	83					multicellular organismal development|transcription initiation from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	55903639	55903639	16172	14	G	A	A	37	37	TBPL2	A	1	1
ZFYVE1	53349	broad.mit.edu	37	14	73437657	73437657	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:73437657G>A	uc001xnm.2	-	12	2907	c.2267C>T	c.(2266-2268)CCT>CTT	p.P756L	ZFYVE1_uc001xnl.2_Missense_Mutation_p.P341L|ZFYVE1_uc010arj.2_Missense_Mutation_p.P742L	NM_021260	NP_067083	Q9HBF4	ZFYV1_HUMAN	zinc finger, FYVE domain containing 1 isoform 1	756	FYVE-type 2.					endoplasmic reticulum|Golgi stack|perinuclear region of cytoplasm	1-phosphatidylinositol binding|phosphatidylinositol-3,4,5-trisphosphate binding|phosphatidylinositol-3,4-bisphosphate binding|zinc ion binding			skin(1)	1		all_lung(585;1.33e-09)		OV - Ovarian serous cystadenocarcinoma(108;1.6e-46)|BRCA - Breast invasive adenocarcinoma(234;0.00349)														---	---	---	---	capture		Missense_Mutation	SNP	73437657	73437657	18253	14	G	A	A	35	35	ZFYVE1	A	2	2
RPS6KA5	9252	broad.mit.edu	37	14	91444752	91444752	+	Missense_Mutation	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:91444752T>C	uc001xys.2	-	3	507	c.292A>G	c.(292-294)ACA>GCA	p.T98A	RPS6KA5_uc010twi.1_Missense_Mutation_p.T19A|RPS6KA5_uc001xyt.2_Missense_Mutation_p.T98A|RPS6KA5_uc010att.1_RNA	NM_004755	NP_004746	O75582	KS6A5_HUMAN	ribosomal protein S6 kinase, polypeptide 5	98	Protein kinase 1.				axon guidance|epidermal growth factor receptor signaling pathway|histone phosphorylation|innate immune response|interleukin-1-mediated signaling pathway|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|positive regulation of histone acetylation|positive regulation of histone phosphorylation|positive regulation of transcription from RNA polymerase II promoter|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytoplasm|nucleoplasm	ATP binding|magnesium ion binding|protein binding|protein serine/threonine kinase activity			ovary(1)	1		all_cancers(154;0.0148)|Melanoma(154;0.099)|all_epithelial(191;0.146)		Epithelial(152;0.182)|BRCA - Breast invasive adenocarcinoma(234;0.201)														---	---	---	---	capture		Missense_Mutation	SNP	91444752	91444752	14134	14	T	C	C	57	57	RPS6KA5	C	4	4
WARS	7453	broad.mit.edu	37	14	100835456	100835456	+	Missense_Mutation	SNP	C	T	T	rs146689917		TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:100835456C>T	uc001yhf.1	-	1	151	c.67G>A	c.(67-69)GTA>ATA	p.V23I	WARS_uc001yhg.1_Missense_Mutation_p.V23I|WARS_uc001yhh.1_Missense_Mutation_p.V23I|WARS_uc001yhi.1_Intron|WARS_uc001yhj.1_Intron|WARS_uc001yhk.1_Intron|WARS_uc001yhl.1_Missense_Mutation_p.V23I|WARS_uc010twz.1_Missense_Mutation_p.V23I	NM_173701	NP_776049	P23381	SYWC_HUMAN	tryptophanyl-tRNA synthetase isoform a	23	WHEP-TRS.				angiogenesis|negative regulation of cell proliferation|regulation of angiogenesis|tryptophanyl-tRNA aminoacylation	cytosol|soluble fraction	ATP binding|protein binding|tryptophan-tRNA ligase activity			breast(1)	1		all_cancers(154;0.00223)|all_lung(585;2.48e-06)|all_epithelial(191;0.000564)|Melanoma(154;0.152)			L-Tryptophan(DB00150)													---	---	---	---	capture		Missense_Mutation	SNP	100835456	100835456	17821	14	C	T	T	19	19	WARS	T	1	1
TNFAIP2	7127	broad.mit.edu	37	14	103599089	103599089	+	Silent	SNP	A	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103599089A>C	uc001ymm.1	+	8	1556	c.1425A>C	c.(1423-1425)CCA>CCC	p.P475P	TNFAIP2_uc010awo.1_Silent_p.P187P|TNFAIP2_uc010txz.1_Silent_p.P144P|TNFAIP2_uc010tya.1_5'UTR	NM_006291	NP_006282	Q03169	TNAP2_HUMAN	tumor necrosis factor, alpha-induced protein 2	475					angiogenesis|cell differentiation	extracellular space				central_nervous_system(1)	1		Melanoma(154;0.155)	Epithelial(46;0.191)															---	---	---	---	capture		Silent	SNP	103599089	103599089	16814	14	A	C	C	6	6	TNFAIP2	C	4	4
HERC2	8924	broad.mit.edu	37	15	28357016	28357016	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28357016C>T	uc001zbj.2	-	93	14504	c.14398G>A	c.(14398-14400)GCA>ACA	p.A4800T	HERC2_uc001zbi.2_Missense_Mutation_p.A489T	NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2	4800					DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)														---	---	---	---	capture		Missense_Mutation	SNP	28357016	28357016	7341	15	C	T	T	27	27	HERC2	T	1	1
KBTBD13	390594	broad.mit.edu	37	15	65370042	65370042	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65370042G>A	uc010uis.1	+	1	889	c.889G>A	c.(889-891)GGC>AGC	p.G297S	RASL12_uc010uir.1_5'Flank	NM_001101362	NP_001094832	C9JR72	KBTBD_HUMAN	hypothetical protein LOC390594	297	Kelch 3.					cytoplasm					0																		---	---	---	---	capture		Missense_Mutation	SNP	65370042	65370042	8297	15	G	A	A	39	39	KBTBD13	A	1	1
C15orf44	81556	broad.mit.edu	37	15	65885801	65885801	+	Silent	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65885801T>C	uc002apd.2	-	8	1287	c.951A>G	c.(949-951)CTA>CTG	p.L317L	C15orf44_uc010uix.1_Silent_p.L353L|C15orf44_uc010uiz.1_Silent_p.L281L|C15orf44_uc010uja.1_Silent_p.L267L|C15orf44_uc010ujb.1_Silent_p.L238L|C15orf44_uc002ape.3_Silent_p.L317L|C15orf44_uc010uiy.1_Silent_p.L238L	NM_030800	NP_110427	Q96SY0	CO044_HUMAN	hypothetical protein LOC81556 isoform 2	317										ovary(1)	1																		---	---	---	---	capture		Silent	SNP	65885801	65885801	1848	15	T	C	C	61	61	C15orf44	C	4	4
SGK269	79834	broad.mit.edu	37	15	77472963	77472963	+	Nonsense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:77472963C>A	uc002bcm.2	-	3	1614	c.1306G>T	c.(1306-1308)GAA>TAA	p.E436*	SGK269_uc002bcn.2_Nonsense_Mutation_p.E436*	NM_024776	NP_079052	Q9H792	PEAK1_HUMAN	NKF3 kinase family member	436					cell migration|protein autophosphorylation|substrate adhesion-dependent cell spreading	actin cytoskeleton|cytoplasm|focal adhesion	ATP binding|non-membrane spanning protein tyrosine kinase activity|protein binding				0				STAD - Stomach adenocarcinoma(199;0.124)														---	---	---	---	capture		Nonsense_Mutation	SNP	77472963	77472963	14702	15	C	A	A	32	32	SGK269	A	5	2
KIAA1024	23251	broad.mit.edu	37	15	79749217	79749217	+	Missense_Mutation	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:79749217C>G	uc002bew.1	+	2	803	c.728C>G	c.(727-729)TCC>TGC	p.S243C	KIAA1024_uc010unk.1_Missense_Mutation_p.S243C	NM_015206	NP_056021	Q9UPX6	K1024_HUMAN	hypothetical protein LOC23251	243						integral to membrane				pancreas(2)|ovary(1)|central_nervous_system(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	79749217	79749217	8512	15	C	G	G	30	30	KIAA1024	G	3	3
AKAP13	11214	broad.mit.edu	37	15	86087101	86087101	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:86087101C>T	uc002blv.1	+	5	747	c.577C>T	c.(577-579)CTC>TTC	p.L193F	AKAP13_uc002blt.1_Missense_Mutation_p.L193F|AKAP13_uc002blu.1_Missense_Mutation_p.L193F	NM_007200	NP_009131	Q12802	AKP13_HUMAN	A-kinase anchor protein 13 isoform 2	193					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|membrane|membrane fraction|nucleus	cAMP-dependent protein kinase activity|metal ion binding|protein binding|Rho guanyl-nucleotide exchange factor activity|signal transducer activity			central_nervous_system(3)|kidney(2)|urinary_tract(1)|liver(1)|skin(1)|ovary(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	86087101	86087101	452	15	C	T	T	32	32	AKAP13	T	2	2
SOX8	30812	broad.mit.edu	37	16	1034928	1034928	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1034928G>A	uc002ckn.2	+	3	998	c.883G>A	c.(883-885)GCC>ACC	p.A295T		NM_014587	NP_055402	P57073	SOX8_HUMAN	SRY (sex determining region Y)-box 8	295					adipose tissue development|enteric nervous system development|fat cell differentiation|in utero embryonic development|metanephric nephron tubule formation|morphogenesis of a branching epithelium|negative regulation of apoptosis|negative regulation of myoblast differentiation|negative regulation of transcription, DNA-dependent|neural crest cell migration|oligodendrocyte differentiation|osteoblast differentiation|peripheral nervous system development|positive regulation of branching involved in ureteric bud morphogenesis|positive regulation of gliogenesis|positive regulation of osteoblast proliferation|positive regulation of transcription from RNA polymerase II promoter|regulation of hormone levels|renal vesicle induction|retinal rod cell differentiation|Sertoli cell development|signal transduction|spermatogenesis|ureter morphogenesis	cytoplasm|nucleus				central_nervous_system(1)|skin(1)	2		Hepatocellular(780;0.00308)																---	---	---	---	capture		Missense_Mutation	SNP	1034928	1034928	15457	16	G	A	A	38	38	SOX8	A	1	1
NTN3	4917	broad.mit.edu	37	16	2522769	2522769	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2522769C>T	uc002cqj.2	+	2	1199	c.996C>T	c.(994-996)CGC>CGT	p.R332R	TBC1D24_uc002cqk.2_5'Flank|TBC1D24_uc002cql.2_5'Flank	NM_006181	NP_006172	O00634	NET3_HUMAN	netrin 3 precursor	332	Laminin EGF-like 2.				axon guidance|muscle cell differentiation|positive regulation of muscle cell differentiation	proteinaceous extracellular matrix				central_nervous_system(1)	1																		---	---	---	---	capture		Silent	SNP	2522769	2522769	11106	16	C	T	T	26	26	NTN3	T	2	2
XYLT1	64131	broad.mit.edu	37	16	17202563	17202563	+	Silent	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:17202563G>T	uc002dfa.2	-	12	2954	c.2869C>A	c.(2869-2871)CGG>AGG	p.R957R		NM_022166	NP_071449	Q86Y38	XYLT1_HUMAN	xylosyltransferase I	957	Lumenal (Potential).				glycosaminoglycan biosynthetic process	endoplasmic reticulum membrane|extracellular region|Golgi membrane|integral to membrane	acetylglucosaminyltransferase activity|protein xylosyltransferase activity			ovary(4)	4																		---	---	---	---	capture		Silent	SNP	17202563	17202563	18046	16	G	T	T	39	39	XYLT1	T	1	1
GPRC5B	51704	broad.mit.edu	37	16	19883337	19883337	+	Silent	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19883337C>G	uc002dgt.2	-	2	939	c.831G>C	c.(829-831)GCG>GCC	p.A277A	GPRC5B_uc010vav.1_Silent_p.A303A	NM_016235	NP_057319	Q9NZH0	GPC5B_HUMAN	G protein-coupled receptor, family C, group 5,	277	Helical; Name=7; (Potential).									lung(1)|breast(1)|skin(1)	3																		---	---	---	---	capture		Silent	SNP	19883337	19883337	7001	16	C	G	G	23	23	GPRC5B	G	3	3
SLC5A11	115584	broad.mit.edu	37	16	24921729	24921729	+	Missense_Mutation	SNP	C	A	A	rs148456649		TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24921729C>A	uc002dmu.2	+	15	1985	c.1753C>A	c.(1753-1755)CCA>ACA	p.P585T	SLC5A11_uc002dms.2_Missense_Mutation_p.P521T|SLC5A11_uc010vcd.1_Missense_Mutation_p.P550T|SLC5A11_uc002dmt.2_Missense_Mutation_p.P429T|SLC5A11_uc010vce.1_Missense_Mutation_p.P515T|SLC5A11_uc010bxt.2_Missense_Mutation_p.P521T|SLC5A11_uc002dmv.2_Missense_Mutation_p.P208T	NM_052944	NP_443176	Q8WWX8	SC5AB_HUMAN	solute carrier family 5 (sodium/glucose	585	Cytoplasmic (Potential).				apoptosis|carbohydrate transport|sodium ion transport	integral to membrane|plasma membrane	polyol transmembrane transporter activity|symporter activity			ovary(2)	2				GBM - Glioblastoma multiforme(48;0.0365)														---	---	---	---	capture		Missense_Mutation	SNP	24921729	24921729	15160	16	C	A	A	26	26	SLC5A11	A	2	2
SEZ6L2	26470	broad.mit.edu	37	16	29891243	29891243	+	Silent	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29891243G>T	uc002duq.3	-	9	1755	c.1515C>A	c.(1513-1515)GCC>GCA	p.A505A	uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|SEZ6L2_uc002dup.3_Silent_p.A435A|SEZ6L2_uc002dur.3_Silent_p.A435A|SEZ6L2_uc002dus.3_Silent_p.A391A|SEZ6L2_uc010vec.1_Silent_p.A505A|SEZ6L2_uc010ved.1_Silent_p.A461A	NM_201575	NP_963869	Q6UXD5	SE6L2_HUMAN	seizure related 6 homolog (mouse)-like 2 isoform	505	Sushi 2.|Extracellular (Potential).					endoplasmic reticulum membrane|integral to membrane|plasma membrane				ovary(1)|skin(1)	2																		---	---	---	---	capture		Silent	SNP	29891243	29891243	14633	16	G	T	T	47	47	SEZ6L2	T	2	2
C16orf78	123970	broad.mit.edu	37	16	49430384	49430384	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:49430384C>A	uc002efr.2	+	4	488	c.445C>A	c.(445-447)CCA>ACA	p.P149T		NM_144602	NP_653203	Q8WTQ4	CP078_HUMAN	hypothetical protein LOC123970	149										central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	49430384	49430384	1888	16	C	A	A	22	22	C16orf78	A	2	2
TMEM208	29100	broad.mit.edu	37	16	67262945	67262945	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67262945G>T	uc002esi.2	+	6	557	c.451G>T	c.(451-453)GGC>TGC	p.G151C	LRRC29_uc002ese.2_5'Flank|LRRC29_uc002esf.2_5'Flank|LRRC29_uc002esg.2_5'Flank|LRRC29_uc010vjg.1_5'Flank|TMEM208_uc002esj.2_RNA	NM_014187	NP_054906	Q9BTX3	TM208_HUMAN	HSPC171 protein	151	Helical; (Potential).					integral to membrane					0		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.00067)|Epithelial(162;0.00442)|all cancers(182;0.0417)														---	---	---	---	capture		Missense_Mutation	SNP	67262945	67262945	16668	16	G	T	T	47	47	TMEM208	T	2	2
LDHD	197257	broad.mit.edu	37	16	75149143	75149143	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:75149143G>T	uc002fdm.2	-	3	327	c.280C>A	c.(280-282)CCA>ACA	p.P94T	LDHD_uc002fdn.2_Missense_Mutation_p.P94T	NM_153486	NP_705690	Q86WU2	LDHD_HUMAN	D-lactate dehydrogenase isoform 1 precursor	94	FAD-binding PCMH-type.						D-lactate dehydrogenase (cytochrome) activity|flavin adenine dinucleotide binding|protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	75149143	75149143	9027	16	G	T	T	43	43	LDHD	T	2	2
TAF1C	9013	broad.mit.edu	37	16	84214991	84214991	+	Silent	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84214991C>A	uc002fhn.2	-	10	1413	c.1185G>T	c.(1183-1185)GCG>GCT	p.A395A	TAF1C_uc002fhm.2_Silent_p.A302A|TAF1C_uc010vnx.1_Silent_p.A369A|TAF1C_uc010vny.1_5'UTR|TAF1C_uc010vnz.1_Silent_p.A63A|TAF1C_uc002fho.2_5'UTR|TAF1C_uc010voa.1_Silent_p.A63A|TAF1C_uc002fhp.1_Intron|TAF1C_uc010vob.1_3'UTR	NM_005679	NP_005670	Q15572	TAF1C_HUMAN	TBP-associated factor 1C isoform 1	395					regulation of transcription, DNA-dependent|termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase I promoter	nucleoplasm	DNA binding			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	84214991	84214991	16042	16	C	A	A	27	27	TAF1C	A	1	1
KIAA1609	57707	broad.mit.edu	37	16	84529384	84529384	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84529384G>A	uc002fib.2	-	3	396	c.289C>T	c.(289-291)CAC>TAC	p.H97Y	KIAA1609_uc010vod.1_Missense_Mutation_p.H70Y|KIAA1609_uc002fic.2_RNA	NM_020947	NP_065998	Q6P9B6	K1609_HUMAN	hypothetical protein LOC57707	97							protein binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	84529384	84529384	8556	16	G	A	A	47	47	KIAA1609	A	2	2
