Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	dataset	MUTSIG_Significant_Genes	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	context_orig	context65	gene_name	newbase	categ	categ_ignoring_null_categ
OR10Z1	128368	broad.mit.edu	37	1	158576522	158576523	+	Missense_Mutation	DNP	TG	CT	CT			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158576522_158576523TG>CT	uc010pio.1	+	1	294_295	c.294_295TG>CT	c.(292-297)GCTGCC>GCCTCC	p.A99S		NM_001004478	NP_001004478	Q8NGY1	O10Z1_HUMAN	olfactory receptor, family 10, subfamily Z,	99	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			pancreas(1)|skin(1)	2	all_hematologic(112;0.0378)																	---	---	---	---	capture		Missense_Mutation	DNP	158576522	158576523	11329	1	TG	CT	CT	55	55	OR10Z1	CT	4	4
DUSP10	11221	broad.mit.edu	37	1	221912899	221912900	+	Missense_Mutation	DNP	GA	AT	AT			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:221912899_221912900GA>AT	uc001hmy.1	-	2	369_370	c.187_188TC>AT	c.(187-189)TCA>ATA	p.S63I	DUSP10_uc001hmx.1_5'Flank|DUSP10_uc001hmz.1_Intron	NM_007207	NP_009138	Q9Y6W6	DUS10_HUMAN	dual specificity phosphatase 10 isoform a	63					inactivation of MAPK activity|JNK cascade|negative regulation of JNK cascade|negative regulation of JUN kinase activity|negative regulation of stress-activated MAPK cascade	Golgi apparatus|nucleus	MAP kinase tyrosine/serine/threonine phosphatase activity|protein tyrosine phosphatase activity			upper_aerodigestive_tract(1)|lung(1)	2				GBM - Glioblastoma multiforme(131;0.0103)														---	---	---	---	capture		Missense_Mutation	DNP	221912899	221912900	4995	1	GA	AT	AT	45	45	DUSP10	AT	2	2
HEATR1	55127	broad.mit.edu	37	1	236751300	236751301	+	Missense_Mutation	DNP	CG	AA	AA			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236751300_236751301CG>AA	uc001hyd.1	-	13	1698_1699	c.1573_1574CG>TT	c.(1573-1575)CGA>TTA	p.R525L		NM_018072	NP_060542	Q9H583	HEAT1_HUMAN	protein BAP28	525					rRNA processing	nucleolus|ribonucleoprotein complex	protein binding			ovary(2)|skin(1)	3	Ovarian(103;0.0634)|Breast(184;0.133)	all_cancers(173;0.0255)|Prostate(94;0.175)	OV - Ovarian serous cystadenocarcinoma(106;0.00117)															---	---	---	---	capture		Missense_Mutation	DNP	236751300	236751301	7310	1	CG	AA	AA	31	31	HEATR1	AA	1	1
OR2G6	391211	broad.mit.edu	37	1	248685105	248685106	+	Nonsense_Mutation	DNP	CC	AA	AA			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248685105_248685106CC>AA	uc001ien.1	+	1	158_159	c.158_159CC>AA	c.(157-159)TCC>TAA	p.S53*		NM_001013355	NP_001013373	Q5TZ20	OR2G6_HUMAN	olfactory receptor, family 2, subfamily G,	53	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(1)	3	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)	all_cancers(173;0.0156)	OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Nonsense_Mutation	DNP	248685105	248685106	11406	1	CC	AA	AA	30	30	OR2G6	AA	5	2
OR13A1	79290	broad.mit.edu	37	10	45799210	45799211	+	Missense_Mutation	DNP	CC	AA	AA	rs148557586		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:45799210_45799211CC>AA	uc001jcc.1	-	4	969_970	c.660_661GG>TT	c.(658-663)GCGGAT>GCTTAT	p.D221Y	OR13A1_uc001jcd.1_Missense_Mutation_p.D217Y	NM_001004297	NP_001004297	Q8NGR1	O13A1_HUMAN	olfactory receptor, family 13, subfamily A,	221	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---	capture		Missense_Mutation	DNP	45799210	45799211	11339	10	CC	AA	AA	30	30	OR13A1	AA	2	2
C10orf90	118611	broad.mit.edu	37	10	128150051	128150052	+	Missense_Mutation	DNP	GG	TT	TT			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:128150051_128150052GG>TT	uc001ljq.2	-	5	1758_1759	c.1637_1638CC>AA	c.(1636-1638)CCC>CAA	p.P546Q	C10orf90_uc001ljp.2_Missense_Mutation_p.P402Q|C10orf90_uc010qum.1_Missense_Mutation_p.P643Q|C10orf90_uc001ljo.2_RNA	NM_001004298	NP_001004298	Q96M02	CJ090_HUMAN	hypothetical protein LOC118611	546										ovary(1)|skin(1)	2		all_epithelial(44;4.51e-05)|all_lung(145;0.0068)|Lung NSC(174;0.0105)|Colorectal(57;0.0848)|all_neural(114;0.0936)|Breast(234;0.203)		COAD - Colon adenocarcinoma(40;0.0442)|Colorectal(40;0.0479)														---	---	---	---	capture		Missense_Mutation	DNP	128150051	128150052	1660	10	GG	TT	TT	43	43	C10orf90	TT	2	2
NLRP14	338323	broad.mit.edu	37	11	7059931	7059932	+	Nonsense_Mutation	DNP	GG	TT	TT			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:7059931_7059932GG>TT	uc001mfb.1	+	2	437_438	c.114_115GG>TT	c.(112-117)ATGGAA>ATTTAA	p.38_39ME>I*		NM_176822	NP_789792	Q86W24	NAL14_HUMAN	NLR family, pyrin domain containing 14	38_39	DAPIN.				cell differentiation|multicellular organismal development|spermatogenesis		ATP binding			ovary(3)|breast(2)|pancreas(1)|lung(1)|skin(1)	8				Epithelial(150;4.62e-08)|BRCA - Breast invasive adenocarcinoma(625;0.0871)														---	---	---	---	capture		Nonsense_Mutation	DNP	7059931	7059932	10879	11	GG	TT	TT	47	47	NLRP14	TT	5	2
SLC4A8	9498	broad.mit.edu	37	12	51851227	51851228	+	Missense_Mutation	DNP	CA	TC	TC			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51851227_51851228CA>TC	uc001rys.1	+	6	845_846	c.667_668CA>TC	c.(667-669)CAG>TCG	p.Q223S	SLC4A8_uc010sni.1_Missense_Mutation_p.Q170S|SLC4A8_uc001rym.2_Missense_Mutation_p.Q170S|SLC4A8_uc001ryn.2_Missense_Mutation_p.Q170S|SLC4A8_uc001ryo.2_Missense_Mutation_p.Q170S|SLC4A8_uc001ryp.1_Missense_Mutation_p.Q170S|SLC4A8_uc010snj.1_Missense_Mutation_p.Q250S|SLC4A8_uc001ryq.3_Missense_Mutation_p.Q223S|SLC4A8_uc001ryr.2_Missense_Mutation_p.Q223S|SLC4A8_uc010snk.1_Missense_Mutation_p.Q170S	NM_001039960	NP_001035049	Q2Y0W8	S4A8_HUMAN	solute carrier family 4, sodium bicarbonate	223	Extracellular (Potential).				bicarbonate transport|sodium ion transport	integral to membrane|plasma membrane	inorganic anion exchanger activity			ovary(3)|pancreas(1)|skin(1)	5				BRCA - Breast invasive adenocarcinoma(357;0.15)														---	---	---	---	capture		Missense_Mutation	DNP	51851227	51851228	15156	12	CA	TC	TC	29	29	SLC4A8	TC	2	2
EGLN3	112399	broad.mit.edu	37	14	34419656	34419657	+	Missense_Mutation	DNP	CA	AG	AG			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:34419656_34419657CA>AG	uc001wsa.3	-	1	628_629	c.302_303TG>CT	c.(301-303)CTG>CCT	p.L101P	EGLN3_uc001wry.2_Intron|EGLN3_uc001wrz.2_Missense_Mutation_p.L101P|EGLN3_uc001wsb.1_Missense_Mutation_p.L101P	NM_022073	NP_071356	Q9H6Z9	EGLN3_HUMAN	egl nine homolog 3	101					apoptosis	cytoplasm|nucleus	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding				0	Breast(36;0.0303)|Hepatocellular(127;0.133)		LUAD - Lung adenocarcinoma(48;0.000246)|Lung(238;0.000959)|Epithelial(34;0.155)	GBM - Glioblastoma multiforme(112;0.0118)	Vitamin C(DB00126)													---	---	---	---	capture		Missense_Mutation	DNP	34419656	34419657	5159	14	CA	AG	AG	21	21	EGLN3	AG	2	2
GAS2L2	246176	broad.mit.edu	37	17	34072205	34072206	+	Missense_Mutation	DNP	TG	AC	AC			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:34072205_34072206TG>AC	uc002hjv.1	-	6	2338_2339	c.2310_2311CA>GT	c.(2308-2313)TCCATC>TCGTTC	p.I771F		NM_139285	NP_644814	Q8NHY3	GA2L2_HUMAN	growth arrest-specific 2 like 2	771					cell cycle arrest	cytoplasm|cytoskeleton				ovary(1)|skin(1)	2		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0182)														---	---	---	---	capture		Missense_Mutation	DNP	34072205	34072206	6511	17	TG	AC	AC	51	51	GAS2L2	AC	4	4
SERPINB4	6318	broad.mit.edu	37	18	61305083	61305084	+	Missense_Mutation	DNP	GC	CT	CT			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:61305083_61305084GC>CT	uc002ljf.2	-	8	1128_1129	c.1042_1043GC>AG	c.(1042-1044)GCT>AGT	p.A348S	SERPINB4_uc002lje.2_Missense_Mutation_p.A327S|SERPINB4_uc002ljg.2_Missense_Mutation_p.A348S	NM_002974	NP_002965	P48594	SPB4_HUMAN	serine (or cysteine) proteinase inhibitor, clade	348					immune response|regulation of proteolysis	cytoplasm|extracellular region	protein binding|serine-type endopeptidase inhibitor activity			ovary(2)|lung(1)	3																		---	---	---	---	capture		Missense_Mutation	DNP	61305083	61305084	14591	18	GC	CT	CT	34	34	SERPINB4	CT	3	3
ZNF236	7776	broad.mit.edu	37	18	74622041	74622042	+	Missense_Mutation	DNP	CA	TT	TT			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74622041_74622042CA>TT	uc002lmi.2	+	15	2761_2762	c.2563_2564CA>TT	c.(2563-2565)CAG>TTG	p.Q855L	ZNF236_uc002lmj.2_RNA	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	855					cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)														---	---	---	---	capture		Missense_Mutation	DNP	74622041	74622042	18380	18	CA	TT	TT	17	17	ZNF236	TT	2	2
XIRP2	129446	broad.mit.edu	37	2	168106535	168106537	+	Missense_Mutation	Consolidated	A-A	G-T	G-T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:168106535A>G	uc002udx.2	+	8	8651	c.8633A>G	c.(8632-8634)GAA>GGA	p.E2878G	XIRP2_uc010fpn.2_Intron|XIRP2_uc010fpo.2_Intron|XIRP2_uc010fpp.2_Intron|XIRP2_uc002udy.2_Missense_Mutation_p.E2703G|XIRP2_uc010fpq.2_Missense_Mutation_p.E2656G|XIRP2_uc010fpr.2_Intron|XIRP2_uc010fps.1_Missense_Mutation_p.E224G	NM_152381	NP_689594	A4UGR9	XIRP2_HUMAN	xin actin-binding repeat containing 2 isoform 1	2703					actin cytoskeleton organization	cell junction	actin binding			skin(7)|ovary(6)|pancreas(1)	14																		---	---	---	---	capture		Missense	Complex_substitution	168106535	168106537	18011	2	ANA	GNT	GNT	9	9	XIRP2	GNT	5	5
LRP2	4036	broad.mit.edu	37	2	170062925	170062926	+	Missense_Mutation	DNP	GA	AT	AT			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170062925_170062926GA>AT	uc002ues.2	-	39	7517_7518	c.7304_7305TC>AT	c.(7303-7305)TTC>TAT	p.F2435Y		NM_004525	NP_004516	P98164	LRP2_HUMAN	low density lipoprotein-related protein 2	2435	LDL-receptor class B 25.|Extracellular (Potential).				hormone biosynthetic process|protein glycosylation|receptor-mediated endocytosis|vitamin D metabolic process	coated pit|integral to membrane|lysosome	calcium ion binding|receptor activity|SH3 domain binding			ovary(13)|skin(6)|central_nervous_system(4)|large_intestine(3)|kidney(2)|pancreas(1)	29				STAD - Stomach adenocarcinoma(1183;0.000766)|COAD - Colon adenocarcinoma(177;0.0101)	Gentamicin(DB00798)|Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Urokinase(DB00013)													---	---	---	---	capture		Missense_Mutation	DNP	170062925	170062926	9329	2	GA	AT	AT	45	45	LRP2	AT	2	2
HCN1	348980	broad.mit.edu	37	5	45303823	45303824	+	Missense_Mutation	DNP	CC	AG	AG			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:45303823_45303824CC>AG	uc003jok.2	-	6	1520_1521	c.1495_1496GG>CT	c.(1495-1497)GGA>CTA	p.G499L		NM_021072	NP_066550	O60741	HCN1_HUMAN	hyperpolarization activated cyclic	499	cAMP.|Cytoplasmic (Potential).					integral to membrane	cAMP binding|sodium channel activity|voltage-gated potassium channel activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	DNP	45303823	45303824	7278	5	CC	AG	AG	30	30	HCN1	AG	2	2
PIK3CG	5294	broad.mit.edu	37	7	106524666	106524667	+	Missense_Mutation	DNP	GG	TT	TT			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:106524666_106524667GG>TT	uc003vdv.3	+	9	2912_2913	c.2827_2828GG>TT	c.(2827-2829)GGA>TTA	p.G943L	PIK3CG_uc003vdu.2_Missense_Mutation_p.G943L|PIK3CG_uc003vdw.2_Missense_Mutation_p.G943L	NM_002649	NP_002640	P48736	PK3CG_HUMAN	phosphoinositide-3-kinase, catalytic, gamma	943	PI3K/PI4K.				G-protein coupled receptor protein signaling pathway|phosphatidylinositol-mediated signaling|platelet activation	phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity|protein binding			lung(16)|central_nervous_system(8)|breast(5)|pancreas(3)|stomach(2)|ovary(2)|upper_aerodigestive_tract(1)|skin(1)	38																		---	---	---	---	capture		Missense_Mutation	DNP	106524666	106524667	12340	7	GG	TT	TT	47	47	PIK3CG	TT	2	2
RBM28	55131	broad.mit.edu	37	7	127970946	127970947	+	Missense_Mutation	DNP	CC	AA	AA			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127970946_127970947CC>AA	uc003vmp.2	-	10	1169_1170	c.1054_1055GG>TT	c.(1054-1056)GGG>TTG	p.G352L	RBM28_uc003vmo.2_5'UTR|RBM28_uc011koj.1_Missense_Mutation_p.G211L|RBM28_uc011kok.1_Missense_Mutation_p.G299L	NM_018077	NP_060547	Q9NW13	RBM28_HUMAN	RNA binding motif protein 28	352	RRM 3.				mRNA processing|RNA splicing	Golgi apparatus|nucleolus|spliceosomal complex	nucleotide binding|RNA binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	DNP	127970946	127970947	13590	7	CC	AA	AA	22	22	RBM28	AA	2	2
DPP6	1804	broad.mit.edu	37	7	154564582	154564583	+	Nonsense_Mutation	DNP	CT	TA	TA			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:154564582_154564583CT>TA	uc003wlk.2	+	10	1195_1196	c.1066_1067CT>TA	c.(1066-1068)CTA>TAA	p.L356*	DPP6_uc003wli.2_Nonsense_Mutation_p.L292*|DPP6_uc003wlm.2_Nonsense_Mutation_p.L294*|DPP6_uc011kvq.1_Nonsense_Mutation_p.L249*	NM_130797	NP_570629	P42658	DPP6_HUMAN	dipeptidyl-peptidase 6 isoform 1	356	Extracellular (Potential).				cell death|proteolysis	integral to membrane	dipeptidyl-peptidase activity|serine-type peptidase activity			pancreas(3)|breast(1)	4	all_neural(206;0.181)	all_hematologic(28;0.0044)|all_lung(21;0.0176)|Lung NSC(21;0.0204)	OV - Ovarian serous cystadenocarcinoma(82;0.0562)															---	---	---	---	capture		Nonsense_Mutation	DNP	154564582	154564583	4914	7	CT	TA	TA	24	24	DPP6	TA	5	2
HUWE1	10075	broad.mit.edu	37	X	53661239	53661240	+	Missense_Mutation	DNP	TC	AA	AA			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53661239_53661240TC>AA	uc004dsp.2	-	8	917_918	c.515_516GA>TT	c.(514-516)GGA>GTT	p.G172V		NM_031407	NP_113584	Q7Z6Z7	HUWE1_HUMAN	HECT, UBA and WWE domain containing 1	172					base-excision repair|cell differentiation|histone ubiquitination|protein monoubiquitination|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	DNA binding|protein binding|ubiquitin-protein ligase activity			ovary(8)|large_intestine(4)|breast(4)|kidney(1)	17																		---	---	---	---	capture		Missense_Mutation	DNP	53661239	53661240	7761	23	TC	AA	AA	62	62	HUWE1	AA	4	4
MEAF6	64769	broad.mit.edu	37	1	37961483	37961484	+	Splice_Site	INS	-	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:37961483_37961484insA	uc001cbg.1	-	6	584	c.567_splice	c.e6+1	p.A189_splice	MEAF6_uc001cbd.1_Splice_Site_p.A167_splice|MEAF6_uc001cbe.1_Splice_Site_p.A199_splice|MEAF6_uc009vvd.1_Splice_Site|MEAF6_uc001cbf.1_Splice_Site	NM_022756	NP_073593			MYST/Esa1-associated factor 6						histone H2A acetylation|histone H3-K14 acetylation|histone H4-K12 acetylation|histone H4-K5 acetylation|histone H4-K8 acetylation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	MOZ/MORF histone acetyltransferase complex|NuA4 histone acetyltransferase complex|nucleolus	protein binding				0																		---	---	---	---	capture_indel		Splice_Site	INS	37961483	37961484	9810	1	-	A	A	61	61	MEAF6	A	5	5
ST8SIA6	338596	broad.mit.edu	37	10	17369069	17369070	+	Frame_Shift_Ins	INS	-	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:17369069_17369070insC	uc001ipd.2	-	6	578_579	c.578_579insG	c.(577-579)GGAfs	p.G193fs	ST8SIA6_uc010qce.1_Intron	NM_001004470	NP_001004470	P61647	SIA8F_HUMAN	ST8 alpha-N-acetyl-neuraminide	193	Lumenal (Potential).				post-translational protein modification|protein N-linked glycosylation via asparagine	integral to Golgi membrane	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity			ovary(1)	1																		---	---	---	---	capture_indel		Frame_Shift_Ins	INS	17369069	17369070	15754	10	-	C	C	62	62	ST8SIA6	C	5	5
NPAS3	64067	broad.mit.edu	37	14	34270285	34270285	+	Frame_Shift_Del	DEL	G	-	-			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:34270285delG	uc001wru.2	+	12	2836	c.2772delG	c.(2770-2772)GCGfs	p.A924fs	NPAS3_uc001wrs.2_Frame_Shift_Del_p.A911fs|NPAS3_uc001wrt.2_Frame_Shift_Del_p.A892fs|NPAS3_uc001wrv.2_Frame_Shift_Del_p.A894fs	NM_173159	NP_071406	Q8IXF0	NPAS3_HUMAN	neuronal PAS domain protein 3 isoform 3	924					regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|signal transducer activity			ovary(1)|skin(1)	2	Breast(36;0.0102)|Hepatocellular(127;0.133)		LUAD - Lung adenocarcinoma(48;0.00169)|Lung(238;0.00968)	GBM - Glioblastoma multiforme(1;1.31e-09)|all cancers(1;0.000112)|OV - Ovarian serous cystadenocarcinoma(311;0.115)														---	---	---	---	capture_indel		Frame_Shift_Del	DEL	34270285	34270285	10968	14	G	-	-	39	39	NPAS3	-	5	5
OTX2	5015	broad.mit.edu	37	14	57272080	57272080	+	Frame_Shift_Del	DEL	G	-	-			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:57272080delG	uc001xcp.2	-	1	266	c.95delC	c.(94-96)CCGfs	p.P32fs	OTX2_uc010aou.2_Frame_Shift_Del_p.P32fs|OTX2_uc001xcq.2_Frame_Shift_Del_p.P32fs	NM_172337	NP_758840	P32243	OTX2_HUMAN	orthodenticle homeobox 2 isoform b	32					axon guidance|forebrain development|midbrain development|positive regulation of embryonic development|positive regulation of gastrulation|primitive streak formation|protein complex assembly|regulation of fibroblast growth factor receptor signaling pathway|regulation of smoothened signaling pathway	growth cone|nucleus|protein complex	eukaryotic initiation factor 4E binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|sequence-specific DNA binding			ovary(1)	1	Medulloblastoma(1;0.00184)|all_neural(1;0.00414)																	---	---	---	---	capture_indel		Frame_Shift_Del	DEL	57272080	57272080	11734	14	G	-	-	39	39	OTX2	-	5	5
TP53	7157	broad.mit.edu	37	17	7578230	7578230	+	Frame_Shift_Del	DEL	C	-	-			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7578230delC	uc002gim.2	-	6	813	c.619delG	c.(619-621)GATfs	p.D207fs	TP53_uc002gig.1_Frame_Shift_Del_p.D207fs|TP53_uc002gih.2_Frame_Shift_Del_p.D207fs|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Frame_Shift_Del_p.D75fs|TP53_uc010cng.1_Frame_Shift_Del_p.D75fs|TP53_uc002gii.1_Frame_Shift_Del_p.D75fs|TP53_uc010cnh.1_Frame_Shift_Del_p.D207fs|TP53_uc010cni.1_Frame_Shift_Del_p.D207fs|TP53_uc002gij.2_Frame_Shift_Del_p.D207fs|TP53_uc010cnj.1_Intron|TP53_uc002gin.2_Frame_Shift_Del_p.D114fs|TP53_uc002gio.2_Frame_Shift_Del_p.D75fs|TP53_uc010vug.1_Frame_Shift_Del_p.D168fs	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	207	Required for interaction with FBXO42.||Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).		D -> E (in sporadic cancers; somatic mutation).|D -> N (in sporadic cancers; somatic mutation).|D -> V (in a sporadic cancer; somatic mutation).|D -> G (in sporadic cancers; somatic mutation).|DD -> EY (in a sporadic cancer; somatic mutation).|D -> Y (in a sporadic cancer; somatic mutation).|D -> H (in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.0?(7)|p.D207fs*6(2)|p.D207G(2)|p.K164_P219del(1)|p.D207_R213delDDRNTFR(1)|p.D207A(1)|p.D207fs*2(1)|p.D207_V216del10(1)|p.D207D(1)|p.D207E(1)|p.D207Y(1)|p.E204fs*39(1)|p.E204_N210delEYLDDRN(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)			111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			---	---	---	---	capture_indel		Frame_Shift_Del	DEL	7578230	7578230	16923	17	C	-	-	30	30	TP53	-	5	5
ZNF787	126208	broad.mit.edu	37	19	56599438	56599440	+	Splice_Site	DEL	TCG	-	-	rs72029508		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56599438_56599440delTCG	uc010eth.1	-	3	1219	c.1100_splice	c.e3+1	p.E367_splice		NM_001002836	NP_001002836			zinc finger protein 787						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			pancreas(1)	1		Colorectal(82;3.46e-05)|Ovarian(87;0.0822)|Renal(1328;0.157)		GBM - Glioblastoma multiforme(193;0.0559)														---	---	---	---	capture_indel		Splice_Site	DEL	56599438	56599440	18757	19	TCG	-	-	54	54	ZNF787	-	5	5
ITGA1	3672	broad.mit.edu	37	5	52157370	52157371	+	Frame_Shift_Ins	INS	-	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:52157370_52157371insT	uc003jou.2	+	3	324_325	c.272_273insT	c.(271-273)CCTfs	p.P91fs	ITGA1_uc003jov.2_RNA	NM_181501	NP_852478	P56199	ITA1_HUMAN	integrin, alpha 1 precursor	91	Extracellular (Potential).|FG-GAP 1.				axon guidance|cell-matrix adhesion|integrin-mediated signaling pathway|muscle contraction	integrin complex	collagen binding|receptor activity			ovary(2)|lung(1)	3		Lung NSC(810;5.05e-05)|Breast(144;0.0851)																---	---	---	---	capture_indel		Frame_Shift_Ins	INS	52157370	52157371	8176	5	-	T	T	24	24	ITGA1	T	5	5
SEC24A	10802	broad.mit.edu	37	5	134023936	134023945	+	Frame_Shift_Del	DEL	GTCTTCAGGA	-	-			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:134023936_134023945delGTCTTCAGGA	uc003kzs.2	+	11	1958_1967	c.1670_1679delGTCTTCAGGA	c.(1669-1680)GGTCTTCAGGAAfs	p.G557fs	SEC24A_uc011cxu.1_Frame_Shift_Del_p.G321fs	NM_021982	NP_068817	O95486	SC24A_HUMAN	SEC24 related gene family, member A	557_560					COPII vesicle coating|intracellular protein transport|post-translational protein modification|protein N-linked glycosylation via asparagine	COPII vesicle coat|cytosol|endoplasmic reticulum membrane|Golgi membrane|perinuclear region of cytoplasm	zinc ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---	capture_indel		Frame_Shift_Del	DEL	134023936	134023945	14480	5	GTCTTCAGGA	-	-	44	44	SEC24A	-	5	5
ZBTB24	9841	broad.mit.edu	37	6	109802814	109802816	+	In_Frame_Del	DEL	GTT	-	-			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:109802814_109802816delGTT	uc003ptl.1	-	2	582_584	c.414_416delAAC	c.(412-417)ACAACT>ACT	p.138_139TT>T	ZBTB24_uc011ear.1_RNA|ZBTB24_uc010kds.1_In_Frame_Del_p.138_139TT>T|ZBTB24_uc010kdt.1_RNA|ZBTB24_uc003ptm.2_In_Frame_Del_p.138_139TT>T	NM_014797	NP_055612	O43167	ZBT24_HUMAN	zinc finger and BTB domain containing 24 isoform	138_139					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3		all_cancers(87;0.000189)|Acute lymphoblastic leukemia(125;3.07e-08)|all_hematologic(75;3.33e-06)|all_epithelial(87;0.00686)|Lung SC(18;0.0743)|Colorectal(196;0.101)|all_lung(197;0.149)		Epithelial(106;0.0154)|all cancers(137;0.0216)|OV - Ovarian serous cystadenocarcinoma(136;0.0242)|BRCA - Breast invasive adenocarcinoma(108;0.059)														---	---	---	---	capture_indel		In_Frame_Del	DEL	109802814	109802816	18117	6	GTT	-	-	36	36	ZBTB24	-	5	5
GABRD	2563	broad.mit.edu	37	1	1961080	1961080	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1961080A>T	uc001aip.2	+	8	1033	c.938A>T	c.(937-939)TAC>TTC	p.Y313F		NM_000815	NP_000806	O14764	GBRD_HUMAN	gamma-aminobutyric acid (GABA) A receptor, delta	313	Helical; (Probable).					cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3	all_cancers(77;0.000708)|all_epithelial(69;0.000943)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;2.7e-19)|all_lung(118;1.22e-08)|Lung NSC(185;1.24e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Medulloblastoma(700;0.123)|Lung SC(97;0.128)		Epithelial(90;2.19e-38)|OV - Ovarian serous cystadenocarcinoma(86;3.17e-24)|GBM - Glioblastoma multiforme(42;9.56e-08)|Colorectal(212;4.12e-05)|COAD - Colon adenocarcinoma(227;0.000194)|Kidney(185;0.00231)|BRCA - Breast invasive adenocarcinoma(365;0.00441)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0344)|Lung(427;0.2)														---	---	---	---	capture		Missense_Mutation	SNP	1961080	1961080	6420	1	A	T	T	14	14	GABRD	T	4	4
MMEL1	79258	broad.mit.edu	37	1	2529710	2529710	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:2529710A>T	uc001ajy.2	-	13	1422	c.1208T>A	c.(1207-1209)CTG>CAG	p.L403Q	MMEL1_uc009vlg.1_RNA	NM_033467	NP_258428	Q495T6	MMEL1_HUMAN	membrane metallo-endopeptidase-like 1	403	Lumenal (Potential).				proteolysis	extracellular region|integral to membrane|intracellular membrane-bounded organelle	metal ion binding|metalloendopeptidase activity				0	all_cancers(77;0.000233)|all_epithelial(69;8.55e-05)|all_lung(157;0.0228)|Lung NSC(156;0.0402)|Ovarian(185;0.0634)	all_epithelial(116;1.03e-20)|all_lung(118;5.15e-09)|Lung NSC(185;9.02e-07)|Breast(487;0.00147)|Renal(390;0.00183)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Lung SC(97;0.0847)|Medulloblastoma(700;0.123)		Epithelial(90;4.31e-38)|OV - Ovarian serous cystadenocarcinoma(86;8.52e-23)|GBM - Glioblastoma multiforme(42;1.49e-08)|Colorectal(212;4.79e-05)|COAD - Colon adenocarcinoma(227;0.000213)|Kidney(185;0.000371)|BRCA - Breast invasive adenocarcinoma(365;0.00219)|KIRC - Kidney renal clear cell carcinoma(229;0.00571)|STAD - Stomach adenocarcinoma(132;0.00645)|Lung(427;0.131)														---	---	---	---	capture		Missense_Mutation	SNP	2529710	2529710	10036	1	A	T	T	7	7	MMEL1	T	4	4
ACTRT2	140625	broad.mit.edu	37	1	2938634	2938634	+	Missense_Mutation	SNP	C	G	G	rs137995220		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:2938634C>G	uc001ajz.2	+	1	589	c.384C>G	c.(382-384)TTC>TTG	p.F128L		NM_080431	NP_536356	Q8TDY3	ACTT2_HUMAN	actin-related protein M2	128						cytoplasm|cytoskeleton					0	all_cancers(77;0.00205)|all_epithelial(69;0.0011)|Ovarian(185;0.0634)|Lung NSC(156;0.0893)|all_lung(157;0.0909)	all_epithelial(116;2.66e-20)|all_lung(118;1.56e-08)|Lung NSC(185;2.54e-06)|Breast(487;0.00156)|Renal(390;0.00183)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0308)|Lung SC(97;0.0847)|Medulloblastoma(700;0.123)		Epithelial(90;7.19e-38)|OV - Ovarian serous cystadenocarcinoma(86;5.15e-22)|GBM - Glioblastoma multiforme(42;1.1e-12)|Colorectal(212;3.98e-05)|COAD - Colon adenocarcinoma(227;0.000193)|Kidney(185;0.000329)|BRCA - Breast invasive adenocarcinoma(365;0.000949)|KIRC - Kidney renal clear cell carcinoma(229;0.00544)|STAD - Stomach adenocarcinoma(132;0.00644)|Lung(427;0.125)														---	---	---	---	capture		Missense_Mutation	SNP	2938634	2938634	220	1	C	G	G	31	31	ACTRT2	G	3	3
CHD5	26038	broad.mit.edu	37	1	6170001	6170001	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6170001T>C	uc001amb.1	-	38	5532	c.5432A>G	c.(5431-5433)TAC>TGC	p.Y1811C	CHD5_uc001alz.1_Missense_Mutation_p.Y668C|CHD5_uc001ama.1_RNA	NM_015557	NP_056372	Q8TDI0	CHD5_HUMAN	chromodomain helicase DNA binding protein 5	1811					chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ATP binding|ATP-dependent helicase activity|DNA binding|zinc ion binding			central_nervous_system(3)|breast(3)|ovary(2)|upper_aerodigestive_tract(1)|lung(1)|skin(1)|pancreas(1)	12	Ovarian(185;0.0634)	all_cancers(23;5.36e-32)|all_epithelial(116;2.32e-17)|all_neural(13;3.68e-06)|all_lung(118;3.94e-06)|all_hematologic(16;2.39e-05)|Lung NSC(185;5.33e-05)|Acute lymphoblastic leukemia(12;0.000372)|Glioma(11;0.00127)|Renal(390;0.00188)|Colorectal(325;0.00342)|Breast(487;0.00373)|Hepatocellular(190;0.0218)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.15)		Epithelial(90;3.08e-37)|GBM - Glioblastoma multiforme(13;1.36e-31)|OV - Ovarian serous cystadenocarcinoma(86;7.7e-19)|Colorectal(212;9.97e-08)|COAD - Colon adenocarcinoma(227;1.07e-05)|Kidney(185;6.16e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.00109)|BRCA - Breast invasive adenocarcinoma(365;0.0012)|STAD - Stomach adenocarcinoma(132;0.00346)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.193)														---	---	---	---	capture		Missense_Mutation	SNP	6170001	6170001	3462	1	T	C	C	57	57	CHD5	C	4	4
KIF1B	23095	broad.mit.edu	37	1	10328302	10328302	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:10328302C>A	uc001aqx.3	+	7	903	c.701C>A	c.(700-702)ACC>AAC	p.T234N	KIF1B_uc001aqv.3_Missense_Mutation_p.T234N|KIF1B_uc001aqw.3_Missense_Mutation_p.T234N|KIF1B_uc001aqy.2_Missense_Mutation_p.T234N|KIF1B_uc001aqz.2_Missense_Mutation_p.T234N|KIF1B_uc001ara.2_Missense_Mutation_p.T234N|KIF1B_uc001arb.2_Missense_Mutation_p.T234N|KIF1B_uc009vmt.2_RNA	NM_015074	NP_055889	O60333	KIF1B_HUMAN	kinesin family member 1B isoform b	234	Kinesin-motor.				anterograde axon cargo transport|apoptosis|neuromuscular synaptic transmission|neuron-neuron synaptic transmission	cytoplasmic vesicle membrane|microtubule|microtubule associated complex|mitochondrion	ATP binding|ATPase activity|kinesin binding|microtubule motor activity|protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	Ovarian(185;0.203)	all_lung(284;1.31e-05)|Lung NSC(185;2.2e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0259)|Colorectal(212;9.79e-07)|COAD - Colon adenocarcinoma(227;0.000143)|BRCA - Breast invasive adenocarcinoma(304;0.000413)|Kidney(185;0.00134)|KIRC - Kidney renal clear cell carcinoma(229;0.0037)|STAD - Stomach adenocarcinoma(132;0.0113)|READ - Rectum adenocarcinoma(331;0.0642)														---	---	---	---	capture		Missense_Mutation	SNP	10328302	10328302	8595	1	C	A	A	18	18	KIF1B	A	2	2
KIAA2013	90231	broad.mit.edu	37	1	11983449	11983449	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:11983449C>T	uc001atk.2	-	2	1325	c.1131G>A	c.(1129-1131)CTG>CTA	p.L377L	KIAA2013_uc001atl.1_Silent_p.L377L	NM_138346	NP_612355	Q8IYS2	K2013_HUMAN	hypothetical protein LOC90231 precursor	377	Extracellular (Potential).					integral to membrane				ovary(1)	1	Ovarian(185;0.249)	Renal(390;0.000469)|Lung NSC(185;0.00149)|all_lung(284;0.00189)|Breast(348;0.00586)|Colorectal(325;0.0062)|Myeloproliferative disorder(586;0.0393)|Hepatocellular(190;0.0556)|Ovarian(437;0.0731)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;4.88e-06)|COAD - Colon adenocarcinoma(227;0.000241)|BRCA - Breast invasive adenocarcinoma(304;0.000293)|Kidney(185;0.000722)|KIRC - Kidney renal clear cell carcinoma(229;0.00258)|STAD - Stomach adenocarcinoma(313;0.0072)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---	capture		Silent	SNP	11983449	11983449	8578	1	C	T	T	25	25	KIAA2013	T	2	2
VPS13D	55187	broad.mit.edu	37	1	12567003	12567003	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12567003C>T	uc001atv.2	+	69	13032	c.12891C>T	c.(12889-12891)GCC>GCT	p.A4297A	VPS13D_uc001atw.2_Silent_p.A4272A|VPS13D_uc001atx.2_Silent_p.A3484A|VPS13D_uc009vnl.2_RNA|VPS13D_uc010obd.1_Silent_p.A295A|SNORA59B_uc001atz.1_5'Flank	NM_015378	NP_056193	Q5THJ4	VP13D_HUMAN	vacuolar protein sorting 13D isoform 1	4296					protein localization					ovary(4)|pancreas(1)	5	Ovarian(185;0.249)	Lung NSC(185;4.08e-05)|all_lung(284;4.55e-05)|Renal(390;0.000147)|Colorectal(325;0.00058)|Breast(348;0.00093)|Ovarian(437;0.00965)|Hepatocellular(190;0.0202)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0327)|Colorectal(212;4.63e-06)|BRCA - Breast invasive adenocarcinoma(304;0.000289)|COAD - Colon adenocarcinoma(227;0.000801)|Kidney(185;0.00216)|KIRC - Kidney renal clear cell carcinoma(229;0.00544)|STAD - Stomach adenocarcinoma(313;0.012)|READ - Rectum adenocarcinoma(331;0.0476)|Lung(427;0.209)														---	---	---	---	capture		Silent	SNP	12567003	12567003	17759	1	C	T	T	21	21	VPS13D	T	2	2
PRAMEF8	391002	broad.mit.edu	37	1	12979852	12979852	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12979852C>A	uc001aup.2	+	4	1127	c.1044C>A	c.(1042-1044)GCC>GCA	p.A348A		NM_001012276	NP_001012276	Q5VWM4	PRAM8_HUMAN	PRAME family member 8	348	LRR 2.										0	Ovarian(185;0.249)	Renal(390;0.000469)|Lung NSC(185;0.00143)|all_lung(284;0.00181)|Colorectal(325;0.00215)|Breast(348;0.00224)|Myeloproliferative disorder(586;0.0393)|Hepatocellular(190;0.0623)|Ovarian(437;0.0731)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00812)|Colorectal(212;4.88e-06)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000194)|COAD - Colon adenocarcinoma(227;0.000241)|BRCA - Breast invasive adenocarcinoma(304;0.000293)|STAD - Stomach adenocarcinoma(313;0.0072)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---	capture		Silent	SNP	12979852	12979852	12881	1	C	A	A	21	21	PRAMEF8	A	2	2
SPATA21	374955	broad.mit.edu	37	1	16727236	16727236	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16727236G>T	uc001ayn.2	-	11	1636	c.1153C>A	c.(1153-1155)CGG>AGG	p.R385R	SPATA21_uc001ayl.1_RNA|SPATA21_uc010occ.1_Silent_p.R362R	NM_198546	NP_940948	Q7Z572	SPT21_HUMAN	spermatogenesis associated 21	385							calcium ion binding			ovary(2)|breast(1)	3		Colorectal(325;0.000147)|Renal(390;0.00145)|Lung NSC(340;0.00215)|Breast(348;0.00224)|all_lung(284;0.00351)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0646)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0182)|COAD - Colon adenocarcinoma(227;1.15e-05)|BRCA - Breast invasive adenocarcinoma(304;4.2e-05)|Kidney(64;0.000183)|KIRC - Kidney renal clear cell carcinoma(64;0.00269)|STAD - Stomach adenocarcinoma(313;0.0122)|READ - Rectum adenocarcinoma(331;0.0651)														---	---	---	---	capture		Silent	SNP	16727236	16727236	15515	1	G	T	T	39	39	SPATA21	T	1	1
PADI1	29943	broad.mit.edu	37	1	17552641	17552641	+	Missense_Mutation	SNP	T	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17552641T>G	uc001bah.1	+	6	732	c.640T>G	c.(640-642)TTC>GTC	p.F214V		NM_013358	NP_037490	Q9ULC6	PADI1_HUMAN	peptidylarginine deiminase type I	214					peptidyl-citrulline biosynthetic process from peptidyl-arginine	cytoplasm	calcium ion binding|protein-arginine deiminase activity				0		Colorectal(325;3.46e-05)|Breast(348;0.000162)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.00054)|Ovarian(437;0.00409)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00522)|BRCA - Breast invasive adenocarcinoma(304;1.3e-05)|COAD - Colon adenocarcinoma(227;1.31e-05)|Kidney(64;0.000212)|KIRC - Kidney renal clear cell carcinoma(64;0.003)|STAD - Stomach adenocarcinoma(196;0.0069)|READ - Rectum adenocarcinoma(331;0.0681)|Lung(427;0.197)	L-Citrulline(DB00155)													---	---	---	---	capture		Missense_Mutation	SNP	17552641	17552641	11793	1	T	G	G	56	56	PADI1	G	4	4
PADI1	29943	broad.mit.edu	37	1	17555289	17555289	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17555289G>T	uc001bah.1	+	7	914	c.822G>T	c.(820-822)CCG>CCT	p.P274P		NM_013358	NP_037490	Q9ULC6	PADI1_HUMAN	peptidylarginine deiminase type I	274					peptidyl-citrulline biosynthetic process from peptidyl-arginine	cytoplasm	calcium ion binding|protein-arginine deiminase activity				0		Colorectal(325;3.46e-05)|Breast(348;0.000162)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.00054)|Ovarian(437;0.00409)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00522)|BRCA - Breast invasive adenocarcinoma(304;1.3e-05)|COAD - Colon adenocarcinoma(227;1.31e-05)|Kidney(64;0.000212)|KIRC - Kidney renal clear cell carcinoma(64;0.003)|STAD - Stomach adenocarcinoma(196;0.0069)|READ - Rectum adenocarcinoma(331;0.0681)|Lung(427;0.197)	L-Citrulline(DB00155)													---	---	---	---	capture		Silent	SNP	17555289	17555289	11793	1	G	T	T	39	39	PADI1	T	1	1
HSPG2	3339	broad.mit.edu	37	1	22172988	22172988	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:22172988G>T	uc001bfj.2	-	63	8309	c.8269C>A	c.(8269-8271)CAG>AAG	p.Q2757K	HSPG2_uc009vqd.2_Missense_Mutation_p.Q2758K	NM_005529	NP_005520	P98160	PGBM_HUMAN	heparan sulfate proteoglycan 2 precursor	2757	Ig-like C2-type 13.				angiogenesis|cell adhesion|lipid metabolic process|lipoprotein metabolic process	basement membrane|extracellular space|plasma membrane	protein C-terminus binding			ovary(5)|large_intestine(2)|central_nervous_system(1)|skin(1)	9		Colorectal(325;3.46e-05)|all_lung(284;7.93e-05)|Lung NSC(340;8.71e-05)|Renal(390;0.000219)|Breast(348;0.00222)|Ovarian(437;0.00308)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0498)|OV - Ovarian serous cystadenocarcinoma(117;1.14e-26)|Colorectal(126;4.18e-07)|COAD - Colon adenocarcinoma(152;1.82e-05)|GBM - Glioblastoma multiforme(114;3.13e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000756)|STAD - Stomach adenocarcinoma(196;0.00656)|KIRC - Kidney renal clear cell carcinoma(1967;0.00942)|READ - Rectum adenocarcinoma(331;0.0721)|Lung(427;0.223)	Becaplermin(DB00102)|Palifermin(DB00039)													---	---	---	---	capture		Missense_Mutation	SNP	22172988	22172988	7730	1	G	T	T	47	47	HSPG2	T	2	2
TCEB3	6924	broad.mit.edu	37	1	24078941	24078941	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24078941G>A	uc001bho.2	+	5	1608	c.1548G>A	c.(1546-1548)GCG>GCA	p.A516A		NM_003198	NP_003189	Q14241	ELOA1_HUMAN	elongin A	516					positive regulation of viral transcription|regulation of transcription from RNA polymerase II promoter|transcription elongation from RNA polymerase II promoter|viral reproduction	integral to membrane	DNA binding			ovary(1)	1		Colorectal(325;3.46e-05)|Lung NSC(340;0.000112)|all_lung(284;0.00016)|Renal(390;0.000219)|Breast(348;0.0044)|Ovarian(437;0.00539)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0227)|OV - Ovarian serous cystadenocarcinoma(117;2.42e-24)|Colorectal(126;5.5e-08)|COAD - Colon adenocarcinoma(152;3.09e-06)|GBM - Glioblastoma multiforme(114;4.74e-06)|BRCA - Breast invasive adenocarcinoma(304;0.000973)|KIRC - Kidney renal clear cell carcinoma(1967;0.00334)|STAD - Stomach adenocarcinoma(196;0.0127)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.0853)|LUSC - Lung squamous cell carcinoma(448;0.187)														---	---	---	---	capture		Silent	SNP	24078941	24078941	16207	1	G	A	A	37	37	TCEB3	A	1	1
C1orf201	90529	broad.mit.edu	37	1	24706237	24706237	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24706237T>C	uc001bjc.2	-	5	503	c.368A>G	c.(367-369)AAG>AGG	p.K123R	C1orf201_uc001bja.2_Missense_Mutation_p.K76R|C1orf201_uc001bjb.2_Missense_Mutation_p.K31R|C1orf201_uc001bjd.2_Missense_Mutation_p.K123R|C1orf201_uc001bje.1_Missense_Mutation_p.K76R|C1orf201_uc001bjf.2_5'UTR			Q5TH74	CA201_HUMAN	RecName: Full=UPF0490 protein C1orf201;	123										ovary(1)|breast(1)	2		Colorectal(325;0.000147)|Renal(390;0.00211)|Lung NSC(340;0.0191)|all_lung(284;0.0251)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.051)|Breast(348;0.056)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;4.48e-25)|Colorectal(126;7.29e-08)|COAD - Colon adenocarcinoma(152;3.85e-06)|GBM - Glioblastoma multiforme(114;0.000399)|BRCA - Breast invasive adenocarcinoma(304;0.00107)|STAD - Stomach adenocarcinoma(196;0.00151)|KIRC - Kidney renal clear cell carcinoma(1967;0.00393)|READ - Rectum adenocarcinoma(331;0.0672)|Lung(427;0.145)														---	---	---	---	capture		Missense_Mutation	SNP	24706237	24706237	2095	1	T	C	C	56	56	C1orf201	C	4	4
PTAFR	5724	broad.mit.edu	37	1	28477001	28477001	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:28477001C>T	uc001bpl.2	-	2	659	c.532G>A	c.(532-534)GAG>AAG	p.E178K	PTAFR_uc001bpm.3_Missense_Mutation_p.E178K|PTAFR_uc009vte.2_Missense_Mutation_p.E178K	NM_000952	NP_000943	P25105	PTAFR_HUMAN	platelet-activating factor receptor	178	Extracellular (Potential).				chemotaxis|inflammatory response|interferon-gamma-mediated signaling pathway|phosphatidylinositol-mediated signaling	integral to plasma membrane|nucleus	phospholipid binding|platelet activating factor receptor activity				0		Colorectal(325;0.000147)|Renal(390;0.00357)|Lung NSC(340;0.00715)|all_lung(284;0.00732)|Breast(348;0.0174)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0545)|all_neural(195;0.0557)		UCEC - Uterine corpus endometrioid carcinoma (279;0.215)|OV - Ovarian serous cystadenocarcinoma(117;6e-22)|Colorectal(126;3.04e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.00279)|BRCA - Breast invasive adenocarcinoma(304;0.00595)|STAD - Stomach adenocarcinoma(196;0.00678)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---	capture		Missense_Mutation	SNP	28477001	28477001	13177	1	C	T	T	31	31	PTAFR	T	1	1
YTHDF2	51441	broad.mit.edu	37	1	29070237	29070237	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:29070237G>T	uc001brc.2	+	4	1952	c.1455G>T	c.(1453-1455)GTG>GTT	p.V485V	YTHDF2_uc001brd.2_Silent_p.V482V|YTHDF2_uc010ofx.1_Silent_p.V435V|YTHDF2_uc001bre.2_Silent_p.V435V	NM_016258	NP_057342	Q9Y5A9	YTHD2_HUMAN	high glucose-regulated protein 8	485	YTH.				humoral immune response					ovary(1)|skin(1)	2		Colorectal(325;3.46e-05)|Lung NSC(340;0.000601)|all_lung(284;0.000771)|Breast(348;0.00502)|Renal(390;0.00758)|all_neural(195;0.0227)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0563)|Medulloblastoma(700;0.123)		Colorectal(126;8.36e-08)|COAD - Colon adenocarcinoma(152;5.46e-06)|STAD - Stomach adenocarcinoma(196;0.00299)|BRCA - Breast invasive adenocarcinoma(304;0.0221)|KIRC - Kidney renal clear cell carcinoma(1967;0.0296)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---	capture		Silent	SNP	29070237	29070237	18082	1	G	T	T	48	48	YTHDF2	T	2	2
CSMD2	114784	broad.mit.edu	37	1	34102088	34102088	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:34102088A>T	uc001bxn.1	-	30	4750	c.4721T>A	c.(4720-4722)CTG>CAG	p.L1574Q	CSMD2_uc001bxm.1_Missense_Mutation_p.L1614Q|CSMD2_uc001bxo.1_Missense_Mutation_p.L487Q	NM_052896	NP_443128	Q7Z408	CSMD2_HUMAN	CUB and Sushi multiple domains 2	1574	Extracellular (Potential).|Sushi 9.					integral to membrane|plasma membrane	protein binding			ovary(6)|skin(5)|pancreas(1)	12		Myeloproliferative disorder(586;0.0294)|all_neural(195;0.249)																---	---	---	---	capture		Missense_Mutation	SNP	34102088	34102088	4086	1	A	T	T	7	7	CSMD2	T	4	4
CSMD2	114784	broad.mit.edu	37	1	34191097	34191097	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:34191097C>A	uc001bxn.1	-	17	2457	c.2428G>T	c.(2428-2430)GAT>TAT	p.D810Y	CSMD2_uc001bxm.1_Missense_Mutation_p.D850Y	NM_052896	NP_443128	Q7Z408	CSMD2_HUMAN	CUB and Sushi multiple domains 2	810	CUB 5.|Extracellular (Potential).					integral to membrane|plasma membrane	protein binding			ovary(6)|skin(5)|pancreas(1)	12		Myeloproliferative disorder(586;0.0294)|all_neural(195;0.249)																---	---	---	---	capture		Missense_Mutation	SNP	34191097	34191097	4086	1	C	A	A	31	31	CSMD2	A	1	1
DLGAP3	58512	broad.mit.edu	37	1	35365738	35365738	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35365738G>C	uc001byc.2	-	2	1244	c.1244C>G	c.(1243-1245)ACA>AGA	p.T415R		NM_001080418	NP_001073887	O95886	DLGP3_HUMAN	discs, large (Drosophila) homolog-associated	415					cell-cell signaling	cell junction|postsynaptic density|postsynaptic membrane				ovary(3)	3		Myeloproliferative disorder(586;0.0393)																---	---	---	---	capture		Missense_Mutation	SNP	35365738	35365738	4741	1	G	C	C	48	48	DLGAP3	C	3	3
DLGAP3	58512	broad.mit.edu	37	1	35370146	35370146	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35370146G>T	uc001byc.2	-	1	839	c.839C>A	c.(838-840)CCT>CAT	p.P280H		NM_001080418	NP_001073887	O95886	DLGP3_HUMAN	discs, large (Drosophila) homolog-associated	280					cell-cell signaling	cell junction|postsynaptic density|postsynaptic membrane				ovary(3)	3		Myeloproliferative disorder(586;0.0393)																---	---	---	---	capture		Missense_Mutation	SNP	35370146	35370146	4741	1	G	T	T	35	35	DLGAP3	T	2	2
KIAA0319L	79932	broad.mit.edu	37	1	35921739	35921739	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35921739G>A	uc001byx.2	-	10	1789	c.1531C>T	c.(1531-1533)CAA>TAA	p.Q511*	KIAA0319L_uc001byw.2_5'Flank|KIAA0319L_uc010ohv.1_Nonsense_Mutation_p.Q153*	NM_024874	NP_079150	Q8IZA0	K319L_HUMAN	dyslexia susceptibility 2-like	511	PKD 3.|Extracellular (Potential).					cytoplasmic vesicle part|integral to membrane	protein binding			skin(2)	2		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---	capture		Nonsense_Mutation	SNP	35921739	35921739	8476	1	G	A	A	47	47	KIAA0319L	A	5	2
GRIK3	2899	broad.mit.edu	37	1	37325587	37325587	+	Missense_Mutation	SNP	C	A	A	rs114188187	by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:37325587C>A	uc001caz.2	-	6	953	c.818G>T	c.(817-819)CGC>CTC	p.R273L	GRIK3_uc001cba.1_Missense_Mutation_p.R273L	NM_000831	NP_000822	Q13003	GRIK3_HUMAN	glutamate receptor, ionotropic, kainate 3	273	Extracellular (Potential).				negative regulation of synaptic transmission, glutamatergic|regulation of membrane potential|synaptic transmission	cell junction|dendrite cytoplasm|integral to plasma membrane|perikaryon|postsynaptic membrane|terminal button	adenylate cyclase inhibiting metabotropic glutamate receptor activity|extracellular-glutamate-gated ion channel activity|G-protein-coupled receptor binding|kainate selective glutamate receptor activity			ovary(3)|skin(2)|large_intestine(1)|breast(1)	7		Myeloproliferative disorder(586;0.0258)|all_neural(195;0.169)			L-Glutamic Acid(DB00142)													---	---	---	---	capture		Missense_Mutation	SNP	37325587	37325587	7054	1	C	A	A	27	27	GRIK3	A	1	1
MACF1	23499	broad.mit.edu	37	1	39715746	39715746	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39715746C>G	uc010ois.1	+	5	548	c.343C>G	c.(343-345)CTG>GTG	p.L115V	MACF1_uc001cda.1_Missense_Mutation_p.L23V|MACF1_uc010oit.1_Missense_Mutation_p.L78V	NM_012090	NP_036222	Q9UPN3	MACF1_HUMAN	microfilament and actin filament cross-linker	115	Actin-binding.|CH 1.				cell cycle arrest|Golgi to plasma membrane protein transport|positive regulation of Wnt receptor signaling pathway|regulation of epithelial cell migration|regulation of focal adhesion assembly|regulation of microtubule-based process|Wnt receptor signaling pathway|wound healing	Golgi apparatus|microtubule|ruffle membrane	actin filament binding|ATPase activity|calcium ion binding|microtubule binding			ovary(8)|breast(3)|central_nervous_system(3)|skin(2)	16	Lung NSC(20;5.57e-06)|Ovarian(52;0.00769)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;7.78e-19)|Epithelial(16;1.73e-17)|all cancers(16;2.49e-16)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)															---	---	---	---	capture		Missense_Mutation	SNP	39715746	39715746	9521	1	C	G	G	32	32	MACF1	G	3	3
KIAA0754	643314	broad.mit.edu	37	1	39876940	39876940	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39876940G>C	uc009vvt.1	+	1	1765	c.1003G>C	c.(1003-1005)GAG>CAG	p.E335Q	MACF1_uc010ois.1_Intron|MACF1_uc001cda.1_Intron|MACF1_uc001cdc.1_Intron|MACF1_uc010oiu.1_Intron	NM_015038	NP_055853	O94854	K0754_HUMAN	hypothetical protein LOC643314	199											0	Lung NSC(20;5.57e-06)|Ovarian(52;0.00769)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0393)	OV - Ovarian serous cystadenocarcinoma(33;7.78e-19)|Epithelial(16;1.73e-17)|all cancers(16;2.49e-16)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)													OREG0013393	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	39876940	39876940	8499	1	G	C	C	33	33	KIAA0754	C	3	3
MACF1	23499	broad.mit.edu	37	1	39945559	39945559	+	Nonsense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39945559C>T	uc010oiu.1	+	62	17439	c.17308C>T	c.(17308-17310)CGA>TGA	p.R5770*	MACF1_uc010ois.1_Nonsense_Mutation_p.R5262*|MACF1_uc001cde.1_Nonsense_Mutation_p.R139*|MACF1_uc001cdf.1_Nonsense_Mutation_p.R145*|MACF1_uc001cdg.2_Nonsense_Mutation_p.R53*|MACF1_uc001cdh.2_Nonsense_Mutation_p.R53*	NM_033044	NP_149033	Q9UPN3	MACF1_HUMAN	microfilament and actin filament cross-linker	7220	C-terminal tail (By similarity).				cell cycle arrest|Golgi to plasma membrane protein transport|positive regulation of Wnt receptor signaling pathway|regulation of epithelial cell migration|regulation of focal adhesion assembly|regulation of microtubule-based process|Wnt receptor signaling pathway|wound healing	Golgi apparatus|microtubule|ruffle membrane	actin filament binding|ATPase activity|calcium ion binding|microtubule binding			ovary(8)|breast(3)|central_nervous_system(3)|skin(2)	16	Lung NSC(20;5.57e-06)|Ovarian(52;0.00769)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;7.78e-19)|Epithelial(16;1.73e-17)|all cancers(16;2.49e-16)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)															---	---	---	---	capture		Nonsense_Mutation	SNP	39945559	39945559	9521	1	C	T	T	31	31	MACF1	T	5	1
CTPS	1503	broad.mit.edu	37	1	41474386	41474386	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:41474386G>T	uc001cgk.3	+	15	1957	c.1449G>T	c.(1447-1449)GAG>GAT	p.E483D	CTPS_uc010ojo.1_Missense_Mutation_p.E252D|CTPS_uc001cgl.3_Missense_Mutation_p.E483D|CTPS_uc010ojq.1_Missense_Mutation_p.E327D|CTPS_uc009vwe.2_Intron	NM_001905	NP_001896	P17812	PYRG1_HUMAN	CTP synthase	483	Glutamine amidotransferase type-1.				CTP biosynthetic process|glutamine metabolic process|nucleobase, nucleoside and nucleotide interconversion|response to drug	cytosol	ATP binding|CTP synthase activity|protein binding				0	Ovarian(52;0.00579)|all_hematologic(146;0.0977)|Breast(333;0.1)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0255)			L-Glutamine(DB00130)													---	---	---	---	capture		Missense_Mutation	SNP	41474386	41474386	4181	1	G	T	T	35	35	CTPS	T	2	2
CLDN19	149461	broad.mit.edu	37	1	43204186	43204186	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43204186G>C	uc001cht.1	-	2	485	c.294C>G	c.(292-294)AGC>AGG	p.S98R	CLDN19_uc001chu.2_Missense_Mutation_p.S98R|CLDN19_uc010ojv.1_Missense_Mutation_p.S98R	NM_148960	NP_683763	Q8N6F1	CLD19_HUMAN	claudin 19 isoform a	98	Helical; (Potential).				calcium-independent cell-cell adhesion|response to stimulus|visual perception	basolateral plasma membrane|integral to membrane|tight junction	identical protein binding				0	Ovarian(52;0.00744)|all_hematologic(146;0.0977)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0505)																---	---	---	---	capture		Missense_Mutation	SNP	43204186	43204186	3616	1	G	C	C	38	38	CLDN19	C	3	3
TIE1	7075	broad.mit.edu	37	1	43777783	43777783	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43777783C>T	uc001ciu.2	+	11	1690	c.1611C>T	c.(1609-1611)CTC>CTT	p.L537L	TIE1_uc010okd.1_Silent_p.L537L|TIE1_uc010oke.1_Silent_p.L492L|TIE1_uc009vwq.2_Silent_p.L493L|TIE1_uc010okf.1_Silent_p.L182L|TIE1_uc010okg.1_Silent_p.L182L	NM_005424	NP_005415	P35590	TIE1_HUMAN	tyrosine kinase with immunoglobulin-like and	537	Extracellular (Potential).|Fibronectin type-III 1.				mesoderm development	integral to plasma membrane	ATP binding|protein binding|transmembrane receptor protein tyrosine kinase activity			lung(3)|stomach(1)|salivary_gland(1)|ovary(1)|skin(1)	7	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0505)																---	---	---	---	capture		Silent	SNP	43777783	43777783	16421	1	C	T	T	29	29	TIE1	T	2	2
KIF2C	11004	broad.mit.edu	37	1	45223802	45223802	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45223802A>G	uc001cmg.3	+	13	1329	c.1214A>G	c.(1213-1215)TAC>TGC	p.Y405C	KIF2C_uc010olb.1_Missense_Mutation_p.Y364C|KIF2C_uc010olc.1_Missense_Mutation_p.Y292C|KIF2C_uc001cmh.3_Missense_Mutation_p.Y351C	NM_006845	NP_006836	Q99661	KIF2C_HUMAN	kinesin family member 2C	405	Kinesin-motor.				blood coagulation|cell division|cell proliferation|chromosome segregation|establishment or maintenance of microtubule cytoskeleton polarity|microtubule depolymerization|microtubule-based movement|mitotic prometaphase|regulation of chromosome segregation	condensed chromosome kinetochore|cytosol|kinesin complex|microtubule|nucleus	ATP binding|centromeric DNA binding|microtubule motor activity|microtubule plus-end binding			ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---	capture		Missense_Mutation	SNP	45223802	45223802	8610	1	A	G	G	14	14	KIF2C	G	4	4
HECTD3	79654	broad.mit.edu	37	1	45469374	45469374	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45469374C>T	uc009vxk.2	-	20	2566	c.2468G>A	c.(2467-2469)TGC>TAC	p.C823Y	HECTD3_uc001cmx.3_Missense_Mutation_p.C172Y|HECTD3_uc001cmy.3_Missense_Mutation_p.C433Y|HECTD3_uc010olh.1_Missense_Mutation_p.C539Y	NM_024602	NP_078878	Q5T447	HECD3_HUMAN	HECT domain containing 3	823	HECT.	Glycyl thioester intermediate.		C->A: Loss of ubiquitin-ligase activity.	proteasomal ubiquitin-dependent protein catabolic process|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	perinuclear region of cytoplasm	ubiquitin-protein ligase activity				0	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---	capture		Missense_Mutation	SNP	45469374	45469374	7324	1	C	T	T	25	25	HECTD3	T	2	2
CYP4B1	1580	broad.mit.edu	37	1	47283849	47283849	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:47283849A>G	uc001cqm.3	+	11	1400	c.1316A>G	c.(1315-1317)CAT>CGT	p.H439R	CYP4B1_uc001cqn.3_Missense_Mutation_p.H440R|CYP4B1_uc009vym.2_Missense_Mutation_p.H425R|CYP4B1_uc010omk.1_Missense_Mutation_p.H276R	NM_000779	NP_000770	P13584	CP4B1_HUMAN	cytochrome P450, family 4, subfamily B,	439					xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	aromatase activity|electron carrier activity|heme binding|oxygen binding			ovary(1)|skin(1)	2	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---	capture		Missense_Mutation	SNP	47283849	47283849	4350	1	A	G	G	8	8	CYP4B1	G	4	4
ELAVL4	1996	broad.mit.edu	37	1	50642799	50642799	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:50642799C>G	uc001csb.2	+	3	557	c.289C>G	c.(289-291)CCA>GCA	p.P97A	ELAVL4_uc001cry.3_Missense_Mutation_p.P100A|ELAVL4_uc001crz.3_Missense_Mutation_p.P97A|ELAVL4_uc001csa.3_Missense_Mutation_p.P114A|ELAVL4_uc001csc.3_Missense_Mutation_p.P97A|ELAVL4_uc009vyu.2_Missense_Mutation_p.P102A|ELAVL4_uc010omz.1_Missense_Mutation_p.P102A	NM_021952	NP_068771	P26378	ELAV4_HUMAN	ELAV-like 4 isoform 1	97	RRM 1.				mRNA processing		AU-rich element binding|mRNA 3'-UTR binding|nucleotide binding			ovary(1)|pancreas(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	50642799	50642799	5243	1	C	G	G	30	30	ELAVL4	G	3	3
C1orf168	199920	broad.mit.edu	37	1	57216842	57216842	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57216842T>A	uc001cym.3	-	9	1668	c.1262A>T	c.(1261-1263)CAG>CTG	p.Q421L	C1orf168_uc009vzu.1_RNA|C1orf168_uc001cyl.2_RNA	NM_001004303	NP_001004303	Q5VWT5	CA168_HUMAN	hypothetical protein LOC199920	421										ovary(3)|skin(2)	5																		---	---	---	---	capture		Missense_Mutation	SNP	57216842	57216842	2079	1	T	A	A	55	55	C1orf168	A	4	4
EFCAB7	84455	broad.mit.edu	37	1	64034182	64034182	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:64034182G>A	uc001dbf.2	+	12	1993	c.1699G>A	c.(1699-1701)GAA>AAA	p.E567K		NM_032437	NP_115813	A8K855	EFCB7_HUMAN	EF-hand calcium binding domain 7	567							calcium ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	64034182	64034182	5127	1	G	A	A	45	45	EFCAB7	A	2	2
SGIP1	84251	broad.mit.edu	37	1	67205146	67205146	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67205146C>A	uc001dcr.2	+	22	2377	c.2160C>A	c.(2158-2160)CTC>CTA	p.L720L	SGIP1_uc010opd.1_Silent_p.L320L|SGIP1_uc001dcs.2_Silent_p.L320L|SGIP1_uc001dct.2_Silent_p.L322L|SGIP1_uc009wat.2_Silent_p.L514L|SGIP1_uc001dcu.2_Silent_p.L225L	NM_032291	NP_115667	Q9BQI5	SGIP1_HUMAN	SH3-domain GRB2-like (endophilin) interacting	720					positive regulation of energy homeostasis|positive regulation of feeding behavior|positive regulation of receptor-mediated endocytosis|response to dietary excess	AP-2 adaptor complex	microtubule binding|phospholipid binding|SH3 domain binding			ovary(3)	3																		---	---	---	---	capture		Silent	SNP	67205146	67205146	14697	1	C	A	A	29	29	SGIP1	A	2	2
WDR78	79819	broad.mit.edu	37	1	67390477	67390477	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67390477G>C	uc001dcx.2	-	1	94	c.38C>G	c.(37-39)GCC>GGC	p.A13G	WDR78_uc001dcy.2_Missense_Mutation_p.A13G|WDR78_uc001dcz.2_Missense_Mutation_p.A13G|MIER1_uc001dda.3_5'Flank|MIER1_uc010opf.1_5'Flank|MIER1_uc009way.2_5'Flank|MIER1_uc001ddc.2_5'Flank|MIER1_uc001ddh.2_5'Flank|MIER1_uc001ddf.2_5'Flank|MIER1_uc001ddg.2_5'Flank|MIER1_uc010opg.1_5'Flank|MIER1_uc001dde.2_5'Flank	NM_024763	NP_079039	Q5VTH9	WDR78_HUMAN	WD repeat domain 78 isoform 1	13										ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	67390477	67390477	17901	1	G	C	C	42	42	WDR78	C	3	3
LRRC7	57554	broad.mit.edu	37	1	70477575	70477575	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70477575T>C	uc001dep.2	+	10	1016	c.986T>C	c.(985-987)GTT>GCT	p.V329A	LRRC7_uc009wbg.2_5'UTR	NM_020794	NP_065845	Q96NW7	LRRC7_HUMAN	leucine rich repeat containing 7	329	LRR 14.					centrosome|focal adhesion|nucleolus	protein binding			ovary(9)|breast(2)|central_nervous_system(2)|liver(1)	14																		---	---	---	---	capture		Missense_Mutation	SNP	70477575	70477575	9396	1	T	C	C	60	60	LRRC7	C	4	4
NEGR1	257194	broad.mit.edu	37	1	72241934	72241934	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:72241934T>A	uc001dfw.2	-	3	556	c.456A>T	c.(454-456)GAA>GAT	p.E152D	NEGR1_uc001dfv.2_Missense_Mutation_p.E24D|NEGR1_uc010oqs.1_Missense_Mutation_p.E152D	NM_173808	NP_776169	Q7Z3B1	NEGR1_HUMAN	neuronal growth regulator 1 precursor	152	Ig-like C2-type 2.				cell adhesion	anchored to membrane|plasma membrane				ovary(1)	1		all_cancers(4;1.26e-06)|Renal(4;1.32e-08)|all_epithelial(4;5.39e-07)|Hepatocellular(141;0.117)		KIRC - Kidney renal clear cell carcinoma(4;0.00529)|Kidney(4;0.00609)|all cancers(265;0.022)|GBM - Glioblastoma multiforme(62;0.0382)|Epithelial(280;0.242)														---	---	---	---	capture		Missense_Mutation	SNP	72241934	72241934	10716	1	T	A	A	56	56	NEGR1	A	4	4
LRRIQ3	127255	broad.mit.edu	37	1	74507259	74507259	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:74507259T>C	uc001dfy.3	-	7	1548	c.1356A>G	c.(1354-1356)AGA>AGG	p.R452R	LRRIQ3_uc001dfz.3_Intron	NM_001105659	NP_001099129	A6PVS8	LRIQ3_HUMAN	leucine-rich repeats and IQ motif containing 3	452										ovary(2)	2																		---	---	---	---	capture		Silent	SNP	74507259	74507259	9406	1	T	C	C	54	54	LRRIQ3	C	4	4
FPGT	8790	broad.mit.edu	37	1	74671168	74671168	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:74671168G>C	uc001dgb.1	+	4	1474	c.1437G>C	c.(1435-1437)AAG>AAC	p.K479N	TNNI3K_uc001dgc.1_Intron|TNNI3K_uc001dgd.2_Intron|TNNI3K_uc001dge.1_Intron|FPGT_uc010oqt.1_Missense_Mutation_p.K104N|FPGT_uc010oqu.1_Missense_Mutation_p.K225N|FPGT_uc010oqv.1_Intron	NM_003838	NP_003829	O14772	FPGT_HUMAN	fucose-1-phosphate guanyltransferase	479					fucose metabolic process	cytoplasm	fucose-1-phosphate guanylyltransferase activity|GTP binding			skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	74671168	74671168	6283	1	G	C	C	33	33	FPGT	C	3	3
MCOLN3	55283	broad.mit.edu	37	1	85486931	85486931	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85486931C>A	uc001dkp.2	-	12	1442	c.1349G>T	c.(1348-1350)TGC>TTC	p.C450F	MCOLN3_uc001dko.2_Missense_Mutation_p.C69F|MCOLN3_uc001dkq.2_Missense_Mutation_p.C394F	NM_018298	NP_060768	Q8TDD5	MCLN3_HUMAN	mucolipin 3	450						integral to membrane	ion channel activity			skin(1)	1				all cancers(265;0.00957)|Epithelial(280;0.0254)														---	---	---	---	capture		Missense_Mutation	SNP	85486931	85486931	9786	1	C	A	A	25	25	MCOLN3	A	2	2
COL24A1	255631	broad.mit.edu	37	1	86590593	86590593	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86590593C>T	uc001dlj.2	-	3	1468	c.1426G>A	c.(1426-1428)GAG>AAG	p.E476K	COL24A1_uc010osd.1_5'UTR|COL24A1_uc001dlk.2_RNA|COL24A1_uc010ose.1_RNA|COL24A1_uc010osf.1_RNA|COL24A1_uc009wcq.2_Missense_Mutation_p.E476K	NM_152890	NP_690850	Q17RW2	COOA1_HUMAN	collagen, type XXIV, alpha 1 precursor	476					cell adhesion	collagen	extracellular matrix structural constituent			ovary(3)|central_nervous_system(1)|skin(1)	5				all cancers(265;0.0627)|Epithelial(280;0.0689)														---	---	---	---	capture		Missense_Mutation	SNP	86590593	86590593	3821	1	C	T	T	29	29	COL24A1	T	2	2
GBP4	115361	broad.mit.edu	37	1	89654377	89654377	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:89654377G>A	uc001dnb.2	-	8	1414	c.1298C>T	c.(1297-1299)ACA>ATA	p.T433I		NM_052941	NP_443173	Q96PP9	GBP4_HUMAN	guanylate binding protein 4	433						cytoplasm	GTP binding|GTPase activity				0				all cancers(265;0.00723)|Epithelial(280;0.0291)														---	---	---	---	capture		Missense_Mutation	SNP	89654377	89654377	6542	1	G	A	A	48	48	GBP4	A	2	2
ABCA4	24	broad.mit.edu	37	1	94502704	94502704	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:94502704T>A	uc001dqh.2	-	25	3914	c.3810A>T	c.(3808-3810)GAA>GAT	p.E1270D		NM_000350	NP_000341	P78363	ABCA4_HUMAN	ATP-binding cassette, sub-family A member 4	1270	Cytoplasmic.				phototransduction, visible light|visual perception	integral to plasma membrane|membrane fraction	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(4)|skin(4)|central_nervous_system(2)|upper_aerodigestive_tract(1)|breast(1)	12		all_lung(203;0.000757)|Lung NSC(277;0.00335)		all cancers(265;0.00432)|GBM - Glioblastoma multiforme(16;0.00715)|Epithelial(280;0.171)														---	---	---	---	capture		Missense_Mutation	SNP	94502704	94502704	35	1	T	A	A	56	56	ABCA4	A	4	4
LPPR4	9890	broad.mit.edu	37	1	99771402	99771402	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:99771402C>T	uc001dse.2	+	7	1234	c.1128C>T	c.(1126-1128)CTC>CTT	p.L376L	LPPR4_uc010oue.1_Silent_p.L318L	NM_014839	NP_055654	Q7Z2D5	LPPR4_HUMAN	plasticity related gene 1	376							phosphatidate phosphatase activity			ovary(3)	3		all_epithelial(167;3.54e-06)|all_lung(203;0.00139)|Lung NSC(277;0.00202)		Epithelial(280;0.0736)|all cancers(265;0.0975)|COAD - Colon adenocarcinoma(174;0.142)|Lung(183;0.201)|Colorectal(170;0.22)														---	---	---	---	capture		Silent	SNP	99771402	99771402	9300	1	C	T	T	29	29	LPPR4	T	2	2
OLFM3	118427	broad.mit.edu	37	1	102270177	102270177	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:102270177C>T	uc001duf.2	-	6	1125	c.1054G>A	c.(1054-1056)GAT>AAT	p.D352N	OLFM3_uc001dug.2_Missense_Mutation_p.D332N|OLFM3_uc001duh.2_RNA|OLFM3_uc001dui.2_RNA|OLFM3_uc001duj.2_Missense_Mutation_p.D257N|OLFM3_uc001due.2_RNA	NM_058170	NP_477518	Q96PB7	NOE3_HUMAN	olfactomedin 3	352	Olfactomedin-like.					extracellular region				ovary(2)|skin(1)	3		all_epithelial(167;1.87e-06)|all_lung(203;8.12e-05)|Lung NSC(277;0.000189)		all cancers(265;0.0843)|Epithelial(280;0.0921)|COAD - Colon adenocarcinoma(174;0.145)														---	---	---	---	capture		Missense_Mutation	SNP	102270177	102270177	11259	1	C	T	T	29	29	OLFM3	T	2	2
OLFM3	118427	broad.mit.edu	37	1	102302551	102302551	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:102302551C>A	uc001duf.2	-	2	231	c.160G>T	c.(160-162)GTG>TTG	p.V54L	OLFM3_uc001dug.2_Missense_Mutation_p.V34L|OLFM3_uc001duh.2_RNA|OLFM3_uc001dui.2_RNA|OLFM3_uc001duj.2_5'UTR|OLFM3_uc001due.2_RNA	NM_058170	NP_477518	Q96PB7	NOE3_HUMAN	olfactomedin 3	54						extracellular region				ovary(2)|skin(1)	3		all_epithelial(167;1.87e-06)|all_lung(203;8.12e-05)|Lung NSC(277;0.000189)		all cancers(265;0.0843)|Epithelial(280;0.0921)|COAD - Colon adenocarcinoma(174;0.145)														---	---	---	---	capture		Missense_Mutation	SNP	102302551	102302551	11259	1	C	A	A	18	18	OLFM3	A	2	2
COL11A1	1301	broad.mit.edu	37	1	103352543	103352543	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103352543C>A	uc001dul.2	-	63	4996	c.4678G>T	c.(4678-4680)GGC>TGC	p.G1560C	COL11A1_uc001duk.2_Missense_Mutation_p.G756C|COL11A1_uc001dum.2_Missense_Mutation_p.G1572C|COL11A1_uc001dun.2_Missense_Mutation_p.G1521C|COL11A1_uc009weh.2_Missense_Mutation_p.G1444C	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	1560	Nonhelical region (C-terminal).				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)														---	---	---	---	capture		Missense_Mutation	SNP	103352543	103352543	3805	1	C	A	A	24	24	COL11A1	A	2	2
COL11A1	1301	broad.mit.edu	37	1	103428220	103428220	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103428220C>T	uc001dul.2	-	39	3331	c.3013G>A	c.(3013-3015)GAA>AAA	p.E1005K	COL11A1_uc001duk.2_Missense_Mutation_p.E201K|COL11A1_uc001dum.2_Missense_Mutation_p.E1017K|COL11A1_uc001dun.2_Missense_Mutation_p.E966K|COL11A1_uc009weh.2_Missense_Mutation_p.E889K	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	1005	Triple-helical region.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)														---	---	---	---	capture		Missense_Mutation	SNP	103428220	103428220	3805	1	C	T	T	32	32	COL11A1	T	2	2
COL11A1	1301	broad.mit.edu	37	1	103453221	103453221	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103453221C>A	uc001dul.2	-	30	2788	c.2470G>T	c.(2470-2472)GAC>TAC	p.D824Y	COL11A1_uc001duk.2_Missense_Mutation_p.E14D|COL11A1_uc001dum.2_Missense_Mutation_p.D836Y|COL11A1_uc001dun.2_Missense_Mutation_p.D785Y|COL11A1_uc009weh.2_Missense_Mutation_p.D708Y	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	824	Triple-helical region.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)														---	---	---	---	capture		Missense_Mutation	SNP	103453221	103453221	3805	1	C	A	A	32	32	COL11A1	A	2	2
CELSR2	1952	broad.mit.edu	37	1	109803812	109803812	+	Silent	SNP	G	T	T	rs148583272		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109803812G>T	uc001dxa.3	+	3	4168	c.4107G>T	c.(4105-4107)ACG>ACT	p.T1369T		NM_001408	NP_001399	Q9HCU4	CELR2_HUMAN	cadherin EGF LAG seven-pass G-type receptor 2	1369	Extracellular (Potential).|Laminin G-like 1.				dendrite morphogenesis|homophilic cell adhesion|neural plate anterior/posterior regionalization|neuropeptide signaling pathway|regulation of cell-cell adhesion|regulation of transcription, DNA-dependent|Wnt receptor signaling pathway	cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(4)|lung(3)|skin(1)	8		all_epithelial(167;0.000114)|all_lung(203;0.000321)|Lung NSC(277;0.000626)|Breast(1374;0.244)		Colorectal(144;0.0296)|Lung(183;0.067)|COAD - Colon adenocarcinoma(174;0.114)|Epithelial(280;0.193)|all cancers(265;0.219)														---	---	---	---	capture		Silent	SNP	109803812	109803812	3355	1	G	T	T	38	38	CELSR2	T	1	1
KCNA3	3738	broad.mit.edu	37	1	111216168	111216168	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:111216168C>T	uc001dzv.1	-	1	1488	c.1264G>A	c.(1264-1266)GAC>AAC	p.D422N		NM_002232	NP_002223	P22001	KCNA3_HUMAN	potassium voltage-gated channel, shaker-related	422						voltage-gated potassium channel complex	delayed rectifier potassium channel activity			ovary(4)|pancreas(1)	5		all_cancers(81;3.92e-06)|all_epithelial(167;1.28e-05)|all_lung(203;0.000199)|Lung NSC(277;0.000398)		Lung(183;0.0235)|Colorectal(144;0.0306)|all cancers(265;0.0752)|Epithelial(280;0.0821)|COAD - Colon adenocarcinoma(174;0.132)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---	capture		Missense_Mutation	SNP	111216168	111216168	8309	1	C	T	T	32	32	KCNA3	T	2	2
RSBN1	54665	broad.mit.edu	37	1	114308797	114308797	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:114308797C>A	uc001edq.2	-	7	2250	c.2214G>T	c.(2212-2214)AGG>AGT	p.R738S	RSBN1_uc001edr.2_RNA	NM_018364	NP_060834	Q5VWQ0	RSBN1_HUMAN	round spermatid basic protein 1	738						nucleus				ovary(1)	1	Lung SC(450;0.184)	all_cancers(81;3.78e-08)|all_epithelial(167;5.56e-08)|all_lung(203;6.97e-06)|Lung NSC(69;1.18e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---	capture		Missense_Mutation	SNP	114308797	114308797	14176	1	C	A	A	30	30	RSBN1	A	2	2