DBNDD1	79007	broad.mit.edu	37	16	90075214	90075214	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:90075214G>C	uc002fqf.1	-	3	485	c.297C>G	c.(295-297)AAC>AAG	p.N99K	DBNDD1_uc002fqe.1_Missense_Mutation_p.N119K|DBNDD1_uc002fqg.1_RNA	NM_001042610	NP_001036075	Q9H9R9	DBND1_HUMAN	dysbindin (dystrobrevin binding protein 1)	99						cytoplasm					0		all_cancers(9;4.44e-13)|Lung NSC(15;1.56e-06)|all_lung(18;2.18e-06)|all_neural(9;0.00118)|all_hematologic(23;0.0194)		BRCA - Breast invasive adenocarcinoma(80;0.0275)														---	---	---	---	capture		Missense_Mutation	SNP	90075214	90075214	4424	16	G	C	C	44	44	DBNDD1	C	3	3
ABR	29	broad.mit.edu	37	17	910480	910480	+	Silent	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:910480C>A	uc002fsd.2	-	22	2525	c.2415G>T	c.(2413-2415)CTG>CTT	p.L805L	ABR_uc002fse.2_Silent_p.L759L|ABR_uc010vqf.1_Silent_p.L256L|ABR_uc010vqg.1_Silent_p.L587L|ABR_uc002fsg.2_Silent_p.L768L|ABR_uc002fsf.2_Silent_p.L342L	NM_021962	NP_068781	Q12979	ABR_HUMAN	active breakpoint cluster region-related	805	Rho-GAP.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity|protein binding|Rho guanyl-nucleotide exchange factor activity			upper_aerodigestive_tract(1)	1				UCEC - Uterine corpus endometrioid carcinoma (25;0.0228)														---	---	---	---	capture		Silent	SNP	910480	910480	100	17	C	A	A	29	29	ABR	A	2	2
MYOCD	93649	broad.mit.edu	37	17	12656496	12656496	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:12656496C>A	uc002gnn.2	+	10	2190	c.1891C>A	c.(1891-1893)CCC>ACC	p.P631T	MYOCD_uc002gno.2_Missense_Mutation_p.P631T|MYOCD_uc002gnp.1_Missense_Mutation_p.P535T|MYOCD_uc002gnq.2_Missense_Mutation_p.P350T	NM_153604	NP_705832	Q8IZQ8	MYCD_HUMAN	myocardin isoform 2	631					cardiac muscle cell differentiation|negative regulation of cell proliferation|negative regulation of cyclin-dependent protein kinase activity|positive regulation of smooth muscle cell differentiation|positive regulation of smooth muscle contraction|positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation|regulation of histone acetylation|smooth muscle cell differentiation	nucleus	nucleic acid binding|RNA polymerase II transcription factor binding transcription factor activity|transcription factor binding			central_nervous_system(2)|skin(2)|ovary(1)	5				UCEC - Uterine corpus endometrioid carcinoma (92;0.0969)														---	---	---	---	capture		Missense_Mutation	SNP	12656496	12656496	10482	17	C	A	A	22	22	MYOCD	A	2	2
COPS3	8533	broad.mit.edu	37	17	17158245	17158245	+	Silent	SNP	T	C	C	rs141030201	by1000genomes	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:17158245T>C	uc002grd.2	-	9	1042	c.951A>G	c.(949-951)CTA>CTG	p.L317L	COPS3_uc010vwv.1_Silent_p.L297L|COPS3_uc010vww.1_Silent_p.L187L	NM_003653	NP_003644	Q9UNS2	CSN3_HUMAN	COP9 constitutive photomorphogenic homolog	317	PCI.				cullin deneddylation|response to light stimulus|signal transduction	cytoplasm|signalosome	protein binding			skin(1)	1																		---	---	---	---	capture		Silent	SNP	17158245	17158245	3872	17	T	C	C	49	49	COPS3	C	4	4
KCNJ12	3768	broad.mit.edu	37	17	21319849	21319849	+	Silent	SNP	C	A	A	rs144702327	byFrequency;by1000genomes	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:21319849C>A	uc002gyv.1	+	3	1900	c.1195C>A	c.(1195-1197)CGA>AGA	p.R399R		NM_021012	NP_066292	Q14500	IRK12_HUMAN	potassium inwardly-rectifying channel, subfamily	399	Cytoplasmic (By similarity).				blood circulation|muscle contraction|regulation of heart contraction|synaptic transmission	integral to membrane	inward rectifier potassium channel activity|ion channel inhibitor activity|potassium channel regulator activity			ovary(3)|skin(1)	4				Colorectal(15;0.0183)|COAD - Colon adenocarcinoma(3;0.0732)	Dofetilide(DB00204)										Prostate(3;0.18)			---	---	---	---	capture		Silent	SNP	21319849	21319849	8351	17	C	A	A	23	23	KCNJ12	A	1	1
EFCAB5	374786	broad.mit.edu	37	17	28296243	28296243	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:28296243G>C	uc002het.2	+	4	817	c.625G>C	c.(625-627)GAC>CAC	p.D209H	EFCAB5_uc010wbi.1_Intron|EFCAB5_uc010wbj.1_Missense_Mutation_p.D153H|EFCAB5_uc010wbk.1_Intron|EFCAB5_uc010csd.2_RNA|EFCAB5_uc010cse.2_Missense_Mutation_p.D88H|EFCAB5_uc010csf.2_Missense_Mutation_p.D88H	NM_198529	NP_940931	A4FU69	EFCB5_HUMAN	EF-hand calcium binding domain 5 isoform a	209							calcium ion binding			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	28296243	28296243	5125	17	G	C	C	45	45	EFCAB5	C	3	3
SLFN11	91607	broad.mit.edu	37	17	33690031	33690031	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:33690031C>T	uc010ctp.2	-	4	1238	c.796G>A	c.(796-798)GAC>AAC	p.D266N	SLFN11_uc010ctq.2_Missense_Mutation_p.D266N|SLFN11_uc002hjh.3_Missense_Mutation_p.D266N|SLFN11_uc002hjg.3_Missense_Mutation_p.D266N|SLFN11_uc010ctr.2_Missense_Mutation_p.D266N	NM_001104588	NP_001098058	Q7Z7L1	SLN11_HUMAN	schlafen family member 11	266						nucleus	ATP binding			large_intestine(1)|ovary(1)|skin(1)	3		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0182)														---	---	---	---	capture		Missense_Mutation	SNP	33690031	33690031	15230	17	C	T	T	29	29	SLFN11	T	2	2
KRTAP4-2	85291	broad.mit.edu	37	17	39334259	39334259	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39334259G>C	uc002hwd.2	-	1	202	c.158C>G	c.(157-159)TCT>TGT	p.S53C		NM_033062	NP_149051	Q9BYR5	KRA42_HUMAN	keratin associated protein 4-2	53	20 X 5 AA repeats OF C-C-[GRQVS]-[SPT]- [VSTQ].|8.					keratin filament					0		Breast(137;0.000496)	STAD - Stomach adenocarcinoma(17;0.000449)															---	---	---	---	capture		Missense_Mutation	SNP	39334259	39334259	8873	17	G	C	C	33	33	KRTAP4-2	C	3	3
WNK4	65266	broad.mit.edu	37	17	40937356	40937356	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40937356G>T	uc002ibj.2	+	6	1353	c.1332G>T	c.(1330-1332)GAG>GAT	p.E444D	WNK4_uc010wgx.1_Missense_Mutation_p.E108D|WNK4_uc002ibk.1_Missense_Mutation_p.E216D|WNK4_uc010wgy.1_Translation_Start_Site	NM_032387	NP_115763	Q96J92	WNK4_HUMAN	WNK lysine deficient protein kinase 4	444					intracellular protein kinase cascade	tight junction	ATP binding|protein serine/threonine kinase activity			ovary(3)|skin(3)|stomach(1)	7		Breast(137;0.000143)		BRCA - Breast invasive adenocarcinoma(366;0.0749)														---	---	---	---	capture		Missense_Mutation	SNP	40937356	40937356	17954	17	G	T	T	35	35	WNK4	T	2	2
ASB16	92591	broad.mit.edu	37	17	42248258	42248258	+	Missense_Mutation	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42248258A>T	uc002ifl.1	+	1	185	c.101A>T	c.(100-102)CAG>CTG	p.Q34L	ASB16_uc002ifm.1_RNA	NM_080863	NP_543139	Q96NS5	ASB16_HUMAN	ankyrin repeat and SOCS box-containing protein	34					intracellular signal transduction		protein binding			kidney(2)	2		Breast(137;0.00765)|Prostate(33;0.0313)		BRCA - Breast invasive adenocarcinoma(366;0.114)														---	---	---	---	capture		Missense_Mutation	SNP	42248258	42248258	1038	17	A	T	T	7	7	ASB16	T	4	4
CRHR1	1394	broad.mit.edu	37	17	43893891	43893891	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43893891C>A	uc010dap.2	+	3	449	c.184C>A	c.(184-186)CAG>AAG	p.Q62K	CRHR1_uc010wjx.1_5'UTR|CRHR1_uc002ijp.2_5'UTR|CRHR1_uc002ijm.2_Missense_Mutation_p.Q62K|CRHR1_uc002ijn.2_Intron|CRHR1_uc010dar.2_Missense_Mutation_p.Q62K|CRHR1_uc010dao.2_5'UTR|CRHR1_uc010daq.2_5'UTR|CRHR1_uc010das.1_RNA|CRHR1_uc002ijo.1_Intron	NM_001145146	NP_001138618	P34998	CRFR1_HUMAN	corticotropin releasing hormone receptor 1	62	Extracellular (Potential).				female pregnancy|immune response|parturition	integral to plasma membrane	corticotrophin-releasing factor receptor activity|protein binding			lung(3)	3	Colorectal(2;0.0416)			BRCA - Breast invasive adenocarcinoma(366;0.161)														---	---	---	---	capture		Missense_Mutation	SNP	43893891	43893891	4010	17	C	A	A	25	25	CRHR1	A	2	2
MRC2	9902	broad.mit.edu	37	17	60768056	60768056	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:60768056G>A	uc002jad.2	+	27	4348	c.3946G>A	c.(3946-3948)GAG>AAG	p.E1316K	MRC2_uc002jae.2_Missense_Mutation_p.E387K|MRC2_uc002jaf.2_Missense_Mutation_p.E182K	NM_006039	NP_006030	Q9UBG0	MRC2_HUMAN	mannose receptor, C type 2	1316	Extracellular (Potential).|C-type lectin 8.				endocytosis	integral to membrane	receptor activity|sugar binding			ovary(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	60768056	60768056	10150	17	G	A	A	41	41	MRC2	A	2	2
ACE	1636	broad.mit.edu	37	17	61554676	61554676	+	Missense_Mutation	SNP	A	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61554676A>C	uc002jau.1	+	1	243	c.221A>C	c.(220-222)AAC>ACC	p.N74T	ACE_uc010wph.1_Missense_Mutation_p.N74T|ACE_uc010wpi.1_Missense_Mutation_p.N74T|ACE_uc010ddu.1_5'UTR	NM_000789	NP_000780	P12821	ACE_HUMAN	angiotensin I converting enzyme 1 isoform 1	74	Extracellular (Potential).|Peptidase M2 1.				arachidonic acid secretion|hormone catabolic process|kidney development|peptide catabolic process|regulation of smooth muscle cell migration	endosome|external side of plasma membrane|extracellular space|integral to membrane|membrane fraction|plasma membrane	actin binding|bradykinin receptor binding|carboxypeptidase activity|chloride ion binding|drug binding|metallopeptidase activity|peptidyl-dipeptidase activity|zinc ion binding			ovary(2)|upper_aerodigestive_tract(1)|pancreas(1)	4					Benazepril(DB00542)|Captopril(DB01197)|Deserpidine(DB01089)|Enalapril(DB00584)|Fosinopril(DB00492)|Lisinopril(DB00722)|Moexipril(DB00691)|Perindopril(DB00790)|Quinapril(DB00881)|Ramipril(DB00178)|Rescinnamine(DB01180)|Spirapril(DB01348)|Trandolapril(DB00519)													---	---	---	---	capture		Missense_Mutation	SNP	61554676	61554676	137	17	A	C	C	2	2	ACE	C	4	4
DDX42	11325	broad.mit.edu	37	17	61895543	61895543	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61895543G>A	uc002jbu.2	+	19	2859	c.2602G>A	c.(2602-2604)GCA>ACA	p.A868T	DDX42_uc002jbv.2_Missense_Mutation_p.A868T|DDX42_uc002jbx.2_Missense_Mutation_p.A604T|DDX42_uc002jby.2_Missense_Mutation_p.A414T|DDX42_uc010wps.1_Missense_Mutation_p.A236T	NM_007372	NP_031398	Q86XP3	DDX42_HUMAN	DEAD box polypeptide 42 protein	868	Gly-rich.|His-rich.				protein localization|regulation of anti-apoptosis	Cajal body|cytoplasm|nuclear speck	ATP binding|ATP-dependent helicase activity|protein binding|RNA binding			ovary(2)|skin(2)|large_intestine(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	61895543	61895543	4533	17	G	A	A	38	38	DDX42	A	1	1
ST6GALNAC1	55808	broad.mit.edu	37	17	74625591	74625591	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74625591G>T	uc002jsh.2	-	2	508	c.334C>A	c.(334-336)CAG>AAG	p.Q112K	ST6GALNAC1_uc002jsi.2_5'UTR|ST6GALNAC1_uc002jsj.2_RNA	NM_018414	NP_060884	Q9NSC7	SIA7A_HUMAN	sialyltransferase 7A	112	Lumenal (Potential).				protein glycosylation	integral to Golgi membrane	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	74625591	74625591	15741	17	G	T	T	46	46	ST6GALNAC1	T	2	2
CANT1	124583	broad.mit.edu	37	17	76989736	76989736	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:76989736C>T	uc002jwn.2	-	6	1541	c.1102G>A	c.(1102-1104)GGC>AGC	p.G368S	CANT1_uc002jwk.2_Missense_Mutation_p.G368S|CANT1_uc002jwj.2_Missense_Mutation_p.G368S|CANT1_uc002jwl.2_Intron|CANT1_uc002jwm.1_RNA	NM_001159772	NP_001153244	Q8WVQ1	CANT1_HUMAN	calcium activated nucleotidase 1	368	Lumenal (Potential).				positive regulation of I-kappaB kinase/NF-kappaB cascade	endoplasmic reticulum membrane|Golgi cisterna membrane|integral to membrane	calcium ion binding|nucleoside-diphosphatase activity|signal transducer activity				0			BRCA - Breast invasive adenocarcinoma(99;0.0362)|OV - Ovarian serous cystadenocarcinoma(97;0.139)					T	ETV4	prostate						OREG0024788	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	76989736	76989736	2734	17	C	T	T	23	23	CANT1	T	1	1
ENPP7	339221	broad.mit.edu	37	17	77708963	77708963	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:77708963C>T	uc002jxa.2	+	3	541	c.521C>T	c.(520-522)GCG>GTG	p.A174V		NM_178543	NP_848638	Q6UWV6	ENPP7_HUMAN	ectonucleotide pyrophosphatase/phosphodiesterase	174					negative regulation of cell proliferation|negative regulation of DNA replication|sphingomyelin metabolic process	Golgi apparatus|integral to membrane|microvillus	sphingomyelin phosphodiesterase activity			central_nervous_system(2)|ovary(1)	3			OV - Ovarian serous cystadenocarcinoma(97;0.016)|BRCA - Breast invasive adenocarcinoma(99;0.0224)															---	---	---	---	capture		Missense_Mutation	SNP	77708963	77708963	5328	17	C	T	T	27	27	ENPP7	T	1	1
CETN1	1068	broad.mit.edu	37	18	580495	580495	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:580495G>C	uc002kko.1	+	1	129	c.87G>C	c.(85-87)CAG>CAC	p.Q29H		NM_004066	NP_004057	Q12798	CETN1_HUMAN	centrin 1	29	EF-hand 1.				cell division|mitosis	spindle pole	ATP binding|ATP-dependent helicase activity|calcium ion binding|nucleic acid binding			upper_aerodigestive_tract(1)|ovary(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	580495	580495	3407	18	G	C	C	33	33	CETN1	C	3	3
DLGAP1	9229	broad.mit.edu	37	18	3879841	3879841	+	Silent	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3879841G>T	uc002kmf.2	-	1	295	c.228C>A	c.(226-228)ACC>ACA	p.T76T	DLGAP1_uc010wyz.1_Silent_p.T76T|DLGAP1_uc002kmk.2_Silent_p.T76T|uc002kml.1_Intron	NM_004746	NP_004737	O14490	DLGP1_HUMAN	discs large homolog-associated protein 1 isoform	76					synaptic transmission	cell junction|postsynaptic density|postsynaptic membrane				ovary(2)|pancreas(1)|skin(1)	4		Colorectal(8;0.0257)																---	---	---	---	capture		Silent	SNP	3879841	3879841	4739	18	G	T	T	35	35	DLGAP1	T	2	2
SALL3	27164	broad.mit.edu	37	18	76753467	76753467	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:76753467C>T	uc002lmt.2	+	2	1476	c.1476C>T	c.(1474-1476)CCC>CCT	p.P492P	SALL3_uc010dra.2_Silent_p.P99P	NM_171999	NP_741996	Q9BXA9	SALL3_HUMAN	sal-like 3	492					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|large_intestine(1)|central_nervous_system(1)	4		Esophageal squamous(42;0.129)|Melanoma(33;0.16)|Prostate(75;0.167)		OV - Ovarian serous cystadenocarcinoma(15;4.69e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0256)														---	---	---	---	capture		Silent	SNP	76753467	76753467	14292	18	C	T	T	21	21	SALL3	T	2	2
DAPK3	1613	broad.mit.edu	37	19	3959564	3959564	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3959564C>T	uc002lzc.1	-	8	993	c.900G>A	c.(898-900)ACG>ACA	p.T300T	DAPK3_uc002lzb.1_Silent_p.T37T|DAPK3_uc002lzd.1_Silent_p.T300T	NM_001348	NP_001339	O43293	DAPK3_HUMAN	death-associated protein kinase 3	300					apoptosis|chromatin modification|induction of apoptosis|intracellular protein kinase cascade	cytoplasm|PML body	ATP binding|leucine zipper domain binding|protein serine/threonine kinase activity			central_nervous_system(3)|lung(2)|ovary(1)|large_intestine(1)	7		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.00461)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Silent	SNP	3959564	3959564	4404	19	C	T	T	27	27	DAPK3	T	1	1