RSBN1	54665	broad.mit.edu	37	1	114310948	114310948	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:114310948G>C	uc001edq.2	-	5	1758	c.1722C>G	c.(1720-1722)CTC>CTG	p.L574L	RSBN1_uc001edr.2_RNA	NM_018364	NP_060834	Q5VWQ0	RSBN1_HUMAN	round spermatid basic protein 1	574						nucleus				ovary(1)	1	Lung SC(450;0.184)	all_cancers(81;3.78e-08)|all_epithelial(167;5.56e-08)|all_lung(203;6.97e-06)|Lung NSC(69;1.18e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---	capture		Silent	SNP	114310948	114310948	14176	1	G	C	C	33	33	RSBN1	C	3	3
TRIM33	51592	broad.mit.edu	37	1	114970445	114970445	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:114970445C>T	uc001eew.2	-	7	1311	c.1227G>A	c.(1225-1227)GTG>GTA	p.V409V	TRIM33_uc010owr.1_Silent_p.V17V|TRIM33_uc010ows.1_Silent_p.V17V|TRIM33_uc001eex.2_Silent_p.V409V	NM_015906	NP_056990	Q9UPN9	TRI33_HUMAN	tripartite motif-containing 33 protein isoform	409					negative regulation of BMP signaling pathway|negative regulation of transcription, DNA-dependent|protein ubiquitination|regulation of transforming growth factor beta receptor signaling pathway|transcription, DNA-dependent	nucleus	co-SMAD binding|DNA binding|ligase activity|R-SMAD binding|zinc ion binding			lung(4)|central_nervous_system(3)|large_intestine(1)|breast(1)|skin(1)|ovary(1)	11	all_epithelial(7;0.000132)|all_lung(7;0.00106)|Lung SC(450;0.184)	all_cancers(81;3.03e-08)|all_epithelial(167;3.24e-08)|all_lung(203;9.97e-06)|Lung NSC(69;1.74e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|all cancers(265;0.112)|Epithelial(280;0.124)|LUSC - Lung squamous cell carcinoma(189;0.133)				T	RET	papillary thyroid								---	---	---	---	capture		Silent	SNP	114970445	114970445	17051	1	C	T	T	29	29	TRIM33	T	2	2
NOTCH2	4853	broad.mit.edu	37	1	120509091	120509091	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:120509091T>C	uc001eik.2	-	9	1731	c.1475A>G	c.(1474-1476)GAA>GGA	p.E492G	NOTCH2_uc001eil.2_Missense_Mutation_p.E492G|NOTCH2_uc001eim.3_Missense_Mutation_p.E409G	NM_024408	NP_077719	Q04721	NOTC2_HUMAN	notch 2 preproprotein	492	Extracellular (Potential).|EGF-like 12; calcium-binding (Potential).				anti-apoptosis|bone remodeling|cell cycle arrest|cell fate determination|cell growth|hemopoiesis|induction of apoptosis|negative regulation of cell proliferation|nervous system development|Notch receptor processing|Notch signaling pathway|organ morphogenesis|positive regulation of Ras protein signal transduction|regulation of transcription, DNA-dependent|stem cell maintenance|transcription, DNA-dependent	cell surface|cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to plasma membrane|nucleoplasm	calcium ion binding|ligand-regulated transcription factor activity|protein binding|receptor activity			lung(8)|haematopoietic_and_lymphoid_tissue(7)|ovary(4)|central_nervous_system(2)|skin(2)|kidney(2)|breast(1)|prostate(1)	27	all_neural(166;0.153)	all_lung(203;1.96e-06)|Lung NSC(69;1.47e-05)|all_epithelial(167;0.000809)		Lung(183;0.0242)|LUSC - Lung squamous cell carcinoma(189;0.133)				N|F|Mis		marginal zone lymphoma|DLBCL				Alagille_Syndrome				---	---	---	---	capture		Missense_Mutation	SNP	120509091	120509091	10951	1	T	C	C	62	62	NOTCH2	C	4	4
HFE2	148738	broad.mit.edu	37	1	145415320	145415320	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145415320G>C	uc001eni.2	+	3	464	c.139G>C	c.(139-141)GTA>CTA	p.V47L	NBPF10_uc001emp.3_Intron|HFE2_uc001enj.2_Intron|HFE2_uc001enk.2_5'UTR|HFE2_uc001enl.2_Intron	NM_213653	NP_998818	Q6ZVN8	RGMC_HUMAN	hemojuvelin isoform a precursor	47					axon guidance	anchored to membrane				ovary(1)	1	all_hematologic(18;0.0187)|Acute lymphoblastic leukemia(18;0.0786)																	---	---	---	---	capture		Missense_Mutation	SNP	145415320	145415320	7365	1	G	C	C	40	40	HFE2	C	3	3
BCL9	607	broad.mit.edu	37	1	147084987	147084987	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:147084987C>G	uc001epq.2	+	5	1099	c.359C>G	c.(358-360)TCT>TGT	p.S120C	BCL9_uc010ozr.1_Intron	NM_004326	NP_004317	O00512	BCL9_HUMAN	B-cell CLL/lymphoma 9	120					Wnt receptor signaling pathway	nucleus	protein binding			ovary(2)|large_intestine(2)|breast(1)|skin(1)	6	all_hematologic(923;0.115)							T	IGH@|IGL@	B-ALL								---	---	---	---	capture		Missense_Mutation	SNP	147084987	147084987	1402	1	C	G	G	32	32	BCL9	G	3	3
TCHHL1	126637	broad.mit.edu	37	1	152058373	152058373	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152058373C>T	uc001ezo.1	-	3	1850	c.1785G>A	c.(1783-1785)CAG>CAA	p.Q595Q		NM_001008536	NP_001008536	Q5QJ38	TCHL1_HUMAN	trichohyalin-like 1	595							calcium ion binding			ovary(1)|skin(1)	2	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.246)															---	---	---	---	capture		Silent	SNP	152058373	152058373	16227	1	C	T	T	32	32	TCHHL1	T	2	2
RPTN	126638	broad.mit.edu	37	1	152129161	152129161	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152129161C>T	uc001ezs.1	-	3	479	c.414G>A	c.(412-414)GAG>GAA	p.E138E		NM_001122965	NP_001116437	Q6XPR3	RPTN_HUMAN	repetin	138	Gln-rich.					proteinaceous extracellular matrix	calcium ion binding				0																		---	---	---	---	capture		Silent	SNP	152129161	152129161	14144	1	C	T	T	32	32	RPTN	T	2	2
TDRD10	126668	broad.mit.edu	37	1	154515264	154515264	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154515264G>T	uc009wow.2	+	8	1308	c.470G>T	c.(469-471)AGG>ATG	p.R157M	TDRD10_uc001ffd.2_Missense_Mutation_p.R157M|TDRD10_uc001ffe.2_Missense_Mutation_p.R78M	NM_001098475	NP_001091945	Q5VZ19	TDR10_HUMAN	tudor domain containing 10 isoform a	157							nucleotide binding|RNA binding			ovary(1)	1	all_lung(78;1.72e-29)|Lung NSC(65;2.96e-27)|Hepatocellular(266;0.0877)|all_hematologic(923;0.088)		LUSC - Lung squamous cell carcinoma(543;0.185)															---	---	---	---	capture		Missense_Mutation	SNP	154515264	154515264	16257	1	G	T	T	35	35	TDRD10	T	2	2
SYT11	23208	broad.mit.edu	37	1	155838213	155838213	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155838213A>G	uc001fmg.2	+	2	755	c.492A>G	c.(490-492)TCA>TCG	p.S164S	SYT11_uc010pgq.1_Intron	NM_152280	NP_689493	Q9BT88	SYT11_HUMAN	synaptotagmin XI	164	Cytoplasmic (Potential).					cell junction|synaptic vesicle membrane	protein binding|transporter activity			ovary(1)|skin(1)	2	Hepatocellular(266;0.133)|all_hematologic(923;0.145)|all_neural(408;0.195)		OV - Ovarian serous cystadenocarcinoma(3;0.000162)															---	---	---	---	capture		Silent	SNP	155838213	155838213	15988	1	A	G	G	7	7	SYT11	G	4	4
FCRL3	115352	broad.mit.edu	37	1	157665335	157665335	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:157665335G>A	uc001frb.2	-	8	1487	c.1195C>T	c.(1195-1197)CTG>TTG	p.L399L	FCRL3_uc001fqx.3_RNA|FCRL3_uc001fqy.3_RNA|FCRL3_uc001fqz.3_Silent_p.L399L|FCRL3_uc009wsn.2_RNA|FCRL3_uc009wso.2_RNA|FCRL3_uc001fra.2_Silent_p.L125L|FCRL3_uc001frc.1_Silent_p.L399L	NM_052939	NP_443171	Q96P31	FCRL3_HUMAN	Fc receptor-like 3 precursor	399	Ig-like C2-type 5.|Extracellular (Potential).					integral to membrane|plasma membrane	receptor activity			ovary(3)|breast(1)	4	all_hematologic(112;0.0378)																	---	---	---	---	capture		Silent	SNP	157665335	157665335	6033	1	G	A	A	35	35	FCRL3	A	2	2
CD1C	911	broad.mit.edu	37	1	158259915	158259915	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158259915G>T	uc001fru.2	+	1	353	c.61G>T	c.(61-63)GCA>TCA	p.A21S	CD1C_uc001frv.2_5'Flank	NM_001765	NP_001756	P29017	CD1C_HUMAN	CD1C antigen precursor	21	Extracellular (Potential).				antigen processing and presentation|T cell activation involved in immune response	endosome membrane|integral to plasma membrane	endogenous lipid antigen binding|exogenous lipid antigen binding|glycolipid binding|lipopeptide binding			ovary(2)|skin(1)|pancreas(1)	4	all_hematologic(112;0.0378)																	---	---	---	---	capture		Missense_Mutation	SNP	158259915	158259915	3103	1	G	T	T	39	39	CD1C	T	1	1
SPTA1	6708	broad.mit.edu	37	1	158592826	158592826	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158592826C>G	uc001fst.1	-	43	6266	c.6067G>C	c.(6067-6069)GCC>CCC	p.A2023P		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	2023	Spectrin 19.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)																	---	---	---	---	capture		Missense_Mutation	SNP	158592826	158592826	15630	1	C	G	G	28	28	SPTA1	G	3	3
SPTA1	6708	broad.mit.edu	37	1	158615329	158615329	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158615329C>A	uc001fst.1	-	28	4151	c.3952G>T	c.(3952-3954)GCC>TCC	p.A1318S		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	1318	Spectrin 13.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)																	---	---	---	---	capture		Missense_Mutation	SNP	158615329	158615329	15630	1	C	A	A	26	26	SPTA1	A	2	2
SPTA1	6708	broad.mit.edu	37	1	158624460	158624460	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158624460G>T	uc001fst.1	-	21	3176	c.2977C>A	c.(2977-2979)CCC>ACC	p.P993T		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	993	SH3.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)																	---	---	---	---	capture		Missense_Mutation	SNP	158624460	158624460	15630	1	G	T	T	43	43	SPTA1	T	2	2
SPTA1	6708	broad.mit.edu	37	1	158648259	158648259	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158648259G>T	uc001fst.1	-	6	943	c.744C>A	c.(742-744)CGC>CGA	p.R248R		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	248	Spectrin 3.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)																	---	---	---	---	capture		Silent	SNP	158648259	158648259	15630	1	G	T	T	42	42	SPTA1	T	2	2
OR6N2	81442	broad.mit.edu	37	1	158747070	158747070	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158747070G>T	uc010pir.1	-	1	356	c.356C>A	c.(355-357)GCC>GAC	p.A119D		NM_001005278	NP_001005278	Q8NGY6	OR6N2_HUMAN	olfactory receptor, family 6, subfamily N,	119	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_hematologic(112;0.0378)																	---	---	---	---	capture		Missense_Mutation	SNP	158747070	158747070	11617	1	G	T	T	42	42	OR6N2	T	2	2
MNDA	4332	broad.mit.edu	37	1	158813875	158813875	+	Missense_Mutation	SNP	C	A	A	rs148142374	byFrequency;by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158813875C>A	uc001fsz.1	+	4	733	c.533C>A	c.(532-534)ACC>AAC	p.T178N		NM_002432	NP_002423	P41218	MNDA_HUMAN	myeloid cell nuclear differentiation antigen	178					B cell receptor signaling pathway|cellular defense response|negative regulation of B cell proliferation|positive regulation of apoptosis|regulation of transcription, DNA-dependent|response to DNA damage stimulus|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding			ovary(2)|skin(2)	4	all_hematologic(112;0.0378)																	---	---	---	---	capture		Missense_Mutation	SNP	158813875	158813875	10067	1	C	A	A	18	18	MNDA	A	2	2
ITLN2	142683	broad.mit.edu	37	1	160920953	160920953	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160920953C>A	uc001fxd.2	-	4	379	c.321G>T	c.(319-321)ACG>ACT	p.T107T	ITLN2_uc009wts.2_Silent_p.T106T|ITLN2_uc010pju.1_Silent_p.T24T	NM_080878	NP_543154	Q8WWU7	ITLN2_HUMAN	intelectin 2 precursor	107	Fibrinogen C-terminal.				signal transduction	extracellular region	receptor binding|sugar binding			ovary(1)	1	all_cancers(52;2.99e-17)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00275)															---	---	---	---	capture		Silent	SNP	160920953	160920953	8215	1	C	A	A	23	23	ITLN2	A	1	1
OLFML2B	25903	broad.mit.edu	37	1	161967803	161967803	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161967803G>A	uc001gbu.2	-	6	1710	c.1286C>T	c.(1285-1287)CCA>CTA	p.P429L	OLFML2B_uc010pkq.1_Missense_Mutation_p.P430L	NM_015441	NP_056256	Q68BL8	OLM2B_HUMAN	olfactomedin-like 2B precursor	429										skin(1)	1	all_hematologic(112;0.156)		BRCA - Breast invasive adenocarcinoma(70;0.0172)															---	---	---	---	capture		Missense_Mutation	SNP	161967803	161967803	11263	1	G	A	A	47	47	OLFML2B	A	2	2
PBX1	5087	broad.mit.edu	37	1	164776878	164776878	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:164776878G>T	uc001gct.2	+	5	1059	c.801G>T	c.(799-801)GAG>GAT	p.E267D	PBX1_uc010pku.1_Missense_Mutation_p.E267D|PBX1_uc010pkv.1_Missense_Mutation_p.E184D|PBX1_uc001gcs.2_Missense_Mutation_p.E267D|PBX1_uc010pkw.1_Missense_Mutation_p.E157D	NM_002585	NP_002576	P40424	PBX1_HUMAN	pre-B-cell leukemia homeobox 1	267	Homeobox; TALE-type.				negative regulation of sequence-specific DNA binding transcription factor activity|sex differentiation|steroid biosynthetic process	cytoplasm|nucleus	sequence-specific DNA binding transcription factor activity|transcription factor binding		EWSR1/PBX1(3)	soft_tissue(3)|lung(1)|skin(1)	5								T	TCF3|EWSR1	pre B-ALL|myoepithelioma								---	---	---	---	capture		Missense_Mutation	SNP	164776878	164776878	11912	1	G	T	T	35	35	PBX1	T	2	2
ILDR2	387597	broad.mit.edu	37	1	166891994	166891994	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:166891994G>A	uc001gdx.1	-	8	1103	c.1047C>T	c.(1045-1047)TTC>TTT	p.F349F		NM_199351	NP_955383	Q71H61	ILDR2_HUMAN	immunoglobulin-like domain containing receptor	349	Cytoplasmic (Potential).					integral to membrane				ovary(1)	1																		---	---	---	---	capture		Silent	SNP	166891994	166891994	8011	1	G	A	A	41	41	ILDR2	A	2	2
C1orf9	51430	broad.mit.edu	37	1	172520690	172520690	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:172520690C>T	uc001giq.3	+	2	417	c.101C>T	c.(100-102)TCA>TTA	p.S34L	C1orf9_uc010pmm.1_Missense_Mutation_p.S34L|C1orf9_uc009wwd.2_Missense_Mutation_p.S34L|C1orf9_uc010pmn.1_Missense_Mutation_p.S34L|C1orf9_uc010pmo.1_RNA	NM_014283	NP_055098	Q9UBS9	OSPT_HUMAN	chromosome 1 open reading frame 9 protein	34					multicellular organismal development|ossification	integral to membrane|rough endoplasmic reticulum membrane				ovary(2)	2		Breast(1374;0.212)		Colorectal(1306;3.98e-05)|KIRC - Kidney renal clear cell carcinoma(1967;0.00544)														---	---	---	---	capture		Missense_Mutation	SNP	172520690	172520690	2143	1	C	T	T	29	29	C1orf9	T	2	2
SLC9A11	284525	broad.mit.edu	37	1	173503744	173503744	+	Missense_Mutation	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173503744A>C	uc001giz.2	-	16	2276	c.1853T>G	c.(1852-1854)TTG>TGG	p.L618W	SLC9A11_uc009wwe.2_Missense_Mutation_p.L176W|SLC9A11_uc010pmq.1_Intron	NM_178527	NP_848622	Q5TAH2	S9A11_HUMAN	solute carrier family 9, member 11	618	Helical; (Potential).				sodium ion transport	integral to membrane	ion channel activity|solute:hydrogen antiporter activity			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	173503744	173503744	15208	1	A	C	C	5	5	SLC9A11	C	4	4
SERPINC1	462	broad.mit.edu	37	1	173881102	173881102	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173881102G>C	uc001gjt.2	-	3	578	c.459C>G	c.(457-459)TTC>TTG	p.F153L		NM_000488	NP_000479	P01008	ANT3_HUMAN	serpin peptidase inhibitor, clade C, member 1	153			Missing (in AT3D; type-I).|Missing (in AT3D; type-I).		blood coagulation|regulation of proteolysis	extracellular space|plasma membrane	heparin binding|protease binding|serine-type endopeptidase inhibitor activity			ovary(1)	1					Enoxaparin(DB01225)|Fondaparinux sodium(DB00569)|Heparin(DB01109)													---	---	---	---	capture		Missense_Mutation	SNP	173881102	173881102	14597	1	G	C	C	33	33	SERPINC1	C	3	3
TNR	7143	broad.mit.edu	37	1	175372675	175372675	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:175372675C>A	uc001gkp.1	-	2	658	c.577G>T	c.(577-579)GGC>TGC	p.G193C	TNR_uc009wwu.1_Missense_Mutation_p.G193C|TNR_uc010pmz.1_Missense_Mutation_p.G193C	NM_003285	NP_003276	Q92752	TENR_HUMAN	tenascin R precursor	193	EGF-like 1.|Cys-rich.				axon guidance|cell adhesion|signal transduction	proteinaceous extracellular matrix				pancreas(5)|ovary(4)|central_nervous_system(1)|skin(1)	11	Renal(580;0.146)																	---	---	---	---	capture		Missense_Mutation	SNP	175372675	175372675	16879	1	C	A	A	24	24	TNR	A	2	2
TNR	7143	broad.mit.edu	37	1	175375662	175375662	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:175375662C>A	uc001gkp.1	-	1	270	c.189G>T	c.(187-189)GTG>GTT	p.V63V	TNR_uc009wwu.1_Silent_p.V63V|TNR_uc010pmz.1_Silent_p.V63V	NM_003285	NP_003276	Q92752	TENR_HUMAN	tenascin R precursor	63					axon guidance|cell adhesion|signal transduction	proteinaceous extracellular matrix				pancreas(5)|ovary(4)|central_nervous_system(1)|skin(1)	11	Renal(580;0.146)																	---	---	---	---	capture		Silent	SNP	175375662	175375662	16879	1	C	A	A	21	21	TNR	A	2	2
PAPPA2	60676	broad.mit.edu	37	1	176760590	176760590	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:176760590G>T	uc001gkz.2	+	19	6156	c.4992G>T	c.(4990-4992)GAG>GAT	p.E1664D	PAPPA2_uc009www.2_RNA	NM_020318	NP_064714	Q9BXP8	PAPP2_HUMAN	pappalysin 2 isoform 1	1664	Sushi 5.				cell differentiation|proteolysis|regulation of cell growth	extracellular region|intracellular|membrane	metalloendopeptidase activity|zinc ion binding			ovary(7)|central_nervous_system(5)|skin(2)|lung(1)|breast(1)	16																		---	---	---	---	capture		Missense_Mutation	SNP	176760590	176760590	11850	1	G	T	T	36	36	PAPPA2	T	2	2
CEP350	9857	broad.mit.edu	37	1	180062650	180062650	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:180062650C>T	uc001gnt.2	+	34	7793	c.7410C>T	c.(7408-7410)CGC>CGT	p.R2470R	CEP350_uc009wxl.2_Silent_p.R2469R|CEP350_uc001gnv.2_Silent_p.R605R|CEP350_uc001gnw.1_Silent_p.R227R|CEP350_uc001gnx.1_Silent_p.R227R	NM_014810	NP_055625	Q5VT06	CE350_HUMAN	centrosome-associated protein 350	2470						centrosome|nucleus|spindle				ovary(4)	4																		---	---	---	---	capture		Silent	SNP	180062650	180062650	3387	1	C	T	T	25	25	CEP350	T	2	2
QSOX1	5768	broad.mit.edu	37	1	180163490	180163490	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:180163490C>T	uc001gnz.2	+	11	1506	c.1431C>T	c.(1429-1431)CTC>CTT	p.L477L	QSOX1_uc001gny.2_Silent_p.L477L|QSOX1_uc001goa.2_Silent_p.L477L|QSOX1_uc001goc.2_Silent_p.L19L	NM_002826	NP_002817	O00391	QSOX1_HUMAN	quiescin Q6 sulfhydryl oxidase 1 isoform a	477	ERV/ALR sulfhydryl oxidase.				cell redox homeostasis|protein thiol-disulfide exchange	extracellular space|integral to Golgi membrane	flavin-linked sulfhydryl oxidase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	180163490	180163490	13341	1	C	T	T	32	32	QSOX1	T	2	2
CACNA1E	777	broad.mit.edu	37	1	181549846	181549846	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:181549846C>A	uc001gow.2	+	6	1050	c.885C>A	c.(883-885)ATC>ATA	p.I295I	CACNA1E_uc009wxr.2_Silent_p.I202I|CACNA1E_uc009wxs.2_Silent_p.I202I	NM_000721	NP_000712	Q15878	CAC1E_HUMAN	calcium channel, voltage-dependent, R type,	295	I.|Extracellular (Potential).				energy reserve metabolic process|membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	voltage-gated calcium channel activity			ovary(3)|central_nervous_system(2)|pancreas(1)	6																		---	---	---	---	capture		Silent	SNP	181549846	181549846	2658	1	C	A	A	30	30	CACNA1E	A	2	2
GLT25D2	23127	broad.mit.edu	37	1	183907946	183907946	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183907946G>A	uc001gqr.2	-	12	2202	c.1830C>T	c.(1828-1830)GCC>GCT	p.A610A	GLT25D2_uc010poj.1_Intron|GLT25D2_uc001gqp.2_Silent_p.A218A|GLT25D2_uc001gqq.2_Silent_p.A347A|GLT25D2_uc001gqs.2_Silent_p.A490A	NM_015101	NP_055916	Q8IYK4	GT252_HUMAN	glycosyltransferase 25 domain containing 2	610					lipopolysaccharide biosynthetic process	endoplasmic reticulum lumen	procollagen galactosyltransferase activity			ovary(1)|breast(1)	2																		---	---	---	---	capture		Silent	SNP	183907946	183907946	6735	1	G	A	A	43	43	GLT25D2	A	2	2
FAM129A	116496	broad.mit.edu	37	1	184764780	184764780	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:184764780C>A	uc001gra.2	-	14	2312	c.2118G>T	c.(2116-2118)TCG>TCT	p.S706S	FAM129A_uc001grb.1_Intron	NM_052966	NP_443198	Q9BZQ8	NIBAN_HUMAN	niban protein isoform 2	706	Glu-rich.				negative regulation of protein phosphorylation|positive regulation of protein phosphorylation|positive regulation of translation|response to endoplasmic reticulum stress	cytoplasm|nucleus|plasma membrane				ovary(3)|skin(1)	4																		---	---	---	---	capture		Silent	SNP	184764780	184764780	5633	1	C	A	A	23	23	FAM129A	A	1	1
HMCN1	83872	broad.mit.edu	37	1	186010270	186010270	+	Splice_Site	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186010270T>C	uc001grq.1	+	40	6533	c.6304_splice	c.e40+2	p.V2102_splice		NM_031935	NP_114141			hemicentin 1 precursor						response to stimulus|visual perception	basement membrane	calcium ion binding			ovary(22)|skin(1)	23																		---	---	---	---	capture		Splice_Site	SNP	186010270	186010270	7511	1	T	C	C	59	59	HMCN1	C	5	4
HMCN1	83872	broad.mit.edu	37	1	186099657	186099657	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186099657G>T	uc001grq.1	+	85	13287	c.13058G>T	c.(13057-13059)GGT>GTT	p.G4353V	HMCN1_uc001grs.1_5'UTR	NM_031935	NP_114141	Q96RW7	HMCN1_HUMAN	hemicentin 1 precursor	4353	Ig-like C2-type 43.				response to stimulus|visual perception	basement membrane	calcium ion binding			ovary(22)|skin(1)	23																		---	---	---	---	capture		Missense_Mutation	SNP	186099657	186099657	7511	1	G	T	T	44	44	HMCN1	T	2	2
TPR	7175	broad.mit.edu	37	1	186326588	186326588	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186326588C>A	uc001grv.2	-	14	1962	c.1665G>T	c.(1663-1665)GTG>GTT	p.V555V	TPR_uc010pop.1_Silent_p.V631V	NM_003292	NP_003283	P12270	TPR_HUMAN	nuclear pore complex-associated protein TPR	555	Potential.				carbohydrate metabolic process|glucose transport|mitotic cell cycle spindle assembly checkpoint|mRNA transport|protein import into nucleus|regulation of glucose transport|seryl-tRNA aminoacylation|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytoplasm|nuclear membrane|nuclear pore|nucleoplasm	ATP binding|protein binding|serine-tRNA ligase activity			ovary(2)|lung(2)|urinary_tract(1)|central_nervous_system(1)|skin(1)	7		Breast(1374;0.000659)|Lung SC(1967;0.0262)|Prostate(1639;0.157)		Colorectal(1306;1.12e-05)|KIRC - Kidney renal clear cell carcinoma(1967;0.00553)				T	NTRK1	papillary thyroid								---	---	---	---	capture		Silent	SNP	186326588	186326588	16960	1	C	A	A	21	21	TPR	A	2	2
PLA2G4A	5321	broad.mit.edu	37	1	186925289	186925289	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186925289G>T	uc001gsc.2	+	14	1597	c.1392G>T	c.(1390-1392)TGG>TGT	p.W464C	PLA2G4A_uc010pos.1_Missense_Mutation_p.W404C	NM_024420	NP_077734	P47712	PA24A_HUMAN	cytosolic phospholipase A2, group IVA	464	PLA2c.				phospholipid catabolic process|platelet activating factor biosynthetic process|platelet activation	cytosol|endoplasmic reticulum membrane	calcium ion binding|calcium-dependent phospholipid binding|lysophospholipase activity			lung(2)|breast(1)	3					Flunisolide(DB00180)|Fluocinolone Acetonide(DB00591)|Fluocinonide(DB01047)|Fluorometholone(DB00324)|Flurandrenolide(DB00846)|Fluticasone Propionate(DB00588)|Medrysone(DB00253)|Quinacrine(DB01103)													---	---	---	---	capture		Missense_Mutation	SNP	186925289	186925289	12427	1	G	T	T	41	41	PLA2G4A	T	2	2
TROVE2	6738	broad.mit.edu	37	1	193038214	193038214	+	Silent	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:193038214A>T	uc001gss.2	+	2	205	c.30A>T	c.(28-30)CCA>CCT	p.P10P	TROVE2_uc001gst.1_Intron|TROVE2_uc001gsu.1_Intron|TROVE2_uc001gsv.1_Silent_p.P10P|TROVE2_uc001gsw.2_Silent_p.P10P|TROVE2_uc009wyp.2_Silent_p.P10P|TROVE2_uc009wyq.2_Silent_p.P10P|TROVE2_uc001gsx.1_Silent_p.P10P	NM_004600	NP_004591	P10155	RO60_HUMAN	TROVE domain family, member 2 isoform 2	10					transcription from RNA polymerase III promoter	cytoplasm|nucleus|ribonucleoprotein complex	protein binding|RNA binding				0																		---	---	---	---	capture		Silent	SNP	193038214	193038214	17127	1	A	T	T	6	6	TROVE2	T	4	4
ASPM	259266	broad.mit.edu	37	1	197112698	197112698	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:197112698G>A	uc001gtu.2	-	3	941	c.684C>T	c.(682-684)TTC>TTT	p.F228F	ASPM_uc001gtv.2_Silent_p.F228F|ASPM_uc001gtw.3_Intron	NM_018136	NP_060606	Q8IZT6	ASPM_HUMAN	asp (abnormal spindle)-like, microcephaly	228					mitosis	cytoplasm|nucleus	calmodulin binding			ovary(4)|central_nervous_system(2)	6																		---	---	---	---	capture		Silent	SNP	197112698	197112698	1075	1	G	A	A	45	45	ASPM	A	2	2
ZC3H11A	9877	broad.mit.edu	37	1	203798581	203798581	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:203798581G>T	uc001hac.2	+	8	917	c.301G>T	c.(301-303)GTG>TTG	p.V101L	ZC3H11A_uc001had.2_Missense_Mutation_p.V101L|ZC3H11A_uc001hae.2_Missense_Mutation_p.V101L|ZC3H11A_uc001haf.2_Missense_Mutation_p.V101L|ZC3H11A_uc010pqm.1_Missense_Mutation_p.V47L|ZC3H11A_uc001hag.1_Missense_Mutation_p.V101L	NM_014827	NP_055642	O75152	ZC11A_HUMAN	zinc finger CCCH-type containing 11A	101							nucleic acid binding|protein binding|zinc ion binding			lung(1)|central_nervous_system(1)	2	all_cancers(21;0.0904)|all_epithelial(62;0.234)		BRCA - Breast invasive adenocarcinoma(75;0.109)															---	---	---	---	capture		Missense_Mutation	SNP	203798581	203798581	18148	1	G	T	T	48	48	ZC3H11A	T	2	2
PPP1R15B	84919	broad.mit.edu	37	1	204380249	204380249	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:204380249T>C	uc001hav.3	-	1	696	c.291A>G	c.(289-291)CTA>CTG	p.L97L		NM_032833	NP_116222	Q5SWA1	PR15B_HUMAN	protein phosphatase 1, regulatory subunit 15B	97					regulation of translation					ovary(1)|pancreas(1)	2	all_cancers(21;0.0032)|all_neural(3;0.0218)|Glioma(3;0.0382)|Breast(84;0.179)|all_epithelial(62;0.193)|Prostate(682;0.227)		all cancers(3;1.14e-29)|KIRC - Kidney renal clear cell carcinoma(13;0.0584)|Kidney(21;0.0934)|BRCA - Breast invasive adenocarcinoma(75;0.139)															---	---	---	---	capture		Silent	SNP	204380249	204380249	12799	1	T	C	C	53	53	PPP1R15B	C	4	4
NFASC	23114	broad.mit.edu	37	1	204924036	204924036	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:204924036C>A	uc001hbj.2	+	7	820	c.492C>A	c.(490-492)CCC>CCA	p.P164P	NFASC_uc001hbh.2_Silent_p.P164P|NFASC_uc010pqz.1_Silent_p.P158P|NFASC_uc010pra.1_Silent_p.P158P|NFASC_uc001hbi.2_Silent_p.P158P|NFASC_uc009xbg.1_Silent_p.P231P|NFASC_uc010prb.1_Silent_p.P158P|NFASC_uc010prc.1_5'UTR|NFASC_uc001hbk.1_5'Flank	NM_001005388	NP_001005388	O94856	NFASC_HUMAN	neurofascin isoform 1 precursor	164	Extracellular (Potential).|Ig-like C2-type 2.				axon guidance|cell adhesion|myelination|peripheral nervous system development	integral to membrane|node of Ranvier|plasma membrane	protein binding			ovary(3)|breast(1)|central_nervous_system(1)|skin(1)	6	all_cancers(21;0.0375)|Breast(84;0.0437)|all_epithelial(62;0.171)|Prostate(682;0.19)		KIRC - Kidney renal clear cell carcinoma(13;0.0584)|Kidney(21;0.0934)|BRCA - Breast invasive adenocarcinoma(75;0.158)															---	---	---	---	capture		Silent	SNP	204924036	204924036	10759	1	C	A	A	22	22	NFASC	A	2	2
LPGAT1	9926	broad.mit.edu	37	1	211952259	211952259	+	Splice_Site	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:211952259C>G	uc001hiu.2	-	6	1667	c.854_splice	c.e6+1	p.R285_splice	LPGAT1_uc001hiv.2_Splice_Site_p.R285_splice	NM_014873	NP_055688			lysophosphatidylglycerol acyltransferase 1						phospholipid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	acyltransferase activity			ovary(1)|skin(1)	2				OV - Ovarian serous cystadenocarcinoma(81;0.00773)|all cancers(67;0.0765)|Epithelial(68;0.114)														---	---	---	---	capture		Splice_Site	SNP	211952259	211952259	9287	1	C	G	G	18	18	LPGAT1	G	5	3
CENPF	1063	broad.mit.edu	37	1	214805946	214805946	+	Splice_Site	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:214805946G>T	uc001hkm.2	+	10	1620	c.1446_splice	c.e10+1	p.E482_splice		NM_016343	NP_057427			centromere protein F						cell differentiation|cell division|cell proliferation|DNA replication|G2 phase of mitotic cell cycle|kinetochore assembly|metaphase plate congression|mitotic cell cycle spindle assembly checkpoint|mitotic prometaphase|muscle organ development|negative regulation of transcription, DNA-dependent|protein transport|regulation of G2/M transition of mitotic cell cycle|regulation of striated muscle tissue development|response to drug	condensed chromosome outer kinetochore|cytosol|midbody|nuclear envelope|nuclear matrix|perinuclear region of cytoplasm|spindle pole	chromatin binding|dynein binding|protein C-terminus binding|protein homodimerization activity|transcription factor binding			ovary(6)|central_nervous_system(4)|large_intestine(2)|skin(1)	13				all cancers(67;0.00836)|OV - Ovarian serous cystadenocarcinoma(81;0.00855)|GBM - Glioblastoma multiforme(131;0.0694)|Epithelial(68;0.0833)														---	---	---	---	capture		Splice_Site	SNP	214805946	214805946	3364	1	G	T	T	44	44	CENPF	T	5	2
CENPF	1063	broad.mit.edu	37	1	214816281	214816281	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:214816281G>T	uc001hkm.2	+	12	4774	c.4600G>T	c.(4600-4602)GAG>TAG	p.E1534*		NM_016343	NP_057427	P49454	CENPF_HUMAN	centromere protein F	1630					cell differentiation|cell division|cell proliferation|DNA replication|G2 phase of mitotic cell cycle|kinetochore assembly|metaphase plate congression|mitotic cell cycle spindle assembly checkpoint|mitotic prometaphase|muscle organ development|negative regulation of transcription, DNA-dependent|protein transport|regulation of G2/M transition of mitotic cell cycle|regulation of striated muscle tissue development|response to drug	condensed chromosome outer kinetochore|cytosol|midbody|nuclear envelope|nuclear matrix|perinuclear region of cytoplasm|spindle pole	chromatin binding|dynein binding|protein C-terminus binding|protein homodimerization activity|transcription factor binding			ovary(6)|central_nervous_system(4)|large_intestine(2)|skin(1)	13				all cancers(67;0.00836)|OV - Ovarian serous cystadenocarcinoma(81;0.00855)|GBM - Glioblastoma multiforme(131;0.0694)|Epithelial(68;0.0833)														---	---	---	---	capture		Nonsense_Mutation	SNP	214816281	214816281	3364	1	G	T	T	41	41	CENPF	T	5	2
USH2A	7399	broad.mit.edu	37	1	215823956	215823956	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:215823956C>T	uc001hku.1	-	65	14708	c.14321G>A	c.(14320-14322)AGC>AAC	p.S4774N		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	4774	Fibronectin type-III 33.|Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---	capture		Missense_Mutation	SNP	215823956	215823956	17598	1	C	T	T	28	28	USH2A	T	2	2
USH2A	7399	broad.mit.edu	37	1	215901539	215901539	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:215901539C>G	uc001hku.1	-	61	12286	c.11899G>C	c.(11899-11901)GAT>CAT	p.D3967H		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	3967	Fibronectin type-III 25.|Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---	capture		Missense_Mutation	SNP	215901539	215901539	17598	1	C	G	G	32	32	USH2A	G	3	3
USH2A	7399	broad.mit.edu	37	1	215990448	215990448	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:215990448G>C	uc001hku.1	-	48	9848	c.9461C>G	c.(9460-9462)GCT>GGT	p.A3154G		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	3154	Extracellular (Potential).|Fibronectin type-III 18.				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---	capture		Missense_Mutation	SNP	215990448	215990448	17598	1	G	C	C	34	34	USH2A	C	3	3
USH2A	7399	broad.mit.edu	37	1	216052200	216052200	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216052200G>C	uc001hku.1	-	42	8851	c.8464C>G	c.(8464-8466)CAG>GAG	p.Q2822E		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	2822	Extracellular (Potential).|Fibronectin type-III 15.				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---	capture		Missense_Mutation	SNP	216052200	216052200	17598	1	G	C	C	45	45	USH2A	C	3	3
USH2A	7399	broad.mit.edu	37	1	216052283	216052283	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216052283A>T	uc001hku.1	-	42	8768	c.8381T>A	c.(8380-8382)GTT>GAT	p.V2794D		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	2794	Fibronectin type-III 14.|Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---	capture		Missense_Mutation	SNP	216052283	216052283	17598	1	A	T	T	2	2	USH2A	T	4	4
USH2A	7399	broad.mit.edu	37	1	216363668	216363668	+	Silent	SNP	T	A	A	rs142068313		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216363668T>A	uc001hku.1	-	20	4680	c.4293A>T	c.(4291-4293)GTA>GTT	p.V1431V	USH2A_uc001hkv.2_Silent_p.V1431V	NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	1431	Extracellular (Potential).|Fibronectin type-III 4.				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---	capture		Silent	SNP	216363668	216363668	17598	1	T	A	A	53	53	USH2A	A	4	4
USH2A	7399	broad.mit.edu	37	1	216595351	216595351	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216595351T>C	uc001hku.1	-	2	715	c.328A>G	c.(328-330)ACA>GCA	p.T110A	USH2A_uc001hkv.2_Missense_Mutation_p.T110A	NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	110	Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---	capture		Missense_Mutation	SNP	216595351	216595351	17598	1	T	C	C	59	59	USH2A	C	4	4
RRP15	51018	broad.mit.edu	37	1	218458684	218458684	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:218458684G>T	uc001hlj.2	+	1	56	c.26G>T	c.(25-27)CGT>CTT	p.R9L		NM_016052	NP_057136	Q9Y3B9	RRP15_HUMAN	ribosomal RNA processing 15 homolog	9						mitochondrion|nucleolus	protein binding				0				all cancers(67;0.0315)|OV - Ovarian serous cystadenocarcinoma(81;0.0411)|GBM - Glioblastoma multiforme(131;0.06)|Epithelial(68;0.248)														---	---	---	---	capture		Missense_Mutation	SNP	218458684	218458684	14167	1	G	T	T	40	40	RRP15	T	1	1
EPRS	2058	broad.mit.edu	37	1	220152881	220152881	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:220152881C>A	uc001hly.1	-	27	4058	c.3788G>T	c.(3787-3789)GGA>GTA	p.G1263V		NM_004446	NP_004437	P07814	SYEP_HUMAN	glutamyl-prolyl tRNA synthetase	1263	Prolyl-tRNA synthetase.				glutamyl-tRNA aminoacylation|prolyl-tRNA aminoacylation|protein complex assembly	cytosol|soluble fraction	ATP binding|glutamate-tRNA ligase activity|proline-tRNA ligase activity|protein binding|RNA binding			ovary(1)|skin(1)	2				GBM - Glioblastoma multiforme(131;0.0735)	L-Glutamic Acid(DB00142)|L-Proline(DB00172)													---	---	---	---	capture		Missense_Mutation	SNP	220152881	220152881	5384	1	C	A	A	30	30	EPRS	A	2	2
ACTA1	58	broad.mit.edu	37	1	229568800	229568800	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229568800G>C	uc001htm.2	-	2	168	c.63C>G	c.(61-63)GCC>GCG	p.A21A		NM_001100	NP_001091	P68133	ACTS_HUMAN	actin, alpha 1, skeletal muscle	21					muscle filament sliding|skeletal muscle fiber development|skeletal muscle thin filament assembly	actin filament|cytosol|stress fiber|striated muscle thin filament	ADP binding|ATP binding|myosin binding|structural constituent of cytoskeleton				0	Breast(184;0.0858)|Ovarian(103;0.103)	Prostate(94;0.167)			Dornase Alfa(DB00003)													---	---	---	---	capture		Silent	SNP	229568800	229568800	192	1	G	C	C	39	39	ACTA1	C	3	3
DISC1	27185	broad.mit.edu	37	1	231885718	231885718	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:231885718C>A	uc001huz.2	+	4	1217	c.1164C>A	c.(1162-1164)ATC>ATA	p.I388I	TSNAX-DISC1_uc010pwf.1_3'UTR|TSNAX-DISC1_uc010pwg.1_Silent_p.I377I|TSNAX-DISC1_uc010pwh.1_Silent_p.I343I|TSNAX-DISC1_uc010pwi.1_Silent_p.I343I|TSNAX-DISC1_uc010pwj.1_Silent_p.I377I|TSNAX-DISC1_uc010pwk.1_Silent_p.I377I|TSNAX-DISC1_uc010pwl.1_RNA|DISC1_uc010pwo.1_3'UTR|DISC1_uc010pwp.1_Silent_p.I388I|DISC1_uc010pwq.1_Silent_p.I388I|DISC1_uc010pwr.1_Silent_p.I388I|DISC1_uc010pws.1_Silent_p.I388I|DISC1_uc010pwt.1_Silent_p.I388I|DISC1_uc010pwu.1_Silent_p.I38I|DISC1_uc010pwv.1_RNA|DISC1_uc010pww.1_Silent_p.I388I|DISC1_uc010pwx.1_Intron|DISC1_uc010pwy.1_RNA|DISC1_uc010pwz.1_RNA|DISC1_uc010pxa.1_RNA|DISC1_uc001huy.2_Silent_p.I388I|DISC1_uc010pxb.1_Silent_p.I388I|DISC1_uc010pxc.1_Silent_p.I388I|DISC1_uc010pxd.1_Silent_p.I33I|DISC1_uc010pxe.1_Silent_p.I388I|DISC1_uc009xfr.2_Silent_p.I343I|DISC1_uc010pxf.1_Silent_p.I388I|DISC1_uc010pxg.1_Silent_p.I388I|DISC1_uc010pxh.1_Silent_p.I420I|DISC1_uc010pxi.1_Intron|DISC1_uc010pxj.1_Silent_p.I33I|DISC1_uc010pxk.1_RNA|DISC1_uc010pxl.1_RNA|DISC1_uc010pxm.1_Silent_p.I388I|DISC1_uc010pxn.1_Silent_p.I33I|DISC1_uc001hva.2_Silent_p.I388I	NM_018662	NP_061132	Q9NRI5	DISC1_HUMAN	disrupted in schizophrenia 1 isoform L	388	Interaction with TRAF3IP1.|Potential.				microtubule cytoskeleton organization|neuron migration|positive regulation of neuroblast proliferation|positive regulation of Wnt receptor signaling pathway|Wnt receptor signaling pathway	centrosome|microtubule	protein binding			skin(1)	1		all_cancers(173;0.0208)|Prostate(94;0.0975)																---	---	---	---	capture		Silent	SNP	231885718	231885718	4717	1	C	A	A	29	29	DISC1	A	2	2
SLC35F3	148641	broad.mit.edu	37	1	234041325	234041325	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:234041325G>T	uc001hvy.1	+	2	249	c.104G>T	c.(103-105)AGC>ATC	p.S35I		NM_173508	NP_775779	Q8IY50	S35F3_HUMAN	solute carrier family 35, member F3	Error:Variant_position_missing_in_Q8IY50_after_alignment					transport	integral to membrane				ovary(2)	2	Ovarian(103;0.0454)	all_cancers(173;0.145)|Prostate(94;0.0885)	OV - Ovarian serous cystadenocarcinoma(106;0.00531)															---	---	---	---	capture		Missense_Mutation	SNP	234041325	234041325	15087	1	G	T	T	34	34	SLC35F3	T	2	2
TARBP1	6894	broad.mit.edu	37	1	234565935	234565935	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:234565935C>A	uc001hwd.2	-	15	2507	c.2507G>T	c.(2506-2508)GGG>GTG	p.G836V		NM_005646	NP_005637	Q13395	TARB1_HUMAN	TAR RNA binding protein 1	836					regulation of transcription from RNA polymerase II promoter|RNA processing	nucleus	RNA binding|RNA methyltransferase activity			ovary(2)|skin(1)	3	Ovarian(103;0.0339)	all_cancers(173;0.00995)|Prostate(94;0.0115)|all_epithelial(177;0.172)	OV - Ovarian serous cystadenocarcinoma(106;0.000263)															---	---	---	---	capture		Missense_Mutation	SNP	234565935	234565935	16076	1	C	A	A	22	22	TARBP1	A	2	2
LGALS8	3964	broad.mit.edu	37	1	236702237	236702237	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236702237C>A	uc001hxz.1	+	5	574	c.193C>A	c.(193-195)CAT>AAT	p.H65N	LGALS8_uc001hxw.1_Missense_Mutation_p.H65N|LGALS8_uc001hxy.1_Missense_Mutation_p.H65N|LGALS8_uc009xgg.1_RNA|LGALS8_uc001hya.1_Missense_Mutation_p.H65N|LGALS8_uc001hyb.1_Missense_Mutation_p.H65N|LGALS8_uc001hyc.1_Missense_Mutation_p.H65N	NM_201543	NP_963837	O00214	LEG8_HUMAN	galectin-8 isoform b	65	Galectin 1.					cytoplasm|extracellular space	sugar binding			ovary(1)	1	Ovarian(103;0.0634)|Breast(184;0.221)	all_cancers(173;0.0253)|Prostate(94;0.174)	OV - Ovarian serous cystadenocarcinoma(106;0.00117)															---	---	---	---	capture		Missense_Mutation	SNP	236702237	236702237	9073	1	C	A	A	29	29	LGALS8	A	2	2
LGALS8	3964	broad.mit.edu	37	1	236711372	236711372	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236711372G>C	uc001hxz.1	+	11	1246	c.865G>C	c.(865-867)GAG>CAG	p.E289Q	LGALS8_uc001hxw.1_Missense_Mutation_p.E331Q|LGALS8_uc001hxy.1_Missense_Mutation_p.E331Q|LGALS8_uc009xgg.1_RNA|LGALS8_uc001hya.1_Missense_Mutation_p.E289Q|LGALS8_uc001hyb.1_Missense_Mutation_p.E289Q|LGALS8_uc001hyc.1_Missense_Mutation_p.E272Q	NM_201543	NP_963837	O00214	LEG8_HUMAN	galectin-8 isoform b	289	Galectin 2.					cytoplasm|extracellular space	sugar binding			ovary(1)	1	Ovarian(103;0.0634)|Breast(184;0.221)	all_cancers(173;0.0253)|Prostate(94;0.174)	OV - Ovarian serous cystadenocarcinoma(106;0.00117)															---	---	---	---	capture		Missense_Mutation	SNP	236711372	236711372	9073	1	G	C	C	41	41	LGALS8	C	3	3
ACTN2	88	broad.mit.edu	37	1	236883436	236883436	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236883436G>T	uc001hyf.2	+	4	597	c.393G>T	c.(391-393)CTG>CTT	p.L131L	ACTN2_uc001hyg.2_5'UTR|ACTN2_uc009xgi.1_Silent_p.L131L	NM_001103	NP_001094	P35609	ACTN2_HUMAN	actinin, alpha 2	131	CH 1.|Actin-binding.				focal adhesion assembly|microspike assembly|muscle filament sliding|platelet activation|platelet degranulation|protein homotetramerization|regulation of apoptosis|synaptic transmission	actin filament|cytosol|dendritic spine|extracellular region|filopodium|focal adhesion|nucleolus|platelet alpha granule lumen|pseudopodium|Z disc	actin binding|calcium ion binding|FATZ 1 binding|identical protein binding|integrin binding|protein dimerization activity|structural constituent of muscle|titin binding|titin Z domain binding|ZASP binding			ovary(4)|skin(1)	5	Ovarian(103;0.0634)|Breast(184;0.221)	all_cancers(173;0.00661)|Acute lymphoblastic leukemia(190;0.109)|Prostate(94;0.174)	OV - Ovarian serous cystadenocarcinoma(106;0.00168)															---	---	---	---	capture		Silent	SNP	236883436	236883436	206	1	G	T	T	47	47	ACTN2	T	2	2
ACTN2	88	broad.mit.edu	37	1	236911049	236911049	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236911049A>G	uc001hyf.2	+	13	1693	c.1489A>G	c.(1489-1491)ACT>GCT	p.T497A	ACTN2_uc001hyg.2_Missense_Mutation_p.T289A|ACTN2_uc009xgi.1_Missense_Mutation_p.T497A|ACTN2_uc010pxu.1_Missense_Mutation_p.T186A|ACTN2_uc001hyh.2_Missense_Mutation_p.T185A	NM_001103	NP_001094	P35609	ACTN2_HUMAN	actinin, alpha 2	497	Spectrin 2.				focal adhesion assembly|microspike assembly|muscle filament sliding|platelet activation|platelet degranulation|protein homotetramerization|regulation of apoptosis|synaptic transmission	actin filament|cytosol|dendritic spine|extracellular region|filopodium|focal adhesion|nucleolus|platelet alpha granule lumen|pseudopodium|Z disc	actin binding|calcium ion binding|FATZ 1 binding|identical protein binding|integrin binding|protein dimerization activity|structural constituent of muscle|titin binding|titin Z domain binding|ZASP binding			ovary(4)|skin(1)	5	Ovarian(103;0.0634)|Breast(184;0.221)	all_cancers(173;0.00661)|Acute lymphoblastic leukemia(190;0.109)|Prostate(94;0.174)	OV - Ovarian serous cystadenocarcinoma(106;0.00168)															---	---	---	---	capture		Missense_Mutation	SNP	236911049	236911049	206	1	A	G	G	14	14	ACTN2	G	4	4
RYR2	6262	broad.mit.edu	37	1	237617764	237617764	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237617764C>A	uc001hyl.1	+	15	1486	c.1366C>A	c.(1366-1368)CTG>ATG	p.L456M		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	456	Cytoplasmic (By similarity).				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---	capture		Missense_Mutation	SNP	237617764	237617764	14249	1	C	A	A	32	32	RYR2	A	2	2
RYR2	6262	broad.mit.edu	37	1	237619941	237619941	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237619941C>G	uc001hyl.1	+	16	1638	c.1518C>G	c.(1516-1518)CAC>CAG	p.H506Q		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	506	Cytoplasmic (By similarity).				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---	capture		Missense_Mutation	SNP	237619941	237619941	14249	1	C	G	G	19	19	RYR2	G	3	3
RYR2	6262	broad.mit.edu	37	1	237632437	237632437	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237632437G>T	uc001hyl.1	+	17	1778	c.1658G>T	c.(1657-1659)GGC>GTC	p.G553V		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	553	Cytoplasmic (By similarity).				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---	capture		Missense_Mutation	SNP	237632437	237632437	14249	1	G	T	T	42	42	RYR2	T	2	2
RYR2	6262	broad.mit.edu	37	1	237730076	237730076	+	Splice_Site	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237730076G>T	uc001hyl.1	+	28	3543	c.3423_splice	c.e28+1	p.K1141_splice		NM_001035	NP_001026			cardiac muscle ryanodine receptor						cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---	capture		Splice_Site	SNP	237730076	237730076	14249	1	G	T	T	44	44	RYR2	T	5	2
RYR2	6262	broad.mit.edu	37	1	237778138	237778138	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237778138T>C	uc001hyl.1	+	37	5830	c.5710T>C	c.(5710-5712)TTG>CTG	p.L1904L		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	1904	Cytoplasmic (By similarity).|4 X approximate repeats.				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---	capture		Silent	SNP	237778138	237778138	14249	1	T	C	C	52	52	RYR2	C	4	4
RYR2	6262	broad.mit.edu	37	1	237948232	237948232	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237948232G>C	uc001hyl.1	+	90	13340	c.13220G>C	c.(13219-13221)AGC>ACC	p.S4407T	RYR2_uc010pya.1_Missense_Mutation_p.S822T	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	4407					cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---	capture		Missense_Mutation	SNP	237948232	237948232	14249	1	G	C	C	34	34	RYR2	C	3	3
RYR2	6262	broad.mit.edu	37	1	237955581	237955581	+	Silent	SNP	G	C	C	rs115854664	by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237955581G>C	uc001hyl.1	+	94	13860	c.13740G>C	c.(13738-13740)ACG>ACC	p.T4580T	RYR2_uc010pyb.1_Silent_p.T13T	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	4580	Helical; Name=M6; (Potential).				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---	capture		Silent	SNP	237955581	237955581	14249	1	G	C	C	39	39	RYR2	C	3	3
RYR2	6262	broad.mit.edu	37	1	237982461	237982461	+	Missense_Mutation	SNP	T	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237982461T>G	uc001hyl.1	+	101	14679	c.14559T>G	c.(14557-14559)TTT>TTG	p.F4853L	RYR2_uc010pyb.1_Missense_Mutation_p.F286L	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	4853	Helical; Name=M10; (Potential).				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---	capture		Missense_Mutation	SNP	237982461	237982461	14249	1	T	G	G	63	63	RYR2	G	4	4
ZP4	57829	broad.mit.edu	37	1	238050774	238050774	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:238050774C>A	uc001hym.2	-	5	641	c.641G>T	c.(640-642)CGC>CTC	p.R214L	LOC100130331_uc010pyc.1_Intron	NM_021186	NP_067009	Q12836	ZP4_HUMAN	zona pellucida glycoprotein 4 preproprotein	214	ZP.|Extracellular (Potential).				acrosomal vesicle exocytosis|negative regulation of binding of sperm to zona pellucida|positive regulation of acrosome reaction|positive regulation of humoral immune response|positive regulation of protein kinase activity|positive regulation of T cell proliferation|protein kinase A signaling cascade|protein kinase C signaling cascade	integral to membrane|intracellular|plasma membrane|proteinaceous extracellular matrix	acrosin binding|receptor activity			ovary(2)|skin(1)	3	Ovarian(103;0.103)	all_cancers(173;0.00175)|all_epithelial(177;0.162)|all_neural(198;0.164)|Melanoma(53;0.211)|Prostate(94;0.214)	OV - Ovarian serous cystadenocarcinoma(106;0.00989)															---	---	---	---	capture		Missense_Mutation	SNP	238050774	238050774	18822	1	C	A	A	27	27	ZP4	A	1	1
CEP170	9859	broad.mit.edu	37	1	243349566	243349566	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:243349566C>A	uc001hzs.2	-	9	1675	c.1267G>T	c.(1267-1269)GCT>TCT	p.A423S	CEP170_uc001hzt.2_Missense_Mutation_p.A423S|CEP170_uc001hzu.2_Missense_Mutation_p.A423S	NM_014812	NP_055627	Q5SW79	CE170_HUMAN	centrosomal protein 170kDa isoform alpha	423						centriole|microtubule|spindle				ovary(1)|haematopoietic_and_lymphoid_tissue(1)	2	all_neural(11;0.101)	all_cancers(173;0.003)	all cancers(7;5.81e-06)|GBM - Glioblastoma multiforme(7;0.000443)|OV - Ovarian serous cystadenocarcinoma(106;0.0101)															---	---	---	---	capture		Missense_Mutation	SNP	243349566	243349566	3383	1	C	A	A	28	28	CEP170	A	2	2
SDCCAG8	10806	broad.mit.edu	37	1	243480191	243480191	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:243480191C>A	uc001hzw.2	+	9	1220	c.1064C>A	c.(1063-1065)ACC>AAC	p.T355N	SDCCAG8_uc010pyk.1_Missense_Mutation_p.T210N|SDCCAG8_uc010pyl.1_Missense_Mutation_p.T167N|SDCCAG8_uc001hzx.2_Missense_Mutation_p.T167N	NM_006642	NP_006633	Q86SQ7	SDCG8_HUMAN	serologically defined colon cancer antigen 8	355	Potential.|Sufficient for homodimerization (By similarity).				establishment of cell polarity|G2/M transition of mitotic cell cycle|tube formation	cell-cell junction|centriole|cytosol	protein binding				0	all_cancers(71;0.000545)|all_epithelial(71;0.000509)|all_lung(81;0.0821)|Ovarian(71;0.0919)|all_neural(11;0.101)|Breast(184;0.218)	all_cancers(173;0.00395)	all cancers(7;1.58e-07)|GBM - Glioblastoma multiforme(7;5.12e-06)|OV - Ovarian serous cystadenocarcinoma(106;0.00392)	COAD - Colon adenocarcinoma(196;0.145)														---	---	---	---	capture		Missense_Mutation	SNP	243480191	243480191	14444	1	C	A	A	18	18	SDCCAG8	A	2	2
KIF26B	55083	broad.mit.edu	37	1	245861458	245861458	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:245861458C>A	uc001ibf.1	+	13	6315	c.5875C>A	c.(5875-5877)CCT>ACT	p.P1959T		NM_018012	NP_060482	Q2KJY2	KI26B_HUMAN	kinesin family member 26B	1959					microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(3)	3	all_cancers(71;3.86e-05)|all_epithelial(71;0.000121)|Ovarian(71;0.0412)|all_lung(81;0.0498)|Lung NSC(105;0.0708)|Breast(184;0.127)		OV - Ovarian serous cystadenocarcinoma(106;0.022)															---	---	---	---	capture		Missense_Mutation	SNP	245861458	245861458	8606	1	C	A	A	22	22	KIF26B	A	2	2
VN1R5	317705	broad.mit.edu	37	1	247419484	247419484	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247419484C>G	uc010pyu.1	+	1	111	c.111C>G	c.(109-111)ATC>ATG	p.I37M		NM_173858	NP_776257	Q7Z5H4	VN1R5_HUMAN	vomeronasal 1 receptor 5	37	Cytoplasmic (Potential).				response to pheromone	integral to membrane|plasma membrane	pheromone receptor activity				0	all_cancers(71;5.7e-05)|all_epithelial(71;1.03e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0607)|Lung NSC(105;0.0661)	all_cancers(173;0.0314)	OV - Ovarian serous cystadenocarcinoma(106;0.00854)															---	---	---	---	capture		Missense_Mutation	SNP	247419484	247419484	17748	1	C	G	G	29	29	VN1R5	G	3	3
NLRP3	114548	broad.mit.edu	37	1	247582273	247582273	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247582273C>A	uc001icr.2	+	3	315	c.177C>A	c.(175-177)ATC>ATA	p.I59I	NLRP3_uc001ics.2_Silent_p.I59I|NLRP3_uc001icu.2_Silent_p.I59I|NLRP3_uc001icw.2_Silent_p.I59I|NLRP3_uc001icv.2_Silent_p.I59I|NLRP3_uc010pyw.1_Silent_p.I57I|NLRP3_uc001ict.1_Silent_p.I57I	NM_001079821	NP_001073289	Q96P20	NALP3_HUMAN	NLR family, pyrin domain containing 3 isoform a	59	DAPIN.				detection of biotic stimulus|induction of apoptosis|inflammatory response|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|positive regulation of interleukin-1 beta secretion|protein oligomerization|signal transduction	cytoplasm	ATP binding|peptidoglycan binding|protein binding	p.I59M(1)		lung(8)|skin(8)|ovary(7)|upper_aerodigestive_tract(1)|breast(1)|pancreas(1)	26	all_cancers(71;9.66e-05)|all_epithelial(71;1.85e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)	all_cancers(173;0.0172)	OV - Ovarian serous cystadenocarcinoma(106;0.0141)															---	---	---	---	capture		Silent	SNP	247582273	247582273	10881	1	C	A	A	31	31	NLRP3	A	1	1
OR6F1	343169	broad.mit.edu	37	1	247875361	247875361	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247875361C>A	uc001idj.1	-	1	697	c.697G>T	c.(697-699)GGC>TGC	p.G233C		NM_001005286	NP_001005286	Q8NGZ6	OR6F1_HUMAN	olfactory receptor, family 6, subfamily F,	233	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(71;3.24e-05)|all_epithelial(71;1.3e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)		OV - Ovarian serous cystadenocarcinoma(106;0.0168)															---	---	---	---	capture		Missense_Mutation	SNP	247875361	247875361	11611	1	C	A	A	21	21	OR6F1	A	2	2
OR1C1	26188	broad.mit.edu	37	1	247920865	247920865	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247920865C>G	uc010pza.1	-	1	844	c.844G>C	c.(844-846)GCT>CCT	p.A282P		NM_012353	NP_036485	Q15619	OR1C1_HUMAN	olfactory receptor, family 1, subfamily C,	282	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;4.34e-05)|all_epithelial(71;1.13e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0786)|Lung NSC(105;0.0858)	all_cancers(173;0.0247)	OV - Ovarian serous cystadenocarcinoma(106;0.0168)															---	---	---	---	capture		Missense_Mutation	SNP	247920865	247920865	11358	1	C	G	G	26	26	OR1C1	G	3	3
OR2L13	284521	broad.mit.edu	37	1	248263520	248263520	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248263520C>A	uc001ids.2	+	3	1180	c.843C>A	c.(841-843)ACC>ACA	p.T281T		NM_175911	NP_787107	Q8N349	OR2LD_HUMAN	olfactory receptor, family 2, subfamily L,	281	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity|protein binding			central_nervous_system(2)|ovary(1)|skin(1)	4	all_cancers(71;0.000149)|all_epithelial(71;1.27e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0132)															---	---	---	---	capture		Silent	SNP	248263520	248263520	11412	1	C	A	A	22	22	OR2L13	A	2	2
OR2T4	127074	broad.mit.edu	37	1	248525735	248525735	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248525735G>T	uc001ieh.1	+	1	853	c.853G>T	c.(853-855)GGG>TGG	p.G285W		NM_001004696	NP_001004696	Q8NH00	OR2T4_HUMAN	olfactory receptor, family 2, subfamily T,	285	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			central_nervous_system(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Missense_Mutation	SNP	248525735	248525735	11433	1	G	T	T	47	47	OR2T4	T	2	2
OR2T2	401992	broad.mit.edu	37	1	248616135	248616135	+	Missense_Mutation	SNP	T	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248616135T>G	uc001iek.1	+	1	37	c.37T>G	c.(37-39)TTC>GTC	p.F13V		NM_001004136	NP_001004136	Q6IF00	OR2T2_HUMAN	olfactory receptor, family 2, subfamily T,	13	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Missense_Mutation	SNP	248616135	248616135	11426	1	T	G	G	56	56	OR2T2	G	4	4
OR2T3	343173	broad.mit.edu	37	1	248637586	248637586	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248637586C>A	uc001iel.1	+	1	935	c.935C>A	c.(934-936)TCA>TAA	p.S312*		NM_001005495	NP_001005495	Q8NH03	OR2T3_HUMAN	olfactory receptor, family 2, subfamily T,	312	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Nonsense_Mutation	SNP	248637586	248637586	11429	1	C	A	A	29	29	OR2T3	A	5	2
OR2G6	391211	broad.mit.edu	37	1	248685110	248685110	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248685110C>G	uc001ien.1	+	1	163	c.163C>G	c.(163-165)CTC>GTC	p.L55V		NM_001013355	NP_001013373	Q5TZ20	OR2G6_HUMAN	olfactory receptor, family 2, subfamily G,	55	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(1)	3	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)	all_cancers(173;0.0156)	OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Missense_Mutation	SNP	248685110	248685110	11406	1	C	G	G	20	20	OR2G6	G	3	3
OR2T10	127069	broad.mit.edu	37	1	248756222	248756222	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248756222G>A	uc010pzn.1	-	1	848	c.848C>T	c.(847-849)CCT>CTT	p.P283L		NM_001004693	NP_001004693	Q8NGZ9	O2T10_HUMAN	olfactory receptor, family 2, subfamily T,	283	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Missense_Mutation	SNP	248756222	248756222	11423	1	G	A	A	35	35	OR2T10	A	2	2
OR2T10	127069	broad.mit.edu	37	1	248756589	248756589	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248756589G>T	uc010pzn.1	-	1	481	c.481C>A	c.(481-483)CCC>ACC	p.P161T		NM_001004693	NP_001004693	Q8NGZ9	O2T10_HUMAN	olfactory receptor, family 2, subfamily T,	161	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Missense_Mutation	SNP	248756589	248756589	11423	1	G	T	T	41	41	OR2T10	T	2	2
OR2T11	127077	broad.mit.edu	37	1	248790288	248790288	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248790288C>T	uc001ier.1	-	1	142	c.142G>A	c.(142-144)GTG>ATG	p.V48M		NM_001001964	NP_001001964	Q8NH01	O2T11_HUMAN	olfactory receptor, family 2, subfamily T,	48	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			lung(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Missense_Mutation	SNP	248790288	248790288	11424	1	C	T	T	18	18	OR2T11	T	2	2
DHTKD1	55526	broad.mit.edu	37	10	12159705	12159705	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:12159705G>T	uc001ild.3	+	14	2452	c.2353G>T	c.(2353-2355)GGA>TGA	p.G785*		NM_018706	NP_061176	Q96HY7	DHTK1_HUMAN	dehydrogenase E1 and transketolase domain	785					glycolysis	mitochondrion	oxoglutarate dehydrogenase (succinyl-transferring) activity|thiamine pyrophosphate binding			ovary(1)|central_nervous_system(1)	2		Renal(717;0.228)	BRCA - Breast invasive adenocarcinoma(52;0.188)															---	---	---	---	capture		Nonsense_Mutation	SNP	12159705	12159705	4679	10	G	T	T	35	35	DHTKD1	T	5	2
CUBN	8029	broad.mit.edu	37	10	16981039	16981039	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:16981039C>A	uc001ioo.2	-	38	5708	c.5656G>T	c.(5656-5658)GCA>TCA	p.A1886S		NM_001081	NP_001072	O60494	CUBN_HUMAN	cubilin precursor	1886	CUB 13.				cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)													---	---	---	---	capture		Missense_Mutation	SNP	16981039	16981039	4211	10	C	A	A	25	25	CUBN	A	2	2
ST8SIA6	338596	broad.mit.edu	37	10	17373464	17373464	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:17373464C>A	uc001ipd.2	-	5	465	c.465G>T	c.(463-465)GAG>GAT	p.E155D	ST8SIA6_uc010qce.1_RNA	NM_001004470	NP_001004470	P61647	SIA8F_HUMAN	ST8 alpha-N-acetyl-neuraminide	155	Lumenal (Potential).				post-translational protein modification|protein N-linked glycosylation via asparagine	integral to Golgi membrane	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	17373464	17373464	15754	10	C	A	A	24	24	ST8SIA6	A	2	2
SLC39A12	221074	broad.mit.edu	37	10	18242259	18242259	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18242259C>A	uc001ipo.2	+	2	327	c.54C>A	c.(52-54)CTC>CTA	p.L18L	SLC39A12_uc001ipn.2_Silent_p.L18L|SLC39A12_uc001ipp.2_Silent_p.L18L|SLC39A12_uc010qck.1_Intron	NM_001145195	NP_001138667	Q504Y0	S39AC_HUMAN	solute carrier family 39 (zinc transporter),	18	Extracellular (Potential).				zinc ion transport	integral to membrane	metal ion transmembrane transporter activity			ovary(1)|breast(1)	2																		---	---	---	---	capture		Silent	SNP	18242259	18242259	15112	10	C	A	A	29	29	SLC39A12	A	2	2
PIP4K2A	5305	broad.mit.edu	37	10	23003205	23003205	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:23003205C>G	uc001irl.3	-	1	299	c.51G>C	c.(49-51)AAG>AAC	p.K17N		NM_005028	NP_005019	P48426	PI42A_HUMAN	phosphatidylinositol-5-phosphate 4-kinase, type	17							1-phosphatidylinositol-4-phosphate 5-kinase activity|1-phosphatidylinositol-5-phosphate 4-kinase activity|ATP binding			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	23003205	23003205	12360	10	C	G	G	32	32	PIP4K2A	G	3	3
ARHGAP21	57584	broad.mit.edu	37	10	24874831	24874831	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:24874831C>T	uc001isb.2	-	26	4874	c.4387G>A	c.(4387-4389)GAG>AAG	p.E1463K	ARHGAP21_uc010qdb.1_RNA	NM_020824	NP_065875	Q5T5U3	RHG21_HUMAN	Rho GTPase activating protein 21	1462					signal transduction	cell junction|cytoplasmic vesicle membrane|cytoskeleton|Golgi membrane	GTPase activator activity|protein binding			ovary(7)|pancreas(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	24874831	24874831	882	10	C	T	T	29	29	ARHGAP21	T	2	2
PARD3	56288	broad.mit.edu	37	10	34573173	34573173	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:34573173C>A	uc010qej.1	-	21	3075	c.3075G>T	c.(3073-3075)AGG>AGT	p.R1025S	PARD3_uc010qek.1_Missense_Mutation_p.R1022S|PARD3_uc010qel.1_Intron|PARD3_uc010qem.1_Missense_Mutation_p.R1009S|PARD3_uc010qen.1_Missense_Mutation_p.R979S|PARD3_uc010qeo.1_Intron|PARD3_uc010qep.1_Missense_Mutation_p.R935S|PARD3_uc010qeq.1_Intron	NM_019619	NP_062565	Q8TEW0	PARD3_HUMAN	partitioning-defective protein 3 homolog	1025	Lys-rich.				activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|asymmetric cell division|axonogenesis|cell cycle|establishment of epithelial cell polarity|protein complex assembly|protein targeting to membrane|tight junction assembly	cell cortex|cytoskeleton|cytosol|endomembrane system|tight junction	phosphatidylinositol-3,4,5-trisphosphate binding|phosphatidylinositol-3-phosphate binding|phosphatidylinositol-4,5-bisphosphate binding|protein binding			ovary(1)	1		Breast(68;0.0707)																---	---	---	---	capture		Missense_Mutation	SNP	34573173	34573173	11860	10	C	A	A	18	18	PARD3	A	2	2
CREM	1390	broad.mit.edu	37	10	35467822	35467822	+	Silent	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:35467822A>T	uc001iyb.2	+	4	336	c.174A>T	c.(172-174)GCA>GCT	p.A58A	CREM_uc001ixx.2_Silent_p.A42A|CREM_uc001ixy.2_Intron|CREM_uc001ixz.2_Intron|CREM_uc001iya.2_Silent_p.A58A|CREM_uc001iyc.2_Silent_p.A42A|CREM_uc001iyd.2_Silent_p.A58A|CREM_uc001iye.2_Silent_p.A58A|CREM_uc001iyf.2_Silent_p.A28A|CREM_uc001iyg.2_Silent_p.A28A|CREM_uc001iyh.2_Silent_p.A3A|CREM_uc001iyi.2_Silent_p.A3A|CREM_uc001iyj.2_5'UTR|CREM_uc001iyk.2_5'UTR	NM_181571	NP_853549	Q03060	CREM_HUMAN	cAMP responsive element modulator isoform a	107	KID.				cell differentiation|multicellular organismal development|signal transduction|spermatogenesis	nucleus	cAMP response element binding protein binding|protein binding|protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---	capture		Silent	SNP	35467822	35467822	4007	10	A	T	T	7	7	CREM	T	4	4
ZNF25	219749	broad.mit.edu	37	10	38246038	38246038	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:38246038G>A	uc001ize.1	-	4	253	c.148C>T	c.(148-150)CAT>TAT	p.H50Y	ZNF25_uc001izf.1_Missense_Mutation_p.H14Y	NM_145011	NP_659448	P17030	ZNF25_HUMAN	zinc finger protein 25	50	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			breast(2)|ovary(1)|central_nervous_system(1)	4		all_neural(218;0.0218)|Breast(68;0.0389)|Ovarian(717;0.0443)|Renal(717;0.157)																---	---	---	---	capture		Missense_Mutation	SNP	38246038	38246038	18385	10	G	A	A	47	47	ZNF25	A	2	2
ZNF33A	7581	broad.mit.edu	37	10	38343517	38343517	+	Missense_Mutation	SNP	G	T	T	rs141144828		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:38343517G>T	uc001izh.2	+	5	640	c.462G>T	c.(460-462)TTG>TTT	p.L154F	ZNF33A_uc001izg.2_Missense_Mutation_p.L155F|ZNF33A_uc010qev.1_Missense_Mutation_p.L161F|ZNF33A_uc001izi.1_Intron	NM_006974	NP_008905	Q06730	ZN33A_HUMAN	zinc finger protein 33A isoform b	154						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)|skin(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	38343517	38343517	18446	10	G	T	T	47	47	ZNF33A	T	2	2
ZNF33B	7582	broad.mit.edu	37	10	43088981	43088981	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43088981C>A	uc001jaf.1	-	5	1532	c.1417G>T	c.(1417-1419)GAG>TAG	p.E473*	ZNF33B_uc009xmg.1_Intron|ZNF33B_uc001jae.1_Intron|ZNF33B_uc001jag.1_Nonsense_Mutation_p.E361*|ZNF33B_uc001jad.2_Intron	NM_006955	NP_008886	Q06732	ZN33B_HUMAN	zinc finger protein 33B	473	C2H2-type 6.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0																		---	---	---	---	capture		Nonsense_Mutation	SNP	43088981	43088981	18447	10	C	A	A	29	29	ZNF33B	A	5	2
RASSF4	83937	broad.mit.edu	37	10	45486418	45486418	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:45486418C>T	uc001jbo.2	+	9	842	c.708C>T	c.(706-708)TGC>TGT	p.C236C	RASSF4_uc001jbp.2_Silent_p.C267C|RASSF4_uc009xmn.2_Silent_p.C166C|RASSF4_uc001jbq.2_Silent_p.C133C|RASSF4_uc001jbt.2_Silent_p.C193C	NM_032023	NP_114412	Q9H2L5	RASF4_HUMAN	Ras association domain family 4	236	Ras-associating.				cell cycle|signal transduction		protein binding			large_intestine(1)	1																		---	---	---	---	capture		Silent	SNP	45486418	45486418	13549	10	C	T	T	27	27	RASSF4	T	1	1
RBP3	5949	broad.mit.edu	37	10	48389621	48389621	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:48389621C>G	uc001jez.2	-	1	1371	c.1257G>C	c.(1255-1257)GAG>GAC	p.E419D		NM_002900	NP_002891	P10745	RET3_HUMAN	retinol-binding protein 3 precursor	419	4 X approximate tandem repeats.|2.				lipid metabolic process|proteolysis|transport|visual perception	interphotoreceptor matrix	retinal binding|serine-type peptidase activity			large_intestine(1)|central_nervous_system(1)	2					Vitamin A(DB00162)													---	---	---	---	capture		Missense_Mutation	SNP	48389621	48389621	13626	10	C	G	G	24	24	RBP3	G	3	3
C10orf71	118461	broad.mit.edu	37	10	50531521	50531521	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:50531521T>C	uc010qgp.1	+	3	1270	c.931T>C	c.(931-933)TTG>CTG	p.L311L		NM_199459	NP_955629	Q711Q0	CJ071_HUMAN	hypothetical protein LOC118461 isoform 2	311											0																		---	---	---	---	capture		Silent	SNP	50531521	50531521	1651	10	T	C	C	56	56	C10orf71	C	4	4
DRGX	644168	broad.mit.edu	37	10	50574366	50574366	+	Missense_Mutation	SNP	T	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:50574366T>G	uc010qgq.1	-	6	602	c.602A>C	c.(601-603)TAT>TCT	p.Y201S		NM_001080520	NP_001073989	A6NNA5	DRGX_HUMAN	dorsal root ganglia homeobox	201					multicellular organismal development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	50574366	50574366	4947	10	T	G	G	49	49	DRGX	G	4	4
A1CF	29974	broad.mit.edu	37	10	52566514	52566514	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:52566514C>T	uc001jjj.2	-	13	1948	c.1760G>A	c.(1759-1761)CGA>CAA	p.R587Q	A1CF_uc010qhn.1_Missense_Mutation_p.R587Q|A1CF_uc001jji.2_Missense_Mutation_p.R579Q|A1CF_uc001jjh.2_Missense_Mutation_p.R587Q|A1CF_uc010qho.1_Missense_Mutation_p.R595Q|A1CF_uc009xov.2_Missense_Mutation_p.R579Q	NM_138932	NP_620310	Q9NQ94	A1CF_HUMAN	apobec-1 complementation factor isoform 2	587					cytidine to uridine editing|mRNA modification|mRNA processing|protein stabilization	apolipoprotein B mRNA editing enzyme complex|endoplasmic reticulum|nucleoplasm	nucleotide binding|protein binding|single-stranded RNA binding			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	52566514	52566514	2	10	C	T	T	31	31	A1CF	T	1	1
PCDH15	65217	broad.mit.edu	37	10	55587246	55587246	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55587246G>C	uc001jju.1	-	32	4669	c.4274C>G	c.(4273-4275)GCA>GGA	p.A1425G	PCDH15_uc010qhq.1_Missense_Mutation_p.A1430G|PCDH15_uc010qhr.1_Missense_Mutation_p.A1425G|PCDH15_uc010qhs.1_Missense_Mutation_p.A1437G|PCDH15_uc010qht.1_Missense_Mutation_p.A1432G|PCDH15_uc010qhu.1_Missense_Mutation_p.A1425G|PCDH15_uc001jjv.1_Intron|PCDH15_uc010qhv.1_Missense_Mutation_p.A1422G|PCDH15_uc010qhw.1_Missense_Mutation_p.A1385G|PCDH15_uc010qhx.1_Missense_Mutation_p.A1354G|PCDH15_uc010qhy.1_Missense_Mutation_p.A1430G|PCDH15_uc010qhz.1_Missense_Mutation_p.A1425G|PCDH15_uc010qia.1_Missense_Mutation_p.A1403G|PCDH15_uc010qib.1_Missense_Mutation_p.A1400G	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	1425	Cytoplasmic (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---	capture		Missense_Mutation	SNP	55587246	55587246	11931	10	G	C	C	46	46	PCDH15	C	3	3