INSR	3643	broad.mit.edu	37	19	7125332	7125332	+	Nonsense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7125332C>A	uc002mgd.1	-	17	3329	c.3220G>T	c.(3220-3222)GAG>TAG	p.E1074*	INSR_uc002mge.1_Nonsense_Mutation_p.E1062*	NM_000208	NP_000199	P06213	INSR_HUMAN	insulin receptor isoform Long precursor	1074	Protein kinase.|Cytoplasmic (Potential).				activation of MAPK activity|activation of protein kinase B activity|carbohydrate metabolic process|fibroblast growth factor receptor signaling pathway|G-protein coupled receptor protein signaling pathway|glucose homeostasis|heart morphogenesis|peptidyl-tyrosine phosphorylation|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of developmental growth|positive regulation of DNA replication|positive regulation of glucose import|positive regulation of glycogen biosynthetic process|positive regulation of glycolysis|positive regulation of MAPKKK cascade|positive regulation of mitosis|positive regulation of nitric oxide biosynthetic process|positive regulation of protein kinase B signaling cascade|positive regulation of protein phosphorylation|positive regulation of respiratory burst|protein autophosphorylation|protein heterotetramerization|regulation of embryonic development|regulation of transcription, DNA-dependent|transformation of host cell by virus	caveola|endosome membrane|insulin receptor complex|microsome	ATP binding|GTP binding|insulin binding|insulin receptor activity|insulin receptor substrate binding|insulin-like growth factor I binding|insulin-like growth factor II binding|insulin-like growth factor receptor binding|metal ion binding|phosphatidylinositol 3-kinase binding|PTB domain binding|receptor signaling protein tyrosine kinase activity|SH2 domain binding			ovary(4)|lung(3)|central_nervous_system(2)|large_intestine(1)|stomach(1)|skin(1)	12					Insulin Glargine recombinant(DB00047)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)													---	---	---	---	capture		Nonsense_Mutation	SNP	7125332	7125332	8074	19	C	A	A	29	29	INSR	A	5	2
FBN3	84467	broad.mit.edu	37	19	8174625	8174625	+	Missense_Mutation	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8174625C>G	uc002mjf.2	-	34	4367	c.4346G>C	c.(4345-4347)TGT>TCT	p.C1449S		NM_032447	NP_115823	Q75N90	FBN3_HUMAN	fibrillin 3 precursor	1449	EGF-like 23; calcium-binding.					proteinaceous extracellular matrix	calcium ion binding|extracellular matrix structural constituent			ovary(6)|skin(3)|pancreas(1)|central_nervous_system(1)	11																		---	---	---	---	capture		Missense_Mutation	SNP	8174625	8174625	5940	19	C	G	G	17	17	FBN3	G	3	3
ADAMTS10	81794	broad.mit.edu	37	19	8657685	8657685	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8657685C>T	uc002mkj.1	-	13	1823	c.1549G>A	c.(1549-1551)GAG>AAG	p.E517K	ADAMTS10_uc002mki.1_5'Flank|ADAMTS10_uc002mkk.1_Missense_Mutation_p.E149K	NM_030957	NP_112219	Q9H324	ATS10_HUMAN	ADAM metallopeptidase with thrombospondin type 1	517	Disintegrin.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			pancreas(2)|skin(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	8657685	8657685	257	19	C	T	T	31	31	ADAMTS10	T	1	1
OR1M1	125963	broad.mit.edu	37	19	9204359	9204359	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9204359G>A	uc010xkj.1	+	1	439	c.439G>A	c.(439-441)GCC>ACC	p.A147T		NM_001004456	NP_001004456	Q8NGA1	OR1M1_HUMAN	olfactory receptor, family 1, subfamily M,	147	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(3)	3																		---	---	---	---	capture		Missense_Mutation	SNP	9204359	9204359	11374	19	G	A	A	38	38	OR1M1	A	1	1
ILF3	3609	broad.mit.edu	37	19	10791697	10791697	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10791697C>T	uc002mpn.2	+	10	1277	c.960C>T	c.(958-960)CAC>CAT	p.H320H	ILF3_uc002mpm.2_Silent_p.H320H|ILF3_uc002mpl.2_Silent_p.H320H|ILF3_uc002mpk.2_Silent_p.H320H|ILF3_uc010xli.1_Intron|ILF3_uc002mpo.2_Silent_p.H320H|ILF3_uc002mpp.2_Silent_p.H141H	NM_012218	NP_036350	Q12906	ILF3_HUMAN	interleukin enhancer binding factor 3 isoform a	320	DZF.				M phase|negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	mitochondrion|nucleolus|ribonucleoprotein complex	DNA binding|double-stranded RNA binding|protein binding|protein binding			ovary(3)	3			Epithelial(33;6.86e-06)|all cancers(31;1.65e-05)															---	---	---	---	capture		Silent	SNP	10791697	10791697	8013	19	C	T	T	19	19	ILF3	T	1	1
ZNF676	163223	broad.mit.edu	37	19	22363521	22363521	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22363521C>A	uc002nqs.1	-	3	1316	c.998G>T	c.(997-999)GGA>GTA	p.G333V		NM_001001411	NP_001001411	Q8N7Q3	ZN676_HUMAN	zinc finger protein 676	333					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Lung NSC(12;0.0207)|all_lung(12;0.0214)|all_epithelial(12;0.114)																---	---	---	---	capture		Missense_Mutation	SNP	22363521	22363521	18678	19	C	A	A	30	30	ZNF676	A	2	2
ZNF492	57615	broad.mit.edu	37	19	22847660	22847660	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22847660G>C	uc002nqw.3	+	4	1433	c.1189G>C	c.(1189-1191)GAA>CAA	p.E397Q		NM_020855	NP_065906	Q9P255	ZN492_HUMAN	zinc finger protein 492	397	C2H2-type 10.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(12;0.0266)|all_lung(12;0.00187)|Lung NSC(12;0.0019)|all_epithelial(12;0.00203)|Hepatocellular(1079;0.244)																---	---	---	---	capture		Missense_Mutation	SNP	22847660	22847660	18537	19	G	C	C	33	33	ZNF492	C	3	3
ZNF492	57615	broad.mit.edu	37	19	22847933	22847933	+	Missense_Mutation	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22847933A>T	uc002nqw.3	+	4	1706	c.1462A>T	c.(1462-1464)AAC>TAC	p.N488Y		NM_020855	NP_065906	Q9P255	ZN492_HUMAN	zinc finger protein 492	488	C2H2-type 13.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(12;0.0266)|all_lung(12;0.00187)|Lung NSC(12;0.0019)|all_epithelial(12;0.00203)|Hepatocellular(1079;0.244)																---	---	---	---	capture		Missense_Mutation	SNP	22847933	22847933	18537	19	A	T	T	5	5	ZNF492	T	4	4
ZNF99	7652	broad.mit.edu	37	19	22940298	22940298	+	Missense_Mutation	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22940298T>C	uc010xrh.1	-	5	2140	c.2140A>G	c.(2140-2142)AGA>GGA	p.R714G		NM_001080409	NP_001073878			zinc finger protein 99											ovary(1)|skin(1)	2		Lung NSC(12;0.0207)|all_lung(12;0.0214)|all_epithelial(12;0.102)																---	---	---	---	capture		Missense_Mutation	SNP	22940298	22940298	18808	19	T	C	C	53	53	ZNF99	C	4	4
C19orf2	8725	broad.mit.edu	37	19	30500174	30500174	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:30500174G>A	uc002nsr.2	+	8	979	c.949G>A	c.(949-951)GAT>AAT	p.D317N	C19orf2_uc002nsq.2_Missense_Mutation_p.D299N|C19orf2_uc002nss.2_Missense_Mutation_p.D277N|C19orf2_uc002nst.2_Missense_Mutation_p.D241N	NM_003796	NP_003787	O94763	RMP_HUMAN	RPB5-mediating protein isoform a	317	Poly-Asp.				protein folding|regulation of transcription from RNA polymerase II promoter|response to virus	DNA-directed RNA polymerase II, core complex|prefoldin complex	transcription corepressor activity|unfolded protein binding			ovary(1)|kidney(1)	2	Ovarian(5;0.000902)|Breast(6;0.0203)|Esophageal squamous(110;0.195)	Hepatocellular(1079;0.137)|Renal(1328;0.228)	STAD - Stomach adenocarcinoma(5;5.36e-06)|Lung(7;0.0144)|LUAD - Lung adenocarcinoma(5;0.115)	STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Missense_Mutation	SNP	30500174	30500174	1973	19	G	A	A	45	45	C19orf2	A	2	2
RYR1	6261	broad.mit.edu	37	19	39062862	39062862	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39062862G>A	uc002oit.2	+	95	14080	c.13950G>A	c.(13948-13950)CTG>CTA	p.L4650L	RYR1_uc002oiu.2_Silent_p.L4645L	NM_000540	NP_000531	P21817	RYR1_HUMAN	skeletal muscle ryanodine receptor isoform 1	4650	Helical; Name=M6; (Potential).		L -> P (in CCD; autosomal recessive form).		muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)													---	---	---	---	capture		Silent	SNP	39062862	39062862	14248	19	G	A	A	46	46	RYR1	A	2	2
GPR77	27202	broad.mit.edu	37	19	47844573	47844573	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:47844573C>A	uc010ela.1	+	2	735	c.517C>A	c.(517-519)CGC>AGC	p.R173S	GPR77_uc002pgk.1_Missense_Mutation_p.R173S	NM_018485	NP_060955	Q9P296	C5ARL_HUMAN	G protein-coupled receptor 77	173	Extracellular (Potential).				chemotaxis	integral to membrane|plasma membrane	C5a anaphylatoxin receptor activity			ovary(1)	1		all_cancers(25;1.72e-06)|all_lung(116;2.15e-05)|all_epithelial(76;3.44e-05)|Lung NSC(112;3.77e-05)|all_neural(266;0.0652)|Ovarian(192;0.086)		all cancers(93;0.000129)|OV - Ovarian serous cystadenocarcinoma(262;0.000415)|Epithelial(262;0.0109)|GBM - Glioblastoma multiforme(486;0.0138)														---	---	---	---	capture		Missense_Mutation	SNP	47844573	47844573	6984	19	C	A	A	23	23	GPR77	A	1	1
RASIP1	54922	broad.mit.edu	37	19	49225237	49225237	+	Missense_Mutation	SNP	T	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49225237T>A	uc002pki.2	-	11	2763	c.2566A>T	c.(2566-2568)ACC>TCC	p.T856S	MAMSTR_uc002pkg.2_5'Flank|RASIP1_uc002pkh.2_Missense_Mutation_p.T117S	NM_017805	NP_060275	Q5U651	RAIN_HUMAN	Ras-interacting protein 1	856	Dilute.				signal transduction	Golgi stack|perinuclear region of cytoplasm				pancreas(1)	1		all_lung(116;4.89e-06)|all_epithelial(76;7.04e-06)|Lung NSC(112;9.34e-06)|all_neural(266;0.0189)|Ovarian(192;0.0261)		OV - Ovarian serous cystadenocarcinoma(262;9.98e-05)|all cancers(93;0.000272)|Epithelial(262;0.0155)|GBM - Glioblastoma multiforme(486;0.0222)														---	---	---	---	capture		Missense_Mutation	SNP	49225237	49225237	13539	19	T	A	A	60	60	RASIP1	A	4	4
SIGLEC9	27180	broad.mit.edu	37	19	51628378	51628378	+	Silent	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:51628378C>A	uc002pvu.2	+	1	214	c.147C>A	c.(145-147)GGC>GGA	p.G49G	SIGLEC9_uc010yct.1_Silent_p.G49G	NM_014441	NP_055256	Q9Y336	SIGL9_HUMAN	sialic acid binding Ig-like lectin 9 precursor	49	Extracellular (Potential).|Ig-like V-type.				cell adhesion|cell surface receptor linked signaling pathway	integral to plasma membrane	sugar binding			skin(1)	1		all_neural(266;0.0529)		GBM - Glioblastoma multiforme(134;0.000826)|OV - Ovarian serous cystadenocarcinoma(262;0.00295)														---	---	---	---	capture		Silent	SNP	51628378	51628378	14810	19	C	A	A	28	28	SIGLEC9	A	2	2
ZNF534	147658	broad.mit.edu	37	19	52941348	52941348	+	Missense_Mutation	SNP	A	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52941348A>C	uc002pzk.2	+	4	735	c.674A>C	c.(673-675)AAA>ACA	p.K225T	ZNF534_uc002pzj.1_Intron|ZNF534_uc010epo.1_Intron|ZNF534_uc002pzl.2_Missense_Mutation_p.K212T	NM_001143939	NP_001137411	Q76KX8	ZN534_HUMAN	zinc finger protein 534 isoform 2	225					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	52941348	52941348	18567	19	A	C	C	1	1	ZNF534	C	4	4
ZNF808	388558	broad.mit.edu	37	19	53057259	53057259	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53057259C>T	uc010epq.1	+	5	1267	c.1090C>T	c.(1090-1092)CTT>TTT	p.L364F	ZNF808_uc002pzq.2_RNA|ZNF808_uc010epr.1_5'Flank	NM_001039886	NP_001034975	Q8N4W9	ZN808_HUMAN	zinc finger protein 808	364	C2H2-type 5.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				OV - Ovarian serous cystadenocarcinoma(262;0.00501)|GBM - Glioblastoma multiforme(134;0.0213)														---	---	---	---	capture		Missense_Mutation	SNP	53057259	53057259	18771	19	C	T	T	20	20	ZNF808	T	2	2
ZNF160	90338	broad.mit.edu	37	19	53572222	53572222	+	Nonsense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53572222G>C	uc010eqk.2	-	7	1981	c.1565C>G	c.(1564-1566)TCA>TGA	p.S522*	ZNF160_uc002qaq.3_Nonsense_Mutation_p.S522*|ZNF160_uc002qar.3_Nonsense_Mutation_p.S522*	NM_001102603	NP_001096073	Q9HCG1	ZN160_HUMAN	zinc finger protein 160	522	C2H2-type 10.				hemopoiesis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			central_nervous_system(1)	1				GBM - Glioblastoma multiforme(134;0.02)														---	---	---	---	capture		Nonsense_Mutation	SNP	53572222	53572222	18330	19	G	C	C	45	45	ZNF160	C	5	3
PEG3	5178	broad.mit.edu	37	19	57325529	57325529	+	Silent	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57325529T>C	uc002qnu.2	-	7	4632	c.4281A>G	c.(4279-4281)GGA>GGG	p.G1427G	ZIM2_uc010ygq.1_Intron|ZIM2_uc010ygr.1_Intron|ZIM2_uc002qnr.2_Intron|ZIM2_uc002qnq.2_Intron|ZIM2_uc010etp.2_Intron|ZIM2_uc010ygs.1_Intron|PEG3_uc002qnt.2_Silent_p.G1398G|PEG3_uc002qnv.2_Silent_p.G1427G|PEG3_uc002qnw.2_Silent_p.G1303G|PEG3_uc002qnx.2_Silent_p.G1301G|PEG3_uc010etr.2_Silent_p.G1427G	NM_001146186	NP_001139658	Q9GZU2	PEG3_HUMAN	paternally expressed 3 isoform 1	1427	1-2.|Glu-rich.|4 X 5 AA repeat of P-X-G-E-A.				apoptosis|viral reproduction	cytoplasm|nucleus	nucleic acid binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(7)|skin(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	12		Colorectal(82;0.000256)|all_neural(62;0.103)|Ovarian(87;0.243)		GBM - Glioblastoma multiforme(193;0.0269)														---	---	---	---	capture		Silent	SNP	57325529	57325529	12141	19	T	C	C	54	54	PEG3	C	4	4
PLEKHH2	130271	broad.mit.edu	37	2	43968158	43968158	+	Missense_Mutation	SNP	A	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:43968158A>C	uc010yny.1	+	21	3280	c.3197A>C	c.(3196-3198)CAC>CCC	p.H1066P	PLEKHH2_uc002rtf.3_Missense_Mutation_p.H1065P	NM_172069	NP_742066	Q8IVE3	PKHH2_HUMAN	pleckstrin homology domain containing, family H	1066	MyTH4.					cytoplasm|cytoskeleton|integral to membrane	binding			skin(2)|central_nervous_system(1)	3		all_hematologic(82;0.166)|Acute lymphoblastic leukemia(82;0.17)																---	---	---	---	capture		Missense_Mutation	SNP	43968158	43968158	12503	2	A	C	C	6	6	PLEKHH2	C	4	4
STON1-GTF2A1L	286749	broad.mit.edu	37	2	48808979	48808979	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48808979G>T	uc010yol.1	+	1	1254	c.1207G>T	c.(1207-1209)GTT>TTT	p.V403F	STON1_uc002rwo.3_Missense_Mutation_p.V403F|STON1_uc010fbm.2_Missense_Mutation_p.V403F|STON1-GTF2A1L_uc002rwp.1_Missense_Mutation_p.V403F|STON1_uc002rwr.2_RNA|STON1_uc002rwq.2_Missense_Mutation_p.V403F	NM_006873	NP_006864	B7ZL16	B7ZL16_HUMAN	stonin 1	403					endocytosis|intracellular protein transport|transcription initiation from RNA polymerase II promoter	clathrin adaptor complex|transcription factor TFIIA complex				ovary(3)|pancreas(1)|skin(1)	5		all_hematologic(82;0.151)|Acute lymphoblastic leukemia(82;0.176)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)															---	---	---	---	capture		Missense_Mutation	SNP	48808979	48808979	15837	2	G	T	T	48	48	STON1-GTF2A1L	T	2	2
KDM3A	55818	broad.mit.edu	37	2	86711188	86711188	+	Nonsense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:86711188G>T	uc002sri.3	+	19	3328	c.3001G>T	c.(3001-3003)GAG>TAG	p.E1001*	KDM3A_uc010ytj.1_Nonsense_Mutation_p.E1001*|KDM3A_uc010ytk.1_Nonsense_Mutation_p.E949*	NM_018433	NP_060903	Q9Y4C1	KDM3A_HUMAN	jumonji domain containing 1A	1001					androgen receptor signaling pathway|cell differentiation|formaldehyde biosynthetic process|histone H3-K9 demethylation|hormone-mediated signaling pathway|positive regulation of transcription, DNA-dependent|spermatogenesis|transcription, DNA-dependent	cytoplasm|nucleus	androgen receptor binding|iron ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			breast(2)|ovary(1)|central_nervous_system(1)|skin(1)	5																		---	---	---	---	capture		Nonsense_Mutation	SNP	86711188	86711188	8432	2	G	T	T	45	45	KDM3A	T	5	2
UBXN4	23190	broad.mit.edu	37	2	136519470	136519470	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:136519470C>T	uc002tur.2	+	6	902	c.591C>T	c.(589-591)ATC>ATT	p.I197I	UBXN4_uc002tus.2_Intron	NM_014607	NP_055422	Q92575	UBXN4_HUMAN	UBX domain containing 2	197	Cytoplasmic (Potential).				response to unfolded protein	endoplasmic reticulum membrane|nuclear envelope	protein binding			skin(2)	2																		---	---	---	---	capture		Silent	SNP	136519470	136519470	17474	2	C	T	T	30	30	UBXN4	T	2	2
CXCR4	7852	broad.mit.edu	37	2	136873097	136873097	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:136873097C>A	uc002tuz.2	-	2	496	c.401G>T	c.(400-402)CGC>CTC	p.R134L	CXCR4_uc002tuy.2_Missense_Mutation_p.R138L|CXCR4_uc010fnk.2_Missense_Mutation_p.R119L	NM_003467	NP_003458	P61073	CXCR4_HUMAN	chemokine (C-X-C motif) receptor 4 isoform b	134	Important for signaling.|Cytoplasmic.			R->A: Loss of agonist-induced G-protein activation.	activation of MAPK activity|apoptosis|dendritic cell chemotaxis|elevation of cytosolic calcium ion concentration|entry into host cell|inflammatory response|initiation of viral infection|regulation of chemotaxis|response to hypoxia|response to virus	cell leading edge|cell surface|cytoplasmic membrane-bounded vesicle|integral to membrane|plasma membrane	actin binding|C-X-C chemokine receptor activity|coreceptor activity|myosin light chain binding|ubiquitin binding|ubiquitin protein ligase binding			upper_aerodigestive_tract(1)|large_intestine(1)|lung(1)	3				BRCA - Breast invasive adenocarcinoma(221;0.155)	Framycetin(DB00452)													---	---	---	---	capture		Missense_Mutation	SNP	136873097	136873097	4253	2	C	A	A	27	27	CXCR4	A	1	1
LRP1B	53353	broad.mit.edu	37	2	141202195	141202195	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141202195G>T	uc002tvj.1	-	64	11083	c.10111C>A	c.(10111-10113)CTA>ATA	p.L3371I		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	3371	Extracellular (Potential).|LDL-receptor class A 22.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)											TSP Lung(27;0.18)			---	---	---	---	capture		Missense_Mutation	SNP	141202195	141202195	9328	2	G	T	T	33	33	LRP1B	T	2	2
LRP1B	53353	broad.mit.edu	37	2	141253313	141253313	+	Missense_Mutation	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141253313T>C	uc002tvj.1	-	56	9827	c.8855A>G	c.(8854-8856)AAA>AGA	p.K2952R		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	2952	Extracellular (Potential).|EGF-like 6.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)											TSP Lung(27;0.18)			---	---	---	---	capture		Missense_Mutation	SNP	141253313	141253313	9328	2	T	C	C	64	64	LRP1B	C	4	4
LRP1B	53353	broad.mit.edu	37	2	141299461	141299461	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141299461C>T	uc002tvj.1	-	44	8246	c.7274G>A	c.(7273-7275)AGA>AAA	p.R2425K		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	2425	Extracellular (Potential).|LDL-receptor class B 27.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)											TSP Lung(27;0.18)			---	---	---	---	capture		Missense_Mutation	SNP	141299461	141299461	9328	2	C	T	T	32	32	LRP1B	T	2	2
ARL6IP6	151188	broad.mit.edu	37	2	153575168	153575168	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:153575168G>A	uc002tyn.2	+	1	746	c.30G>A	c.(28-30)TCG>TCA	p.S10S	ARL6IP6_uc002tym.2_Intron|ARL6IP6_uc002tyo.2_5'Flank|PRPF40A_uc002tyh.3_5'Flank|PRPF40A_uc010zcd.1_5'Flank|PRPF40A_uc002tyi.2_5'Flank|PRPF40A_uc002tyj.2_5'Flank|PRPF40A_uc002tyl.1_5'Flank	NM_152522	NP_689735	Q8N6S5	AR6P6_HUMAN	ADP-ribosylation-like factor 6 interacting	10						integral to membrane					0																		---	---	---	---	capture		Silent	SNP	153575168	153575168	963	2	G	A	A	39	39	ARL6IP6	A	1	1
GALNT13	114805	broad.mit.edu	37	2	155158018	155158018	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:155158018G>T	uc002tyr.3	+	9	1639	c.1072G>T	c.(1072-1074)GGT>TGT	p.G358C	GALNT13_uc002tyt.3_Missense_Mutation_p.G358C|GALNT13_uc010foc.1_Missense_Mutation_p.G177C|GALNT13_uc010fod.2_Missense_Mutation_p.G111C	NM_052917	NP_443149	Q8IUC8	GLT13_HUMAN	UDP-N-acetyl-alpha-D-galactosamine:polypeptide	358	Lumenal (Potential).					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			ovary(2)|pancreas(2)|central_nervous_system(1)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	155158018	155158018	6475	2	G	T	T	47	47	GALNT13	T	2	2
KCNH7	90134	broad.mit.edu	37	2	163291882	163291882	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:163291882G>T	uc002uch.1	-	8	1992	c.1780C>A	c.(1780-1782)CAA>AAA	p.Q594K	KCNH7_uc002uci.2_Missense_Mutation_p.Q587K	NM_033272	NP_150375	Q9NS40	KCNH7_HUMAN	potassium voltage-gated channel, subfamily H,	594	Extracellular (Potential).				regulation of transcription, DNA-dependent	integral to membrane	protein binding|signal transducer activity			ovary(3)|skin(2)	5					Ibutilide(DB00308)													---	---	---	---	capture		Missense_Mutation	SNP	163291882	163291882	8342	2	G	T	T	46	46	KCNH7	T	2	2
SLC39A10	57181	broad.mit.edu	37	2	196545295	196545295	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196545295C>A	uc002utg.3	+	2	743	c.529C>A	c.(529-531)CGC>AGC	p.R177S	SLC39A10_uc002uth.3_Missense_Mutation_p.R177S|SLC39A10_uc010zgp.1_Intron	NM_001127257	NP_001120729	Q9ULF5	S39AA_HUMAN	solute carrier family 39 (zinc transporter),	177	His-rich.				zinc ion transport	integral to membrane	metal ion transmembrane transporter activity			pancreas(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.221)															---	---	---	---	capture		Missense_Mutation	SNP	196545295	196545295	15110	2	C	A	A	23	23	SLC39A10	A	1	1
SATB2	23314	broad.mit.edu	37	2	200173623	200173623	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:200173623G>T	uc002uuy.1	-	10	2417	c.1600C>A	c.(1600-1602)CTC>ATC	p.L534I	SATB2_uc010fsq.1_Missense_Mutation_p.L416I|SATB2_uc002uuz.1_Missense_Mutation_p.L534I|SATB2_uc002uva.1_Missense_Mutation_p.L534I	NM_015265	NP_056080	Q9UPW6	SATB2_HUMAN	SATB homeobox 2	534	CUT 2.					cytoplasm|nuclear matrix	sequence-specific DNA binding transcription factor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	200173623	200173623	14335	2	G	T	T	35	35	SATB2	T	2	2
FN1	2335	broad.mit.edu	37	2	216259272	216259272	+	Missense_Mutation	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:216259272T>C	uc002vfa.2	-	24	4041	c.3775A>G	c.(3775-3777)ATC>GTC	p.I1259V	FN1_uc002vfb.2_Missense_Mutation_p.I1259V|FN1_uc002vfc.2_Missense_Mutation_p.I1259V|FN1_uc002vfd.2_Missense_Mutation_p.I1259V|FN1_uc002vfe.2_Missense_Mutation_p.I1259V|FN1_uc002vff.2_Missense_Mutation_p.I1259V|FN1_uc002vfg.2_Missense_Mutation_p.I1259V|FN1_uc002vfh.2_Missense_Mutation_p.I1259V|FN1_uc002vfi.2_Missense_Mutation_p.I1259V|FN1_uc002vfj.2_Missense_Mutation_p.I1259V|FN1_uc002vez.2_5'Flank|FN1_uc010zjp.1_5'Flank	NM_212482	NP_997647	P02751	FINC_HUMAN	fibronectin 1 isoform 1 preproprotein	1259	Fibronectin type-III 7.				acute-phase response|angiogenesis|leukocyte migration|peptide cross-linking|platelet activation|platelet degranulation|regulation of cell shape|substrate adhesion-dependent cell spreading	ER-Golgi intermediate compartment|fibrinogen complex|platelet alpha granule lumen|proteinaceous extracellular matrix	collagen binding|extracellular matrix structural constituent|heparin binding			central_nervous_system(7)|large_intestine(2)|breast(2)|ovary(1)|pancreas(1)	13		Renal(323;0.127)		Epithelial(149;9.59e-07)|all cancers(144;0.000174)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00948)	Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---	capture		Missense_Mutation	SNP	216259272	216259272	6204	2	T	C	C	49	49	FN1	C	4	4
WDFY1	57590	broad.mit.edu	37	2	224809975	224809975	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:224809975C>T	uc002vnq.2	-	1	78	c.27G>A	c.(25-27)CCG>CCA	p.P9P		NM_020830	NP_065881	Q8IWB7	WDFY1_HUMAN	WD repeat and FYVE domain containing 1	9						cytosol|early endosome|nucleus	1-phosphatidylinositol binding|zinc ion binding			lung(1)	1		all_lung(227;0.00682)|Lung NSC(271;0.00859)|Renal(207;0.0112)|all_hematologic(139;0.189)		Epithelial(121;5.34e-10)|all cancers(144;1.67e-07)|Lung(261;0.00807)|LUSC - Lung squamous cell carcinoma(224;0.00843)														---	---	---	---	capture		Silent	SNP	224809975	224809975	17840	2	C	T	T	27	27	WDFY1	T	1	1
PLK1S1	55857	broad.mit.edu	37	20	21142527	21142527	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:21142527G>C	uc002wsb.2	+	5	554	c.421G>C	c.(421-423)GGG>CGG	p.G141R	PLK1S1_uc010zsh.1_Missense_Mutation_p.G38R|PLK1S1_uc010zsi.1_Missense_Mutation_p.G8R|PLK1S1_uc010zsj.1_RNA|uc002wsc.2_Intron|PLK1S1_uc002wsd.2_RNA	NM_018474	NP_060944	Q2M2Z5	KIZ_HUMAN	polo-like kinase 1 substrate 1 isoform 1	141					spindle organization	centrosome	protein kinase binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	21142527	21142527	12521	20	G	C	C	43	43	PLK1S1	C	3	3
C20orf186	149954	broad.mit.edu	37	20	31672750	31672750	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31672750G>T	uc010zue.1	+	4	745	c.730G>T	c.(730-732)GGC>TGC	p.G244C		NM_182519	NP_872325	P59827	LPLC4_HUMAN	antimicrobial peptide RY2G5 precursor	244						cytoplasm|extracellular region	lipid binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	31672750	31672750	2176	20	G	T	T	39	39	C20orf186	T	1	1
C20orf117	140710	broad.mit.edu	37	20	35444582	35444582	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35444582C>T	uc002xgd.1	-	5	876	c.549G>A	c.(547-549)TCG>TCA	p.S183S	C20orf117_uc002xge.1_RNA	NM_199181	NP_954650	O94964	K0889_HUMAN	hypothetical protein LOC140710 isoform 2	183											0		Myeloproliferative disorder(115;0.00874)																---	---	---	---	capture		Silent	SNP	35444582	35444582	2159	20	C	T	T	27	27	C20orf117	T	1	1
ZNFX1	57169	broad.mit.edu	37	20	47880003	47880003	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47880003C>T	uc002xui.2	-	6	2416	c.2169G>A	c.(2167-2169)AAG>AAA	p.K723K		NM_021035	NP_066363	Q9P2E3	ZNFX1_HUMAN	zinc finger, NFX1-type containing 1	723							metal ion binding			ovary(2)	2			BRCA - Breast invasive adenocarcinoma(12;0.00173)|COAD - Colon adenocarcinoma(4;0.14)|Colorectal(8;0.166)															---	---	---	---	capture		Silent	SNP	47880003	47880003	18809	20	C	T	T	24	24	ZNFX1	T	2	2
BCAS1	8537	broad.mit.edu	37	20	52645146	52645146	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:52645146G>A	uc002xws.2	-	4	846	c.508C>T	c.(508-510)CCC>TCC	p.P170S	BCAS1_uc010zzb.1_Missense_Mutation_p.P73S|BCAS1_uc010gim.2_Missense_Mutation_p.P73S|BCAS1_uc002xwt.2_Missense_Mutation_p.P170S|BCAS1_uc010gil.1_Missense_Mutation_p.P170S|BCAS1_uc010zzc.1_Missense_Mutation_p.P73S	NM_003657	NP_003648	O75363	BCAS1_HUMAN	breast carcinoma amplified sequence 1	170						cytoplasm	protein binding			ovary(2)|central_nervous_system(1)	3	Breast(2;9.53e-15)|Lung NSC(4;5.57e-06)|all_lung(4;1.44e-05)		STAD - Stomach adenocarcinoma(23;0.116)|Colorectal(105;0.198)															---	---	---	---	capture		Missense_Mutation	SNP	52645146	52645146	1371	20	G	A	A	41	41	BCAS1	A	2	2
SYCP2	10388	broad.mit.edu	37	20	58440891	58440891	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:58440891G>A	uc002yaz.2	-	41	4489	c.4350C>T	c.(4348-4350)TTC>TTT	p.F1450F		NM_014258	NP_055073	Q9BX26	SYCP2_HUMAN	synaptonemal complex protein 2	1450					cell division|meiotic prophase I|synaptonemal complex assembly		DNA binding			ovary(3)|lung(2)	5	all_lung(29;0.00344)		BRCA - Breast invasive adenocarcinoma(7;1.19e-09)															---	---	---	---	capture		Silent	SNP	58440891	58440891	15953	20	G	A	A	45	45	SYCP2	A	2	2
PRIC285	85441	broad.mit.edu	37	20	62196906	62196906	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62196906C>T	uc002yfm.2	-	9	4161	c.3269G>A	c.(3268-3270)GGG>GAG	p.G1090E	PRIC285_uc002yfl.1_Missense_Mutation_p.G521E	NM_001037335	NP_001032412	Q9BYK8	PR285_HUMAN	PPAR-alpha interacting complex protein 285	1090					cellular lipid metabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm	ATP binding|DNA binding|helicase activity|ribonuclease activity|RNA binding|transcription coactivator activity|zinc ion binding			central_nervous_system(2)	2	all_cancers(38;2.51e-11)|all_epithelial(29;8.27e-13)		Epithelial(9;1.27e-08)|all cancers(9;7.32e-08)|BRCA - Breast invasive adenocarcinoma(10;5.15e-06)															---	---	---	---	capture		Missense_Mutation	SNP	62196906	62196906	12928	20	C	T	T	22	22	PRIC285	T	2	2
DSCAM	1826	broad.mit.edu	37	21	41725408	41725408	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:41725408G>A	uc002yyq.1	-	5	1370	c.918C>T	c.(916-918)GGC>GGT	p.G306G	DSCAM_uc002yyr.1_RNA	NM_001389	NP_001380	O60469	DSCAM_HUMAN	Down syndrome cell adhesion molecule isoform	306	Extracellular (Potential).				cell adhesion|dendrite self-avoidance|negative regulation of cell adhesion|positive regulation of axon extension involved in axon guidance|positive regulation of phosphorylation	axon|extracellular region|growth cone|integral to plasma membrane|membrane fraction	protein binding			ovary(6)|skin(4)|upper_aerodigestive_tract(1)	11		all_cancers(19;0.186)|Prostate(19;1.15e-05)|all_epithelial(19;0.0103)																---	---	---	---	capture		Silent	SNP	41725408	41725408	4952	21	G	A	A	42	42	DSCAM	A	2	2
SLC25A38	54977	broad.mit.edu	37	3	39433022	39433022	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:39433022G>T	uc003cjo.2	+	4	768	c.367G>T	c.(367-369)GCC>TCC	p.A123S		NM_017875	NP_060345	Q96DW6	S2538_HUMAN	solute carrier family 25, member 38	123	Solcar 2.				erythrocyte differentiation|heme biosynthetic process|transport	integral to membrane|mitochondrial inner membrane					0				KIRC - Kidney renal clear cell carcinoma(284;0.0525)|Kidney(284;0.0661)														---	---	---	---	capture		Missense_Mutation	SNP	39433022	39433022	14999	3	G	T	T	38	38	SLC25A38	T	1	1
MAGI1	9223	broad.mit.edu	37	3	65342127	65342127	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:65342127C>A	uc003dmn.2	-	23	4841	c.4315G>T	c.(4315-4317)GGC>TGC	p.G1439C	MAGI1_uc003dmm.2_3'UTR	NM_001033057	NP_001028229	Q96QZ7	MAGI1_HUMAN	membrane associated guanylate kinase, WW and PDZ	1468					cell adhesion|cell surface receptor linked signaling pathway|protein complex assembly	tight junction	ATP binding|protein C-terminus binding			lung(2)|skin(1)|breast(1)|kidney(1)|pancreas(1)	6		Lung NSC(201;0.0016)		BRCA - Breast invasive adenocarcinoma(55;0.00138)|KIRC - Kidney renal clear cell carcinoma(15;0.0988)|Kidney(15;0.133)														---	---	---	---	capture		Missense_Mutation	SNP	65342127	65342127	9573	3	C	A	A	23	23	MAGI1	A	1	1