PCDH15	65217	broad.mit.edu	37	10	55839174	55839174	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55839174G>A	uc001jju.1	-	17	2403	c.2008C>T	c.(2008-2010)CTA>TTA	p.L670L	PCDH15_uc010qhq.1_Silent_p.L675L|PCDH15_uc010qhr.1_Silent_p.L670L|PCDH15_uc010qhs.1_Silent_p.L682L|PCDH15_uc010qht.1_Silent_p.L677L|PCDH15_uc010qhu.1_Silent_p.L670L|PCDH15_uc001jjv.1_Silent_p.L648L|PCDH15_uc010qhv.1_Silent_p.L670L|PCDH15_uc010qhw.1_Silent_p.L633L|PCDH15_uc010qhx.1_Silent_p.L599L|PCDH15_uc010qhy.1_Silent_p.L675L|PCDH15_uc010qhz.1_Silent_p.L670L|PCDH15_uc010qia.1_Silent_p.L648L|PCDH15_uc010qib.1_Silent_p.L648L|PCDH15_uc001jjw.2_Silent_p.L670L	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	670	Cadherin 6.|Extracellular (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---	capture		Silent	SNP	55839174	55839174	11931	10	G	A	A	33	33	PCDH15	A	2	2
PCDH15	65217	broad.mit.edu	37	10	55973758	55973758	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55973758C>G	uc001jju.1	-	10	1431	c.1036G>C	c.(1036-1038)GAA>CAA	p.E346Q	PCDH15_uc010qhq.1_Missense_Mutation_p.E351Q|PCDH15_uc010qhr.1_Missense_Mutation_p.E346Q|PCDH15_uc010qhs.1_Missense_Mutation_p.E351Q|PCDH15_uc010qht.1_Missense_Mutation_p.E346Q|PCDH15_uc010qhu.1_Missense_Mutation_p.E346Q|PCDH15_uc001jjv.1_Missense_Mutation_p.E324Q|PCDH15_uc010qhv.1_Missense_Mutation_p.E346Q|PCDH15_uc010qhw.1_Missense_Mutation_p.E309Q|PCDH15_uc010qhx.1_Missense_Mutation_p.E346Q|PCDH15_uc010qhy.1_Missense_Mutation_p.E351Q|PCDH15_uc010qhz.1_Missense_Mutation_p.E346Q|PCDH15_uc010qia.1_Missense_Mutation_p.E324Q|PCDH15_uc010qib.1_Missense_Mutation_p.E324Q|PCDH15_uc001jjw.2_Missense_Mutation_p.E346Q	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	346	Cadherin 3.|Extracellular (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---	capture		Missense_Mutation	SNP	55973758	55973758	11931	10	C	G	G	32	32	PCDH15	G	3	3
PCDH15	65217	broad.mit.edu	37	10	56106233	56106233	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:56106233A>G	uc001jju.1	-	6	881	c.486T>C	c.(484-486)GTT>GTC	p.V162V	PCDH15_uc010qhq.1_Silent_p.V167V|PCDH15_uc010qhr.1_Silent_p.V162V|PCDH15_uc010qhs.1_Silent_p.V167V|PCDH15_uc010qht.1_Silent_p.V162V|PCDH15_uc010qhu.1_Silent_p.V162V|PCDH15_uc001jjv.1_Silent_p.V140V|PCDH15_uc010qhv.1_Silent_p.V162V|PCDH15_uc010qhw.1_Silent_p.V162V|PCDH15_uc010qhx.1_Silent_p.V162V|PCDH15_uc010qhy.1_Silent_p.V167V|PCDH15_uc010qhz.1_Silent_p.V162V|PCDH15_uc010qia.1_Silent_p.V140V|PCDH15_uc010qib.1_Silent_p.V140V|PCDH15_uc001jjw.2_Silent_p.V162V	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	162	Extracellular (Potential).|Cadherin 2.				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---	capture		Silent	SNP	56106233	56106233	11931	10	A	G	G	5	5	PCDH15	G	4	4
RTKN2	219790	broad.mit.edu	37	10	63983069	63983069	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:63983069C>A	uc001jlw.2	-	7	806	c.709G>T	c.(709-711)GCT>TCT	p.A237S	RTKN2_uc009xpf.1_Missense_Mutation_p.A18S	NM_145307	NP_660350	Q8IZC4	RTKN2_HUMAN	rhotekin 2	237					signal transduction	intracellular					0	Prostate(12;0.0297)|all_hematologic(501;0.215)																	---	---	---	---	capture		Missense_Mutation	SNP	63983069	63983069	14203	10	C	A	A	28	28	RTKN2	A	2	2
JMJD1C	221037	broad.mit.edu	37	10	64943277	64943277	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64943277T>C	uc001jmn.2	-	22	7314	c.7014A>G	c.(7012-7014)GAA>GAG	p.E2338E	JMJD1C_uc001jml.2_Silent_p.E2101E|JMJD1C_uc001jmm.2_Silent_p.E2050E|JMJD1C_uc010qiq.1_Silent_p.E2156E|JMJD1C_uc009xpi.2_Silent_p.E2156E|JMJD1C_uc009xpj.1_RNA|JMJD1C_uc001jmo.2_Silent_p.E245E	NM_032776	NP_116165	Q15652	JHD2C_HUMAN	jumonji domain containing 1C isoform a	2338	JmjC.	Iron; catalytic (By similarity).			blood coagulation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm	histone demethylase activity (H3-K9 specific)|metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|thyroid hormone receptor binding			ovary(4)|breast(1)|central_nervous_system(1)	6	Prostate(12;0.0119)|all_hematologic(501;0.191)																	---	---	---	---	capture		Silent	SNP	64943277	64943277	8254	10	T	C	C	56	56	JMJD1C	C	4	4
MYPN	84665	broad.mit.edu	37	10	69926318	69926318	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69926318C>T	uc001jnm.3	+	11	2053	c.1868C>T	c.(1867-1869)ACC>ATC	p.T623I	MYPN_uc001jnl.1_Missense_Mutation_p.T623I|MYPN_uc001jnn.3_Missense_Mutation_p.T348I|MYPN_uc001jno.3_Missense_Mutation_p.T623I|MYPN_uc009xps.2_Missense_Mutation_p.T623I|MYPN_uc009xpt.2_Missense_Mutation_p.T623I|MYPN_uc010qit.1_Missense_Mutation_p.T329I|MYPN_uc010qiu.1_RNA	NM_032578	NP_115967	Q86TC9	MYPN_HUMAN	myopalladin	623						nucleus|sarcomere	actin binding			ovary(3)|skin(2)	5																		---	---	---	---	capture		Missense_Mutation	SNP	69926318	69926318	10493	10	C	T	T	18	18	MYPN	T	2	2
DDX21	9188	broad.mit.edu	37	10	70719870	70719870	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70719870G>A	uc001jov.1	+	2	486	c.396G>A	c.(394-396)AAG>AAA	p.K132K	DDX21_uc001jow.1_Silent_p.K64K	NM_004728	NP_004719	Q9NR30	DDX21_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 21	132						nucleolus	ATP binding|ATP-dependent RNA helicase activity|protein binding|RNA binding			ovary(2)|kidney(1)	3																		---	---	---	---	capture		Silent	SNP	70719870	70719870	4520	10	G	A	A	33	33	DDX21	A	2	2
SRGN	5552	broad.mit.edu	37	10	70863695	70863695	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70863695G>T	uc001joz.2	+	3	382	c.296G>T	c.(295-297)GGC>GTC	p.G99V		NM_002727	NP_002718	P10124	SRGN_HUMAN	serglycin precursor	99	3.|9 X 2 AA tandem repeats of [SF]-G.				apoptosis|biomineral tissue development|maintenance of granzyme B location in T cell secretory granule|maintenance of protease location in mast cell secretory granule|negative regulation of bone mineralization|negative regulation of cytokine secretion|platelet activation|platelet degranulation|protein maturation by peptide bond cleavage	extracellular space|mast cell granule|platelet alpha granule lumen					0																		---	---	---	---	capture		Missense_Mutation	SNP	70863695	70863695	15662	10	G	T	T	42	42	SRGN	T	2	2
TYSND1	219743	broad.mit.edu	37	10	71899758	71899758	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:71899758C>G	uc001jqr.2	-	4	1777	c.1623G>C	c.(1621-1623)CTG>CTC	p.L541L	TYSND1_uc001jqq.2_RNA|TYSND1_uc001jqs.2_3'UTR|TYSND1_uc001jqt.2_RNA	NM_173555	NP_775826	Q2T9J0	TYSD1_HUMAN	trypsin domain containing 1 isoform a	541					proteolysis	peroxisome	serine-type endopeptidase activity			large_intestine(1)	1																		---	---	---	---	capture		Silent	SNP	71899758	71899758	17374	10	C	G	G	21	21	TYSND1	G	3	3
SAR1A	56681	broad.mit.edu	37	10	71917543	71917543	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:71917543C>A	uc010qjh.1	-	6	528	c.325G>T	c.(325-327)GTG>TTG	p.V109L	SAR1A_uc010qji.1_Missense_Mutation_p.V109L|SAR1A_uc010qjj.1_Missense_Mutation_p.V66L	NM_001142648	NP_001136120	Q9NR31	SAR1A_HUMAN	SAR1a gene homolog 1	109					ER to Golgi vesicle-mediated transport|intracellular protein transport	Golgi apparatus	GTP binding|GTPase activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	71917543	71917543	14320	10	C	A	A	19	19	SAR1A	A	1	1
ADAMTS14	140766	broad.mit.edu	37	10	72503416	72503416	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72503416C>G	uc001jrh.2	+	13	2037	c.2037C>G	c.(2035-2037)GTC>GTG	p.V679V	ADAMTS14_uc001jrg.2_Silent_p.V682V|ADAMTS14_uc001jri.1_Silent_p.V202V	NM_080722	NP_542453	Q8WXS8	ATS14_HUMAN	ADAM metallopeptidase with thrombospondin type 1	679	Cys-rich.				collagen catabolic process|proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(5)|upper_aerodigestive_tract(1)	6																		---	---	---	---	capture		Silent	SNP	72503416	72503416	260	10	C	G	G	32	32	ADAMTS14	G	3	3
UNC5B	219699	broad.mit.edu	37	10	73046577	73046577	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:73046577G>C	uc001jro.2	+	5	1129	c.684G>C	c.(682-684)AAG>AAC	p.K228N	UNC5B_uc001jrp.2_Missense_Mutation_p.K228N	NM_170744	NP_734465	Q8IZJ1	UNC5B_HUMAN	unc-5 homolog B precursor	228	Ig-like C2-type.|Extracellular (Potential).				apoptosis|axon guidance|regulation of apoptosis	integral to membrane				ovary(2)|lung(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	73046577	73046577	17550	10	G	C	C	33	33	UNC5B	C	3	3
CDH23	64072	broad.mit.edu	37	10	73501524	73501524	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:73501524C>G	uc001jrx.3	+	36	5068	c.4691C>G	c.(4690-4692)TCC>TGC	p.S1564C	CDH23_uc001jsc.1_Missense_Mutation_p.S371C	NM_022124	NP_071407	Q9H251	CAD23_HUMAN	cadherin-like 23 isoform 1 precursor	1564	Cadherin 15.|Extracellular (Potential).				calcium ion transport|calcium-dependent cell-cell adhesion|cytosolic calcium ion homeostasis|equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	cytosol|integral to membrane|plasma membrane|stereocilium	calcium ion binding|protein binding			central_nervous_system(5)|large_intestine(4)|ovary(2)	11																		---	---	---	---	capture		Missense_Mutation	SNP	73501524	73501524	3237	10	C	G	G	30	30	CDH23	G	3	3
TTC18	118491	broad.mit.edu	37	10	75013743	75013743	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:75013743G>A	uc009xrc.2	-	28	3477	c.3356C>T	c.(3355-3357)CCA>CTA	p.P1119L	TTC18_uc001jty.2_Missense_Mutation_p.P1119L|MRPS16_uc010qkh.1_5'Flank|MRPS16_uc001jts.1_5'Flank|MRPS16_uc001jtt.1_5'Flank|uc001jtu.1_RNA|TTC18_uc001jtv.3_Missense_Mutation_p.P223L|TTC18_uc001jtw.3_Missense_Mutation_p.P193L|TTC18_uc001jtx.2_Missense_Mutation_p.P470L	NM_145170	NP_660153	Q5T0N1	TTC18_HUMAN	tetratricopeptide repeat domain 18	1119							binding			ovary(2)|central_nervous_system(1)	3	Prostate(51;0.0119)																	---	---	---	---	capture		Missense_Mutation	SNP	75013743	75013743	17239	10	G	A	A	47	47	TTC18	A	2	2
KIAA0913	23053	broad.mit.edu	37	10	75550015	75550015	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:75550015G>T	uc009xrl.2	+	7	938	c.906G>T	c.(904-906)CTG>CTT	p.L302L	KIAA0913_uc001jve.2_Silent_p.L302L|KIAA0913_uc001jvf.2_Silent_p.L302L|KIAA0913_uc001jvh.2_5'Flank|KIAA0913_uc001jvi.2_5'Flank|KIAA0913_uc010qkr.1_5'Flank|KIAA0913_uc001jvj.2_5'Flank	NM_015037	NP_055852	A7E2V4	K0913_HUMAN	hypothetical protein LOC23053	302							zinc ion binding			breast(1)	1	Prostate(51;0.0112)																	---	---	---	---	capture		Silent	SNP	75550015	75550015	8507	10	G	T	T	46	46	KIAA0913	T	2	2
POLR3A	11128	broad.mit.edu	37	10	79777381	79777381	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:79777381C>A	uc001jzn.2	-	10	1477	c.1383G>T	c.(1381-1383)CTG>CTT	p.L461L		NM_007055	NP_008986	O14802	RPC1_HUMAN	polymerase (RNA) III (DNA directed) polypeptide	461					innate immune response|positive regulation of interferon-beta production|response to virus|termination of RNA polymerase III transcription|transcription elongation from RNA polymerase III promoter	DNA-directed RNA polymerase III complex	DNA binding|DNA-directed RNA polymerase activity|ribonucleoside binding|zinc ion binding				0	all_cancers(46;0.0356)|all_epithelial(25;0.00102)|Breast(12;0.00124)|Prostate(51;0.0095)		Epithelial(14;0.00161)|OV - Ovarian serous cystadenocarcinoma(4;0.00323)|all cancers(16;0.00646)															---	---	---	---	capture		Silent	SNP	79777381	79777381	12656	10	C	A	A	17	17	POLR3A	A	2	2
SFTPA1	653509	broad.mit.edu	37	10	81373497	81373497	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:81373497C>T	uc001kap.2	+	6	496	c.375C>T	c.(373-375)CTC>CTT	p.L125L	SFTPA1_uc001kaq.2_Silent_p.L125L|SFTPA1_uc009xry.2_Silent_p.L140L|SFTPA1_uc001kar.2_Silent_p.L125L|SFTPA1_uc010qlt.1_Silent_p.L66L|SFTPA1_uc009xrz.2_Silent_p.L55L|SFTPA1_uc009xsa.2_Silent_p.L125L|SFTPA1_uc009xsf.2_5'Flank	NM_005411	NP_005402	Q8IWL2	SFTA1_HUMAN	surfactant protein A1 isoform 1	125					cell junction assembly|respiratory gaseous exchange	collagen|extracellular space	lipid transporter activity|sugar binding				0	all_cancers(46;0.197)|Breast(12;0.000326)|Prostate(51;0.00985)|all_epithelial(25;0.0149)		Epithelial(14;0.00957)|all cancers(16;0.0179)|Colorectal(32;0.229)															---	---	---	---	capture		Silent	SNP	81373497	81373497	14680	10	C	T	T	29	29	SFTPA1	T	2	2
CDHR1	92211	broad.mit.edu	37	10	85968559	85968559	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:85968559G>C	uc001kcv.2	+	12	1242	c.1242G>C	c.(1240-1242)CTG>CTC	p.L414L	CDHR1_uc001kcw.2_Silent_p.L414L|CDHR1_uc009xst.2_Silent_p.L173L	NM_033100	NP_149091	Q96JP9	CDHR1_HUMAN	protocadherin 21 precursor	414	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion		calcium ion binding|receptor activity			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	85968559	85968559	3247	10	G	C	C	45	45	CDHR1	C	3	3
GPR120	338557	broad.mit.edu	37	10	95347066	95347066	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95347066C>G	uc010qnt.1	+	4	890	c.834C>G	c.(832-834)CTC>CTG	p.L278L	GPR120_uc010qnu.1_Silent_p.L262L	NM_181745	NP_859529	Q5NUL3	O3FA1_HUMAN	G protein-coupled receptor 120	278	Cytoplasmic (Potential).				negative regulation of cytokine secretion|negative regulation of inflammatory response|regulation of glucose transport	integral to membrane|plasma membrane	fatty acid binding				0		Colorectal(252;0.122)																---	---	---	---	capture		Silent	SNP	95347066	95347066	6910	10	C	G	G	32	32	GPR120	G	3	3
ARHGAP19	84986	broad.mit.edu	37	10	99003889	99003889	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99003889G>A	uc001knb.2	-	8	1050	c.1021C>T	c.(1021-1023)CAT>TAT	p.H341Y	ARHGAP19_uc001kmy.2_RNA|ARHGAP19_uc001kna.2_Missense_Mutation_p.H332Y|ARHGAP19_uc009xvi.2_RNA|ARHGAP19_uc009xvj.2_Missense_Mutation_p.H312Y|ARHGAP19_uc009xvk.2_Missense_Mutation_p.H135Y	NM_032900	NP_116289	Q14CB8	RHG19_HUMAN	Rho GTPase activating protein 19	341					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|nucleus	GTPase activator activity				0		Colorectal(252;0.0854)		Epithelial(162;7.65e-09)|all cancers(201;4.49e-07)														---	---	---	---	capture		Missense_Mutation	SNP	99003889	99003889	880	10	G	A	A	45	45	ARHGAP19	A	2	2
DNMBP	23268	broad.mit.edu	37	10	101656026	101656026	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101656026G>A	uc001kqj.2	-	10	3141	c.3049C>T	c.(3049-3051)CAG>TAG	p.Q1017*	DNMBP_uc010qpl.1_Intron|DNMBP_uc001kqg.2_Nonsense_Mutation_p.Q305*|DNMBP_uc001kqh.2_Nonsense_Mutation_p.Q649*	NM_015221	NP_056036	Q6XZF7	DNMBP_HUMAN	dynamin binding protein	1017	BAR.				intracellular signal transduction|regulation of Rho protein signal transduction	cell junction|cytoskeleton|Golgi stack|synapse	protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(5)|skin(1)	6		Colorectal(252;0.234)		Epithelial(162;2.94e-10)|all cancers(201;3.15e-08)														---	---	---	---	capture		Nonsense_Mutation	SNP	101656026	101656026	4857	10	G	A	A	45	45	DNMBP	A	5	2
TLX1NB	100038246	broad.mit.edu	37	10	102849512	102849512	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102849512G>T	uc001ksv.2	-	3	1448	c.151C>A	c.(151-153)CCG>ACG	p.P51T		NM_001085398	NP_001078867	P0CAT3	TLXNB_HUMAN	TLX1 divergent	51											0																		---	---	---	---	capture		Missense_Mutation	SNP	102849512	102849512	16490	10	G	T	T	43	43	TLX1NB	T	2	2
TDRD1	56165	broad.mit.edu	37	10	115986958	115986958	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:115986958G>T	uc001lbg.1	+	23	3456	c.3303G>T	c.(3301-3303)GAG>GAT	p.E1101D	TDRD1_uc001lbf.2_Missense_Mutation_p.E978D|TDRD1_uc001lbh.1_Missense_Mutation_p.E1088D|TDRD1_uc001lbi.1_Missense_Mutation_p.E1092D|TDRD1_uc010qsc.1_Intron|TDRD1_uc001lbj.2_Missense_Mutation_p.E810D	NM_198795	NP_942090	Q9BXT4	TDRD1_HUMAN	tudor domain containing 1	1101					DNA methylation involved in gamete generation|gene silencing by RNA|germ cell development|meiosis|multicellular organismal development|piRNA metabolic process|spermatogenesis	pi-body	nucleic acid binding|protein binding|zinc ion binding				0		Colorectal(252;0.172)|Breast(234;0.188)		Epithelial(162;0.0343)|all cancers(201;0.0754)														---	---	---	---	capture		Missense_Mutation	SNP	115986958	115986958	16256	10	G	T	T	33	33	TDRD1	T	2	2
ATRNL1	26033	broad.mit.edu	37	10	116919865	116919865	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:116919865C>A	uc001lcg.2	+	6	1280	c.894C>A	c.(892-894)CCC>CCA	p.P298P	ATRNL1_uc001lce.2_RNA|ATRNL1_uc001lcf.2_Silent_p.P298P|ATRNL1_uc009xyq.2_Silent_p.P298P	NM_207303	NP_997186	Q5VV63	ATRN1_HUMAN	attractin-like 1 precursor	298	Extracellular (Potential).					integral to membrane	sugar binding			ovary(5)|lung(1)|central_nervous_system(1)	7		all_lung(145;0.0686)|Breast(234;0.0969)|Lung NSC(174;0.17)|Colorectal(252;0.234)		Epithelial(162;0.00031)|all cancers(201;0.000753)|LUSC - Lung squamous cell carcinoma(1;0.0515)|Lung(30;0.0827)														---	---	---	---	capture		Silent	SNP	116919865	116919865	1226	10	C	A	A	24	24	ATRNL1	A	2	2
C10orf96	374355	broad.mit.edu	37	10	118101703	118101703	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118101703G>C	uc001lck.2	+	5	689	c.438G>C	c.(436-438)ATG>ATC	p.M146I		NM_198515	NP_940917	P0C7W6	CJ096_HUMAN	hypothetical protein LOC374355	146	Potential.									ovary(2)	2		Lung NSC(174;0.204)|all_lung(145;0.248)		all cancers(201;0.014)														---	---	---	---	capture		Missense_Mutation	SNP	118101703	118101703	1664	10	G	C	C	48	48	C10orf96	C	3	3
PNLIPRP3	119548	broad.mit.edu	37	10	118220751	118220751	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118220751G>A	uc001lcl.3	+	7	858	c.757G>A	c.(757-759)GAA>AAA	p.E253K		NM_001011709	NP_001011709	Q17RR3	LIPR3_HUMAN	pancreatic lipase-related protein 3 precursor	253					lipid catabolic process	extracellular region	triglyceride lipase activity			ovary(1)	1				all cancers(201;0.0131)														---	---	---	---	capture		Missense_Mutation	SNP	118220751	118220751	12578	10	G	A	A	45	45	PNLIPRP3	A	2	2
PPAPDC1A	196051	broad.mit.edu	37	10	122273500	122273500	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:122273500G>T	uc001lev.1	+	3	595	c.243G>T	c.(241-243)AAG>AAT	p.K81N	PPAPDC1A_uc010qtd.1_Missense_Mutation_p.K81N|PPAPDC1A_uc009xzl.1_Missense_Mutation_p.K81N|PPAPDC1A_uc001lew.1_Intron|PPAPDC1A_uc001lex.1_Intron|PPAPDC1A_uc001ley.1_Translation_Start_Site	NM_001030059	NP_001025230	Q5VZY2	PPC1A_HUMAN	phosphatidic acid phosphatase type 2 domain	81					phospholipid dephosphorylation	integral to membrane	phosphatidate phosphatase activity			breast(1)	1		Lung NSC(174;0.1)|all_lung(145;0.132)		all cancers(201;0.0117)														---	---	---	---	capture		Missense_Mutation	SNP	122273500	122273500	12723	10	G	T	T	35	35	PPAPDC1A	T	2	2
TACC2	10579	broad.mit.edu	37	10	123846008	123846008	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:123846008G>A	uc001lfv.2	+	4	4353	c.3993G>A	c.(3991-3993)CGG>CGA	p.R1331R	TACC2_uc001lfw.2_Intron|TACC2_uc009xzx.2_Silent_p.R1331R|TACC2_uc010qtv.1_Silent_p.R1331R	NM_206862	NP_996744	O95359	TACC2_HUMAN	transforming, acidic coiled-coil containing	1331						microtubule organizing center|nucleus	nuclear hormone receptor binding			ovary(4)|breast(3)|skin(2)|central_nervous_system(1)	10		all_neural(114;0.0656)|Lung NSC(174;0.136)|all_lung(145;0.17)|Breast(234;0.197)																---	---	---	---	capture		Silent	SNP	123846008	123846008	16023	10	G	A	A	41	41	TACC2	A	2	2
GPR26	2849	broad.mit.edu	37	10	125447671	125447671	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:125447671G>C	uc001lhh.2	+	3	1062	c.1009G>C	c.(1009-1011)GAG>CAG	p.E337Q		NM_153442	NP_703143	Q8NDV2	GPR26_HUMAN	G protein-coupled receptor 26	337	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			skin(1)	1		Colorectal(57;0.178)|Glioma(114;0.222)|all_neural(114;0.226)																---	---	---	---	capture		Missense_Mutation	SNP	125447671	125447671	6959	10	G	C	C	45	45	GPR26	C	3	3
DOCK1	1793	broad.mit.edu	37	10	129201358	129201358	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:129201358G>A	uc001ljt.2	+	39	3968	c.3904G>A	c.(3904-3906)GAG>AAG	p.E1302K	DOCK1_uc010qun.1_Missense_Mutation_p.E1323K|DOCK1_uc009yaq.2_Missense_Mutation_p.E297K	NM_001380	NP_001371	Q14185	DOCK1_HUMAN	dedicator of cytokinesis 1	1302	DHR-2.				apoptosis|axon guidance|blood coagulation|integrin-mediated signaling pathway|phagocytosis, engulfment|small GTPase mediated signal transduction	cytosol|membrane	GTP binding|GTPase activator activity|GTPase binding|guanyl-nucleotide exchange factor activity|SH3 domain binding			central_nervous_system(4)|ovary(2)|lung(1)|breast(1)|kidney(1)	9		all_epithelial(44;2.3e-07)|all_lung(145;0.00466)|Lung NSC(174;0.00685)|Colorectal(57;0.0107)|Renal(717;0.0113)|Breast(234;0.0492)|all_neural(114;0.108)|all_hematologic(284;0.14)		BRCA - Breast invasive adenocarcinoma(275;0.0221)|Colorectal(40;0.115)														---	---	---	---	capture		Missense_Mutation	SNP	129201358	129201358	4868	10	G	A	A	37	37	DOCK1	A	1	1
PTPRE	5791	broad.mit.edu	37	10	129868640	129868640	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:129868640C>A	uc001lkb.2	+	14	1498	c.1219C>A	c.(1219-1221)CTG>ATG	p.L407M	PTPRE_uc009yat.2_Missense_Mutation_p.L418M|PTPRE_uc009yau.2_Missense_Mutation_p.L407M|PTPRE_uc001lkd.2_Missense_Mutation_p.L349M|PTPRE_uc010quq.1_Missense_Mutation_p.L308M	NM_006504	NP_006495	P23469	PTPRE_HUMAN	protein tyrosine phosphatase, receptor type, E	407	Cytoplasmic (Potential).				negative regulation of insulin receptor signaling pathway|protein phosphorylation	cytoplasm|integral to membrane|intermediate filament cytoskeleton|nucleus|plasma membrane	transmembrane receptor protein tyrosine phosphatase activity			ovary(1)	1		all_epithelial(44;1.66e-05)|all_lung(145;0.00456)|Lung NSC(174;0.0066)|all_neural(114;0.0936)|Colorectal(57;0.141)|Breast(234;0.166)|Melanoma(40;0.203)																---	---	---	---	capture		Missense_Mutation	SNP	129868640	129868640	13257	10	C	A	A	24	24	PTPRE	A	2	2
TALDO1	6888	broad.mit.edu	37	11	764383	764383	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:764383G>T	uc001lqz.2	+	7	981	c.931G>T	c.(931-933)GGG>TGG	p.G311W	TALDO1_uc001lra.2_Silent_p.T309T	NM_006755	NP_006746	P37837	TALDO_HUMAN	transaldolase 1	311					energy reserve metabolic process|xylulose biosynthetic process	cytosol	protein binding|sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity				0		all_cancers(49;1.13e-08)|all_epithelial(84;2.95e-05)|Breast(177;0.000286)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.159)|all_lung(207;0.198)		all cancers(45;4.66e-26)|Epithelial(43;2.97e-25)|OV - Ovarian serous cystadenocarcinoma(40;1.48e-19)|BRCA - Breast invasive adenocarcinoma(625;4.41e-05)|Lung(200;0.0595)|LUSC - Lung squamous cell carcinoma(625;0.0712)														---	---	---	---	capture		Missense_Mutation	SNP	764383	764383	16064	11	G	T	T	39	39	TALDO1	T	1	1
MUC5B	727897	broad.mit.edu	37	11	1261425	1261425	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1261425G>A	uc009ycr.1	+	46	5995	c.5869G>A	c.(5869-5871)GAG>AAG	p.E1957K	MUC5B_uc001ltb.2_Missense_Mutation_p.E1267K|MUC5B_uc001lta.2_Missense_Mutation_p.E932K	NM_017511	NP_059981	Q9HC84	MUC5B_HUMAN	SubName: Full=Mucin 5AC, oligomeric mucus/gel-forming;	1264					cell adhesion	extracellular region	extracellular matrix structural constituent|protein binding				0		all_cancers(49;6.97e-08)|all_epithelial(84;3.45e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		BRCA - Breast invasive adenocarcinoma(625;0.00141)|Lung(200;0.0853)|LUSC - Lung squamous cell carcinoma(625;0.1)														---	---	---	---	capture		Missense_Mutation	SNP	1261425	1261425	10373	11	G	A	A	45	45	MUC5B	A	2	2
KCNQ1	3784	broad.mit.edu	37	11	2604670	2604670	+	Silent	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:2604670A>T	uc001lwn.2	+	7	1035	c.927A>T	c.(925-927)ACA>ACT	p.T309T	KCNQ1_uc009ydp.1_Silent_p.T93T|KCNQ1_uc001lwo.2_Silent_p.T182T	NM_000218	NP_000209	P51787	KCNQ1_HUMAN	potassium voltage-gated channel, KQT-like	309			T -> R (in LQT1).		blood circulation|membrane depolarization|muscle contraction|sensory perception of sound		delayed rectifier potassium channel activity|protein binding			ovary(1)	1		all_epithelial(84;3.26e-05)|Breast(177;0.001)|Medulloblastoma(188;0.00111)|Ovarian(85;0.00158)|all_neural(188;0.00725)|all_lung(207;0.11)|Lung NSC(207;0.159)		BRCA - Breast invasive adenocarcinoma(625;0.00251)|Lung(200;0.131)	Bepridil(DB01244)|Indapamide(DB00808)													---	---	---	---	capture		Silent	SNP	2604670	2604670	8387	11	A	T	T	7	7	KCNQ1	T	4	4
OR52I2	143502	broad.mit.edu	37	11	4608328	4608328	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4608328C>T	uc010qyh.1	+	1	286	c.286C>T	c.(286-288)CTG>TTG	p.L96L		NM_001005170	NP_001005170	Q8NH67	O52I2_HUMAN	olfactory receptor, family 52, subfamily I,	96	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			pancreas(1)	1		Medulloblastoma(188;0.0075)|Breast(177;0.0461)|all_neural(188;0.0577)		Epithelial(150;8.45e-12)|BRCA - Breast invasive adenocarcinoma(625;0.0285)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---	capture		Silent	SNP	4608328	4608328	11531	11	C	T	T	32	32	OR52I2	T	2	2
OR51S1	119692	broad.mit.edu	37	11	4869826	4869826	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4869826A>G	uc010qyo.1	-	1	613	c.613T>C	c.(613-615)TAC>CAC	p.Y205H		NM_001004758	NP_001004758	Q8NGJ8	O51S1_HUMAN	olfactory receptor, family 51, subfamily S,	205	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|upper_aerodigestive_tract(1)|ovary(1)	4		Medulloblastoma(188;0.0075)|all_neural(188;0.0577)|Breast(177;0.086)		Epithelial(150;5.06e-12)|BRCA - Breast invasive adenocarcinoma(625;0.00438)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---	capture		Missense_Mutation	SNP	4869826	4869826	11515	11	A	G	G	15	15	OR51S1	G	4	4
OR51S1	119692	broad.mit.edu	37	11	4869963	4869963	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4869963C>T	uc010qyo.1	-	1	476	c.476G>A	c.(475-477)CGA>CAA	p.R159Q		NM_001004758	NP_001004758	Q8NGJ8	O51S1_HUMAN	olfactory receptor, family 51, subfamily S,	159	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|upper_aerodigestive_tract(1)|ovary(1)	4		Medulloblastoma(188;0.0075)|all_neural(188;0.0577)|Breast(177;0.086)		Epithelial(150;5.06e-12)|BRCA - Breast invasive adenocarcinoma(625;0.00438)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---	capture		Missense_Mutation	SNP	4869963	4869963	11515	11	C	T	T	31	31	OR51S1	T	1	1
OR52A5	390054	broad.mit.edu	37	11	5153427	5153427	+	Missense_Mutation	SNP	C	A	A	rs144335026		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5153427C>A	uc010qyx.1	-	1	446	c.446G>T	c.(445-447)GGG>GTG	p.G149V		NM_001005160	NP_001005160	Q9H2C5	O52A5_HUMAN	olfactory receptor, family 52, subfamily A,	149	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|lung(1)|central_nervous_system(1)	4		Medulloblastoma(188;0.0049)|all_neural(188;0.0442)|Breast(177;0.0675)		Epithelial(150;1.74e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)|LUSC - Lung squamous cell carcinoma(625;0.2)														---	---	---	---	capture		Missense_Mutation	SNP	5153427	5153427	11520	11	C	A	A	22	22	OR52A5	A	2	2
HBB	3043	broad.mit.edu	37	11	5246869	5246869	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5246869C>A	uc001mae.1	-	3	453	c.403G>T	c.(403-405)GTG>TTG	p.V135L		NM_000518	NP_000509	P68871	HBB_HUMAN	beta globin	135			V -> E (in North Shore-Caracas; unstable).		blood coagulation|hydrogen peroxide catabolic process|nitric oxide transport|positive regulation of cell death|positive regulation of nitric oxide biosynthetic process|protein heterooligomerization|regulation of blood pressure|regulation of blood vessel size	haptoglobin-hemoglobin complex|hemoglobin complex	heme binding|hemoglobin binding|oxygen binding|oxygen transporter activity			central_nervous_system(1)	1		Medulloblastoma(188;0.00225)|Breast(177;0.0155)|all_neural(188;0.0212)		Epithelial(150;2.76e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)	Iron Dextran(DB00893)									Sickle_Cell_Trait				---	---	---	---	capture		Missense_Mutation	SNP	5246869	5246869	7260	11	C	A	A	18	18	HBB	A	2	2
UBQLN3	50613	broad.mit.edu	37	11	5529375	5529375	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5529375G>T	uc001may.1	-	2	1500	c.1414C>A	c.(1414-1416)CCT>ACT	p.P472T	HBG2_uc001mak.1_Intron|HBE1_uc001mam.1_5'Flank|OR51B5_uc001maq.1_5'Flank	NM_017481	NP_059509	Q9H347	UBQL3_HUMAN	ubiquilin 3	472										ovary(3)	3		Medulloblastoma(188;0.00225)|Breast(177;0.0155)|all_neural(188;0.0212)		Epithelial(150;1.74e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---	capture		Missense_Mutation	SNP	5529375	5529375	17456	11	G	T	T	43	43	UBQLN3	T	2	2
CNGA4	1262	broad.mit.edu	37	11	6261502	6261502	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6261502C>A	uc001mco.2	+	4	585	c.478C>A	c.(478-480)CGC>AGC	p.R160S	CNGA4_uc010raa.1_Intron|CNGA4_uc001mcn.2_Missense_Mutation_p.R120S	NM_001037329	NP_001032406	Q8IV77	CNGA4_HUMAN	cyclic nucleotide gated channel alpha 4	160	Extracellular (Potential).				response to stimulus|sensory perception of smell		cAMP binding			skin(1)	1		Medulloblastoma(188;0.00263)|all_neural(188;0.026)|Breast(177;0.029)		Epithelial(150;2.04e-08)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---	capture		Missense_Mutation	SNP	6261502	6261502	3737	11	C	A	A	23	23	CNGA4	A	1	1
OR2D3	120775	broad.mit.edu	37	11	6942862	6942862	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6942862C>A	uc010rav.1	+	1	630	c.630C>A	c.(628-630)AGC>AGA	p.S210R		NM_001004684	NP_001004684	Q8NGH3	OR2D3_HUMAN	olfactory receptor, family 2, subfamily D,	210	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0		Medulloblastoma(188;0.0523)|all_neural(188;0.236)		Epithelial(150;4.78e-08)|BRCA - Breast invasive adenocarcinoma(625;0.129)														---	---	---	---	capture		Missense_Mutation	SNP	6942862	6942862	11401	11	C	A	A	25	25	OR2D3	A	2	2
ZNF215	7762	broad.mit.edu	37	11	6977732	6977732	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6977732T>A	uc001mey.2	+	7	2112	c.1524T>A	c.(1522-1524)CAT>CAA	p.H508Q	ZNF215_uc010raw.1_3'UTR|ZNF215_uc010rax.1_Missense_Mutation_p.H270Q|ZNF215_uc001mez.1_Intron	NM_013250	NP_037382	Q9UL58	ZN215_HUMAN	zinc finger protein 215	508	C2H2-type 4.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0				Epithelial(150;6.33e-08)|BRCA - Breast invasive adenocarcinoma(625;0.134)														---	---	---	---	capture		Missense_Mutation	SNP	6977732	6977732	18362	11	T	A	A	50	50	ZNF215	A	4	4
ZNF215	7762	broad.mit.edu	37	11	6977739	6977739	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6977739C>A	uc001mey.2	+	7	2119	c.1531C>A	c.(1531-1533)CTG>ATG	p.L511M	ZNF215_uc010raw.1_3'UTR|ZNF215_uc010rax.1_Missense_Mutation_p.L273M|ZNF215_uc001mez.1_Intron	NM_013250	NP_037382	Q9UL58	ZN215_HUMAN	zinc finger protein 215	511	C2H2-type 4.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0				Epithelial(150;6.33e-08)|BRCA - Breast invasive adenocarcinoma(625;0.134)														---	---	---	---	capture		Missense_Mutation	SNP	6977739	6977739	18362	11	C	A	A	20	20	ZNF215	A	2	2
OR5P2	120065	broad.mit.edu	37	11	7817698	7817698	+	Silent	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:7817698A>T	uc001mfp.1	-	1	792	c.792T>A	c.(790-792)ACT>ACA	p.T264T		NM_153444	NP_703145	Q8WZ92	OR5P2_HUMAN	olfactory receptor, family 5, subfamily P,	264	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(2)|central_nervous_system(1)	5				Epithelial(150;8.62e-08)|BRCA - Breast invasive adenocarcinoma(625;0.189)														---	---	---	---	capture		Silent	SNP	7817698	7817698	11588	11	A	T	T	7	7	OR5P2	T	4	4
ST5	6764	broad.mit.edu	37	11	8737282	8737282	+	Missense_Mutation	SNP	C	A	A	rs139182184		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:8737282C>A	uc001mgt.2	-	6	1899	c.1713G>T	c.(1711-1713)AAG>AAT	p.K571N	ST5_uc009yfr.2_Missense_Mutation_p.K151N|ST5_uc001mgu.2_Missense_Mutation_p.K151N|ST5_uc001mgv.2_Missense_Mutation_p.K571N|ST5_uc010rbq.1_RNA|ST5_uc010rbp.1_Missense_Mutation_p.K84N	NM_213618	NP_998783	P78524	ST5_HUMAN	suppression of tumorigenicity 5 isoform 1	571					positive regulation of ERK1 and ERK2 cascade		protein binding			upper_aerodigestive_tract(1)	1				Epithelial(150;2.63e-07)|BRCA - Breast invasive adenocarcinoma(625;0.0352)														---	---	---	---	capture		Missense_Mutation	SNP	8737282	8737282	15738	11	C	A	A	32	32	ST5	A	2	2
SBF2	81846	broad.mit.edu	37	11	9861114	9861114	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:9861114C>A	uc001mib.2	-	26	3524	c.3386G>T	c.(3385-3387)AGC>ATC	p.S1129I	SBF2_uc001mif.3_Missense_Mutation_p.S885I|uc001mig.2_Intron	NM_030962	NP_112224	Q86WG5	MTMRD_HUMAN	SET binding factor 2	1129	Myotubularin phosphatase.				myelination	cytoplasm|membrane	phosphatase activity|protein binding			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3				all cancers(16;2.88e-11)|Epithelial(150;3.61e-10)|BRCA - Breast invasive adenocarcinoma(625;0.00887)														---	---	---	---	capture		Missense_Mutation	SNP	9861114	9861114	14340	11	C	A	A	28	28	SBF2	A	2	2