MAGI1	9223	broad.mit.edu	37	3	66023816	66023816	+	Silent	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:66023816G>T	uc003dmn.2	-	1	694	c.168C>A	c.(166-168)CCC>CCA	p.P56P	MAGI1_uc003dmm.2_Silent_p.P56P|MAGI1_uc003dmo.2_Silent_p.P56P|MAGI1_uc003dmp.2_Silent_p.P56P|MAGI1_uc003dmr.2_Silent_p.P56P	NM_001033057	NP_001028229	Q96QZ7	MAGI1_HUMAN	membrane associated guanylate kinase, WW and PDZ	56	PDZ 1.				cell adhesion|cell surface receptor linked signaling pathway|protein complex assembly	tight junction	ATP binding|protein C-terminus binding			lung(2)|skin(1)|breast(1)|kidney(1)|pancreas(1)	6		Lung NSC(201;0.0016)		BRCA - Breast invasive adenocarcinoma(55;0.00138)|KIRC - Kidney renal clear cell carcinoma(15;0.0988)|Kidney(15;0.133)														---	---	---	---	capture		Silent	SNP	66023816	66023816	9573	3	G	T	T	39	39	MAGI1	T	1	1
C3orf38	285237	broad.mit.edu	37	3	88205461	88205461	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:88205461G>A	uc003dqw.2	+	4	977	c.666G>A	c.(664-666)CTG>CTA	p.L222L		NM_173824	NP_776185	Q5JPI3	CC038_HUMAN	hypothetical protein LOC285237	222					apoptosis						0		Lung NSC(201;0.17)		UCEC - Uterine corpus endometrioid carcinoma (27;0.194)|LUSC - Lung squamous cell carcinoma(29;0.00353)|Lung(72;0.00661)														---	---	---	---	capture		Silent	SNP	88205461	88205461	2321	3	G	A	A	45	45	C3orf38	A	2	2
MYH15	22989	broad.mit.edu	37	3	108182048	108182048	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108182048G>T	uc003dxa.1	-	17	1891	c.1834C>A	c.(1834-1836)CTC>ATC	p.L612I		NM_014981	NP_055796	Q9Y2K3	MYH15_HUMAN	myosin, heavy polypeptide 15	612	Myosin head-like.					myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity			ovary(5)|central_nervous_system(2)	7																		---	---	---	---	capture		Missense_Mutation	SNP	108182048	108182048	10429	3	G	T	T	35	35	MYH15	T	2	2
SIDT1	54847	broad.mit.edu	37	3	113329993	113329993	+	Splice_Site	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113329993T>C	uc003eak.2	+	18	2508	c.1857_splice	c.e18+2	p.V619_splice	SIDT1_uc011bif.1_Splice_Site|SIDT1_uc003eaj.1_Splice_Site_p.V619_splice|SIDT1_uc011big.1_Splice_Site_p.V372_splice|SIDT1_uc011bih.1_Splice_Site|SIDT1_uc011bii.1_Splice_Site_p.V72_splice	NM_017699	NP_060169			SID1 transmembrane family, member 1 precursor							integral to membrane				ovary(3)|pancreas(1)|skin(1)	5																		---	---	---	---	capture		Splice_Site	SNP	113329993	113329993	14797	3	T	C	C	59	59	SIDT1	C	5	4
PLOD2	5352	broad.mit.edu	37	3	145828223	145828223	+	Missense_Mutation	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:145828223T>C	uc003evs.1	-	4	857	c.351A>G	c.(349-351)ATA>ATG	p.I117M	PLOD2_uc011bnm.1_Missense_Mutation_p.I62M|PLOD2_uc003evr.1_Missense_Mutation_p.I117M	NM_000935	NP_000926	O00469	PLOD2_HUMAN	procollagen-lysine, 2-oxoglutarate 5-dioxygenase	117					protein modification process|response to hypoxia	rough endoplasmic reticulum membrane	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|procollagen-lysine 5-dioxygenase activity|protein binding			ovary(1)|skin(1)	2					Vitamin C(DB00126)													---	---	---	---	capture		Missense_Mutation	SNP	145828223	145828223	12528	3	T	C	C	49	49	PLOD2	C	4	4
FETUB	26998	broad.mit.edu	37	3	186362564	186362564	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186362564C>T	uc010hyq.2	+	5	710	c.449C>T	c.(448-450)ACG>ATG	p.T150M	FETUB_uc011brz.1_Missense_Mutation_p.T2M|FETUB_uc003fqn.2_Missense_Mutation_p.T150M|FETUB_uc003fqo.2_Missense_Mutation_p.T45M|FETUB_uc010hyr.2_Missense_Mutation_p.T113M|FETUB_uc010hys.2_Missense_Mutation_p.T2M|FETUB_uc003fqp.3_Missense_Mutation_p.T85M	NM_014375	NP_055190	Q9UGM5	FETUB_HUMAN	fetuin B precursor	150	Cystatin fetuin-B-type 2.					extracellular space	cysteine-type endopeptidase inhibitor activity			ovary(1)|lung(1)	2	all_cancers(143;6.64e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;5.73e-20)	GBM - Glioblastoma multiforme(93;0.0479)														---	---	---	---	capture		Missense_Mutation	SNP	186362564	186362564	6058	3	C	T	T	19	19	FETUB	T	1	1
OSTN	344901	broad.mit.edu	37	3	190936651	190936651	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:190936651A>G	uc011bsn.1	+	2	218	c.218A>G	c.(217-219)AAT>AGT	p.N73S		NM_198184	NP_937827	P61366	OSTN_HUMAN	osteocrin precursor	73					cell differentiation|multicellular organismal development|ossification		hormone activity			pancreas(1)|skin(1)	2	all_cancers(143;6.79e-09)|Ovarian(172;0.103)		LUSC - Lung squamous cell carcinoma(58;2.42e-06)|Lung(62;2.86e-06)	GBM - Glioblastoma multiforme(46;0.000254)														---	---	---	---	capture		Missense_Mutation	SNP	190936651	190936651	11711	3	A	G	G	4	4	OSTN	G	4	4
RNF168	165918	broad.mit.edu	37	3	196229779	196229779	+	Missense_Mutation	SNP	T	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196229779T>C	uc003fwq.2	-	1	804	c.266A>G	c.(265-267)AAG>AGG	p.K89R	RNF168_uc010iah.2_5'UTR	NM_152617	NP_689830	Q8IYW5	RN168_HUMAN	ring finger protein 168	89					double-strand break repair|histone H2A K63-linked ubiquitination|positive regulation of DNA repair|response to ionizing radiation	nucleus|ubiquitin ligase complex	chromatin binding|histone binding|ubiquitin binding|ubiquitin-protein ligase activity|zinc ion binding				0	all_cancers(143;1e-08)|Ovarian(172;0.0634)|Breast(254;0.206)		Epithelial(36;5.25e-24)|all cancers(36;5.47e-22)|OV - Ovarian serous cystadenocarcinoma(49;1.76e-18)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.00348)														---	---	---	---	capture		Missense_Mutation	SNP	196229779	196229779	13936	3	T	C	C	56	56	RNF168	C	4	4
MFI2	4241	broad.mit.edu	37	3	196754761	196754761	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196754761G>A	uc003fxk.3	-	2	183	c.70C>T	c.(70-72)CGG>TGG	p.R24W	MFI2_uc003fxl.3_Missense_Mutation_p.R24W|MFI2_uc011bua.1_Missense_Mutation_p.R24W	NM_005929	NP_005920	P08582	TRFM_HUMAN	melanoma-associated antigen p97 isoform 1	24	Antigenic epitope.|Transferrin-like 1.				cellular iron ion homeostasis|iron ion transport	anchored to membrane|extracellular region|integral to plasma membrane	ferric iron binding|protein binding				0	all_cancers(143;3.95e-09)|Ovarian(172;0.0634)|Breast(254;0.0838)		Epithelial(36;4.55e-24)|all cancers(36;2.87e-22)|OV - Ovarian serous cystadenocarcinoma(49;1.76e-18)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.00536)														---	---	---	---	capture		Missense_Mutation	SNP	196754761	196754761	9912	3	G	A	A	38	38	MFI2	A	1	1
FYTTD1	84248	broad.mit.edu	37	3	197505234	197505234	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:197505234A>G	uc003fyi.2	+	8	976	c.757A>G	c.(757-759)ACT>GCT	p.T253A	FYTTD1_uc011bui.1_Missense_Mutation_p.T227A|FYTTD1_uc011buj.1_RNA|FYTTD1_uc011buk.1_Missense_Mutation_p.T186A	NM_032288	NP_115664	Q96QD9	UIF_HUMAN	forty-two-three domain containing 1 isoform 1	253					mRNA export from nucleus	nuclear speck	mRNA binding|protein binding				0	all_cancers(143;1.15e-09)|Ovarian(172;0.0418)|Breast(254;0.0976)	Lung NSC(153;0.132)	Epithelial(36;2.19e-23)|all cancers(36;1.39e-21)|OV - Ovarian serous cystadenocarcinoma(49;1.21e-18)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(93;0.175)														---	---	---	---	capture		Missense_Mutation	SNP	197505234	197505234	6378	3	A	G	G	14	14	FYTTD1	G	4	4
KLB	152831	broad.mit.edu	37	4	39436232	39436232	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:39436232C>T	uc003gua.2	+	2	1325	c.1228C>T	c.(1228-1230)CCT>TCT	p.P410S	KLB_uc011byj.1_Missense_Mutation_p.P410S	NM_175737	NP_783864	Q86Z14	KLOTB_HUMAN	klotho beta	410	Extracellular (Potential).|Glycosyl hydrolase-1 1.				carbohydrate metabolic process	integral to membrane|plasma membrane	cation binding|fibroblast growth factor binding|hydrolase activity, hydrolyzing O-glycosyl compounds			skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	39436232	39436232	8644	4	C	T	T	22	22	KLB	T	2	2
EPHA5	2044	broad.mit.edu	37	4	66189898	66189898	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:66189898C>T	uc003hcy.2	-	18	3241	c.3048G>A	c.(3046-3048)CAG>CAA	p.Q1016Q	EPHA5_uc003hcx.2_Silent_p.Q948Q|EPHA5_uc003hcz.2_Silent_p.Q994Q|EPHA5_uc011cah.1_Silent_p.Q1017Q|EPHA5_uc011cai.1_Silent_p.Q995Q	NM_004439	NP_004430	P54756	EPHA5_HUMAN	ephrin receptor EphA5 isoform a precursor	1016	Cytoplasmic (Potential).|SAM.				cAMP-mediated signaling|neuron development	dendrite|external side of plasma membrane|integral to plasma membrane|neuronal cell body|perinuclear region of cytoplasm|rough endoplasmic reticulum	ATP binding|transmembrane-ephrin receptor activity			lung(19)|stomach(2)|ovary(2)|central_nervous_system(1)	24															TSP Lung(17;0.13)			---	---	---	---	capture		Silent	SNP	66189898	66189898	5363	4	C	T	T	32	32	EPHA5	T	2	2
EPHA5	2044	broad.mit.edu	37	4	66231713	66231713	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:66231713C>A	uc003hcy.2	-	11	2180	c.1987G>T	c.(1987-1989)GTC>TTC	p.V663F	EPHA5_uc003hcx.2_Missense_Mutation_p.V595F|EPHA5_uc003hcz.2_Missense_Mutation_p.V641F|EPHA5_uc011cah.1_Missense_Mutation_p.V664F|EPHA5_uc011cai.1_Missense_Mutation_p.V642F|EPHA5_uc003hda.2_Missense_Mutation_p.V664F	NM_004439	NP_004430	P54756	EPHA5_HUMAN	ephrin receptor EphA5 isoform a precursor	663	Cytoplasmic (Potential).				cAMP-mediated signaling|neuron development	dendrite|external side of plasma membrane|integral to plasma membrane|neuronal cell body|perinuclear region of cytoplasm|rough endoplasmic reticulum	ATP binding|transmembrane-ephrin receptor activity			lung(19)|stomach(2)|ovary(2)|central_nervous_system(1)	24															TSP Lung(17;0.13)			---	---	---	---	capture		Missense_Mutation	SNP	66231713	66231713	5363	4	C	A	A	17	17	EPHA5	A	2	2
ANTXR2	118429	broad.mit.edu	37	4	80929677	80929677	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:80929677C>A	uc003hlz.3	-	12	1802	c.1039G>T	c.(1039-1041)GTG>TTG	p.V347L	ANTXR2_uc003hly.3_Missense_Mutation_p.V347L|ANTXR2_uc003hlx.1_RNA|ANTXR2_uc010ijn.2_Missense_Mutation_p.V244L	NM_001145794	NP_001139266	P58335	ANTR2_HUMAN	anthrax toxin receptor 2 isoform 2	347	Cytoplasmic (Potential).					endoplasmic reticulum membrane|extracellular region|integral to membrane|plasma membrane	metal ion binding|protein binding|receptor activity			ovary(1)	1														Juvenile_Hyaline_Fibromatosis				---	---	---	---	capture		Missense_Mutation	SNP	80929677	80929677	720	4	C	A	A	20	20	ANTXR2	A	2	2
PTPN13	5783	broad.mit.edu	37	4	87706382	87706382	+	Splice_Site	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:87706382A>T	uc003hpz.2	+	39	6599	c.6119_splice	c.e39-2	p.E2040_splice	PTPN13_uc003hpy.2_Splice_Site_p.E2045_splice|PTPN13_uc003hqa.2_Splice_Site_p.E2021_splice|PTPN13_uc003hqb.2_Splice_Site_p.E1849_splice|PTPN13_uc003hqc.1_Splice_Site_p.E406_splice	NM_080683	NP_542414			protein tyrosine phosphatase, non-receptor type							cytoplasm|cytoskeleton|plasma membrane	protein binding|protein binding|protein tyrosine phosphatase activity			ovary(4)|breast(1)|kidney(1)	6		Hepatocellular(203;0.114)|all_hematologic(202;0.21)|Acute lymphoblastic leukemia(40;0.242)		OV - Ovarian serous cystadenocarcinoma(123;0.00082)														---	---	---	---	capture		Splice_Site	SNP	87706382	87706382	13237	4	A	T	T	3	3	PTPN13	T	5	4
NDST3	9348	broad.mit.edu	37	4	118975203	118975203	+	Silent	SNP	G	A	A	rs145505386		TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:118975203G>A	uc003ibx.2	+	2	541	c.138G>A	c.(136-138)ACG>ACA	p.T46T	NDST3_uc011cgf.1_Silent_p.T46T|NDST3_uc003ibw.2_Silent_p.T46T	NM_004784	NP_004775	O95803	NDST3_HUMAN	N-deacetylase/N-sulfotransferase (heparan	46	Lumenal (Potential).|Heparan sulfate N-deacetylase 3.					Golgi membrane|integral to membrane	[heparan sulfate]-glucosamine N-sulfotransferase activity|hydrolase activity			large_intestine(1)	1																		---	---	---	---	capture		Silent	SNP	118975203	118975203	10656	4	G	A	A	39	39	NDST3	A	1	1
QRFPR	84109	broad.mit.edu	37	4	122254006	122254006	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:122254006A>G	uc010inj.1	-	4	1146	c.767T>C	c.(766-768)ATT>ACT	p.I256T	QRFPR_uc010ink.1_RNA|QRFPR_uc003ids.2_Intron	NM_198179	NP_937822	Q96P65	QRFPR_HUMAN	G protein-coupled receptor 103	256	Cytoplasmic (Potential).			VILFLLPLMVMLILYSKIGYELWIKKRVGDGSVLRTIHGKE MSKIAR -> SSSSSCLLW (in Ref. 1; AAL26488).		plasma membrane	neuropeptide Y receptor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	122254006	122254006	13336	4	A	G	G	4	4	QRFPR	G	4	4
FAT4	79633	broad.mit.edu	37	4	126411435	126411435	+	Silent	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:126411435G>T	uc003ifj.3	+	17	13458	c.13458G>T	c.(13456-13458)GGG>GGT	p.G4486G	FAT4_uc011cgp.1_Silent_p.G2727G|FAT4_uc003ifi.1_Silent_p.G1963G	NM_024582	NP_078858	Q6V0I7	FAT4_HUMAN	FAT tumor suppressor homolog 4 precursor	4486	Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(9)|skin(5)|upper_aerodigestive_tract(2)|pancreas(2)	18																		---	---	---	---	capture		Silent	SNP	126411435	126411435	5928	4	G	T	T	42	42	FAT4	T	2	2
GUCY1A3	2982	broad.mit.edu	37	4	156651265	156651265	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:156651265G>A	uc003iov.2	+	11	2491	c.1955G>A	c.(1954-1956)GGA>GAA	p.G652E	GUCY1A3_uc003iow.2_Missense_Mutation_p.G652E|GUCY1A3_uc010iqd.2_Missense_Mutation_p.G651E|GUCY1A3_uc003iox.2_Missense_Mutation_p.G652E|GUCY1A3_uc003ioz.2_Missense_Mutation_p.G417E|GUCY1A3_uc003ioy.2_Missense_Mutation_p.G652E|GUCY1A3_uc010iqe.2_Missense_Mutation_p.G417E|GUCY1A3_uc003ipa.2_RNA|GUCY1A3_uc003ipb.2_Missense_Mutation_p.G652E	NM_000856	NP_000847	Q02108	GCYA3_HUMAN	guanylate cyclase 1, soluble, alpha 3 isoform A	652					blood circulation|intracellular signal transduction|nitric oxide mediated signal transduction|platelet activation	guanylate cyclase complex, soluble	GTP binding|guanylate cyclase activity|heme binding|receptor activity			central_nervous_system(2)|ovary(1)|skin(1)	4	all_hematologic(180;0.24)	Renal(120;0.0854)		COAD - Colon adenocarcinoma(41;0.17)														---	---	---	---	capture		Missense_Mutation	SNP	156651265	156651265	7174	4	G	A	A	41	41	GUCY1A3	A	2	2
SLC6A3	6531	broad.mit.edu	37	5	1422092	1422092	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:1422092C>T	uc003jck.2	-	5	812	c.691G>A	c.(691-693)GAC>AAC	p.D231N		NM_001044	NP_001035	Q01959	SC6A3_HUMAN	solute carrier family 6 (neurotransmitter	231	Extracellular (Potential).				cell death|neurotransmitter biosynthetic process	axon|cytoplasm|integral to plasma membrane|neuronal cell body				ovary(3)|breast(2)|pancreas(1)	6			OV - Ovarian serous cystadenocarcinoma(19;0.00928)|all cancers(22;0.0262)		Amphetamine(DB00182)|Benztropine(DB00245)|Bupropion(DB01156)|Chloroprocaine(DB01161)|Cocaine(DB00907)|Dextroamphetamine(DB01576)|Diethylpropion(DB00937)|Duloxetine(DB00476)|Fencamfamine(DB01463)|Mazindol(DB00579)|Methylphenidate(DB00422)|Modafinil(DB00745)|Phenmetrazine(DB00830)|Phentermine(DB00191)|Procaine(DB00721)													---	---	---	---	capture		Missense_Mutation	SNP	1422092	1422092	15182	5	C	T	T	31	31	SLC6A3	T	1	1