CALCA	796	broad.mit.edu	37	11	14989261	14989261	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:14989261G>T	uc001mlt.1	-	4	442	c.367C>A	c.(367-369)CGC>AGC	p.R123S	CALCA_uc001mlu.1_RNA	NM_001033953	NP_001029125	P06881	CALCA_HUMAN	calcitonin isoform CGRP preproprotein	123					activation of adenylate cyclase activity|cell-cell signaling|elevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger|endothelial cell migration|endothelial cell proliferation|leukocyte cell-cell adhesion|negative regulation of blood pressure|negative regulation of bone resorption|negative regulation of calcium ion transport into cytosol|negative regulation of osteoclast differentiation|neurological system process involved in regulation of systemic arterial blood pressure|positive regulation of interleukin-1 alpha production|positive regulation of interleukin-8 production|positive regulation of macrophage differentiation|positive regulation of vasodilation|regulation of blood pressure|vasculature development|vasodilation	cytosol|extracellular space	hormone activity			central_nervous_system(1)	1					Phentolamine(DB00692)													---	---	---	---	capture		Missense_Mutation	SNP	14989261	14989261	2691	11	G	T	T	39	39	CALCA	T	1	1
MRGPRX3	117195	broad.mit.edu	37	11	18158752	18158752	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:18158752G>C	uc001mnu.2	+	3	364	c.3G>C	c.(1-3)ATG>ATC	p.M1I		NM_054031	NP_473372	Q96LB0	MRGX3_HUMAN	MAS-related GPR, member X3	1	Extracellular (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(1)|pancreas(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	18158752	18158752	10161	11	G	C	C	47	47	MRGPRX3	C	3	3
BDNF	627	broad.mit.edu	37	11	27680064	27680064	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:27680064C>T	uc010rdu.1	-	2	899	c.48G>A	c.(46-48)ATG>ATA	p.M16I	BDNFOS_uc001mrm.2_Intron|BDNFOS_uc009yij.2_RNA|BDNFOS_uc009yik.2_Intron|BDNFOS_uc009yil.2_RNA|BDNFOS_uc001mrp.2_Intron|BDNFOS_uc009yim.2_RNA|BDNFOS_uc009yin.2_Intron|BDNFOS_uc009yio.2_RNA|BDNFOS_uc009yip.2_RNA|BDNFOS_uc001mrn.2_Intron|BDNFOS_uc009yiq.2_RNA|BDNFOS_uc001mro.2_Intron|BDNFOS_uc009yir.2_RNA|BDNFOS_uc009yis.2_Intron|BDNFOS_uc009yit.2_Intron|BDNFOS_uc009yiu.2_RNA|BDNFOS_uc009yiv.2_Intron|BDNFOS_uc009yiw.2_RNA|BDNFOS_uc009yix.2_Intron|BDNFOS_uc009yiy.2_RNA|BDNFOS_uc009yiz.2_RNA|BDNFOS_uc001mrq.3_Intron|BDNFOS_uc001mrr.3_Intron|BDNFOS_uc009yja.2_Intron|BDNFOS_uc009yjb.2_RNA|BDNF_uc010rdv.1_Missense_Mutation_p.M16I|BDNF_uc001mrt.2_Missense_Mutation_p.M31I|BDNF_uc010rdw.1_Missense_Mutation_p.M16I|BDNF_uc009yjd.2_Missense_Mutation_p.M16I|BDNF_uc001mru.2_Missense_Mutation_p.M16I|BDNF_uc010rdx.1_Missense_Mutation_p.M16I|BDNF_uc010rdy.1_Missense_Mutation_p.M16I|BDNF_uc009yjg.2_Missense_Mutation_p.M16I|BDNF_uc009yje.2_Missense_Mutation_p.M98I|BDNF_uc009yjf.2_Missense_Mutation_p.M45I|BDNF_uc001mrv.2_Missense_Mutation_p.M16I|BDNF_uc001mrw.3_Missense_Mutation_p.M16I|BDNF_uc001mrx.2_Missense_Mutation_p.M16I|BDNF_uc001mry.3_Missense_Mutation_p.M16I|BDNF_uc001mrz.3_Missense_Mutation_p.M16I|BDNF_uc001msa.2_Missense_Mutation_p.M24I	NM_001143816	NP_001137288	P23560	BDNF_HUMAN	brain-derived neurotrophic factor isoform a	16						extracellular region	growth factor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	27680064	27680064	1416	11	C	T	T	29	29	BDNF	T	2	2
KCNA4	3739	broad.mit.edu	37	11	30032317	30032317	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:30032317C>T	uc001msk.2	-	2	3061	c.1909G>A	c.(1909-1911)GAG>AAG	p.E637K		NM_002233	NP_002224	P22459	KCNA4_HUMAN	potassium voltage-gated channel, shaker-related	637						voltage-gated potassium channel complex	potassium ion binding|protein binding|voltage-gated potassium channel activity			ovary(2)|central_nervous_system(1)|pancreas(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	30032317	30032317	8310	11	C	T	T	29	29	KCNA4	T	2	2
DCDC1	341019	broad.mit.edu	37	11	31327851	31327851	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31327851C>A	uc001msv.2	-	5	721	c.519G>T	c.(517-519)GTG>GTT	p.V173V	DCDC1_uc001msu.1_5'UTR	NM_181807	NP_861523	P59894	DCDC1_HUMAN	doublecortin domain containing 1	173	Doublecortin.				intracellular signal transduction					skin(1)	1	Lung SC(675;0.225)																	---	---	---	---	capture		Silent	SNP	31327851	31327851	4455	11	C	A	A	29	29	DCDC1	A	2	2
PAX6	5080	broad.mit.edu	37	11	31815649	31815649	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31815649G>T	uc001mtd.3	-	8	1586	c.696C>A	c.(694-696)ACC>ACA	p.T232T	PAX6_uc001mte.3_Silent_p.T232T|PAX6_uc001mtg.3_Silent_p.T246T|PAX6_uc001mtf.3_Silent_p.T232T|PAX6_uc001mth.3_Silent_p.T232T|PAX6_uc009yjr.2_Silent_p.T232T	NM_001127612	NP_001121084	P26367	PAX6_HUMAN	paired box gene 6 isoform a	232	Homeobox.				blood vessel development|central nervous system development|cornea development in camera-type eye|glucose homeostasis|iris morphogenesis|negative regulation of neurogenesis|neuron fate commitment|pancreatic A cell development|positive regulation of transcription, DNA-dependent|response to wounding|visual perception	cytoplasm|nuclear chromatin	R-SMAD binding|RNA polymerase II core promoter sequence-specific DNA binding|sequence-specific DNA binding RNA polymerase II transcription factor activity|ubiquitin-protein ligase activity			lung(4)|ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	9	Lung SC(675;0.225)													Wilms_tumor-Aniridia-ambiguous_Genitals-mental_Retardation				---	---	---	---	capture		Silent	SNP	31815649	31815649	11903	11	G	T	T	43	43	PAX6	T	2	2
WT1	7490	broad.mit.edu	37	11	32417924	32417924	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:32417924C>A	uc001mtn.1	-	7	1324	c.1128G>T	c.(1126-1128)CCG>CCT	p.P376P	WT1_uc001mtl.1_Silent_p.P164P|WT1_uc001mtm.1_Silent_p.P147P|WT1_uc001mto.1_Silent_p.P376P|WT1_uc001mtp.1_Silent_p.P359P|WT1_uc001mtq.1_Silent_p.P359P|WT1_uc009yjs.1_RNA	NM_024426	NP_077744	P19544	WT1_HUMAN	Wilms tumor 1 isoform D	308					adrenal cortex formation|branching involved in ureteric bud morphogenesis|camera-type eye development|cardiac muscle cell fate commitment|cellular response to cAMP|cellular response to gonadotropin stimulus|germ cell development|glomerular basement membrane development|glomerular visceral epithelial cell differentiation|induction of apoptosis|male genitalia development|male gonad development|mesenchymal to epithelial transition|metanephric epithelium development|metanephric S-shaped body morphogenesis|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of female gonad development|negative regulation of metanephric glomerular mesangial cell proliferation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|negative regulation of translation|positive regulation of male gonad development|positive regulation of transcription, DNA-dependent|posterior mesonephric tubule development|regulation of organ formation|RNA splicing|sex determination|vasculogenesis|visceral serous pericardium development	cytoplasm|nuclear speck|nucleoplasm	C2H2 zinc finger domain binding|RNA binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding	p.T309fs*73(3)|p.T309fs*12(3)|p.T309fs*9(2)|p.T309fs*8(2)|p.R301fs*3(1)|p.A307fs*69(1)|p.P308fs*67(1)|p.A307fs*70(1)|p.T309fs*75(1)|p.P308fs*9(1)|p.V300fs*6(1)|p.R301fs*73(1)|p.T309fs*71(1)|p.R302fs*12(1)	EWSR1/WT1(231)	haematopoietic_and_lymphoid_tissue(318)|soft_tissue(231)|kidney(132)|pleura(2)|lung(2)|upper_aerodigestive_tract(1)|peritoneum(1)	687	Breast(20;0.247)		OV - Ovarian serous cystadenocarcinoma(30;0.128)					D|Mis|N|F|S	EWSR1	Wilms|desmoplastic small round cell tumor	Wilms			Denys-Drash_syndrome|Frasier_syndrome|Familial_Wilms_tumor|Wilms_tumor-Aniridia-ambiguous_Genitals-mental_Retardation				---	---	---	---	capture		Silent	SNP	32417924	32417924	17982	11	C	A	A	31	31	WT1	A	1	1
WT1	7490	broad.mit.edu	37	11	32450097	32450097	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:32450097A>G	uc001mtn.1	-	2	911	c.715T>C	c.(715-717)TTC>CTC	p.F239L	WT1_uc001mtl.1_Missense_Mutation_p.F27L|WT1_uc001mtm.1_Missense_Mutation_p.F27L|WT1_uc001mto.1_Missense_Mutation_p.F239L|WT1_uc001mtp.1_Missense_Mutation_p.F239L|WT1_uc001mtq.1_Missense_Mutation_p.F239L|WT1_uc009yjs.1_RNA	NM_024426	NP_077744	P19544	WT1_HUMAN	Wilms tumor 1 isoform D	171					adrenal cortex formation|branching involved in ureteric bud morphogenesis|camera-type eye development|cardiac muscle cell fate commitment|cellular response to cAMP|cellular response to gonadotropin stimulus|germ cell development|glomerular basement membrane development|glomerular visceral epithelial cell differentiation|induction of apoptosis|male genitalia development|male gonad development|mesenchymal to epithelial transition|metanephric epithelium development|metanephric S-shaped body morphogenesis|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of female gonad development|negative regulation of metanephric glomerular mesangial cell proliferation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|negative regulation of translation|positive regulation of male gonad development|positive regulation of transcription, DNA-dependent|posterior mesonephric tubule development|regulation of organ formation|RNA splicing|sex determination|vasculogenesis|visceral serous pericardium development	cytoplasm|nuclear speck|nucleoplasm	C2H2 zinc finger domain binding|RNA binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding		EWSR1/WT1(231)	haematopoietic_and_lymphoid_tissue(318)|soft_tissue(231)|kidney(132)|pleura(2)|lung(2)|upper_aerodigestive_tract(1)|peritoneum(1)	687	Breast(20;0.247)		OV - Ovarian serous cystadenocarcinoma(30;0.128)					D|Mis|N|F|S	EWSR1	Wilms|desmoplastic small round cell tumor	Wilms			Denys-Drash_syndrome|Frasier_syndrome|Familial_Wilms_tumor|Wilms_tumor-Aniridia-ambiguous_Genitals-mental_Retardation				---	---	---	---	capture		Missense_Mutation	SNP	32450097	32450097	17982	11	A	G	G	2	2	WT1	G	4	4
CCDC73	493860	broad.mit.edu	37	11	32635972	32635972	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:32635972G>C	uc001mtv.2	-	16	1936	c.1892C>G	c.(1891-1893)TCG>TGG	p.S631W		NM_001008391	NP_001008392	Q6ZRK6	CCD73_HUMAN	sarcoma antigen NY-SAR-79	631										ovary(1)|central_nervous_system(1)	2	Breast(20;0.112)																	---	---	---	---	capture		Missense_Mutation	SNP	32635972	32635972	2969	11	G	C	C	37	37	CCDC73	C	3	3
QSER1	79832	broad.mit.edu	37	11	32956358	32956358	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:32956358G>T	uc001mty.2	+	4	3434	c.3167G>T	c.(3166-3168)AGT>ATT	p.S1056I	QSER1_uc001mtz.1_Missense_Mutation_p.S817I|QSER1_uc001mua.2_Missense_Mutation_p.S561I	NM_001076786	NP_001070254	Q2KHR3	QSER1_HUMAN	glutamine and serine rich 1	1056										ovary(3)|central_nervous_system(2)|skin(1)	6	Breast(20;0.158)																	---	---	---	---	capture		Missense_Mutation	SNP	32956358	32956358	13340	11	G	T	T	36	36	QSER1	T	2	2
C11orf41	25758	broad.mit.edu	37	11	33572687	33572687	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:33572687G>C	uc001mup.3	+	4	2854	c.2730G>C	c.(2728-2730)GTG>GTC	p.V910V	C11orf41_uc001mun.1_Silent_p.V910V	NM_012194	NP_036326	Q6ZVL6	CK041_HUMAN	hypothetical protein LOC25758	904						integral to membrane				ovary(2)	2																		---	---	---	---	capture		Silent	SNP	33572687	33572687	1679	11	G	C	C	48	48	C11orf41	C	3	3
TRAF6	7189	broad.mit.edu	37	11	36511715	36511715	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:36511715C>T	uc001mwr.1	-	8	1582	c.1242G>A	c.(1240-1242)ATG>ATA	p.M414I	uc001mwq.1_5'Flank|TRAF6_uc001mws.1_Missense_Mutation_p.M414I	NM_145803	NP_665802	Q9Y4K3	TRAF6_HUMAN	TNF receptor-associated factor 6	414	MATH.				activation of MAPK activity|activation of NF-kappaB-inducing kinase activity|anti-apoptosis|apoptosis|induction of apoptosis by extracellular signals|innate immune response|JNK cascade|membrane protein intracellular domain proteolysis|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|ossification|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-2 production|positive regulation of JUN kinase activity|positive regulation of NF-kappaB transcription factor activity|positive regulation of osteoclast differentiation|positive regulation of T cell cytokine production|protein autoubiquitination|protein K63-linked ubiquitination|response to interleukin-1|stress-activated MAPK cascade|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	CD40 receptor complex|cell cortex|cytosol|endosome membrane|internal side of plasma membrane|nuclear membrane	histone deacetylase binding|mitogen-activated protein kinase kinase kinase binding|protein kinase B binding|protein N-terminus binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1	all_lung(20;0.211)	all_hematologic(20;0.107)																---	---	---	---	capture		Missense_Mutation	SNP	36511715	36511715	16989	11	C	T	T	25	25	TRAF6	T	2	2
RAG1	5896	broad.mit.edu	37	11	36595604	36595604	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:36595604G>T	uc001mwu.3	+	2	874	c.750G>T	c.(748-750)AAG>AAT	p.K250N	RAG1_uc001mwt.2_RNA	NM_000448	NP_000439	P15918	RAG1_HUMAN	recombination activating gene 1	250	Interaction with importin alpha-1.				histone monoubiquitination|immune response|pre-B cell allelic exclusion|protein autoubiquitination|T cell differentiation in thymus|V(D)J recombination	nucleus	endonuclease activity|histone binding|protein homodimerization activity|sequence-specific DNA binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|pancreas(1)|lung(1)|kidney(1)|skin(1)	5	all_lung(20;0.226)	all_hematologic(20;0.107)												Familial_Hemophagocytic_Lymphohistiocytosis				---	---	---	---	capture		Missense_Mutation	SNP	36595604	36595604	13463	11	G	T	T	33	33	RAG1	T	2	2
LRRC4C	57689	broad.mit.edu	37	11	40137549	40137549	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:40137549G>C	uc001mxa.1	-	2	2258	c.294C>G	c.(292-294)CAC>CAG	p.H98Q	LRRC4C_uc001mxc.1_Missense_Mutation_p.H94Q|LRRC4C_uc001mxd.1_Missense_Mutation_p.H94Q|LRRC4C_uc001mxb.1_Missense_Mutation_p.H94Q	NM_020929	NP_065980	Q9HCJ2	LRC4C_HUMAN	netrin-G1 ligand precursor	98	LRR 1.				regulation of axonogenesis	integral to membrane	protein binding			ovary(4)|skin(3)|central_nervous_system(1)	8		all_lung(304;0.0575)|Lung NSC(402;0.138)																---	---	---	---	capture		Missense_Mutation	SNP	40137549	40137549	9383	11	G	C	C	36	36	LRRC4C	C	3	3
DDB2	1643	broad.mit.edu	37	11	47238436	47238436	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47238436C>G	uc001neb.2	+	3	487	c.292C>G	c.(292-294)CTG>GTG	p.L98V	DDB2_uc001nec.2_RNA|DDB2_uc009yli.1_Intron|DDB2_uc001ned.2_RNA|DDB2_uc001nee.2_Missense_Mutation_p.L98V|DDB2_uc001nef.2_Missense_Mutation_p.L84V|DDB2_uc001neg.2_5'UTR|DDB2_uc001neh.2_RNA	NM_000107	NP_000098	Q92466	DDB2_HUMAN	damage-specific DNA binding protein 2	98	Required for interaction with DDB1.				nucleotide-excision repair, DNA damage removal|protein autoubiquitination|protein polyubiquitination|response to UV	nucleoplasm|protein complex	damaged DNA binding|protein binding			kidney(2)|ovary(1)	3								Mis|N			skin basal cell|skin squamous cell|melanoma		Direct_reversal_of_damage|NER	Xeroderma_Pigmentosum				---	---	---	---	capture		Missense_Mutation	SNP	47238436	47238436	4495	11	C	G	G	32	32	DDB2	G	3	3
MADD	8567	broad.mit.edu	37	11	47312322	47312322	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47312322C>T	uc001ner.1	+	20	3507	c.3316C>T	c.(3316-3318)CTG>TTG	p.L1106L	MADD_uc001neq.2_Silent_p.L1086L|MADD_uc001nev.1_Silent_p.L1043L|MADD_uc001nes.1_Silent_p.L1063L|MADD_uc001net.1_Silent_p.L1106L|MADD_uc009yln.1_Silent_p.L1043L|MADD_uc001neu.1_Silent_p.L1043L|MADD_uc001nex.2_Silent_p.L1106L|MADD_uc001nez.2_Silent_p.L1043L|MADD_uc001new.2_Silent_p.L1086L|MADD_uc009ylo.2_Silent_p.L24L	NM_003682	NP_003673	Q8WXG6	MADD_HUMAN	MAP-kinase activating death domain-containing	1106					activation of MAPK activity|apoptosis|cell surface receptor linked signaling pathway|regulation of apoptosis|regulation of cell cycle	cytoplasm|integral to membrane|plasma membrane	death receptor binding|protein kinase activator activity|Rab guanyl-nucleotide exchange factor activity			ovary(5)|skin(4)|central_nervous_system(2)	11				Lung(87;0.182)														---	---	---	---	capture		Silent	SNP	47312322	47312322	9529	11	C	T	T	20	20	MADD	T	2	2
OR4B1	119765	broad.mit.edu	37	11	48239093	48239093	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48239093G>C	uc010rhs.1	+	1	732	c.732G>C	c.(730-732)GTG>GTC	p.V244V		NM_001005470	NP_001005470	Q8NGF8	OR4B1_HUMAN	olfactory receptor, family 4, subfamily B,	244	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)|pancreas(1)	4																		---	---	---	---	capture		Silent	SNP	48239093	48239093	11450	11	G	C	C	47	47	OR4B1	C	3	3
OR4A5	81318	broad.mit.edu	37	11	51411878	51411878	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:51411878T>C	uc001nhi.1	-	1	518	c.518A>G	c.(517-519)CAT>CGT	p.H173R		NM_001005272	NP_001005272	Q8NH83	OR4A5_HUMAN	olfactory receptor, family 4, subfamily A,	173	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3		all_lung(304;0.236)																---	---	---	---	capture		Missense_Mutation	SNP	51411878	51411878	11449	11	T	C	C	51	51	OR4A5	C	4	4
OR4C6	219432	broad.mit.edu	37	11	55433256	55433256	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55433256G>T	uc001nht.3	+	3	879	c.614G>T	c.(613-615)TGT>TTT	p.C205F	OR4C6_uc010rik.1_Missense_Mutation_p.C205F	NM_001004704	NP_001004704	Q8NH72	OR4C6_HUMAN	olfactory receptor, family 4, subfamily C,	205	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	55433256	55433256	11459	11	G	T	T	48	48	OR4C6	T	2	2
OR5D13	390142	broad.mit.edu	37	11	55540949	55540949	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55540949C>A	uc010ril.1	+	1	36	c.36C>A	c.(34-36)CCC>CCA	p.P12P		NM_001001967	NP_001001967	Q8NGL4	OR5DD_HUMAN	olfactory receptor, family 5, subfamily D,	12	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3		all_epithelial(135;0.196)																---	---	---	---	capture		Silent	SNP	55540949	55540949	11564	11	C	A	A	21	21	OR5D13	A	2	2
OR5D18	219438	broad.mit.edu	37	11	55587261	55587261	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55587261C>G	uc010rin.1	+	1	156	c.156C>G	c.(154-156)ATC>ATG	p.I52M		NM_001001952	NP_001001952	Q8NGL1	OR5DI_HUMAN	olfactory receptor, family 5, subfamily D,	52	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)	3		all_epithelial(135;0.208)																---	---	---	---	capture		Missense_Mutation	SNP	55587261	55587261	11567	11	C	G	G	29	29	OR5D18	G	3	3
OR5L2	26338	broad.mit.edu	37	11	55595417	55595417	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55595417T>C	uc001nhy.1	+	1	723	c.723T>C	c.(721-723)TGT>TGC	p.C241C		NM_001004739	NP_001004739	Q8NGL0	OR5L2_HUMAN	olfactory receptor, family 5, subfamily L,	241	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		all_epithelial(135;0.208)													HNSCC(27;0.073)			---	---	---	---	capture		Silent	SNP	55595417	55595417	11581	11	T	C	C	59	59	OR5L2	C	4	4
OR8I2	120586	broad.mit.edu	37	11	55861081	55861081	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55861081C>G	uc010rix.1	+	1	298	c.298C>G	c.(298-300)CAA>GAA	p.Q100E		NM_001003750	NP_001003750	Q8N0Y5	OR8I2_HUMAN	olfactory receptor, family 8, subfamily I,	100	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			breast(1)	1	Esophageal squamous(21;0.00693)																	---	---	---	---	capture		Missense_Mutation	SNP	55861081	55861081	11651	11	C	G	G	29	29	OR8I2	G	3	3
OR5J2	282775	broad.mit.edu	37	11	55944717	55944717	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55944717G>T	uc010rjb.1	+	1	624	c.624G>T	c.(622-624)ATG>ATT	p.M208I		NM_001005492	NP_001005492	Q8NH18	OR5J2_HUMAN	olfactory receptor, family 5, subfamily J,	208	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|large_intestine(1)|breast(1)|pancreas(1)	4	Esophageal squamous(21;0.00693)																	---	---	---	---	capture		Missense_Mutation	SNP	55944717	55944717	11575	11	G	T	T	47	47	OR5J2	T	2	2
OR5M9	390162	broad.mit.edu	37	11	56230190	56230190	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56230190C>T	uc010rjj.1	-	1	688	c.688G>A	c.(688-690)GAT>AAT	p.D230N		NM_001004743	NP_001004743	Q8NGP3	OR5M9_HUMAN	olfactory receptor, family 5, subfamily M,	230	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)|central_nervous_system(1)	4	Esophageal squamous(21;0.00448)																	---	---	---	---	capture		Missense_Mutation	SNP	56230190	56230190	11587	11	C	T	T	31	31	OR5M9	T	1	1
OR5AR1	219493	broad.mit.edu	37	11	56431331	56431331	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56431331C>G	uc010rjm.1	+	1	170	c.170C>G	c.(169-171)ACA>AGA	p.T57R		NM_001004730	NP_001004730	Q8NGP9	O5AR1_HUMAN	olfactory receptor, family 5, subfamily AR,	57	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	56431331	56431331	11555	11	C	G	G	17	17	OR5AR1	G	3	3
OR9G9	504191	broad.mit.edu	37	11	56468215	56468215	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56468215G>C	uc010rjn.1	+	1	352	c.352G>C	c.(352-354)GCT>CCT	p.A118P		NM_001013358	NP_001013376	P0C7N8	OR9G9_HUMAN	olfactory receptor, family 9, subfamily G,	118	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	56468215	56468215	11663	11	G	C	C	42	42	OR9G9	C	3	3
LRRC55	219527	broad.mit.edu	37	11	56949613	56949613	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56949613C>G	uc001njl.1	+	1	393	c.246C>G	c.(244-246)CCC>CCG	p.P82P		NM_001005210	NP_001005210	Q6ZSA7	LRC55_HUMAN	leucine rich repeat containing 55	52	LRRNT.					integral to membrane					0																		---	---	---	---	capture		Silent	SNP	56949613	56949613	9386	11	C	G	G	23	23	LRRC55	G	3	3
OR5B12	390191	broad.mit.edu	37	11	58207465	58207465	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58207465G>C	uc010rkh.1	-	1	160	c.160C>G	c.(160-162)CAC>GAC	p.H54D		NM_001004733	NP_001004733	Q96R08	OR5BC_HUMAN	olfactory receptor, family 5, subfamily B,	54	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	Esophageal squamous(5;0.0027)	Breast(21;0.0778)																---	---	---	---	capture		Missense_Mutation	SNP	58207465	58207465	11558	11	G	C	C	47	47	OR5B12	C	3	3
OR5A1	219982	broad.mit.edu	37	11	59211286	59211286	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:59211286C>G	uc001nnx.1	+	1	645	c.645C>G	c.(643-645)CTC>CTG	p.L215L		NM_001004728	NP_001004728	Q8NGJ0	OR5A1_HUMAN	olfactory receptor, family 5, subfamily A,	215	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	59211286	59211286	11549	11	C	G	G	30	30	OR5A1	G	3	3
OR4D9	390199	broad.mit.edu	37	11	59282638	59282638	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:59282638C>A	uc010rkv.1	+	1	253	c.253C>A	c.(253-255)CTT>ATT	p.L85I		NM_001004711	NP_001004711	Q8NGE8	OR4D9_HUMAN	olfactory receptor, family 4, subfamily D,	85	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	59282638	59282638	11466	11	C	A	A	32	32	OR4D9	A	2	2
MRPL16	54948	broad.mit.edu	37	11	59574004	59574004	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:59574004C>G	uc001noh.2	-	4	786	c.572G>C	c.(571-573)AGC>ACC	p.S191T		NM_017840	NP_060310	Q9NX20	RM16_HUMAN	mitochondrial ribosomal protein L16 precursor	191							rRNA binding			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	59574004	59574004	10174	11	C	G	G	28	28	MRPL16	G	3	3
MS4A6E	245802	broad.mit.edu	37	11	60105243	60105243	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60105243G>C	uc001npd.2	+	2	191	c.177G>C	c.(175-177)CTG>CTC	p.L59L		NM_139249	NP_640342	Q96DS6	M4A6E_HUMAN	membrane-spanning 4-domains, subfamily A, member	59	Helical; (Potential).					integral to membrane	receptor activity				0																		---	---	---	---	capture		Silent	SNP	60105243	60105243	10258	11	G	C	C	45	45	MS4A6E	C	3	3
TMEM109	79073	broad.mit.edu	37	11	60687196	60687196	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60687196G>T	uc001nqg.2	+	2	409	c.31G>T	c.(31-33)GGA>TGA	p.G11*	TMEM109_uc001nqh.2_Nonsense_Mutation_p.G11*	NM_024092	NP_076997	Q9BVC6	TM109_HUMAN	transmembrane protein 109 precursor	11						integral to membrane|nuclear outer membrane|sarcoplasmic reticulum membrane					0																		---	---	---	---	capture		Nonsense_Mutation	SNP	60687196	60687196	16555	11	G	T	T	43	43	TMEM109	T	5	2
CD6	923	broad.mit.edu	37	11	60785239	60785239	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60785239G>A	uc001nqq.2	+	11	1814	c.1591G>A	c.(1591-1593)GAG>AAG	p.E531K	CD6_uc001nqp.2_Missense_Mutation_p.E531K|CD6_uc001nqr.2_Missense_Mutation_p.E499K|CD6_uc001nqs.2_RNA|CD6_uc001nqt.2_Missense_Mutation_p.E490K	NM_006725	NP_006716	P30203	CD6_HUMAN	CD6 molecule precursor	531	Cytoplasmic (Potential).				cell adhesion	cell surface|integral to plasma membrane	scavenger receptor activity			pancreas(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	60785239	60785239	3156	11	G	A	A	33	33	CD6	A	2	2
PGA3	643834	broad.mit.edu	37	11	60971058	60971058	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60971058G>C	uc001nqx.2	+	1	75	c.22G>C	c.(22-24)GGT>CGT	p.G8R	PGA3_uc010rld.1_Missense_Mutation_p.G8R	NM_001079807	NP_001073275			pepsinogen 3, group I precursor											ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	60971058	60971058	12193	11	G	C	C	43	43	PGA3	C	3	3
INCENP	3619	broad.mit.edu	37	11	61919412	61919412	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61919412C>G	uc001nsw.1	+	19	2923	c.2721C>G	c.(2719-2721)GTC>GTG	p.V907V	INCENP_uc001nsx.1_Silent_p.V903V|INCENP_uc001nsy.1_Silent_p.V321V	NM_001040694	NP_001035784	Q9NQS7	INCE_HUMAN	inner centromere protein antigens 135/155kDa	907					chromosome segregation|cytokinesis|mitotic prometaphase	centromeric heterochromatin|condensed chromosome kinetochore|cytosol|microtubule|spindle	protein binding			lung(1)	1																		---	---	---	---	capture		Silent	SNP	61919412	61919412	8034	11	C	G	G	30	30	INCENP	G	3	3
ACY3	91703	broad.mit.edu	37	11	67413199	67413199	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67413199G>A	uc001omq.2	-	4	567	c.396C>T	c.(394-396)CAC>CAT	p.H132H		NM_080658	NP_542389	Q96HD9	ACY3_HUMAN	aspartoacylase 3	132					interspecies interaction between organisms	apical plasma membrane|cytoplasm	hydrolase activity, acting on ester bonds|metal ion binding				0					L-Aspartic Acid(DB00128)													---	---	---	---	capture		Silent	SNP	67413199	67413199	228	11	G	A	A	40	40	ACY3	A	1	1
KRTAP5-11	440051	broad.mit.edu	37	11	71293514	71293514	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:71293514G>A	uc001oqu.2	-	1	408	c.370C>T	c.(370-372)CCC>TCC	p.P124S		NM_001005405	NP_001005405	Q6L8G4	KR511_HUMAN	keratin associated protein 5-11	124	5.|6 X 4 AA repeats of C-C-X-P.					keratin filament					0																		---	---	---	---	capture		Missense_Mutation	SNP	71293514	71293514	8882	11	G	A	A	42	42	KRTAP5-11	A	2	2
ARHGEF17	9828	broad.mit.edu	37	11	73020284	73020284	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:73020284C>A	uc001otu.2	+	1	622	c.601C>A	c.(601-603)CAG>AAG	p.Q201K		NM_014786	NP_055601	Q96PE2	ARHGH_HUMAN	Rho guanine nucleotide exchange factor (GEF) 17	201	Poly-Gln.				actin cytoskeleton organization|apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	Rho guanyl-nucleotide exchange factor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	73020284	73020284	914	11	C	A	A	25	25	ARHGEF17	A	2	2
C11orf30	56946	broad.mit.edu	37	11	76162994	76162994	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:76162994G>C	uc001oxl.2	+	3	306	c.163G>C	c.(163-165)GTT>CTT	p.V55L	C11orf30_uc001oxj.2_Missense_Mutation_p.V55L|C11orf30_uc001oxk.2_Missense_Mutation_p.V55L|C11orf30_uc009yuj.1_Missense_Mutation_p.V55L|C11orf30_uc010rsa.1_Missense_Mutation_p.V55L|C11orf30_uc001oxm.2_Missense_Mutation_p.V55L|C11orf30_uc010rsb.1_Missense_Mutation_p.V55L|C11orf30_uc010rsc.1_Missense_Mutation_p.V55L|C11orf30_uc001oxn.2_Missense_Mutation_p.V55L|C11orf30_uc010rsd.1_Missense_Mutation_p.V55L	NM_020193	NP_064578	Q7Z589	EMSY_HUMAN	EMSY protein	55	Interaction with BRCA2.|ENT.				chromatin modification|DNA repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(5)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	76162994	76162994	1674	11	G	C	C	36	36	C11orf30	C	3	3
NARS2	79731	broad.mit.edu	37	11	78285425	78285425	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:78285425G>C	uc001ozi.2	-	1	485	c.109C>G	c.(109-111)CAG>GAG	p.Q37E	NARS2_uc010rsq.1_Intron	NM_024678	NP_078954	Q96I59	SYNM_HUMAN	asparaginyl-tRNA synthetase 2, mitochondrial	37					asparaginyl-tRNA aminoacylation	mitochondrial matrix	asparagine-tRNA ligase activity|ATP binding|nucleic acid binding			ovary(2)	2	all_cancers(14;2.63e-17)|all_epithelial(13;1.85e-19)				L-Asparagine(DB00174)													---	---	---	---	capture		Missense_Mutation	SNP	78285425	78285425	10567	11	G	C	C	45	45	NARS2	C	3	3
SYTL2	54843	broad.mit.edu	37	11	85447559	85447559	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:85447559G>C	uc010rth.1	-	5	844	c.568C>G	c.(568-570)CAG>GAG	p.Q190E	SYTL2_uc010rtg.1_Missense_Mutation_p.Q191E|SYTL2_uc010rti.1_Missense_Mutation_p.Q190E|SYTL2_uc010rtj.1_Missense_Mutation_p.Q142E|SYTL2_uc001pbf.3_Missense_Mutation_p.Q190E|SYTL2_uc010rtf.1_Missense_Mutation_p.Q48E	NM_001162951	NP_001156423	Q9HCH5	SYTL2_HUMAN	synaptotagmin-like 2 isoform g	190					intracellular protein transport|vesicle docking involved in exocytosis	exocytic vesicle|extrinsic to plasma membrane|melanosome|membrane fraction	neurexin binding|phosphatidylinositol-4,5-bisphosphate binding|phosphatidylserine binding|Rab GTPase binding	p.G190V(1)		ovary(2)|large_intestine(1)	3		Acute lymphoblastic leukemia(157;4.19e-06)|all_hematologic(158;0.0033)		KIRC - Kidney renal clear cell carcinoma(183;0.202)|Kidney(183;0.237)														---	---	---	---	capture		Missense_Mutation	SNP	85447559	85447559	16004	11	G	C	C	45	45	SYTL2	C	3	3
FAT3	120114	broad.mit.edu	37	11	92533735	92533735	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92533735G>C	uc001pdj.3	+	9	7573	c.7556G>C	c.(7555-7557)CGA>CCA	p.R2519P		NM_001008781	NP_001008781	Q8TDW7	FAT3_HUMAN	FAT tumor suppressor homolog 3	2519	Cadherin 23.|Extracellular (Potential).				homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|pancreas(1)	5		Acute lymphoblastic leukemia(157;3.01e-05)|all_hematologic(158;0.00858)													TCGA Ovarian(4;0.039)			---	---	---	---	capture		Missense_Mutation	SNP	92533735	92533735	5927	11	G	C	C	37	37	FAT3	C	3	3
FAT3	120114	broad.mit.edu	37	11	92600001	92600001	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92600001A>T	uc001pdj.3	+	21	11770	c.11753A>T	c.(11752-11754)CAC>CTC	p.H3918L	FAT3_uc001pdi.3_Missense_Mutation_p.H358L	NM_001008781	NP_001008781	Q8TDW7	FAT3_HUMAN	FAT tumor suppressor homolog 3	3918	Laminin G-like.|Extracellular (Potential).				homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|pancreas(1)	5		Acute lymphoblastic leukemia(157;3.01e-05)|all_hematologic(158;0.00858)													TCGA Ovarian(4;0.039)			---	---	---	---	capture		Missense_Mutation	SNP	92600001	92600001	5927	11	A	T	T	6	6	FAT3	T	4	4
SLC36A4	120103	broad.mit.edu	37	11	92881849	92881849	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92881849C>A	uc001pdn.2	-	11	1466	c.1369G>T	c.(1369-1371)GCA>TCA	p.A457S	uc001pdl.1_5'Flank|SLC36A4_uc001pdm.2_Missense_Mutation_p.A322S	NM_152313	NP_689526	Q6YBV0	S36A4_HUMAN	solute carrier family 36 (proton/amino acid	457	Helical; (Potential).				L-alanine transport|proline transport|tryptophan transport	integral to membrane	symporter activity			ovary(2)|upper_aerodigestive_tract(1)	3		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.0123)																---	---	---	---	capture		Missense_Mutation	SNP	92881849	92881849	15093	11	C	A	A	28	28	SLC36A4	A	2	2
ENDOD1	23052	broad.mit.edu	37	11	94861787	94861787	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:94861787G>A	uc001pfh.2	+	2	622	c.547G>A	c.(547-549)GAC>AAC	p.D183N		NM_015036	NP_055851	O94919	ENDD1_HUMAN	endonuclease domain containing 1 precursor	183						extracellular region	endonuclease activity|metal ion binding|nucleic acid binding				0		Acute lymphoblastic leukemia(157;2.33e-05)|all_hematologic(158;0.00824)																---	---	---	---	capture		Missense_Mutation	SNP	94861787	94861787	5307	11	G	A	A	41	41	ENDOD1	A	2	2
KIAA1377	57562	broad.mit.edu	37	11	101834216	101834216	+	Missense_Mutation	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:101834216A>C	uc001pgm.2	+	6	2720	c.2450A>C	c.(2449-2451)CAA>CCA	p.Q817P	KIAA1377_uc001pgn.2_Missense_Mutation_p.Q773P|KIAA1377_uc010run.1_Missense_Mutation_p.Q618P|KIAA1377_uc009yxa.1_Missense_Mutation_p.Q618P	NM_020802	NP_065853	Q9P2H0	K1377_HUMAN	hypothetical protein LOC57562	817							protein binding			breast(2)|ovary(1)|central_nervous_system(1)	4	all_epithelial(12;0.0104)	Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.00931)		BRCA - Breast invasive adenocarcinoma(274;0.038)														---	---	---	---	capture		Missense_Mutation	SNP	101834216	101834216	8536	11	A	C	C	5	5	KIAA1377	C	4	4