TRIO	7204	broad.mit.edu	37	5	14330959	14330959	+	Missense_Mutation	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:14330959C>G	uc003jff.2	+	10	1810	c.1804C>G	c.(1804-1806)CGG>GGG	p.R602G	TRIO_uc003jfg.2_RNA|TRIO_uc011cna.1_Missense_Mutation_p.R553G|TRIO_uc003jfh.1_Missense_Mutation_p.R251G	NM_007118	NP_009049	O75962	TRIO_HUMAN	triple functional domain (PTPRF interacting)	602	Spectrin 2.				apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|transmembrane receptor protein tyrosine phosphatase signaling pathway	cytosol	ATP binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			skin(4)|central_nervous_system(3)|ovary(3)|large_intestine(2)|stomach(2)|breast(2)|upper_aerodigestive_tract(1)|kidney(1)	18	Lung NSC(4;0.000742)																	---	---	---	---	capture		Missense_Mutation	SNP	14330959	14330959	17102	5	C	G	G	31	31	TRIO	G	3	3
PDZD2	23037	broad.mit.edu	37	5	32088280	32088280	+	Missense_Mutation	SNP	G	A	A	rs138759971		TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:32088280G>A	uc003jhl.2	+	20	5114	c.4726G>A	c.(4726-4728)GGC>AGC	p.G1576S	PDZD2_uc003jhm.2_Missense_Mutation_p.G1576S	NM_178140	NP_835260	O15018	PDZD2_HUMAN	PDZ domain containing 2	1576					cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	32088280	32088280	12122	5	G	A	A	39	39	PDZD2	A	1	1
NUP155	9631	broad.mit.edu	37	5	37370948	37370948	+	Silent	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37370948G>T	uc003jku.1	-	1	250	c.132C>A	c.(130-132)TCC>TCA	p.S44S	NUP155_uc003jkt.1_5'Flank|NUP155_uc010iuz.1_Silent_p.S44S	NM_153485	NP_705618	O75694	NU155_HUMAN	nucleoporin 155kDa isoform 1	44					carbohydrate metabolic process|glucose transport|mRNA transport|nucleocytoplasmic transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	nuclear membrane|nuclear pore	protein binding|structural constituent of nuclear pore|transporter activity			ovary(1)	1	all_lung(31;0.000137)		COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---	capture		Silent	SNP	37370948	37370948	11161	5	G	T	T	39	39	NUP155	T	1	1
PLCXD3	345557	broad.mit.edu	37	5	41382419	41382419	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41382419G>T	uc003jmm.1	-	2	423	c.321C>A	c.(319-321)GAC>GAA	p.D107E		NM_001005473	NP_001005473	Q63HM9	PLCX3_HUMAN	phosphatidylinositol-specific phospholipase C, X	107	PI-PLC X-box.				intracellular signal transduction|lipid catabolic process		phospholipase C activity|signal transducer activity			skin(2)|urinary_tract(1)|ovary(1)|lung(1)|central_nervous_system(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	41382419	41382419	12469	5	G	T	T	48	48	PLCXD3	T	2	2
HCN1	348980	broad.mit.edu	37	5	45645701	45645701	+	Nonsense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:45645701C>T	uc003jok.2	-	2	460	c.435G>A	c.(433-435)TGG>TGA	p.W145*		NM_021072	NP_066550	O60741	HCN1_HUMAN	hyperpolarization activated cyclic	145	Cytoplasmic (Potential).					integral to membrane	cAMP binding|sodium channel activity|voltage-gated potassium channel activity			ovary(1)	1																		---	---	---	---	capture		Nonsense_Mutation	SNP	45645701	45645701	7278	5	C	T	T	22	22	HCN1	T	5	2
MAP3K1	4214	broad.mit.edu	37	5	56177955	56177955	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:56177955C>T	uc003jqw.3	+	14	3429	c.2928C>T	c.(2926-2928)TCC>TCT	p.S976S		NM_005921	NP_005912	Q13233	M3K1_HUMAN	mitogen-activated protein kinase kinase kinase	976					cellular response to mechanical stimulus|innate immune response|MyD88-dependent toll-like receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 4 signaling pathway	cytosol	ATP binding|zinc ion binding			ovary(1)|skin(1)	2		Lung NSC(810;4.65e-05)|Prostate(74;0.0132)|Breast(144;0.0321)|Ovarian(174;0.223)		OV - Ovarian serous cystadenocarcinoma(10;6.08e-40)														---	---	---	---	capture		Silent	SNP	56177955	56177955	9626	5	C	T	T	22	22	MAP3K1	T	2	2
MAP1B	4131	broad.mit.edu	37	5	71491801	71491801	+	Silent	SNP	C	A	A	rs144157105		TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:71491801C>A	uc003kbw.3	+	5	2860	c.2619C>A	c.(2617-2619)GTC>GTA	p.V873V	MAP1B_uc010iyw.1_Silent_p.V890V|MAP1B_uc010iyx.1_Silent_p.V747V|MAP1B_uc010iyy.1_Silent_p.V747V	NM_005909	NP_005900	P46821	MAP1B_HUMAN	microtubule-associated protein 1B	873						microtubule|microtubule associated complex	structural molecule activity			large_intestine(2)|ovary(1)|central_nervous_system(1)|pancreas(1)	5		Lung NSC(167;0.00202)|Ovarian(174;0.0175)|Prostate(461;0.142)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;7.99e-54)														---	---	---	---	capture		Silent	SNP	71491801	71491801	9611	5	C	A	A	31	31	MAP1B	A	1	1
FCHO2	115548	broad.mit.edu	37	5	72359685	72359685	+	Missense_Mutation	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:72359685C>G	uc003kcl.2	+	18	1479	c.1363C>G	c.(1363-1365)CTT>GTT	p.L455V	FCHO2_uc011csl.1_Missense_Mutation_p.L422V|FCHO2_uc010izb.2_5'UTR|FCHO2_uc011csn.1_5'UTR	NM_138782	NP_620137	Q0JRZ9	FCHO2_HUMAN	FCH domain only 2 isoform a	455	Ser-rich.									ovary(1)	1		Lung NSC(167;0.0465)|Ovarian(174;0.0908)|Prostate(461;0.165)		OV - Ovarian serous cystadenocarcinoma(47;4.6e-53)														---	---	---	---	capture		Missense_Mutation	SNP	72359685	72359685	6025	5	C	G	G	32	32	FCHO2	G	3	3
ACOT12	134526	broad.mit.edu	37	5	80639988	80639988	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:80639988C>T	uc003khl.3	-	9	1026	c.971G>A	c.(970-972)CGC>CAC	p.R324H	RNU5E_uc011cto.1_Intron	NM_130767	NP_570123	Q8WYK0	ACO12_HUMAN	acyl-CoA thioesterase 12	324					acyl-CoA metabolic process|fatty acid metabolic process	cytosol	acetyl-CoA hydrolase activity|carboxylesterase activity			ovary(1)|kidney(1)	2		Lung NSC(167;0.0176)|all_lung(232;0.0205)|Ovarian(174;0.135)		OV - Ovarian serous cystadenocarcinoma(54;1.37e-45)|Epithelial(54;1.25e-39)|all cancers(79;5.01e-34)														---	---	---	---	capture		Missense_Mutation	SNP	80639988	80639988	151	5	C	T	T	27	27	ACOT12	T	1	1
DUSP22	56940	broad.mit.edu	37	6	311944	311944	+	Missense_Mutation	SNP	T	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:311944T>G	uc003msx.2	+	3	559	c.120T>G	c.(118-120)AGT>AGG	p.S40R	DUSP22_uc011dhn.1_Missense_Mutation_p.S40R|DUSP22_uc003msy.1_5'UTR	NM_020185	NP_064570	Q9NRW4	DUS22_HUMAN	dual specificity phosphatase 22	40					apoptosis|cell proliferation|inactivation of MAPK activity|multicellular organismal development|positive regulation of JNK cascade|regulation of cell proliferation|transforming growth factor beta receptor signaling pathway	cytoplasm|nucleus	protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			ovary(1)|kidney(1)|central_nervous_system(1)	3	all_hematologic(77;0.228)	Breast(5;0.0249)|all_hematologic(90;0.0489)		OV - Ovarian serous cystadenocarcinoma(45;0.0277)|BRCA - Breast invasive adenocarcinoma(62;0.0669)														---	---	---	---	capture		Missense_Mutation	SNP	311944	311944	5006	6	T	G	G	59	59	DUSP22	G	4	4
NEDD9	4739	broad.mit.edu	37	6	11190802	11190802	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:11190802C>A	uc003mzv.2	-	5	1467	c.1300G>T	c.(1300-1302)GAC>TAC	p.D434Y	NEDD9_uc010joz.2_Missense_Mutation_p.D434Y|NEDD9_uc003mzw.3_Missense_Mutation_p.D288Y	NM_006403	NP_006394	Q14511	CASL_HUMAN	neural precursor cell expressed, developmentally	434					actin filament bundle assembly|cell adhesion|cell division|integrin-mediated signaling pathway|mitosis|regulation of growth	cell cortex|focal adhesion|Golgi apparatus|lamellipodium|nucleus	protein binding				0	Breast(50;0.0768)|Ovarian(93;0.152)	all_hematologic(90;0.135)	Epithelial(50;0.0647)|all cancers(50;0.179)															---	---	---	---	capture		Missense_Mutation	SNP	11190802	11190802	10712	6	C	A	A	31	31	NEDD9	A	1	1
ZKSCAN3	80317	broad.mit.edu	37	6	28327373	28327373	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28327373G>C	uc003nle.3	+	2	226	c.10G>C	c.(10-12)GAA>CAA	p.E4Q	ZKSCAN3_uc010jrc.2_Missense_Mutation_p.E4Q|ZKSCAN3_uc003nlf.3_Intron	NM_024493	NP_077819	Q9BRR0	ZKSC3_HUMAN	zinc finger with KRAB and SCAN domains 3	4					positive regulation of transcription, DNA-dependent|viral reproduction	nucleus	chromatin binding|DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	28327373	28327373	18279	6	G	C	C	33	33	ZKSCAN3	C	3	3
NOTCH4	4855	broad.mit.edu	37	6	32163314	32163314	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32163314C>A	uc003obb.2	-	30	6051	c.5912G>T	c.(5911-5913)TGC>TTC	p.C1971F	GPSM3_uc003oax.3_5'Flank|GPSM3_uc003oay.3_5'Flank|GPSM3_uc003oaz.2_5'Flank|NOTCH4_uc011dpt.1_3'UTR|NOTCH4_uc003oba.2_Missense_Mutation_p.C631F|NOTCH4_uc011dpu.1_RNA|NOTCH4_uc011dpv.1_RNA	NM_004557	NP_004548	Q99466	NOTC4_HUMAN	notch4 preproprotein	1971	Cytoplasmic (Potential).				cell fate determination|embryo development|hemopoiesis|mammary gland development|negative regulation of endothelial cell differentiation|Notch receptor processing|Notch signaling pathway|patterning of blood vessels|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cell surface|cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to plasma membrane|nucleoplasm	calcium ion binding|protein heterodimerization activity|receptor activity			lung(8)|ovary(5)|breast(4)|central_nervous_system(3)|upper_aerodigestive_tract(1)|skin(1)	22																		---	---	---	---	capture		Missense_Mutation	SNP	32163314	32163314	10954	6	C	A	A	25	25	NOTCH4	A	2	2
CUL9	23113	broad.mit.edu	37	6	43172777	43172777	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43172777G>C	uc003ouk.2	+	23	4631	c.4556G>C	c.(4555-4557)CGG>CCG	p.R1519P	CUL9_uc003oul.2_Missense_Mutation_p.R1519P|CUL9_uc010jyk.2_Missense_Mutation_p.R671P	NM_015089	NP_055904	Q8IWT3	CUL9_HUMAN	p53-associated parkin-like cytoplasmic protein	1519					ubiquitin-dependent protein catabolic process	cullin-RING ubiquitin ligase complex|cytoplasm	ATP binding|ubiquitin protein ligase binding|zinc ion binding			ovary(5)|lung(3)|skin(2)|breast(1)|central_nervous_system(1)	12																		---	---	---	---	capture		Missense_Mutation	SNP	43172777	43172777	4221	6	G	C	C	39	39	CUL9	C	3	3
SLC22A7	10864	broad.mit.edu	37	6	43266473	43266473	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43266473C>A	uc003out.2	+	1	476	c.377C>A	c.(376-378)TCT>TAT	p.S126Y	SLC22A7_uc010jyl.1_Missense_Mutation_p.S126Y|SLC22A7_uc003ous.2_Missense_Mutation_p.S126Y	NM_153320	NP_696961	Q9Y694	S22A7_HUMAN	solute carrier family 22 member 7 isoform b	126						basolateral plasma membrane|integral to plasma membrane|membrane fraction	anion:anion antiporter activity|sodium-independent organic anion transmembrane transporter activity				0			Colorectal(64;0.00245)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.00998)|OV - Ovarian serous cystadenocarcinoma(102;0.0305)															---	---	---	---	capture		Missense_Mutation	SNP	43266473	43266473	14956	6	C	A	A	32	32	SLC22A7	A	2	2
C6orf223	221416	broad.mit.edu	37	6	43970796	43970796	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43970796G>T	uc003own.2	+	4	680	c.662G>T	c.(661-663)CGC>CTC	p.R221L	uc003owm.1_Intron|C6orf223_uc003owo.2_Missense_Mutation_p.R201L	NM_153246	NP_694978	Q8N319	CF223_HUMAN	hypothetical protein LOC221416	221											0	all_cancers(18;2.28e-07)|all_epithelial(2;1.62e-08)|Lung NSC(15;0.000172)|all_lung(25;0.000533)|Hepatocellular(11;0.00309)|Ovarian(13;0.0437)		all cancers(41;0.00141)|Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)|STAD - Stomach adenocarcinoma(11;0.217)															---	---	---	---	capture		Missense_Mutation	SNP	43970796	43970796	2462	6	G	T	T	38	38	C6orf223	T	1	1
RUNX2	860	broad.mit.edu	37	6	45514801	45514801	+	Missense_Mutation	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:45514801C>G	uc011dvx.1	+	9	1535	c.1325C>G	c.(1324-1326)ACT>AGT	p.T442S	RUNX2_uc011dvy.1_Missense_Mutation_p.T420S|RUNX2_uc003oxt.2_Missense_Mutation_p.T428S	NM_001024630	NP_001019801	Q13950	RUNX2_HUMAN	runt-related transcription factor 2 isoform a	442	Pro/Ser/Thr-rich.|Interaction with MYST4.				negative regulation of transcription, DNA-dependent|osteoblast differentiation|positive regulation of transcription, DNA-dependent	nucleus	ATP binding|DNA binding|protein binding|sequence-specific DNA binding transcription factor activity			ovary(2)|skin(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	45514801	45514801	14228	6	C	G	G	20	20	RUNX2	G	3	3
EYS	346007	broad.mit.edu	37	6	66063410	66063410	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:66063410C>A	uc011dxu.1	-	9	1938	c.1400G>T	c.(1399-1401)GGT>GTT	p.G467V	EYS_uc003peq.2_Missense_Mutation_p.G467V|EYS_uc003per.1_Missense_Mutation_p.G467V	NM_001142800	NP_001136272	Q5T1H1	EYS_HUMAN	eyes shut homolog isoform 1	467					response to stimulus|visual perception	extracellular region	calcium ion binding			lung(4)|ovary(1)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	66063410	66063410	5526	6	C	A	A	18	18	EYS	A	2	2
COL19A1	1310	broad.mit.edu	37	6	70637829	70637829	+	Nonsense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70637829G>T	uc003pfc.1	+	5	412	c.295G>T	c.(295-297)GAG>TAG	p.E99*	COL19A1_uc010kam.1_5'UTR	NM_001858	NP_001849	Q14993	COJA1_HUMAN	alpha 1 type XIX collagen precursor	99	TSP N-terminal.				cell differentiation|cell-cell adhesion|extracellular matrix organization|skeletal system development	collagen	extracellular matrix structural constituent|protein binding, bridging			ovary(2)|breast(2)	4																		---	---	---	---	capture		Nonsense_Mutation	SNP	70637829	70637829	3814	6	G	T	T	41	41	COL19A1	T	5	2
COL12A1	1303	broad.mit.edu	37	6	75893694	75893694	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:75893694C>T	uc003phs.2	-	9	1330	c.1164G>A	c.(1162-1164)ACG>ACA	p.T388T	COL12A1_uc003pht.2_Intron|COL12A1_uc003phu.1_Silent_p.T46T	NM_004370	NP_004361	Q99715	COCA1_HUMAN	collagen, type XII, alpha 1 long isoform	388	Fibronectin type-III 2.				cell adhesion|collagen fibril organization|skeletal system development	collagen type XII|extracellular space	extracellular matrix structural constituent conferring tensile strength			ovary(6)|large_intestine(1)|breast(1)|skin(1)	9																		---	---	---	---	capture		Silent	SNP	75893694	75893694	3807	6	C	T	T	27	27	COL12A1	T	1	1
NT5E	4907	broad.mit.edu	37	6	86159901	86159901	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:86159901C>A	uc003pko.3	+	1	600	c.44C>A	c.(43-45)GCC>GAC	p.A15D	NT5E_uc003pkn.2_Missense_Mutation_p.A15D|NT5E_uc010kbr.2_Missense_Mutation_p.A15D	NM_002526	NP_002517	P21589	5NTD_HUMAN	5' nucleotidase, ecto precursor	15					DNA metabolic process|purine base metabolic process|pyrimidine base metabolic process|pyrimidine nucleoside catabolic process	anchored to membrane|cytoplasm|membrane fraction|plasma membrane	5'-nucleotidase activity|nucleotide binding			ovary(3)|central_nervous_system(1)	4		all_cancers(76;0.000215)|Acute lymphoblastic leukemia(125;3.66e-08)|all_hematologic(105;8.61e-05)|all_epithelial(107;0.0427)		BRCA - Breast invasive adenocarcinoma(108;0.0417)	Pentoxifylline(DB00806)													---	---	---	---	capture		Missense_Mutation	SNP	86159901	86159901	11098	6	C	A	A	26	26	NT5E	A	2	2
PRDM13	59336	broad.mit.edu	37	6	100062541	100062541	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:100062541G>T	uc003pqg.1	+	4	2291	c.2030G>T	c.(2029-2031)GGG>GTG	p.G677V		NM_021620	NP_067633	Q9H4Q3	PRD13_HUMAN	PR domain containing 13	677					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(76;1.64e-05)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0128)|Colorectal(196;0.069)|Lung NSC(302;0.186)		BRCA - Breast invasive adenocarcinoma(108;0.0598)														---	---	---	---	capture		Missense_Mutation	SNP	100062541	100062541	12896	6	G	T	T	43	43	PRDM13	T	2	2
PRDM13	59336	broad.mit.edu	37	6	100062564	100062564	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:100062564G>T	uc003pqg.1	+	4	2314	c.2053G>T	c.(2053-2055)GAC>TAC	p.D685Y		NM_021620	NP_067633	Q9H4Q3	PRD13_HUMAN	PR domain containing 13	685					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(76;1.64e-05)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0128)|Colorectal(196;0.069)|Lung NSC(302;0.186)		BRCA - Breast invasive adenocarcinoma(108;0.0598)														---	---	---	---	capture		Missense_Mutation	SNP	100062564	100062564	12896	6	G	T	T	45	45	PRDM13	T	2	2
HS3ST5	222537	broad.mit.edu	37	6	114379015	114379015	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:114379015C>T	uc003pwg.3	-	2	479	c.447G>A	c.(445-447)CAG>CAA	p.Q149Q	uc003pwf.2_Intron|HS3ST5_uc003pwh.3_Silent_p.Q149Q	NM_153612	NP_705840	Q8IZT8	HS3S5_HUMAN	heparan sulfate (glucosamine)	149	Lumenal (Potential).				heparan sulfate proteoglycan biosynthetic process, enzymatic modification|negative regulation of coagulation|protein sulfation|regulation of virion penetration into host cell	Golgi membrane|integral to membrane	3'-phosphoadenosine 5'-phosphosulfate binding|[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity|protein binding			ovary(1)|pancreas(1)	2		all_cancers(87;0.0587)|Colorectal(196;0.0676)|all_epithelial(87;0.154)		OV - Ovarian serous cystadenocarcinoma(136;0.00937)|all cancers(137;0.0117)|Epithelial(106;0.0274)|GBM - Glioblastoma multiforme(226;0.143)														---	---	---	---	capture		Silent	SNP	114379015	114379015	7662	6	C	T	T	28	28	HS3ST5	T	2	2
PARK2	5071	broad.mit.edu	37	6	161969933	161969933	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:161969933C>T	uc003qtx.3	-	9	1170	c.1036G>A	c.(1036-1038)GAC>AAC	p.D346N	PARK2_uc003qtv.3_Intron|PARK2_uc010kkd.2_Missense_Mutation_p.D155N|PARK2_uc003qtw.3_Missense_Mutation_p.D155N|PARK2_uc003qty.3_Missense_Mutation_p.D318N|PARK2_uc003qtz.3_Missense_Mutation_p.D197N|PARK2_uc010kke.1_Missense_Mutation_p.D365N|PARK2_uc011egf.1_Missense_Mutation_p.D20N	NM_004562	NP_004553	O60260	PRKN2_HUMAN	parkin isoform 1	346	IBR-type.				aggresome assembly|central nervous system development|mitochondrion degradation|negative regulation of actin filament bundle assembly|negative regulation of cell death|negative regulation of protein phosphorylation|negative regulation of release of cytochrome c from mitochondria|neuron death|positive regulation of I-kappaB kinase/NF-kappaB cascade|protein autoubiquitination|protein K48-linked ubiquitination|protein K63-linked ubiquitination|protein monoubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|regulation of autophagy|regulation of reactive oxygen species metabolic process	aggresome|cytosol|endoplasmic reticulum|Golgi apparatus|mitochondrion|nucleus|perinuclear region of cytoplasm	chaperone binding|PDZ domain binding|protein kinase binding|ubiquitin protein ligase binding|ubiquitin-protein ligase activity|zinc ion binding			upper_aerodigestive_tract(1)	1		all_cancers(1;8.13e-65)|all_epithelial(1;5.77e-64)|Colorectal(1;9.65e-15)|all_lung(1;1.66e-13)|Lung NSC(1;7.54e-11)|Melanoma(1;1.75e-09)|Breast(66;7.81e-05)|Ovarian(120;0.000981)|Prostate(117;0.0288)|Esophageal squamous(34;0.102)		UCEC - Uterine corpus endometrioid carcinoma (4;0.0663)|all cancers(1;1.9e-63)|Epithelial(1;1.5e-59)|Colorectal(1;2.16e-23)|OV - Ovarian serous cystadenocarcinoma(65;3.53e-20)|COAD - Colon adenocarcinoma(1;2.11e-15)|STAD - Stomach adenocarcinoma(1;4.64e-07)|BRCA - Breast invasive adenocarcinoma(81;1.49e-06)|READ - Rectum adenocarcinoma(1;2.95e-06)|GBM - Glioblastoma multiforme(2;7.23e-06)|Lung(1;0.00163)|KIRC - Kidney renal clear cell carcinoma(4;0.00371)|LUSC - Lung squamous cell carcinoma(1;0.00442)|Kidney(4;0.0046)														---	---	---	---	capture		Missense_Mutation	SNP	161969933	161969933	11866	6	C	T	T	29	29	PARK2	T	2	2
DLL1	28514	broad.mit.edu	37	6	170592599	170592599	+	Missense_Mutation	SNP	T	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170592599T>A	uc003qxm.2	-	9	2238	c.1768A>T	c.(1768-1770)ATG>TTG	p.M590L		NM_005618	NP_005609	O00548	DLL1_HUMAN	delta-like 1 precursor	590	Cytoplasmic (Potential).				cell communication|cell fate determination|hemopoiesis|Notch receptor processing|Notch signaling pathway|regulation of cell adhesion	extracellular region|integral to plasma membrane	calcium ion binding|Notch binding			lung(4)|ovary(1)	5		Breast(66;5.08e-05)|Ovarian(120;0.125)|Esophageal squamous(34;0.246)		OV - Ovarian serous cystadenocarcinoma(33;6.71e-23)|BRCA - Breast invasive adenocarcinoma(81;4.81e-06)|GBM - Glioblastoma multiforme(31;0.0584)														---	---	---	---	capture		Missense_Mutation	SNP	170592599	170592599	4746	6	T	A	A	51	51	DLL1	A	4	4
INTS1	26173	broad.mit.edu	37	7	1542595	1542595	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:1542595C>T	uc003skn.2	-	3	392	c.291G>A	c.(289-291)GTG>GTA	p.V97V	INTS1_uc003skq.2_Silent_p.V97V	NM_001080453	NP_001073922	Q8N201	INT1_HUMAN	integrator complex subunit 1	97					snRNA processing	integral to membrane|integrator complex|nuclear membrane					0		Ovarian(82;0.0253)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0181)|OV - Ovarian serous cystadenocarcinoma(56;6.99e-15)														---	---	---	---	capture		Silent	SNP	1542595	1542595	8076	7	C	T	T	21	21	INTS1	T	2	2
FBXL18	80028	broad.mit.edu	37	7	5540481	5540481	+	Silent	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:5540481G>A	uc003soo.2	-	3	1513	c.1419C>T	c.(1417-1419)TCC>TCT	p.S473S	FBXL18_uc003son.3_Silent_p.S473S	NM_024963	NP_079239	Q96ME1	FXL18_HUMAN	F-box and leucine-rich repeat protein 18	473	LRR 8.									central_nervous_system(2)|ovary(1)	3		Ovarian(82;0.0607)		UCEC - Uterine corpus endometrioid carcinoma (126;0.181)|OV - Ovarian serous cystadenocarcinoma(56;3.64e-13)														---	---	---	---	capture		Silent	SNP	5540481	5540481	5951	7	G	A	A	39	39	FBXL18	A	1	1
OSBPL3	26031	broad.mit.edu	37	7	24888721	24888721	+	Silent	SNP	G	T	T	rs150573309	byFrequency	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:24888721G>T	uc003sxf.2	-	12	1638	c.1233C>A	c.(1231-1233)CCC>CCA	p.P411P	OSBPL3_uc003sxd.2_RNA|OSBPL3_uc003sxe.2_RNA|OSBPL3_uc003sxg.2_Intron|OSBPL3_uc003sxh.2_Silent_p.P380P|OSBPL3_uc003sxi.2_Intron|OSBPL3_uc003sxj.1_Intron|OSBPL3_uc003sxk.1_Intron	NM_015550	NP_056365	Q9H4L5	OSBL3_HUMAN	oxysterol-binding protein-like protein 3 isoform	411					lipid transport		lipid binding|protein binding			skin(1)	1																		---	---	---	---	capture		Silent	SNP	24888721	24888721	11690	7	G	T	T	39	39	OSBPL3	T	1	1
RP9	6100	broad.mit.edu	37	7	33139017	33139017	+	Missense_Mutation	SNP	G	C	C			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:33139017G>C	uc003tdm.2	-	3	233	c.215C>G	c.(214-216)CCA>CGA	p.P72R		NM_203288	NP_976033	Q8TA86	RP9_HUMAN	retinitis pigmentosa 9	72	PIM1-binding (By similarity).				RNA splicing	nucleus	nucleic acid binding|protein binding|zinc ion binding				0			GBM - Glioblastoma multiforme(11;0.0403)															---	---	---	---	capture		Missense_Mutation	SNP	33139017	33139017	14014	7	G	C	C	47	47	RP9	C	3	3
C7orf36	57002	broad.mit.edu	37	7	39612040	39612040	+	Missense_Mutation	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:39612040A>T	uc003thc.3	+	3	425	c.416A>T	c.(415-417)GAT>GTT	p.D139V		NM_020192	NP_064577	Q9NRH1	CG036_HUMAN	hypothetical protein LOC57002	139											0																		---	---	---	---	capture		Missense_Mutation	SNP	39612040	39612040	2497	7	A	T	T	12	12	C7orf36	T	4	4
PKD1L1	168507	broad.mit.edu	37	7	47886477	47886477	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:47886477C>A	uc003tny.1	-	32	5153	c.5153G>T	c.(5152-5154)AGC>ATC	p.S1718I		NM_138295	NP_612152	Q8TDX9	PK1L1_HUMAN	polycystin-1L1	1718	Extracellular (Potential).|GPS.				cell-cell adhesion	integral to membrane				ovary(8)|upper_aerodigestive_tract(2)|breast(1)	11																		---	---	---	---	capture		Missense_Mutation	SNP	47886477	47886477	12388	7	C	A	A	24	24	PKD1L1	A	2	2
KRIT1	889	broad.mit.edu	37	7	91851289	91851289	+	Missense_Mutation	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:91851289A>T	uc003ulq.1	-	12	1661	c.1490T>A	c.(1489-1491)CTG>CAG	p.L497Q	KRIT1_uc010lev.1_Missense_Mutation_p.L254Q|KRIT1_uc003ulr.1_Missense_Mutation_p.L497Q|KRIT1_uc003uls.1_Missense_Mutation_p.L497Q|KRIT1_uc003ult.1_Missense_Mutation_p.L449Q|KRIT1_uc003ulu.1_Missense_Mutation_p.L497Q|KRIT1_uc003ulv.1_Missense_Mutation_p.L497Q	NM_194456	NP_919438	O00522	KRIT1_HUMAN	krev interaction trapped 1 isoform 1	497	Required for RAP1A binding.|FERM.				angiogenesis|cell redox homeostasis|negative regulation of angiogenesis|negative regulation of endothelial cell apoptosis|negative regulation of endothelial cell migration|negative regulation of endothelial cell proliferation|regulation of establishment of cell polarity|small GTPase mediated signal transduction	cell-cell junction|cytoskeleton	protein binding|small GTPase regulator activity			ovary(2)|lung(1)	3	all_cancers(62;1.04e-09)|all_epithelial(64;5.75e-09)|Breast(17;0.00206)|all_lung(186;0.0509)|Lung NSC(181;0.0692)		STAD - Stomach adenocarcinoma(171;6.16e-05)|Lung(22;0.123)|LUSC - Lung squamous cell carcinoma(200;0.225)											Familial_Cerebral_Cavernous_Angioma				---	---	---	---	capture		Missense_Mutation	SNP	91851289	91851289	8760	7	A	T	T	7	7	KRIT1	T	4	4
LMTK2	22853	broad.mit.edu	37	7	97800938	97800938	+	Missense_Mutation	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:97800938A>T	uc003upd.1	+	7	1036	c.743A>T	c.(742-744)GAG>GTG	p.E248V		NM_014916	NP_055731	Q8IWU2	LMTK2_HUMAN	lemur tyrosine kinase 2 precursor	248	Protein kinase.				early endosome to late endosome transport|endocytic recycling|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|protein autophosphorylation|receptor recycling|transferrin transport	early endosome|Golgi apparatus|integral to membrane|perinuclear region of cytoplasm|recycling endosome	ATP binding|myosin VI binding|protein phosphatase inhibitor activity|protein serine/threonine kinase activity|protein tyrosine kinase activity			lung(9)|stomach(3)|pancreas(2)|large_intestine(1)|breast(1)	16	all_cancers(62;3.23e-09)|all_epithelial(64;7.65e-10)|Lung NSC(181;0.00902)|all_lung(186;0.0104)|Esophageal squamous(72;0.0125)																	---	---	---	---	capture		Missense_Mutation	SNP	97800938	97800938	9188	7	A	T	T	11	11	LMTK2	T	4	4
TBXAS1	6916	broad.mit.edu	37	7	139661962	139661962	+	Missense_Mutation	SNP	A	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:139661962A>G	uc011kqv.1	+	10	1369	c.1205A>G	c.(1204-1206)TAC>TGC	p.Y402C	TBXAS1_uc003vvh.2_Missense_Mutation_p.Y356C|TBXAS1_uc010lne.2_Missense_Mutation_p.Y288C|TBXAS1_uc011kqu.1_Missense_Mutation_p.Y307C|TBXAS1_uc003vvi.2_Missense_Mutation_p.Y356C|TBXAS1_uc003vvj.2_Missense_Mutation_p.Y356C|TBXAS1_uc011kqw.1_Missense_Mutation_p.Y336C	NM_001130966	NP_001124438	P24557	THAS_HUMAN	thromboxane A synthase 1, platelet isoform	355	Helical; (Potential).				hormone biosynthetic process|prostaglandin biosynthetic process|xenobiotic metabolic process	endoplasmic reticulum lumen|endoplasmic reticulum membrane|integral to membrane	electron carrier activity|heme binding|monooxygenase activity|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen|thromboxane-A synthase activity			ovary(2)|breast(1)	3	Melanoma(164;0.0142)																	---	---	---	---	capture		Missense_Mutation	SNP	139661962	139661962	16190	7	A	G	G	14	14	TBXAS1	G	4	4
PTPRN2	5799	broad.mit.edu	37	7	157985171	157985171	+	Missense_Mutation	SNP	C	T	T	rs140977880	byFrequency;by1000genomes	TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:157985171C>T	uc003wno.2	-	5	518	c.397G>A	c.(397-399)GTT>ATT	p.V133I	PTPRN2_uc003wnp.2_Missense_Mutation_p.V116I|PTPRN2_uc003wnq.2_Missense_Mutation_p.V133I|PTPRN2_uc003wnr.2_Missense_Mutation_p.V95I|PTPRN2_uc011kwa.1_Missense_Mutation_p.V156I	NM_002847	NP_002838	Q92932	PTPR2_HUMAN	protein tyrosine phosphatase, receptor type, N	133	Extracellular (Potential).					integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(4)|large_intestine(1)|pleura(1)|skin(1)	7	all_neural(206;0.181)	all_cancers(7;8.99e-13)|all_epithelial(9;2.4e-06)|all_hematologic(28;0.0155)|Breast(660;0.132)	OV - Ovarian serous cystadenocarcinoma(82;0.00463)	STAD - Stomach adenocarcinoma(7;0.0875)														---	---	---	---	capture		Missense_Mutation	SNP	157985171	157985171	13265	7	C	T	T	19	19	PTPRN2	T	1	1
MYOM2	9172	broad.mit.edu	37	8	2033485	2033485	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:2033485C>T	uc003wpx.3	+	14	1745	c.1607C>T	c.(1606-1608)CCC>CTC	p.P536L	MYOM2_uc011kwi.1_Intron	NM_003970	NP_003961	P54296	MYOM2_HUMAN	myomesin 2	536	Fibronectin type-III 2.				muscle contraction	myosin filament	structural constituent of muscle			ovary(4)|central_nervous_system(1)|skin(1)	6		Ovarian(12;0.0572)|Colorectal(14;0.0844)|Hepatocellular(245;0.217)		BRCA - Breast invasive adenocarcinoma(11;1.85e-05)|Colorectal(4;0.0101)|READ - Rectum adenocarcinoma(4;0.148)|COAD - Colon adenocarcinoma(4;0.179)														---	---	---	---	capture		Missense_Mutation	SNP	2033485	2033485	10487	8	C	T	T	22	22	MYOM2	T	2	2
MMP16	4325	broad.mit.edu	37	8	89180014	89180014	+	Missense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:89180014G>T	uc003yeb.3	-	4	875	c.593C>A	c.(592-594)CCC>CAC	p.P198H	MMP16_uc003yec.2_Missense_Mutation_p.P198H	NM_005941	NP_005932	P51512	MMP16_HUMAN	matrix metalloproteinase 16 isoform 1	198	Extracellular (Potential).				collagen catabolic process|proteolysis	cell surface|integral to plasma membrane|proteinaceous extracellular matrix	calcium ion binding|enzyme activator activity|metalloendopeptidase activity|zinc ion binding			upper_aerodigestive_tract(2)|ovary(2)|central_nervous_system(1)|urinary_tract(1)|skin(1)|kidney(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	89180014	89180014	10045	8	G	T	T	43	43	MMP16	T	2	2