EXPH5	23086	broad.mit.edu	37	11	108382262	108382262	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:108382262G>C	uc001pkk.2	-	6	4083	c.3972C>G	c.(3970-3972)CTC>CTG	p.L1324L	EXPH5_uc010rvy.1_Silent_p.L1136L|EXPH5_uc010rvz.1_Silent_p.L1168L|EXPH5_uc010rwa.1_Silent_p.L1248L	NM_015065	NP_055880	Q8NEV8	EXPH5_HUMAN	exophilin 5 isoform a	1324					intracellular protein transport		Rab GTPase binding			skin(3)|ovary(2)	5		all_cancers(61;3.99e-08)|Acute lymphoblastic leukemia(157;3.97e-05)|Melanoma(852;4.04e-05)|all_epithelial(67;0.000116)|all_hematologic(158;0.000315)|Breast(348;0.104)|all_neural(303;0.16)		Epithelial(105;8.1e-06)|BRCA - Breast invasive adenocarcinoma(274;1.22e-05)|all cancers(92;0.000129)|OV - Ovarian serous cystadenocarcinoma(223;0.11)|Colorectal(284;0.184)														---	---	---	---	capture		Silent	SNP	108382262	108382262	5516	11	G	C	C	45	45	EXPH5	C	3	3
ARHGAP20	57569	broad.mit.edu	37	11	110456944	110456944	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:110456944G>C	uc001pkz.1	-	13	1696	c.1411C>G	c.(1411-1413)CAA>GAA	p.Q471E	ARHGAP20_uc001pky.1_Missense_Mutation_p.Q448E|ARHGAP20_uc009yyb.1_Missense_Mutation_p.Q435E|ARHGAP20_uc001pla.1_Missense_Mutation_p.Q435E|ARHGAP20_uc001plb.2_Missense_Mutation_p.Q14E	NM_020809	NP_065860	Q9P2F6	RHG20_HUMAN	Rho GTPase activating protein 20	471	Rho-GAP.				regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(3)|kidney(2)	5		all_cancers(61;3.26e-12)|all_epithelial(67;6.09e-07)|Melanoma(852;1.46e-05)|all_hematologic(158;0.000484)|Acute lymphoblastic leukemia(157;0.000967)|all_neural(223;0.0199)|Medulloblastoma(222;0.0425)|Breast(348;0.0544)		Epithelial(105;3.05e-06)|BRCA - Breast invasive adenocarcinoma(274;1.24e-05)|all cancers(92;0.000147)|OV - Ovarian serous cystadenocarcinoma(223;0.0475)														---	---	---	---	capture		Missense_Mutation	SNP	110456944	110456944	881	11	G	C	C	45	45	ARHGAP20	C	3	3
APOA4	337	broad.mit.edu	37	11	116693478	116693478	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:116693478C>T	uc001pps.1	-	2	177	c.73G>A	c.(73-75)GAC>AAC	p.D25N		NM_000482	NP_000473			apolipoprotein A-IV precursor												0	all_hematologic(175;0.0487)	Breast(348;0.0126)|Medulloblastoma(222;0.0425)|all_hematologic(158;0.0564)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;8.54e-06)|Epithelial(105;1.62e-05)|all cancers(92;0.000165)|OV - Ovarian serous cystadenocarcinoma(223;0.148)														---	---	---	---	capture		Missense_Mutation	SNP	116693478	116693478	794	11	C	T	T	29	29	APOA4	T	2	2
RNF26	79102	broad.mit.edu	37	11	119206354	119206354	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:119206354C>A	uc001pwh.2	+	1	1118	c.522C>A	c.(520-522)ACC>ACA	p.T174T		NM_032015	NP_114404	Q9BY78	RNF26_HUMAN	ring finger protein 26	174	Leu-rich.						zinc ion binding			ovary(1)	1		Medulloblastoma(222;0.0425)|Breast(348;0.052)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;3.8e-05)														---	---	---	---	capture		Silent	SNP	119206354	119206354	13965	11	C	A	A	23	23	RNF26	A	1	1
SORL1	6653	broad.mit.edu	37	11	121476146	121476146	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:121476146C>T	uc001pxx.2	+	35	4894	c.4814C>T	c.(4813-4815)ACC>ATC	p.T1605I	SORL1_uc010rzp.1_Missense_Mutation_p.T451I|SORL1_uc010rzq.1_Missense_Mutation_p.T220I	NM_003105	NP_003096	Q92673	SORL_HUMAN	sortilin-related receptor containing LDLR class	1605	Extracellular (Potential).|Fibronectin type-III 1.				cholesterol metabolic process|lipid transport|receptor-mediated endocytosis	integral to plasma membrane|low-density lipoprotein particle	low-density lipoprotein particle binding|transmembrane receptor activity			ovary(5)|breast(4)|large_intestine(2)|skin(2)|central_nervous_system(1)|pancreas(1)	15		Breast(109;0.00119)|Medulloblastoma(222;0.0429)|all_neural(223;0.113)		BRCA - Breast invasive adenocarcinoma(274;3.34e-05)|OV - Ovarian serous cystadenocarcinoma(223;0.108)														---	---	---	---	capture		Missense_Mutation	SNP	121476146	121476146	15434	11	C	T	T	18	18	SORL1	T	2	2
SORL1	6653	broad.mit.edu	37	11	121485651	121485651	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:121485651C>G	uc001pxx.2	+	41	5571	c.5491C>G	c.(5491-5493)CTG>GTG	p.L1831V	SORL1_uc010rzp.1_Missense_Mutation_p.L677V|SORL1_uc010rzq.1_Missense_Mutation_p.L446V	NM_003105	NP_003096	Q92673	SORL_HUMAN	sortilin-related receptor containing LDLR class	1831	Extracellular (Potential).|Fibronectin type-III 3.				cholesterol metabolic process|lipid transport|receptor-mediated endocytosis	integral to plasma membrane|low-density lipoprotein particle	low-density lipoprotein particle binding|transmembrane receptor activity			ovary(5)|breast(4)|large_intestine(2)|skin(2)|central_nervous_system(1)|pancreas(1)	15		Breast(109;0.00119)|Medulloblastoma(222;0.0429)|all_neural(223;0.113)		BRCA - Breast invasive adenocarcinoma(274;3.34e-05)|OV - Ovarian serous cystadenocarcinoma(223;0.108)														---	---	---	---	capture		Missense_Mutation	SNP	121485651	121485651	15434	11	C	G	G	32	32	SORL1	G	3	3
OR6M1	390261	broad.mit.edu	37	11	123676886	123676886	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123676886A>T	uc010rzz.1	-	1	172	c.172T>A	c.(172-174)TAC>AAC	p.Y58N		NM_001005325	NP_001005325	Q8NGM8	OR6M1_HUMAN	olfactory receptor, family 6, subfamily M,	58	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2		Breast(109;0.0109)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.028)														---	---	---	---	capture		Missense_Mutation	SNP	123676886	123676886	11615	11	A	T	T	14	14	OR6M1	T	4	4
OR6T1	219874	broad.mit.edu	37	11	123814316	123814316	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123814316A>T	uc010sab.1	-	1	230	c.230T>A	c.(229-231)GTG>GAG	p.V77E		NM_001005187	NP_001005187	Q8NGN1	OR6T1_HUMAN	olfactory receptor, family 6, subfamily T,	77	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0401)														---	---	---	---	capture		Missense_Mutation	SNP	123814316	123814316	11621	11	A	T	T	6	6	OR6T1	T	4	4
OR10G9	219870	broad.mit.edu	37	11	123893820	123893820	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123893820T>A	uc010sad.1	+	1	101	c.101T>A	c.(100-102)GTG>GAG	p.V34E		NM_001001953	NP_001001953	Q8NGN4	O10G9_HUMAN	olfactory receptor, family 10, subfamily G,	34	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0399)														---	---	---	---	capture		Missense_Mutation	SNP	123893820	123893820	11310	11	T	A	A	59	59	OR10G9	A	4	4
OR8G2	26492	broad.mit.edu	37	11	124096236	124096236	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124096236C>A	uc010saf.1	+	1	839	c.839C>A	c.(838-840)TCC>TAC	p.S280Y		NM_001007249	NP_001007250	Q15614	OR8G2_HUMAN	olfactory receptor, family 8, subfamily G,	280						integral to membrane	olfactory receptor activity				0		Breast(109;0.0157)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.91e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0528)														---	---	---	---	capture		Missense_Mutation	SNP	124096236	124096236	11646	11	C	A	A	30	30	OR8G2	A	2	2
ROBO4	54538	broad.mit.edu	37	11	124756551	124756551	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124756551G>T	uc001qbg.2	-	16	2743	c.2603C>A	c.(2602-2604)CCC>CAC	p.P868H	ROBO4_uc010sas.1_Missense_Mutation_p.P723H|ROBO4_uc001qbh.2_3'UTR|ROBO4_uc001qbi.2_Missense_Mutation_p.P426H	NM_019055	NP_061928	Q8WZ75	ROBO4_HUMAN	roundabout homolog 4, magic roundabout	868					angiogenesis|cell differentiation	integral to membrane	receptor activity			ovary(1)|skin(1)	2	all_hematologic(175;0.215)	Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|Breast(109;0.171)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;1.5e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0301)														---	---	---	---	capture		Missense_Mutation	SNP	124756551	124756551	13995	11	G	T	T	43	43	ROBO4	T	2	2
HEPACAM	220296	broad.mit.edu	37	11	124793658	124793658	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124793658C>A	uc001qbk.2	-	3	1082	c.676G>T	c.(676-678)GGC>TGC	p.G226C	HEPACAM_uc009zbj.2_5'Flank|HEPACAM_uc001qbl.1_Missense_Mutation_p.G226C	NM_152722	NP_689935	Q14CZ8	HECAM_HUMAN	hepatocyte cell adhesion molecule precursor	226	Extracellular (Potential).|Ig-like C2-type.				cell adhesion|cell cycle arrest|regulation of growth	cytoplasm|integral to membrane				pancreas(1)	1	all_hematologic(175;0.215)	Breast(109;0.00222)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.54e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0308)														---	---	---	---	capture		Missense_Mutation	SNP	124793658	124793658	7335	11	C	A	A	22	22	HEPACAM	A	2	2
KCNJ1	3758	broad.mit.edu	37	11	128710133	128710133	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:128710133G>C	uc001qeo.1	-	2	114	c.63C>G	c.(61-63)TTC>TTG	p.F21L	KCNJ1_uc001qep.1_Missense_Mutation_p.F2L|KCNJ1_uc001qeq.1_Missense_Mutation_p.F2L|KCNJ1_uc001qer.1_Missense_Mutation_p.F2L|KCNJ1_uc001qes.1_Missense_Mutation_p.F2L	NM_000220	NP_000211	P48048	IRK1_HUMAN	potassium inwardly-rectifying channel J1 isoform	21	Cytoplasmic (By similarity).				excretion	voltage-gated potassium channel complex	ATP binding|inward rectifier potassium channel activity			ovary(3)|breast(1)	4	all_hematologic(175;0.0641)	all_lung(97;4.89e-06)|Lung NSC(97;9.34e-06)|Breast(109;0.00123)|all_hematologic(192;0.00793)|Renal(330;0.0112)|all_neural(223;0.0189)|Medulloblastoma(222;0.0425)		OV - Ovarian serous cystadenocarcinoma(99;4.05e-06)|LUSC - Lung squamous cell carcinoma(976;0.008)|Lung(977;0.00942)	Acetohexamide(DB00414)|Chlorpropamide(DB00672)|Glibenclamide(DB01016)|Gliclazide(DB01120)|Glimepiride(DB00222)|Glipizide(DB01067)|Glycodiazine(DB01382)|Minoxidil(DB00350)|Nateglinide(DB00731)|Repaglinide(DB00912)|Tolazamide(DB00839)|Tolbutamide(DB01124)													---	---	---	---	capture		Missense_Mutation	SNP	128710133	128710133	8348	11	G	C	C	45	45	KCNJ1	C	3	3
KDM5A	5927	broad.mit.edu	37	12	427394	427394	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:427394C>G	uc001qif.1	-	19	3138	c.2775G>C	c.(2773-2775)CTG>CTC	p.L925L	KDM5A_uc001qie.1_Silent_p.L925L|KDM5A_uc010sdn.1_Silent_p.L884L	NM_001042603	NP_001036068	P29375	KDM5A_HUMAN	retinoblastoma binding protein 2 isoform 1	925					chromatin modification|multicellular organismal development|positive regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	cytoplasm|nucleolus	DNA binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(2)|ovary(1)	3								T 	NUP98	AML								---	---	---	---	capture		Silent	SNP	427394	427394	8439	12	C	G	G	29	29	KDM5A	G	3	3
CACNA1C	775	broad.mit.edu	37	12	2693757	2693757	+	Missense_Mutation	SNP	G	T	T	rs150598253	by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:2693757G>T	uc009zdu.1	+	16	2626	c.2313G>T	c.(2311-2313)GAG>GAT	p.E771D	CACNA1C_uc009zdv.1_Missense_Mutation_p.E768D|CACNA1C_uc001qkb.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkc.2_Missense_Mutation_p.E771D|CACNA1C_uc001qke.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkf.2_Missense_Mutation_p.E771D|CACNA1C_uc001qjz.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkd.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkg.2_Missense_Mutation_p.E771D|CACNA1C_uc009zdw.1_Missense_Mutation_p.E771D|CACNA1C_uc001qkh.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkl.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkn.2_Missense_Mutation_p.E771D|CACNA1C_uc001qko.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkp.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkr.2_Missense_Mutation_p.E771D|CACNA1C_uc001qku.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkq.2_Missense_Mutation_p.E771D|CACNA1C_uc001qks.2_Missense_Mutation_p.E771D|CACNA1C_uc001qkt.2_Missense_Mutation_p.E771D|CACNA1C_uc001qka.1_Missense_Mutation_p.E306D|CACNA1C_uc001qki.1_Missense_Mutation_p.E507D|CACNA1C_uc001qkj.1_Missense_Mutation_p.E507D|CACNA1C_uc001qkk.1_Missense_Mutation_p.E507D|CACNA1C_uc001qkm.1_Missense_Mutation_p.E507D|CACNA1C_uc001qkw.2_Missense_Mutation_p.E60D	NM_199460	NP_955630	Q13936	CAC1C_HUMAN	calcium channel, voltage-dependent, L type,	771	Cytoplasmic (Potential).|Poly-Glu.				axon guidance|calcium ion transport into cytosol|energy reserve metabolic process|regulation of insulin secretion	cytoplasm|postsynaptic density|voltage-gated calcium channel complex	calmodulin binding|voltage-gated calcium channel activity			ovary(10)|central_nervous_system(1)	11			OV - Ovarian serous cystadenocarcinoma(31;0.00256)	LUAD - Lung adenocarcinoma(1;0.134)	Ibutilide(DB00308)|Isradipine(DB00270)|Magnesium Sulfate(DB00653)|Mibefradil(DB01388)|Nicardipine(DB00622)|Verapamil(DB00661)													---	---	---	---	capture		Missense_Mutation	SNP	2693757	2693757	2656	12	G	T	T	35	35	CACNA1C	T	2	2
CACNA1C	775	broad.mit.edu	37	12	2702441	2702441	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:2702441C>T	uc009zdu.1	+	19	2906	c.2593C>T	c.(2593-2595)CTT>TTT	p.L865F	CACNA1C_uc009zdv.1_Missense_Mutation_p.L862F|CACNA1C_uc001qkb.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkc.2_Missense_Mutation_p.L865F|CACNA1C_uc001qke.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkf.2_Missense_Mutation_p.L865F|CACNA1C_uc001qjz.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkd.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkg.2_Missense_Mutation_p.L865F|CACNA1C_uc009zdw.1_Missense_Mutation_p.L865F|CACNA1C_uc001qkh.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkl.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkn.2_Missense_Mutation_p.L865F|CACNA1C_uc001qko.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkp.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkr.2_Missense_Mutation_p.L865F|CACNA1C_uc001qku.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkq.2_Missense_Mutation_p.L865F|CACNA1C_uc001qks.2_Missense_Mutation_p.L865F|CACNA1C_uc001qkt.2_Missense_Mutation_p.L865F|CACNA1C_uc001qka.1_Missense_Mutation_p.L400F|CACNA1C_uc001qki.1_Missense_Mutation_p.L601F|CACNA1C_uc001qkj.1_Missense_Mutation_p.L601F|CACNA1C_uc001qkk.1_Missense_Mutation_p.L601F|CACNA1C_uc001qkm.1_Missense_Mutation_p.L601F|CACNA1C_uc001qkw.2_Missense_Mutation_p.L154F	NM_199460	NP_955630	Q13936	CAC1C_HUMAN	calcium channel, voltage-dependent, L type,	865	Cytoplasmic (Potential).				axon guidance|calcium ion transport into cytosol|energy reserve metabolic process|regulation of insulin secretion	cytoplasm|postsynaptic density|voltage-gated calcium channel complex	calmodulin binding|voltage-gated calcium channel activity			ovary(10)|central_nervous_system(1)	11			OV - Ovarian serous cystadenocarcinoma(31;0.00256)	LUAD - Lung adenocarcinoma(1;0.134)	Ibutilide(DB00308)|Isradipine(DB00270)|Magnesium Sulfate(DB00653)|Mibefradil(DB01388)|Nicardipine(DB00622)|Verapamil(DB00661)													---	---	---	---	capture		Missense_Mutation	SNP	2702441	2702441	2656	12	C	T	T	28	28	CACNA1C	T	2	2
FKBP4	2288	broad.mit.edu	37	12	2906971	2906971	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:2906971A>G	uc001qkz.2	+	3	525	c.327A>G	c.(325-327)CCA>CCG	p.P109P		NM_002014	NP_002005	Q02790	FKBP4_HUMAN	FK506 binding protein 52	109	PPIase FKBP-type 1.				negative regulation of microtubule polymerization or depolymerization|negative regulation of neuron projection development|protein folding	axonal growth cone|cytosol|membrane|microtubule|nucleus	FK506 binding|heat shock protein binding|peptidyl-prolyl cis-trans isomerase activity|protein binding, bridging				0			OV - Ovarian serous cystadenocarcinoma(31;0.00105)		Dimethyl sulfoxide(DB01093)													---	---	---	---	capture		Silent	SNP	2906971	2906971	6148	12	A	G	G	7	7	FKBP4	G	4	4
VWF	7450	broad.mit.edu	37	12	6138553	6138553	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6138553C>A	uc001qnn.1	-	22	3172	c.2922G>T	c.(2920-2922)TGG>TGT	p.W974C	VWF_uc010set.1_Intron	NM_000552	NP_000543	P04275	VWF_HUMAN	von Willebrand factor preproprotein	974	VWFD 3.				blood coagulation, intrinsic pathway|cell-substrate adhesion|platelet activation|platelet degranulation|protein homooligomerization	endoplasmic reticulum|platelet alpha granule lumen|proteinaceous extracellular matrix|Weibel-Palade body	chaperone binding|collagen binding|glycoprotein binding|immunoglobulin binding|integrin binding|protease binding|protein homodimerization activity|protein N-terminus binding			skin(4)|ovary(3)|pancreas(2)|central_nervous_system(1)|haematopoietic_and_lymphoid_tissue(1)|breast(1)	12					Antihemophilic Factor(DB00025)													---	---	---	---	capture		Missense_Mutation	SNP	6138553	6138553	17818	12	C	A	A	22	22	VWF	A	2	2
VWF	7450	broad.mit.edu	37	12	6138585	6138585	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6138585G>A	uc001qnn.1	-	22	3140	c.2890C>T	c.(2890-2892)CTG>TTG	p.L964L	VWF_uc010set.1_Intron	NM_000552	NP_000543	P04275	VWF_HUMAN	von Willebrand factor preproprotein	964	VWFD 3.				blood coagulation, intrinsic pathway|cell-substrate adhesion|platelet activation|platelet degranulation|protein homooligomerization	endoplasmic reticulum|platelet alpha granule lumen|proteinaceous extracellular matrix|Weibel-Palade body	chaperone binding|collagen binding|glycoprotein binding|immunoglobulin binding|integrin binding|protease binding|protein homodimerization activity|protein N-terminus binding			skin(4)|ovary(3)|pancreas(2)|central_nervous_system(1)|haematopoietic_and_lymphoid_tissue(1)|breast(1)	12					Antihemophilic Factor(DB00025)													---	---	---	---	capture		Silent	SNP	6138585	6138585	17818	12	G	A	A	33	33	VWF	A	2	2
CD4	920	broad.mit.edu	37	12	6925470	6925470	+	Nonsense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6925470C>T	uc001qqv.1	+	6	1101	c.856C>T	c.(856-858)CAG>TAG	p.Q286*	CD4_uc009zez.1_3'UTR|CD4_uc009zfa.1_RNA|CD4_uc009zfb.1_RNA|CD4_uc010sfj.1_Nonsense_Mutation_p.Q13*|CD4_uc009zfc.1_Nonsense_Mutation_p.Q107*|CD4_uc010sfk.1_Nonsense_Mutation_p.Q13*|CD4_uc010sfl.1_Nonsense_Mutation_p.Q13*|CD4_uc010sfm.1_Nonsense_Mutation_p.Q13*	NM_000616	NP_000607	P01730	CD4_HUMAN	CD4 antigen precursor	286	Extracellular (Potential).|Ig-like C2-type 2.				cell adhesion|entry into host cell|immune response|induction by virus of host cell-cell fusion|initiation of viral infection|maintenance of protein location in cell|positive regulation of interleukin-2 biosynthetic process|positive regulation of protein kinase activity|protein palmitoleylation|regulation of defense response to virus by virus|T cell costimulation|T cell receptor signaling pathway|T cell selection|transmembrane receptor protein tyrosine kinase signaling pathway	early endosome|endoplasmic reticulum membrane|integral to membrane|T cell receptor complex	coreceptor activity|extracellular matrix structural constituent|glycoprotein binding|MHC class II protein binding|protein homodimerization activity|protein kinase binding|transmembrane receptor activity|zinc ion binding				0		Myeloproliferative disorder(1001;0.0122)																---	---	---	---	capture		Nonsense_Mutation	SNP	6925470	6925470	3142	12	C	T	T	21	21	CD4	T	5	2
LPCAT3	10162	broad.mit.edu	37	12	7090191	7090191	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7090191C>A	uc001qsi.2	-	6	766	c.652G>T	c.(652-654)GAC>TAC	p.D218Y	EMG1_uc010sfv.1_Intron|LPCAT3_uc010sfw.1_Missense_Mutation_p.D112Y|LPCAT3_uc009zfp.2_RNA|LPCAT3_uc010sfx.1_RNA|LPCAT3_uc009zfq.1_Missense_Mutation_p.D76Y	NM_005768	NP_005759	Q6P1A2	MBOA5_HUMAN	lysophosphatidylcholine acyltransferase 3	218					phospholipid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	1-acylglycerophosphocholine O-acyltransferase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	7090191	7090191	9285	12	C	A	A	29	29	LPCAT3	A	2	2
LPCAT3	10162	broad.mit.edu	37	12	7090202	7090202	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7090202C>T	uc001qsi.2	-	6	755	c.641G>A	c.(640-642)GGA>GAA	p.G214E	EMG1_uc010sfv.1_Intron|LPCAT3_uc010sfw.1_Missense_Mutation_p.G108E|LPCAT3_uc009zfp.2_RNA|LPCAT3_uc010sfx.1_RNA|LPCAT3_uc009zfq.1_Missense_Mutation_p.G72E	NM_005768	NP_005759	Q6P1A2	MBOA5_HUMAN	lysophosphatidylcholine acyltransferase 3	214					phospholipid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	1-acylglycerophosphocholine O-acyltransferase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	7090202	7090202	9285	12	C	T	T	30	30	LPCAT3	T	2	2
C3AR1	719	broad.mit.edu	37	12	8212271	8212271	+	Nonsense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:8212271T>A	uc001qtv.1	-	2	603	c.511A>T	c.(511-513)AGA>TGA	p.R171*		NM_004054	NP_004045	Q16581	C3AR_HUMAN	complement component 3a receptor 1	171	Extracellular (Potential).				blood circulation|chemotaxis|elevation of cytosolic calcium ion concentration|inflammatory response	integral to plasma membrane	C3a anaphylatoxin receptor activity|complement component C3a receptor activity|phosphatidylinositol phospholipase C activity			ovary(1)	1				Kidney(36;0.0893)														---	---	---	---	capture		Nonsense_Mutation	SNP	8212271	8212271	2297	12	T	A	A	53	53	C3AR1	A	5	4
PRH2	5555	broad.mit.edu	37	12	11081921	11081921	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:11081921C>A	uc009zhr.2	+	1	87	c.49C>A	c.(49-51)CAG>AAG	p.Q17K	PRR4_uc009zhp.2_Intron|PRH1_uc001qzb.3_Intron|PRH1_uc001qzc.2_Intron|PRB4_uc001qzf.1_Intron|PRH2_uc001qzh.2_Missense_Mutation_p.Q17K|PRH2_uc001qzi.3_Missense_Mutation_p.Q17K	NM_001110213	NP_001103683	P02810	PRPC_HUMAN	proline-rich protein HaeIII subfamily 2	17	Inhibits hydroxyapatite formation, binds to hydroxyapatite and calcium.					extracellular space	protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	11081921	11081921	12926	12	C	A	A	29	29	PRH2	A	2	2
LRP6	4040	broad.mit.edu	37	12	12303970	12303970	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12303970G>A	uc001rah.3	-	13	2936	c.2794C>T	c.(2794-2796)CCT>TCT	p.P932S	BCL2L14_uc001raf.1_Intron|LRP6_uc010shl.1_Missense_Mutation_p.P932S	NM_002336	NP_002327	O75581	LRP6_HUMAN	low density lipoprotein receptor-related protein	932	Extracellular (Potential).				cellular response to cholesterol|negative regulation of protein phosphorylation|negative regulation of protein serine/threonine kinase activity|negative regulation of smooth muscle cell apoptosis|neural crest formation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of cell cycle|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|positive regulation of Wnt receptor signaling pathway involved in dorsal/ventral axis specification|Wnt receptor signaling pathway involved in dorsal/ventral axis specification	cell surface|cytoplasmic vesicle|endoplasmic reticulum|integral to membrane|plasma membrane	coreceptor activity|frizzled binding|kinase inhibitor activity|low-density lipoprotein receptor activity|protein homodimerization activity|toxin transporter activity|Wnt-protein binding			lung(4)|skin(4)|ovary(2)|kidney(1)|central_nervous_system(1)	12		Prostate(47;0.0865)																---	---	---	---	capture		Missense_Mutation	SNP	12303970	12303970	9335	12	G	A	A	41	41	LRP6	A	2	2
GRIN2B	2904	broad.mit.edu	37	12	13769432	13769432	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:13769432A>T	uc001rbt.2	-	5	1464	c.1285T>A	c.(1285-1287)TGC>AGC	p.C429S		NM_000834	NP_000825	Q13224	NMDE2_HUMAN	N-methyl-D-aspartate receptor subunit 2B	429	Extracellular (Potential).				response to ethanol	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|outer membrane-bounded periplasmic space|postsynaptic membrane	glycine binding|N-methyl-D-aspartate selective glutamate receptor activity|zinc ion binding			central_nervous_system(4)|ovary(3)|skin(3)|lung(2)	12					Felbamate(DB00949)|Haloperidol(DB00502)|L-Glutamic Acid(DB00142)|Loperamide(DB00836)|Memantine(DB01043)													---	---	---	---	capture		Missense_Mutation	SNP	13769432	13769432	7059	12	A	T	T	7	7	GRIN2B	T	4	4
ATF7IP	55729	broad.mit.edu	37	12	14577231	14577231	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14577231G>T	uc001rbw.2	+	2	540	c.382G>T	c.(382-384)GAA>TAA	p.E128*	ATF7IP_uc010shs.1_Nonsense_Mutation_p.E128*|ATF7IP_uc001rbu.2_Nonsense_Mutation_p.E128*|ATF7IP_uc001rbv.1_Nonsense_Mutation_p.E128*|ATF7IP_uc001rbx.2_Nonsense_Mutation_p.E128*|ATF7IP_uc010sht.1_Nonsense_Mutation_p.E128*|ATF7IP_uc001rby.3_Nonsense_Mutation_p.E128*|ATF7IP_uc001rbz.1_Nonsense_Mutation_p.E128*|ATF7IP_uc001rca.2_Nonsense_Mutation_p.E128*|ATF7IP_uc001rcb.2_5'Flank	NM_018179	NP_060649	Q6VMQ6	MCAF1_HUMAN	activating transcription factor 7 interacting	128					DNA methylation|interspecies interaction between organisms|positive regulation of transcription, DNA-dependent|regulation of RNA polymerase II transcriptional preinitiation complex assembly|transcription, DNA-dependent		protein binding			lung(3)|ovary(1)|skin(1)	5																		---	---	---	---	capture		Nonsense_Mutation	SNP	14577231	14577231	1106	12	G	T	T	45	45	ATF7IP	T	5	2
ABCC9	10060	broad.mit.edu	37	12	21958144	21958144	+	Missense_Mutation	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21958144A>C	uc001rfi.1	-	38	4634	c.4614T>G	c.(4612-4614)AAT>AAG	p.N1538K	ABCC9_uc001rfh.2_Intron|ABCC9_uc001rfj.1_Missense_Mutation_p.N1502K|ABCC9_uc001rfg.2_Intron	NM_005691	NP_005682	O60706	ABCC9_HUMAN	ATP-binding cassette, sub-family C, member 9	1538	Cytoplasmic (Potential).|ABC transporter 2.				defense response to virus|potassium ion import	ATP-sensitive potassium channel complex	ATP binding|ATPase activity, coupled to transmembrane movement of substances|potassium channel regulator activity|sulfonylurea receptor activity			ovary(4)|skin(2)	6					Adenosine triphosphate(DB00171)|Glibenclamide(DB01016)													---	---	---	---	capture		Missense_Mutation	SNP	21958144	21958144	60	12	A	C	C	8	8	ABCC9	C	4	4
ARNTL2	56938	broad.mit.edu	37	12	27553476	27553476	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:27553476A>G	uc001rht.1	+	10	947	c.929A>G	c.(928-930)AAA>AGA	p.K310R	ARNTL2_uc001rhw.2_Missense_Mutation_p.K273R|ARNTL2_uc010sjp.1_Missense_Mutation_p.K273R|ARNTL2_uc001rhu.1_Missense_Mutation_p.K296R|ARNTL2_uc009zji.1_Missense_Mutation_p.K276R|ARNTL2_uc001rhv.1_Missense_Mutation_p.K262R|uc001rhx.2_Intron	NM_020183	NP_064568	Q8WYA1	BMAL2_HUMAN	aryl hydrocarbon receptor nuclear	310					circadian rhythm|entrainment of circadian clock|regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|signal transducer activity			ovary(1)|skin(1)	2	Colorectal(261;0.0847)|Lung SC(9;0.184)																	---	---	---	---	capture		Missense_Mutation	SNP	27553476	27553476	986	12	A	G	G	1	1	ARNTL2	G	4	4
REP15	387849	broad.mit.edu	37	12	27849721	27849721	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:27849721C>A	uc001rig.1	+	1	294	c.226C>A	c.(226-228)CTG>ATG	p.L76M		NM_001029874	NP_001025045	Q6BDI9	REP15_HUMAN	RAB15 effector protein	76						early endosome membrane				ovary(1)	1	Lung SC(9;0.0873)																	---	---	---	---	capture		Missense_Mutation	SNP	27849721	27849721	13695	12	C	A	A	28	28	REP15	A	2	2
PTHLH	5744	broad.mit.edu	37	12	28116594	28116594	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:28116594C>T	uc001rik.2	-	3	514	c.211G>A	c.(211-213)GAA>AAA	p.E71K	PTHLH_uc001ril.2_Missense_Mutation_p.E71K|PTHLH_uc001rim.2_Missense_Mutation_p.E71K|PTHLH_uc001rin.2_Missense_Mutation_p.E71K	NM_198966	NP_945317	P12272	PTHR_HUMAN	parathyroid hormone-like hormone isoform 1	71					activation of adenylate cyclase activity by G-protein signaling pathway|cAMP metabolic process|cell-cell signaling|epidermis development|female pregnancy|negative regulation of cell proliferation|negative regulation of chondrocyte differentiation|positive regulation of cAMP biosynthetic process|positive regulation of cell proliferation	cytoplasm|extracellular space|nucleus	hormone activity|peptide hormone receptor binding			breast(1)	1	Lung SC(9;0.184)																	---	---	---	---	capture		Missense_Mutation	SNP	28116594	28116594	13216	12	C	T	T	29	29	PTHLH	T	2	2
OVCH1	341350	broad.mit.edu	37	12	29639211	29639211	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:29639211T>C	uc001rix.1	-	8	963	c.963A>G	c.(961-963)CAA>CAG	p.Q321Q		NM_183378	NP_899234	Q7RTY7	OVCH1_HUMAN	ovochymase 1 precursor	321	CUB 1.				proteolysis	extracellular region	metal ion binding|serine-type endopeptidase activity			ovary(3)|central_nervous_system(3)|pancreas(3)|large_intestine(1)	10	Lung NSC(12;1.84e-09)|Acute lymphoblastic leukemia(23;0.00885)|all_hematologic(23;0.0155)																	---	---	---	---	capture		Silent	SNP	29639211	29639211	11736	12	T	C	C	56	56	OVCH1	C	4	4
TMTC1	83857	broad.mit.edu	37	12	29659798	29659798	+	Missense_Mutation	SNP	C	G	G	rs79931373	byFrequency;by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:29659798C>G	uc001rjb.2	-	18	2780	c.2306G>C	c.(2305-2307)CGA>CCA	p.R769P	TMTC1_uc001riz.2_Missense_Mutation_p.R526P|TMTC1_uc001rja.2_Missense_Mutation_p.R613P|TMTC1_uc001riy.2_Missense_Mutation_p.R222P	NM_175861	NP_787057	Q8IUR5	TMTC1_HUMAN	transmembrane and tetratricopeptide repeat	877						integral to membrane	binding				0	Lung NSC(12;7.61e-10)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.032)																	---	---	---	---	capture		Missense_Mutation	SNP	29659798	29659798	16801	12	C	G	G	31	31	TMTC1	G	3	3
C12orf35	55196	broad.mit.edu	37	12	32137137	32137137	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32137137A>T	uc001rks.2	+	4	3662	c.3248A>T	c.(3247-3249)CAG>CTG	p.Q1083L	C12orf35_uc001rkt.2_5'Flank	NM_018169	NP_060639	Q9HCM1	CL035_HUMAN	hypothetical protein LOC55196	1083										ovary(1)|skin(1)	2	all_cancers(9;3.36e-11)|all_epithelial(9;2.56e-11)|all_lung(12;5.67e-10)|Acute lymphoblastic leukemia(23;0.0122)|Lung SC(12;0.0336)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.204)		OV - Ovarian serous cystadenocarcinoma(6;0.0114)															---	---	---	---	capture		Missense_Mutation	SNP	32137137	32137137	1726	12	A	T	T	7	7	C12orf35	T	4	4
PKP2	5318	broad.mit.edu	37	12	32974420	32974420	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32974420T>C	uc001rlj.3	-	10	2130	c.2015A>G	c.(2014-2016)AAG>AGG	p.K672R	PKP2_uc001rlk.3_Missense_Mutation_p.K628R|PKP2_uc010skj.1_Missense_Mutation_p.K625R	NM_004572	NP_004563	Q99959	PKP2_HUMAN	plakophilin 2 isoform 2b	672	ARM 5.				cell-cell adhesion	desmosome|integral to membrane|nucleus	binding			ovary(1)|pancreas(1)	2	Lung NSC(5;9.35e-07)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.239)																	---	---	---	---	capture		Missense_Mutation	SNP	32974420	32974420	12410	12	T	C	C	56	56	PKP2	C	4	4
CNTN1	1272	broad.mit.edu	37	12	41327314	41327314	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:41327314A>T	uc001rmm.1	+	8	868	c.755A>T	c.(754-756)TAT>TTT	p.Y252F	CNTN1_uc009zjy.1_Missense_Mutation_p.Y252F|CNTN1_uc001rmn.1_Missense_Mutation_p.Y241F|CNTN1_uc001rmo.2_Missense_Mutation_p.Y252F	NM_001843	NP_001834	Q12860	CNTN1_HUMAN	contactin 1 isoform 1 precursor	252	Ig-like C2-type 3.				axon guidance|cell adhesion|Notch signaling pathway	anchored to membrane|membrane fraction|plasma membrane				lung(4)|ovary(3)|large_intestine(1)|skin(1)	9	all_cancers(12;2.07e-06)|all_epithelial(1;4.26e-06)|Breast(8;0.0716)	Lung NSC(34;0.0211)|all_lung(34;0.0294)																---	---	---	---	capture		Missense_Mutation	SNP	41327314	41327314	3778	12	A	T	T	16	16	CNTN1	T	4	4
SLC38A1	81539	broad.mit.edu	37	12	46591814	46591814	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46591814C>G	uc001rpa.2	-	15	1410	c.1152G>C	c.(1150-1152)AAG>AAC	p.K384N	SLC38A1_uc001rpb.2_Missense_Mutation_p.K384N|SLC38A1_uc001rpc.2_Missense_Mutation_p.K384N|SLC38A1_uc001rpd.2_Missense_Mutation_p.K384N|SLC38A1_uc001rpe.2_Missense_Mutation_p.K384N|SLC38A1_uc009zkj.1_Missense_Mutation_p.K384N	NM_030674	NP_109599	Q9H2H9	S38A1_HUMAN	amino acid transporter system A1	384	Cytoplasmic (Potential).				cellular nitrogen compound metabolic process|neurotransmitter uptake	integral to membrane|plasma membrane	sodium:amino acid symporter activity			ovary(2)|skin(2)|central_nervous_system(1)	5	Lung SC(27;0.137)|Renal(347;0.236)		all cancers(1;0.00805)|OV - Ovarian serous cystadenocarcinoma(5;0.0106)|Epithelial(2;0.0344)															---	---	---	---	capture		Missense_Mutation	SNP	46591814	46591814	15098	12	C	G	G	32	32	SLC38A1	G	3	3
ADCY6	112	broad.mit.edu	37	12	49176824	49176824	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49176824G>A	uc001rsh.3	-	1	1054	c.394C>T	c.(394-396)CGT>TGT	p.R132C	ADCY6_uc001rsj.3_Missense_Mutation_p.R132C|ADCY6_uc001rsi.3_Missense_Mutation_p.R132C	NM_015270	NP_056085	O43306	ADCY6_HUMAN	adenylate cyclase 6 isoform a	132	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|synaptic transmission|transmembrane transport|water transport	integral to membrane	ATP binding|metal ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	49176824	49176824	299	12	G	A	A	39	39	ADCY6	A	1	1
DDX23	9416	broad.mit.edu	37	12	49230475	49230475	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49230475C>G	uc001rsm.2	-	10	1204	c.1113G>C	c.(1111-1113)CGG>CGC	p.R371R		NM_004818	NP_004809	Q9BUQ8	DDX23_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 23	371						catalytic step 2 spliceosome|nucleoplasm|U5 snRNP	ATP binding|ATP-dependent RNA helicase activity|nucleic acid binding|protein binding			kidney(3)|ovary(1)|lung(1)|skin(1)	6																		---	---	---	---	capture		Silent	SNP	49230475	49230475	4521	12	C	G	G	30	30	DDX23	G	3	3