RIMS2	9699	broad.mit.edu	37	8	105263842	105263842	+	Nonsense_Mutation	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:105263842G>T	uc003yls.2	+	28	4139	c.3898G>T	c.(3898-3900)GGA>TGA	p.G1300*	RIMS2_uc003ylp.2_Nonsense_Mutation_p.G1282*|RIMS2_uc003ylq.2_Nonsense_Mutation_p.G1096*|RIMS2_uc003ylr.2_Nonsense_Mutation_p.G1121*	NM_014677	NP_055492	Q9UQ26	RIMS2_HUMAN	regulating synaptic membrane exocytosis 2	1344	C2 2.				intracellular protein transport	cell junction|presynaptic membrane	metal ion binding|Rab GTPase binding			ovary(6)|lung(2)|breast(2)|skin(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	15			OV - Ovarian serous cystadenocarcinoma(57;7.7e-07)|STAD - Stomach adenocarcinoma(118;0.229)												HNSCC(12;0.0054)			---	---	---	---	capture		Nonsense_Mutation	SNP	105263842	105263842	13845	8	G	T	T	43	43	RIMS2	T	5	2
LRP12	29967	broad.mit.edu	37	8	105503379	105503379	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:105503379C>A	uc003yma.2	-	7	2197	c.2102G>T	c.(2101-2103)CGA>CTA	p.R701L	LRP12_uc003ymb.2_Missense_Mutation_p.R682L|LRP12_uc003ylz.2_Missense_Mutation_p.R107L	NM_013437	NP_038465	Q9Y561	LRP12_HUMAN	low density lipoprotein-related protein 12	701	Cytoplasmic (Potential).				endocytosis|regulation of growth	coated pit|integral to plasma membrane	low-density lipoprotein receptor activity|protein binding				0			OV - Ovarian serous cystadenocarcinoma(57;1.21e-06)|STAD - Stomach adenocarcinoma(118;0.229)															---	---	---	---	capture		Missense_Mutation	SNP	105503379	105503379	9327	8	C	A	A	31	31	LRP12	A	1	1
OXR1	55074	broad.mit.edu	37	8	107718644	107718644	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:107718644C>T	uc011lht.1	+	8	997	c.898C>T	c.(898-900)CAT>TAT	p.H300Y	OXR1_uc003ymf.2_Missense_Mutation_p.H299Y|OXR1_uc011lhu.1_Missense_Mutation_p.H292Y|OXR1_uc010mcg.2_Intron|OXR1_uc010mch.2_5'UTR|OXR1_uc003ymg.1_Missense_Mutation_p.H232Y|OXR1_uc003ymi.1_Missense_Mutation_p.H211Y	NM_018002	NP_060472	Q8N573	OXR1_HUMAN	oxidation resistance 1 isoform 1	300					cell wall macromolecule catabolic process|response to oxidative stress	mitochondrion					0			OV - Ovarian serous cystadenocarcinoma(57;1.81e-09)															---	---	---	---	capture		Missense_Mutation	SNP	107718644	107718644	11747	8	C	T	T	21	21	OXR1	T	2	2
CSMD3	114788	broad.mit.edu	37	8	113364684	113364684	+	Missense_Mutation	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113364684A>T	uc003ynu.2	-	39	6375	c.6216T>A	c.(6214-6216)GAT>GAA	p.D2072E	CSMD3_uc003yns.2_Missense_Mutation_p.D1274E|CSMD3_uc003ynt.2_Missense_Mutation_p.D2032E|CSMD3_uc011lhx.1_Missense_Mutation_p.D1968E	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	2072	Extracellular (Potential).|Sushi 11.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---	capture		Missense_Mutation	SNP	113364684	113364684	4087	8	A	T	T	8	8	CSMD3	T	4	4
CSMD3	114788	broad.mit.edu	37	8	113364700	113364700	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113364700C>T	uc003ynu.2	-	39	6359	c.6200G>A	c.(6199-6201)AGA>AAA	p.R2067K	CSMD3_uc003yns.2_Missense_Mutation_p.R1269K|CSMD3_uc003ynt.2_Missense_Mutation_p.R2027K|CSMD3_uc011lhx.1_Missense_Mutation_p.R1963K	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	2067	Extracellular (Potential).|Sushi 11.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---	capture		Missense_Mutation	SNP	113364700	113364700	4087	8	C	T	T	32	32	CSMD3	T	2	2
EFR3A	23167	broad.mit.edu	37	8	132996394	132996394	+	Missense_Mutation	SNP	A	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:132996394A>T	uc003yte.2	+	15	1785	c.1584A>T	c.(1582-1584)CAA>CAT	p.Q528H		NM_015137	NP_055952	Q14156	EFR3A_HUMAN	EFR3 homolog A	528						plasma membrane	binding			ovary(3)|breast(1)|central_nervous_system(1)	5	Esophageal squamous(12;0.00693)|Ovarian(258;0.00769)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.000805)|LUAD - Lung adenocarcinoma(14;0.102)															---	---	---	---	capture		Missense_Mutation	SNP	132996394	132996394	5146	8	A	T	T	2	2	EFR3A	T	4	4
CDKN2A	1029	broad.mit.edu	37	9	21971017	21971017	+	Missense_Mutation	SNP	G	A	A	rs121913386		TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:21971017G>A	uc003zpk.2	-	2	553	c.341C>T	c.(340-342)CCC>CTC	p.P114L	MTAP_uc003zpi.1_Intron|CDKN2A_uc003zpj.2_3'UTR|CDKN2A_uc010miu.2_RNA|CDKN2A_uc003zpl.2_Silent_p.A169A	NM_000077	NP_000068	P42771	CD2A1_HUMAN	cyclin-dependent kinase inhibitor 2A isoform 1	114	ANK 4.		P -> L (in non-small cell lung carcinoma).|P -> S (found in some patients with melanoma; loss of CDK4 binding).		cell cycle arrest|cell cycle checkpoint|G1 phase of mitotic cell cycle|G1/S transition of mitotic cell cycle|induction of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of cell-matrix adhesion|negative regulation of cyclin-dependent protein kinase activity|negative regulation of NF-kappaB transcription factor activity|positive regulation of macrophage apoptosis|positive regulation of smooth muscle cell apoptosis|Ras protein signal transduction|replicative senescence	cytosol|nucleus	cyclin-dependent protein kinase inhibitor activity|NF-kappaB binding|protein binding|protein binding|protein kinase binding	p.0?(1112)|p.P114L(21)|p.?(13)|p.P114H(3)|p.H83fs*2(2)|p.P114S(2)|p.A68fs*3(1)|p.P114P(1)|p.V115fs*11(1)		haematopoietic_and_lymphoid_tissue(647)|skin(419)|upper_aerodigestive_tract(414)|central_nervous_system(381)|lung(325)|pancreas(244)|oesophagus(230)|urinary_tract(225)|pleura(94)|liver(91)|soft_tissue(79)|bone(77)|ovary(76)|biliary_tract(71)|stomach(46)|breast(46)|kidney(39)|NS(28)|thyroid(24)|cervix(23)|meninges(18)|genital_tract(15)|endometrium(13)|prostate(11)|autonomic_ganglia(10)|salivary_gland(10)|large_intestine(9)|adrenal_gland(6)|eye(4)|vulva(2)|small_intestine(1)	3678		all_cancers(5;0)|Acute lymphoblastic leukemia(3;0)|all_hematologic(3;0)|all_epithelial(2;2.37e-290)|Lung NSC(2;1.26e-139)|all_lung(2;4.48e-131)|Glioma(2;3.26e-60)|all_neural(2;2.1e-52)|Renal(3;1.07e-46)|Esophageal squamous(3;3.83e-46)|Melanoma(2;2.74e-34)|Breast(3;1.14e-11)|Ovarian(3;0.000128)|Hepatocellular(5;0.00162)|Colorectal(97;0.172)		all cancers(2;0)|GBM - Glioblastoma multiforme(3;0)|Lung(2;4.07e-74)|Epithelial(2;1.08e-61)|LUSC - Lung squamous cell carcinoma(2;3.82e-48)|LUAD - Lung adenocarcinoma(2;4.56e-26)|OV - Ovarian serous cystadenocarcinoma(39;7.64e-10)|BRCA - Breast invasive adenocarcinoma(2;5.01e-09)|STAD - Stomach adenocarcinoma(4;4.63e-07)|Kidney(2;5.79e-07)|KIRC - Kidney renal clear cell carcinoma(2;7.27e-07)|COAD - Colon adenocarcinoma(8;5.15e-05)		P114L(SKMEL30_SKIN)|P114L(WM983B_SKIN)	17							Uveal_Melanoma_Familial|Familial_Malignant_Melanoma_and_Tumors_of_the_Nervous_System|Hereditary_Melanoma	HNSCC(2;<9.43e_08)|TSP Lung(5;3.83e-07)			---	---	---	---	capture		Missense_Mutation	SNP	21971017	21971017	3290	9	G	A	A	43	43	CDKN2A	A	2	2
IFT74	80173	broad.mit.edu	37	9	26984516	26984516	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:26984516G>A	uc010mja.2	+	6	551	c.424G>A	c.(424-426)GAG>AAG	p.E142K	IFT74_uc010mjb.2_Missense_Mutation_p.E142K|IFT74_uc003zqf.3_Missense_Mutation_p.E142K|IFT74_uc003zqg.3_Missense_Mutation_p.E142K	NM_001099223	NP_001092693	Q96LB3	IFT74_HUMAN	coiled-coil domain containing 2 isoform a	142	Potential.					cytoplasmic membrane-bounded vesicle|intraflagellar transport particle B|microtubule-based flagellum				skin(1)	1		all_neural(11;2.36e-10)		Lung(218;1.4e-05)|LUSC - Lung squamous cell carcinoma(38;0.000114)														---	---	---	---	capture		Missense_Mutation	SNP	26984516	26984516	7864	9	G	A	A	45	45	IFT74	A	2	2
DCAF12	25853	broad.mit.edu	37	9	34098402	34098402	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:34098402C>A	uc003ztt.2	-	5	1057	c.715G>T	c.(715-717)GCC>TCC	p.A239S		NM_015397	NP_056212	Q5T6F0	DCA12_HUMAN	DDB1 and CUL4 associated factor 12	239						centrosome|CUL4 RING ubiquitin ligase complex					0																		---	---	---	---	capture		Missense_Mutation	SNP	34098402	34098402	4434	9	C	A	A	26	26	DCAF12	A	2	2
TLR4	7099	broad.mit.edu	37	9	120475753	120475753	+	Silent	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:120475753C>T	uc004bjz.2	+	3	1638	c.1347C>T	c.(1345-1347)CTC>CTT	p.L449L	TLR4_uc004bka.2_Silent_p.L409L|TLR4_uc004bkb.2_Silent_p.L249L	NM_138554	NP_612564	O00206	TLR4_HUMAN	toll-like receptor 4 precursor	449	LRR 14.|Extracellular (Potential).				activation of MAPK activity|cellular response to mechanical stimulus|detection of fungus|detection of lipopolysaccharide|I-kappaB phosphorylation|innate immune response|intestinal epithelial structure maintenance|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of ERK1 and ERK2 cascade|negative regulation of interferon-gamma production|negative regulation of interleukin-17 production|negative regulation of interleukin-23 production|negative regulation of interleukin-6 production|negative regulation of osteoclast differentiation|negative regulation of tumor necrosis factor production|positive regulation of chemokine production|positive regulation of interferon-alpha production|positive regulation of interferon-beta production|positive regulation of interferon-gamma production|positive regulation of interleukin-1 production|positive regulation of interleukin-10 production|positive regulation of interleukin-12 biosynthetic process|positive regulation of interleukin-12 production|positive regulation of interleukin-6 production|positive regulation of interleukin-8 biosynthetic process|positive regulation of interleukin-8 production|positive regulation of NF-kappaB import into nucleus|positive regulation of NF-kappaB transcription factor activity|positive regulation of nitric-oxide synthase biosynthetic process|positive regulation of platelet activation|positive regulation of transcription from RNA polymerase II promoter|positive regulation of tumor necrosis factor biosynthetic process|positive regulation of tumor necrosis factor production|T-helper 1 type immune response|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 4 signaling pathway	external side of plasma membrane|integral to plasma membrane|lipopolysaccharide receptor complex|perinuclear region of cytoplasm	lipopolysaccharide receptor activity|transmembrane receptor activity			lung(10)|ovary(4)|breast(1)|skin(1)	16																		---	---	---	---	capture		Silent	SNP	120475753	120475753	16483	9	C	T	T	29	29	TLR4	T	2	2
GRIN1	2902	broad.mit.edu	37	9	140057129	140057129	+	Missense_Mutation	SNP	C	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140057129C>A	uc004clk.2	+	14	2281	c.1951C>A	c.(1951-1953)CTG>ATG	p.L651M	GRIN1_uc004cli.1_Missense_Mutation_p.L326M|GRIN1_uc004clj.1_Missense_Mutation_p.L648M|GRIN1_uc004cll.2_Missense_Mutation_p.L651M|GRIN1_uc004clm.2_Missense_Mutation_p.L651M|GRIN1_uc004cln.2_Missense_Mutation_p.L669M|GRIN1_uc004clo.2_Missense_Mutation_p.L669M	NM_007327	NP_015566	Q05586	NMDZ1_HUMAN	NMDA receptor 1 isoform NR1-3 precursor	651	Helical; (Potential).				ionotropic glutamate receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|regulation of excitatory postsynaptic membrane potential|response to ethanol|visual learning	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|outer membrane-bounded periplasmic space|postsynaptic density|postsynaptic membrane|synaptic vesicle|synaptosome	calcium ion binding|calmodulin binding|extracellular-glutamate-gated ion channel activity|glutamate binding|glycine binding			skin(1)	1	all_cancers(76;0.0926)		STAD - Stomach adenocarcinoma(284;0.0878)	OV - Ovarian serous cystadenocarcinoma(145;6.87e-05)|Epithelial(140;0.00095)	L-Glutamic Acid(DB00142)|Orphenadrine(DB01173)													---	---	---	---	capture		Missense_Mutation	SNP	140057129	140057129	7057	9	C	A	A	24	24	GRIN1	A	2	2
NHS	4810	broad.mit.edu	37	X	17746389	17746389	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:17746389C>T	uc004cxx.2	+	6	4438	c.4100C>T	c.(4099-4101)GCC>GTC	p.A1367V	NHS_uc011mix.1_Missense_Mutation_p.A1388V|NHS_uc004cxy.2_Missense_Mutation_p.A1211V|NHS_uc004cxz.2_Missense_Mutation_p.A1190V|NHS_uc004cya.2_Missense_Mutation_p.A1090V	NM_198270	NP_938011	Q6T4R5	NHS_HUMAN	Nance-Horan syndrome protein isoform 1	1367						nucleus				skin(3)|ovary(2)|breast(1)|central_nervous_system(1)	7	Hepatocellular(33;0.183)																	---	---	---	---	capture		Missense_Mutation	SNP	17746389	17746389	10811	23	C	T	T	26	26	NHS	T	2	2
CDK16	5127	broad.mit.edu	37	X	47086599	47086599	+	Missense_Mutation	SNP	G	A	A			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:47086599G>A	uc004dho.2	+	13	1657	c.1261G>A	c.(1261-1263)GAC>AAC	p.D421N	CDK16_uc011mli.1_Missense_Mutation_p.D427N|CDK16_uc011mlk.1_Missense_Mutation_p.D428N|CDK16_uc011mll.1_Missense_Mutation_p.D495N	NM_006201	NP_006192	Q00536	CDK16_HUMAN	PCTAIRE protein kinase 1 isoform 1	421	Protein kinase.						ATP binding|cyclin-dependent protein kinase activity|protein binding			lung(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	47086599	47086599	3261	23	G	A	A	37	37	CDK16	A	1	1
ITIH5L	347365	broad.mit.edu	37	X	54814966	54814966	+	Missense_Mutation	SNP	C	G	G			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54814966C>G	uc004dtj.2	-	5	763	c.733G>C	c.(733-735)GAC>CAC	p.D245H		NM_198510	NP_940912	Q6UXX5	ITH5L_HUMAN	inter-alpha (globulin) inhibitor H5-like	245					hyaluronan metabolic process	extracellular region	serine-type endopeptidase inhibitor activity			lung(2)|skin(2)|ovary(1)|breast(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	54814966	54814966	8212	23	C	G	G	29	29	ITIH5L	G	3	3
ALG13	79868	broad.mit.edu	37	X	110928309	110928309	+	Missense_Mutation	SNP	C	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:110928309C>T	uc011msy.1	+	3	395	c.361C>T	c.(361-363)CAT>TAT	p.H121Y	ALG13_uc004epi.1_Missense_Mutation_p.H121Y|ALG13_uc011msw.1_Missense_Mutation_p.H43Y|ALG13_uc011msx.1_Missense_Mutation_p.H17Y|ALG13_uc011msz.1_Missense_Mutation_p.H43Y|ALG13_uc011mta.1_Missense_Mutation_p.H17Y|ALG13_uc011mtb.1_Missense_Mutation_p.H17Y			Q9NP73	ALG13_HUMAN	SubName: Full=Asparagine-linked glycosylation 13 homolog (S. cerevisiae);	121					dolichol-linked oligosaccharide biosynthetic process|lipid glycosylation|post-translational protein modification|protein N-linked glycosylation via asparagine	endoplasmic reticulum membrane	carbohydrate binding|N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity			lung(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	110928309	110928309	518	23	C	T	T	29	29	ALG13	T	2	2
SLC6A14	11254	broad.mit.edu	37	X	115574932	115574932	+	Silent	SNP	G	T	T			TCGA-22-4593-01	TCGA-22-4593-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:115574932G>T	uc004eqi.2	+	5	734	c.630G>T	c.(628-630)GGG>GGT	p.G210G	SLC6A14_uc011mtm.1_RNA	NM_007231	NP_009162	Q9UN76	S6A14_HUMAN	solute carrier family 6 (amino acid	210	Extracellular (Potential).				cellular amino acid metabolic process|response to toxin	integral to membrane	amino acid transmembrane transporter activity|neurotransmitter:sodium symporter activity			ovary(2)|pancreas(1)	3					L-Proline(DB00172)													---	---	---	---	capture		Silent	SNP	115574932	115574932	15174	23	G	T	T	42	42	SLC6A14	T	2	2