TMBIM6	7009	broad.mit.edu	37	12	50149493	50149493	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50149493G>T	uc001rux.2	+	4	373	c.241G>T	c.(241-243)GAA>TAA	p.E81*	TMBIM6_uc010sml.1_Nonsense_Mutation_p.E81*|TMBIM6_uc001ruy.2_Nonsense_Mutation_p.E139*|TMBIM6_uc001ruz.2_Nonsense_Mutation_p.E81*	NM_003217	NP_003208	P55061	BI1_HUMAN	testis enhanced gene transcript (BAX inhibitor	81					apoptosis|negative regulation of apoptosis	endoplasmic reticulum|insoluble fraction|integral to plasma membrane|nucleus					0																		---	---	---	---	capture		Nonsense_Mutation	SNP	50149493	50149493	16513	12	G	T	T	45	45	TMBIM6	T	5	2
NCKAP5L	57701	broad.mit.edu	37	12	50186285	50186285	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50186285A>T	uc009zlk.2	-	12	3938	c.3736T>A	c.(3736-3738)TCG>ACG	p.S1246T	NCKAP5L_uc001rvc.3_Missense_Mutation_p.S450T|NCKAP5L_uc001rvb.2_Missense_Mutation_p.S839T	NM_001037806	NP_001032895	Q9HCH0	NCK5L_HUMAN	NCK-associated protein 5-like	1242	Pro-rich.									central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	50186285	50186285	10623	12	A	T	T	11	11	NCKAP5L	T	4	4
GPD1	2819	broad.mit.edu	37	12	50498416	50498416	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50498416C>A	uc001rvz.2	+	2	134	c.101C>A	c.(100-102)CCA>CAA	p.P34Q	GPD1_uc010smp.1_Missense_Mutation_p.P34Q|GPD1_uc001rwa.2_Missense_Mutation_p.P34Q	NM_005276	NP_005267	P21695	GPDA_HUMAN	glycerol-3-phosphate dehydrogenase 1 (soluble)	34					glycerol-3-phosphate catabolic process|triglyceride biosynthetic process	cytosol|glycerol-3-phosphate dehydrogenase complex	glycerol-3-phosphate dehydrogenase|protein homodimerization activity				0					NADH(DB00157)													---	---	---	---	capture		Missense_Mutation	SNP	50498416	50498416	6878	12	C	A	A	21	21	GPD1	A	2	2
KRT85	3891	broad.mit.edu	37	12	52758919	52758919	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52758919C>T	uc001sag.2	-	2	576	c.456G>A	c.(454-456)GAG>GAA	p.E152E		NM_002283	NP_002274	P78386	KRT85_HUMAN	keratin 85	152	Rod.|Coil 1A.				epidermis development	keratin filament	protein binding|structural molecule activity			ovary(1)	1	Myeloproliferative disorder(4;0.0484)|all_hematologic(5;0.088)			BRCA - Breast invasive adenocarcinoma(357;0.189)														---	---	---	---	capture		Silent	SNP	52758919	52758919	8814	12	C	T	T	32	32	KRT85	T	2	2
KRT77	374454	broad.mit.edu	37	12	53096844	53096844	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53096844C>G	uc001saw.2	-	1	404	c.375G>C	c.(373-375)GGG>GGC	p.G125G	KRT77_uc009zmi.2_5'UTR	NM_175078	NP_778253	Q7Z794	K2C1B_HUMAN	keratin 77	125	Head.					keratin filament	structural molecule activity			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	53096844	53096844	8805	12	C	G	G	22	22	KRT77	G	3	3
OR6C65	403282	broad.mit.edu	37	12	55794480	55794480	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:55794480T>A	uc010spl.1	+	1	168	c.168T>A	c.(166-168)CCT>CCA	p.P56P		NM_001005518	NP_001005518	A6NJZ3	O6C65_HUMAN	olfactory receptor, family 6, subfamily C,	56	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---	capture		Silent	SNP	55794480	55794480	11605	12	T	A	A	53	53	OR6C65	A	4	4
ITGA7	3679	broad.mit.edu	37	12	56094770	56094770	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56094770C>T	uc001shh.2	-	4	803	c.583G>A	c.(583-585)GGG>AGG	p.G195R	ITGA7_uc001shg.2_Missense_Mutation_p.G195R|ITGA7_uc010sps.1_Missense_Mutation_p.G98R|ITGA7_uc009znx.2_Missense_Mutation_p.G82R	NM_001144996	NP_001138468	Q13683	ITA7_HUMAN	integrin alpha 7 isoform 1 precursor	195	FG-GAP 3.|Extracellular (Potential).				cell-matrix adhesion|integrin-mediated signaling pathway|muscle organ development|regulation of cell shape	integrin complex	receptor activity			ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	56094770	56094770	8185	12	C	T	T	21	21	ITGA7	T	2	2
MARS	4141	broad.mit.edu	37	12	57910229	57910229	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57910229C>T	uc001sog.2	+	21	2591	c.2568C>T	c.(2566-2568)GTC>GTT	p.V856V	MARS_uc001sof.1_RNA|MARS_uc001soh.1_3'UTR	NM_004990	NP_004981	P56192	SYMC_HUMAN	methionyl-tRNA synthetase	856	WHEP-TRS.				methionyl-tRNA aminoacylation	cytosol	ATP binding|methionine-tRNA ligase activity|protein binding|tRNA binding			ovary(3)|central_nervous_system(1)|pancreas(1)	5			GBM - Glioblastoma multiforme(3;4.27e-41)		L-Methionine(DB00134)													---	---	---	---	capture		Silent	SNP	57910229	57910229	9699	12	C	T	T	30	30	MARS	T	2	2
TBK1	29110	broad.mit.edu	37	12	64854058	64854058	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:64854058G>T	uc001ssc.1	+	3	239	c.177G>T	c.(175-177)TTG>TTT	p.L59F		NM_013254	NP_037386	Q9UHD2	TBK1_HUMAN	TANK-binding kinase 1	59	Protein kinase.				I-kappaB kinase/NF-kappaB cascade|innate immune response|interspecies interaction between organisms|MyD88-independent toll-like receptor signaling pathway|negative regulation of type I interferon production|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interferon-alpha production|positive regulation of interferon-beta production|positive regulation of transcription from RNA polymerase II promoter|response to virus|Toll signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|endosome membrane|plasma membrane	ATP binding|phosphoprotein binding|protein serine/threonine kinase activity			central_nervous_system(2)|ovary(1)|large_intestine(1)|breast(1)	5				GBM - Glioblastoma multiforme(28;0.0386)														---	---	---	---	capture		Missense_Mutation	SNP	64854058	64854058	16163	12	G	T	T	45	45	TBK1	T	2	2
PTPRR	5801	broad.mit.edu	37	12	71092078	71092078	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:71092078C>G	uc001swi.1	-	8	1662	c.1246G>C	c.(1246-1248)GGA>CGA	p.G416R	PTPRR_uc001swh.1_Missense_Mutation_p.G171R|PTPRR_uc009zrs.2_Missense_Mutation_p.G265R|PTPRR_uc010stq.1_Missense_Mutation_p.G304R|PTPRR_uc010str.1_Missense_Mutation_p.G265R	NM_002849	NP_002840	Q15256	PTPRR_HUMAN	protein tyrosine phosphatase, receptor type, R	416	Tyrosine-protein phosphatase.|Cytoplasmic (Potential).				in utero embryonic development	cell surface|Golgi apparatus|integral to membrane|nucleus|perinuclear region of cytoplasm|plasma membrane	protein kinase binding|transmembrane receptor protein tyrosine phosphatase activity			skin(2)|ovary(1)	3			GBM - Glioblastoma multiforme(2;5.67e-07)|Lung(24;0.00283)|OV - Ovarian serous cystadenocarcinoma(12;0.00578)|LUSC - Lung squamous cell carcinoma(43;0.132)	COAD - Colon adenocarcinoma(1;0.136)														---	---	---	---	capture		Missense_Mutation	SNP	71092078	71092078	13268	12	C	G	G	21	21	PTPRR	G	3	3
LRRIQ1	84125	broad.mit.edu	37	12	85432046	85432046	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:85432046G>T	uc001tac.2	+	2	203	c.92G>T	c.(91-93)AGT>ATT	p.S31I	LRRIQ1_uc001tab.1_Missense_Mutation_p.S31I|TSPAN19_uc009zsj.2_5'Flank|LRRIQ1_uc001taa.1_Missense_Mutation_p.S31I|LRRIQ1_uc001tad.2_5'Flank	NM_001079910	NP_001073379	Q96JM4	LRIQ1_HUMAN	leucine-rich repeats and IQ motif containing 1	31										ovary(4)|central_nervous_system(1)|skin(1)	6				GBM - Glioblastoma multiforme(134;0.212)														---	---	---	---	capture		Missense_Mutation	SNP	85432046	85432046	9405	12	G	T	T	36	36	LRRIQ1	T	2	2
C12orf74	338809	broad.mit.edu	37	12	93100523	93100523	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:93100523G>T	uc001tch.1	+	2	346	c.116G>T	c.(115-117)CGG>CTG	p.R39L	C12orf74_uc001tci.2_Missense_Mutation_p.R39L	NM_001037671	NP_001032760	Q32Q52	CL074_HUMAN	hypothetical protein LOC338809	39											0																		---	---	---	---	capture		Missense_Mutation	SNP	93100523	93100523	1760	12	G	T	T	39	39	C12orf74	T	1	1
NT5DC3	51559	broad.mit.edu	37	12	104190720	104190720	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104190720G>C	uc010swe.1	-	6	746	c.705C>G	c.(703-705)CTC>CTG	p.L235L		NM_001031701	NP_001026871	Q86UY8	NT5D3_HUMAN	5'-nucleotidase domain containing 3	235							hydrolase activity|metal ion binding			ovary(2)|skin(1)	3																		---	---	---	---	capture		Silent	SNP	104190720	104190720	11097	12	G	C	C	45	45	NT5DC3	C	3	3
APPL2	55198	broad.mit.edu	37	12	105600901	105600901	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:105600901C>A	uc001tlf.1	-	8	777	c.559G>T	c.(559-561)GCG>TCG	p.A187S	APPL2_uc010swt.1_Missense_Mutation_p.A144S|APPL2_uc001tlg.1_5'UTR|APPL2_uc010swu.1_Missense_Mutation_p.A193S|APPL2_uc009zuq.2_Missense_Mutation_p.A144S	NM_018171	NP_060641	Q8NEU8	DP13B_HUMAN	adaptor protein, phosphotyrosine interaction, PH	187	Required for RAB5A binding (By similarity).				cell cycle|cell proliferation|signal transduction	early endosome membrane|nucleus	protein binding			upper_aerodigestive_tract(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	105600901	105600901	829	12	C	A	A	27	27	APPL2	A	1	1
NUAK1	9891	broad.mit.edu	37	12	106460588	106460588	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:106460588G>C	uc001tlj.1	-	7	3358	c.1978C>G	c.(1978-1980)CTC>GTC	p.L660V		NM_014840	NP_055655	O60285	NUAK1_HUMAN	AMPK-related protein kinase 5	660							ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	106460588	106460588	11117	12	G	C	C	34	34	NUAK1	C	3	3
POLR3B	55703	broad.mit.edu	37	12	106824224	106824224	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:106824224G>A	uc001tlp.2	+	14	1659	c.1437G>A	c.(1435-1437)CTG>CTA	p.L479L	POLR3B_uc001tlq.2_Silent_p.L421L	NM_018082	NP_060552	Q9NW08	RPC2_HUMAN	DNA-directed RNA polymerase III B isoform 1	479					innate immune response|positive regulation of innate immune response|positive regulation of interferon-beta production|response to virus|termination of RNA polymerase III transcription|transcription elongation from RNA polymerase III promoter	nucleoplasm	DNA binding|DNA-directed RNA polymerase activity|metal ion binding|ribonucleoside binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	106824224	106824224	12657	12	G	A	A	48	48	POLR3B	A	2	2
CMKLR1	1240	broad.mit.edu	37	12	108685783	108685783	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:108685783C>A	uc009zuw.2	-	3	1148	c.957G>T	c.(955-957)ATG>ATT	p.M319I	CMKLR1_uc001tmw.2_Missense_Mutation_p.M319I|CMKLR1_uc001tmv.2_Missense_Mutation_p.M317I|CMKLR1_uc009zuv.2_Missense_Mutation_p.M319I	NM_001142345	NP_001135817	Q99788	CML1_HUMAN	chemokine-like receptor 1 isoform a	319	Helical; Name=7; (Potential).				chemotaxis|immune response|negative regulation of interleukin-12 production|negative regulation of NF-kappaB transcription factor activity|positive regulation of macrophage chemotaxis|regulation of calcium-mediated signaling|skeletal system development	integral to plasma membrane	chemokine receptor activity			lung(3)|ovary(1)|pancreas(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	108685783	108685783	3717	12	C	A	A	21	21	CMKLR1	A	2	2
MYO1H	283446	broad.mit.edu	37	12	109843825	109843825	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109843825C>T	uc010sxn.1	+	7	900	c.900C>T	c.(898-900)ATC>ATT	p.I300I		NM_001101421	NP_001094891	Q8N1T3	MYO1H_HUMAN	myosin 1H	Error:Variant_position_missing_in_B4DNW6_after_alignment						myosin complex	motor activity				0																		---	---	---	---	capture		Silent	SNP	109843825	109843825	10470	12	C	T	T	29	29	MYO1H	T	2	2
C12orf76	400073	broad.mit.edu	37	12	110495092	110495092	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:110495092C>T	uc001tqd.1	-	4	566	c.201G>A	c.(199-201)AAG>AAA	p.K67K	C12orf76_uc001tqe.1_RNA|C12orf76_uc010sxx.1_RNA|uc001tqf.1_Intron	NM_207435	NP_997318	Q8N812	CL076_HUMAN	hypothetical protein LOC400073	67										large_intestine(1)	1																		---	---	---	---	capture		Silent	SNP	110495092	110495092	1762	12	C	T	T	24	24	C12orf76	T	2	2
C12orf51	283450	broad.mit.edu	37	12	112654880	112654880	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112654880G>A	uc009zwc.2	-	39	5946	c.5928C>T	c.(5926-5928)CCC>CCT	p.P1976P	C12orf51_uc001ttr.1_Silent_p.P151P	NM_001109662	NP_001103132			chromosome 12 open reading frame 51											ovary(1)|lung(1)	2																		---	---	---	---	capture		Silent	SNP	112654880	112654880	1740	12	G	A	A	43	43	C12orf51	A	2	2
TBX3	6926	broad.mit.edu	37	12	115114170	115114170	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:115114170G>A	uc001tvt.1	-	6	2011	c.1047C>T	c.(1045-1047)TTC>TTT	p.F349F	TBX3_uc001tvu.1_Silent_p.F329F	NM_016569	NP_057653	O15119	TBX3_HUMAN	T-box 3 protein isoform 2	349					anterior/posterior axis specification, embryo|anti-apoptosis|cell aging|embryonic arm morphogenesis|embryonic digit morphogenesis|female genitalia development|follicle-stimulating hormone secretion|luteinizing hormone secretion|male genitalia development|mesoderm morphogenesis|negative regulation of myoblast differentiation|negative regulation of transcription, DNA-dependent|positive regulation of cell cycle|positive regulation of cell proliferation|regulation of transcription from RNA polymerase II promoter|skeletal system development	nucleus	sequence-specific DNA binding			ovary(2)|skin(1)	3	Medulloblastoma(191;0.163)|all_neural(191;0.178)			BRCA - Breast invasive adenocarcinoma(302;0.0574)														---	---	---	---	capture		Silent	SNP	115114170	115114170	16185	12	G	A	A	37	37	TBX3	A	1	1
TBX3	6926	broad.mit.edu	37	12	115120647	115120647	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:115120647C>A	uc001tvt.1	-	1	1323	c.359G>T	c.(358-360)GGC>GTC	p.G120V	TBX3_uc001tvu.1_Missense_Mutation_p.G120V|TBX3_uc010syw.1_Missense_Mutation_p.G120V	NM_016569	NP_057653	O15119	TBX3_HUMAN	T-box 3 protein isoform 2	120	T-box; first part.				anterior/posterior axis specification, embryo|anti-apoptosis|cell aging|embryonic arm morphogenesis|embryonic digit morphogenesis|female genitalia development|follicle-stimulating hormone secretion|luteinizing hormone secretion|male genitalia development|mesoderm morphogenesis|negative regulation of myoblast differentiation|negative regulation of transcription, DNA-dependent|positive regulation of cell cycle|positive regulation of cell proliferation|regulation of transcription from RNA polymerase II promoter|skeletal system development	nucleus	sequence-specific DNA binding			ovary(2)|skin(1)	3	Medulloblastoma(191;0.163)|all_neural(191;0.178)			BRCA - Breast invasive adenocarcinoma(302;0.0574)														---	---	---	---	capture		Missense_Mutation	SNP	115120647	115120647	16185	12	C	A	A	26	26	TBX3	A	2	2
HSPB8	26353	broad.mit.edu	37	12	119624881	119624881	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:119624881C>A	uc001txb.2	+	2	942	c.419C>A	c.(418-420)ACA>AAA	p.T140K	HSPB8_uc001txc.2_Intron	NM_014365	NP_055180	Q9UJY1	HSPB8_HUMAN	heat shock 22kDa protein 8	140					cell death|response to heat	cytoplasm|nucleus	identical protein binding|protein serine/threonine kinase activity			central_nervous_system(1)|skin(1)	2	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---	capture		Missense_Mutation	SNP	119624881	119624881	7723	12	C	A	A	17	17	HSPB8	A	2	2
WDR66	144406	broad.mit.edu	37	12	122396305	122396305	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:122396305C>A	uc009zxk.2	+	12	2000	c.1858C>A	c.(1858-1860)CTC>ATC	p.L620I		NM_144668	NP_653269	Q8TBY9	WDR66_HUMAN	WD repeat domain 66	620	WD 6.						calcium ion binding			ovary(1)|skin(1)	2	all_neural(191;0.0496)|Medulloblastoma(191;0.0922)			OV - Ovarian serous cystadenocarcinoma(86;0.000155)|Epithelial(86;0.000634)|BRCA - Breast invasive adenocarcinoma(302;0.248)														---	---	---	---	capture		Missense_Mutation	SNP	122396305	122396305	17890	12	C	A	A	24	24	WDR66	A	2	2
DNAH10	196385	broad.mit.edu	37	12	124303771	124303771	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124303771G>T	uc001uft.3	+	22	3645	c.3620G>T	c.(3619-3621)GGT>GTT	p.G1207V		NM_207437	NP_997320	Q8IVF4	DYH10_HUMAN	dynein, axonemal, heavy chain 10	1207	Stem (By similarity).				microtubule-based movement	cilium axoneme|cytoplasm|dynein complex|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(3)|skin(2)|central_nervous_system(1)	6	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000207)|Epithelial(86;0.000556)|all cancers(50;0.00346)														---	---	---	---	capture		Missense_Mutation	SNP	124303771	124303771	4780	12	G	T	T	44	44	DNAH10	T	2	2
UBC	7316	broad.mit.edu	37	12	125397817	125397817	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:125397817G>A	uc001ugs.3	-	2	949	c.501C>T	c.(499-501)CTC>CTT	p.L167L	UBC_uc001ugr.2_5'Flank|UBC_uc001ugu.1_Silent_p.L167L|UBC_uc001ugt.2_Silent_p.L167L|UBC_uc001ugv.2_Intron|UBC_uc001ugw.2_Silent_p.L15L	NM_021009	NP_066289	P0CG48	UBC_HUMAN	ubiquitin C	167	Ubiquitin-like 3.				activation of MAPK activity|anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|anti-apoptosis|apoptosis|cellular membrane organization|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA repair|endosome transport|epidermal growth factor receptor signaling pathway|G1/S transition of mitotic cell cycle|I-kappaB kinase/NF-kappaB cascade|induction of apoptosis by extracellular signals|innate immune response|JNK cascade|M/G1 transition of mitotic cell cycle|mRNA metabolic process|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of epidermal growth factor receptor signaling pathway|negative regulation of type I interferon production|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|nerve growth factor receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|S phase of mitotic cell cycle|stress-activated MAPK cascade|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway|viral reproduction	cytosol|endocytic vesicle membrane|endosome membrane|nucleoplasm|plasma membrane	protein binding			ovary(2)	2	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;6.17e-05)|Epithelial(86;0.000207)|all cancers(50;0.00308)														---	---	---	---	capture		Silent	SNP	125397817	125397817	17399	12	G	A	A	37	37	UBC	A	1	1
TMEM132B	114795	broad.mit.edu	37	12	126138695	126138695	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:126138695G>C	uc001uhe.1	+	9	2684	c.2676G>C	c.(2674-2676)AGG>AGC	p.R892S	TMEM132B_uc001uhf.1_Missense_Mutation_p.R404S	NM_052907	NP_443139	Q14DG7	T132B_HUMAN	transmembrane protein 132B	892	Extracellular (Potential).					integral to membrane				skin(11)|ovary(5)|large_intestine(1)|pancreas(1)|breast(1)	19	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000423)|Epithelial(86;0.00394)|all cancers(50;0.0362)														---	---	---	---	capture		Missense_Mutation	SNP	126138695	126138695	16577	12	G	C	C	43	43	TMEM132B	C	3	3
TMEM132D	121256	broad.mit.edu	37	12	129559279	129559279	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:129559279G>T	uc009zyl.1	-	9	2769	c.2441C>A	c.(2440-2442)GCA>GAA	p.A814E	TMEM132D_uc001uia.2_Missense_Mutation_p.A352E	NM_133448	NP_597705	Q14C87	T132D_HUMAN	transmembrane protein 132D precursor	814	Extracellular (Potential).					integral to membrane				ovary(10)|pancreas(2)|upper_aerodigestive_tract(1)|skin(1)	14	all_neural(191;0.101)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0934)|Breast(359;0.133)		OV - Ovarian serous cystadenocarcinoma(86;0.000288)|Epithelial(86;0.0116)|all cancers(50;0.0246)														---	---	---	---	capture		Missense_Mutation	SNP	129559279	129559279	16579	12	G	T	T	46	46	TMEM132D	T	2	2
IFT88	8100	broad.mit.edu	37	13	21189974	21189974	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:21189974C>G	uc001unh.2	+	16	1578	c.1182C>G	c.(1180-1182)CTC>CTG	p.L394L	IFT88_uc001uni.2_Silent_p.L385L|IFT88_uc001unj.2_Silent_p.L384L|IFT88_uc010tcq.1_Silent_p.L365L|IFT88_uc001unk.2_Silent_p.L140L|IFT88_uc001unl.1_Silent_p.L12L	NM_175605	NP_783195	Q13099	IFT88_HUMAN	intraflagellar transport 88 homolog isoform 1	394					cilium morphogenesis	centriole|intraflagellar transport particle B|microtubule basal body|microtubule-based flagellum	protein binding			ovary(1)	1		all_cancers(29;5.79e-25)|all_epithelial(30;2.57e-20)|all_lung(29;3.13e-16)|Lung SC(185;0.0262)|Ovarian(182;0.0825)|Hepatocellular(188;0.244)		all cancers(112;0.000667)|Epithelial(112;0.00119)|OV - Ovarian serous cystadenocarcinoma(117;0.0141)|Lung(94;0.0183)|LUSC - Lung squamous cell carcinoma(192;0.0528)														---	---	---	---	capture		Silent	SNP	21189974	21189974	7867	13	C	G	G	29	29	IFT88	G	3	3
IFT88	8100	broad.mit.edu	37	13	21219051	21219051	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:21219051T>A	uc001unh.2	+	22	2326	c.1930T>A	c.(1930-1932)TTT>ATT	p.F644I	IFT88_uc001uni.2_Missense_Mutation_p.F635I|IFT88_uc001unj.2_Missense_Mutation_p.F634I|IFT88_uc010tcq.1_Missense_Mutation_p.F615I	NM_175605	NP_783195	Q13099	IFT88_HUMAN	intraflagellar transport 88 homolog isoform 1	644	TPR 11.				cilium morphogenesis	centriole|intraflagellar transport particle B|microtubule basal body|microtubule-based flagellum	protein binding			ovary(1)	1		all_cancers(29;5.79e-25)|all_epithelial(30;2.57e-20)|all_lung(29;3.13e-16)|Lung SC(185;0.0262)|Ovarian(182;0.0825)|Hepatocellular(188;0.244)		all cancers(112;0.000667)|Epithelial(112;0.00119)|OV - Ovarian serous cystadenocarcinoma(117;0.0141)|Lung(94;0.0183)|LUSC - Lung squamous cell carcinoma(192;0.0528)														---	---	---	---	capture		Missense_Mutation	SNP	21219051	21219051	7867	13	T	A	A	52	52	IFT88	A	4	4
LATS2	26524	broad.mit.edu	37	13	21562336	21562336	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:21562336G>A	uc009zzs.2	-	4	1948	c.1583C>T	c.(1582-1584)TCG>TTG	p.S528L	LATS2_uc001unr.3_Missense_Mutation_p.S528L	NM_014572	NP_055387	Q9NRM7	LATS2_HUMAN	LATS, large tumor suppressor, homolog 2	528					cell division|G1/S transition of mitotic cell cycle|hippo signaling cascade|hormone-mediated signaling pathway|intracellular protein kinase cascade|mitosis|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cyclin-dependent protein kinase activity	microtubule organizing center|nucleus|spindle pole	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			lung(3)|central_nervous_system(3)|ovary(2)|breast(1)|pancreas(1)	10		all_cancers(29;4.74e-22)|all_epithelial(30;1.45e-18)|all_lung(29;4.69e-16)|Lung SC(185;0.0262)|Hepatocellular(188;0.244)		all cancers(112;0.000781)|Epithelial(112;0.00144)|OV - Ovarian serous cystadenocarcinoma(117;0.0183)|Lung(94;0.0375)|LUSC - Lung squamous cell carcinoma(192;0.104)														---	---	---	---	capture		Missense_Mutation	SNP	21562336	21562336	8970	13	G	A	A	37	37	LATS2	A	1	1
CENPJ	55835	broad.mit.edu	37	13	25480240	25480240	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25480240C>T	uc001upt.3	-	7	2189	c.1936G>A	c.(1936-1938)GAG>AAG	p.E646K	CENPJ_uc010tdf.1_RNA|CENPJ_uc010aae.2_RNA|CENPJ_uc010aaf.2_RNA|CENPJ_uc001upu.2_5'Flank	NM_018451	NP_060921	Q9HC77	CENPJ_HUMAN	centromere protein J	646					cell division|centriole replication|G2/M transition of mitotic cell cycle|microtubule nucleation|microtubule polymerization	centriole|cytosol|gamma-tubulin small complex|microtubule	protein domain specific binding|tubulin binding			ovary(2)	2		Lung SC(185;0.0225)|Breast(139;0.0602)		all cancers(112;0.00793)|Epithelial(112;0.0411)|OV - Ovarian serous cystadenocarcinoma(117;0.139)														---	---	---	---	capture		Missense_Mutation	SNP	25480240	25480240	3367	13	C	T	T	29	29	CENPJ	T	2	2
FLT1	2321	broad.mit.edu	37	13	29001924	29001924	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:29001924A>G	uc001usb.3	-	9	1526	c.1241T>C	c.(1240-1242)GTG>GCG	p.V414A	FLT1_uc010aar.1_Missense_Mutation_p.V414A|FLT1_uc001usc.3_Missense_Mutation_p.V414A|FLT1_uc010tdp.1_Missense_Mutation_p.V414A	NM_002019	NP_002010	P17948	VGFR1_HUMAN	fms-related tyrosine kinase 1 isoform 1	414	Ig-like C2-type 4.|Extracellular (Potential).				cell differentiation|female pregnancy|positive regulation of vascular endothelial growth factor receptor signaling pathway	extracellular space|Golgi apparatus|integral to plasma membrane|nucleus	ATP binding|growth factor binding|vascular endothelial growth factor receptor activity			lung(10)|central_nervous_system(5)|ovary(3)|stomach(2)|skin(2)|urinary_tract(1)|breast(1)	24	Acute lymphoblastic leukemia(6;0.04)	Lung SC(185;0.0262)|Breast(139;0.188)	Colorectal(13;0.000674)	all cancers(112;0.0301)|Epithelial(112;0.155)|GBM - Glioblastoma multiforme(144;0.184)|OV - Ovarian serous cystadenocarcinoma(117;0.205)|Lung(94;0.207)	Sunitinib(DB01268)													---	---	---	---	capture		Missense_Mutation	SNP	29001924	29001924	6183	13	A	G	G	6	6	FLT1	G	4	4
TRPC4	7223	broad.mit.edu	37	13	38213200	38213200	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:38213200C>A	uc001uws.2	-	10	2423	c.2188G>T	c.(2188-2190)GGC>TGC	p.G730C	TRPC4_uc010abv.2_Missense_Mutation_p.G310C|TRPC4_uc001uwt.2_Missense_Mutation_p.G730C|TRPC4_uc010tey.1_Missense_Mutation_p.V730F|TRPC4_uc010abw.2_Missense_Mutation_p.G557C|TRPC4_uc010abx.2_Missense_Mutation_p.G735C|TRPC4_uc010aby.2_Missense_Mutation_p.G665C	NM_016179	NP_057263	Q9UBN4	TRPC4_HUMAN	transient receptor potential cation channel,	730	Binds to ITPR1, ITPR2 and ITPR3.|Cytoplasmic (Potential).				axon guidance|calcium ion import	basolateral plasma membrane|calcium channel complex|cell surface|cortical cytoskeleton	beta-catenin binding|cadherin binding|store-operated calcium channel activity			ovary(3)|skin(2)|breast(1)	6				all cancers(112;1.92e-08)|Epithelial(112;5.04e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.000677)|GBM - Glioblastoma multiforme(144;0.00623)|BRCA - Breast invasive adenocarcinoma(63;0.0126)														---	---	---	---	capture		Missense_Mutation	SNP	38213200	38213200	17131	13	C	A	A	24	24	TRPC4	A	2	2
FREM2	341640	broad.mit.edu	37	13	39264956	39264956	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:39264956G>T	uc001uwv.2	+	1	3784	c.3475G>T	c.(3475-3477)GTG>TTG	p.V1159L		NM_207361	NP_997244	Q5SZK8	FREM2_HUMAN	FRAS1-related extracellular matrix protein 2	1159	Extracellular (Potential).|CSPG 7.				cell communication|homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(7)|pancreas(1)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|skin(1)	11		Lung NSC(96;1.04e-07)|Prostate(109;0.00384)|Breast(139;0.00396)|Lung SC(185;0.0565)|Hepatocellular(188;0.114)		all cancers(112;3.32e-07)|Epithelial(112;1.66e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.00154)|BRCA - Breast invasive adenocarcinoma(63;0.00631)|GBM - Glioblastoma multiforme(144;0.0312)														---	---	---	---	capture		Missense_Mutation	SNP	39264956	39264956	6292	13	G	T	T	48	48	FREM2	T	2	2
FREM2	341640	broad.mit.edu	37	13	39266606	39266606	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:39266606C>G	uc001uwv.2	+	1	5434	c.5125C>G	c.(5125-5127)CTT>GTT	p.L1709V		NM_207361	NP_997244	Q5SZK8	FREM2_HUMAN	FRAS1-related extracellular matrix protein 2	1709	Extracellular (Potential).|CSPG 12.				cell communication|homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(7)|pancreas(1)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|skin(1)	11		Lung NSC(96;1.04e-07)|Prostate(109;0.00384)|Breast(139;0.00396)|Lung SC(185;0.0565)|Hepatocellular(188;0.114)		all cancers(112;3.32e-07)|Epithelial(112;1.66e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.00154)|BRCA - Breast invasive adenocarcinoma(63;0.00631)|GBM - Glioblastoma multiforme(144;0.0312)														---	---	---	---	capture		Missense_Mutation	SNP	39266606	39266606	6292	13	C	G	G	32	32	FREM2	G	3	3
SLC25A15	10166	broad.mit.edu	37	13	41379369	41379369	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:41379369G>C	uc001uxn.2	+	4	752	c.430G>C	c.(430-432)GGG>CGG	p.G144R	SUGT1L1_uc001uxp.1_Intron|SLC25A15_uc010tfb.1_Missense_Mutation_p.G50R|SUGT1L1_uc001uxo.1_Intron	NM_014252	NP_055067	Q9Y619	ORNT1_HUMAN	mitochondrial ornithine transporter 1	144	Solcar 2.				cellular amino acid metabolic process|mitochondrial ornithine transport|urea cycle	integral to membrane|mitochondrial inner membrane	L-ornithine transmembrane transporter activity				0		Lung NSC(96;3.55e-06)|Breast(139;0.00394)|Prostate(109;0.0181)|Lung SC(185;0.0262)|Hepatocellular(188;0.194)		all cancers(112;1.48e-08)|Epithelial(112;7.51e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.000191)|GBM - Glioblastoma multiforme(144;0.00231)|BRCA - Breast invasive adenocarcinoma(63;0.0704)	L-Ornithine(DB00129)													---	---	---	---	capture		Missense_Mutation	SNP	41379369	41379369	14974	13	G	C	C	35	35	SLC25A15	C	3	3
PCDH17	27253	broad.mit.edu	37	13	58207038	58207038	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:58207038G>T	uc001vhq.1	+	1	1250	c.358G>T	c.(358-360)GTA>TTA	p.V120L	PCDH17_uc010aec.1_Missense_Mutation_p.V120L	NM_001040429	NP_001035519	O14917	PCD17_HUMAN	protocadherin 17 precursor	120	Extracellular (Potential).|Cadherin 1.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding|protein binding			ovary(3)|pancreas(2)|upper_aerodigestive_tract(1)|skin(1)	7		Lung NSC(96;0.027)|Prostate(109;0.0453)|Breast(118;0.128)|Hepatocellular(98;0.132)		GBM - Glioblastoma multiforme(99;1.06e-05)														---	---	---	---	capture		Missense_Mutation	SNP	58207038	58207038	11932	13	G	T	T	44	44	PCDH17	T	2	2
PCDH9	5101	broad.mit.edu	37	13	66879051	66879051	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:66879051T>A	uc001vik.2	-	5	4142	c.3450A>T	c.(3448-3450)CCA>CCT	p.P1150P	PCDH9_uc010aei.2_RNA|PCDH9_uc001vil.2_Silent_p.P1116P|PCDH9_uc010thl.1_Silent_p.P1108P	NM_203487	NP_982354	Q9HC56	PCDH9_HUMAN	protocadherin 9 isoform 1 precursor	1150	Cytoplasmic (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|pancreas(1)|skin(1)	6		Hepatocellular(98;0.0906)|Breast(118;0.107)		GBM - Glioblastoma multiforme(99;0.00819)														---	---	---	---	capture		Silent	SNP	66879051	66879051	11938	13	T	A	A	51	51	PCDH9	A	4	4
MYCBP2	23077	broad.mit.edu	37	13	77739409	77739409	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:77739409T>A	uc001vkf.2	-	43	6435	c.6344A>T	c.(6343-6345)GAG>GTG	p.E2115V	MYCBP2_uc010aev.2_Missense_Mutation_p.E1519V	NM_015057	NP_055872	O75592	MYCB2_HUMAN	MYC binding protein 2	2115					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ligase activity|protein binding|zinc ion binding			ovary(4)|breast(4)|skin(3)|lung(2)|pancreas(1)	14		Breast(118;0.212)|Acute lymphoblastic leukemia(28;0.22)		GBM - Glioblastoma multiforme(99;0.109)														---	---	---	---	capture		Missense_Mutation	SNP	77739409	77739409	10413	13	T	A	A	54	54	MYCBP2	A	4	4
CLDN10	9071	broad.mit.edu	37	13	96086270	96086270	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:96086270C>T	uc001vmg.2	+	1	418	c.183C>T	c.(181-183)TGC>TGT	p.C61C	CLDN10_uc010tii.1_Intron	NM_182848	NP_878268	P78369	CLD10_HUMAN	claudin 10 isoform a	63	Extracellular (Potential).				calcium-independent cell-cell adhesion	integral to membrane|tight junction	identical protein binding|structural molecule activity			ovary(1)	1	all_neural(89;0.0878)|Breast(111;0.148)|Medulloblastoma(90;0.163)		BRCA - Breast invasive adenocarcinoma(86;0.18)															---	---	---	---	capture		Silent	SNP	96086270	96086270	3608	13	C	T	T	26	26	CLDN10	T	2	2
TM9SF2	9375	broad.mit.edu	37	13	100181719	100181719	+	Splice_Site	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:100181719A>T	uc001voj.1	+	4	467	c.334_splice	c.e4-2	p.F112_splice	TM9SF2_uc010afz.1_Intron	NM_004800	NP_004791			transmembrane 9 superfamily member 2 precursor						transport	endosome membrane|integral to plasma membrane				ovary(1)	1	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.218)																	---	---	---	---	capture		Splice_Site	SNP	100181719	100181719	16508	13	A	T	T	7	7	TM9SF2	T	5	4
PCCA	5095	broad.mit.edu	37	13	100925585	100925585	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:100925585G>C	uc001voo.2	+	12	1088	c.1050G>C	c.(1048-1050)ATG>ATC	p.M350I	PCCA_uc010aga.2_Missense_Mutation_p.M324I|PCCA_uc010tiz.1_Missense_Mutation_p.M350I	NM_000282	NP_000273	P05165	PCCA_HUMAN	propionyl-Coenzyme A carboxylase, alpha	350	ATP-grasp.|Biotin carboxylation.				fatty acid beta-oxidation	mitochondrial matrix	ATP binding|biotin binding|biotin carboxylase activity|enzyme binding|metal ion binding|propionyl-CoA carboxylase activity			skin(2)	2	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)				Biotin(DB00121)													---	---	---	---	capture		Missense_Mutation	SNP	100925585	100925585	11924	13	G	C	C	45	45	PCCA	C	3	3
PROZ	8858	broad.mit.edu	37	13	113814408	113814408	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:113814408G>A	uc001vta.1	+	2	158	c.151G>A	c.(151-153)GAG>AAG	p.E51K	PROZ_uc010agr.1_Missense_Mutation_p.E73K	NM_003891	NP_003882	P22891	PROZ_HUMAN	protein Z, vitamin K-dependent plasma	51	Gla.				blood coagulation|peptidyl-glutamic acid carboxylation|post-translational protein modification|proteolysis	endoplasmic reticulum lumen|extracellular region|Golgi lumen	calcium ion binding|serine-type endopeptidase activity				0	all_lung(23;0.000374)|Lung NSC(43;0.0107)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)	all_lung(25;0.216)	all cancers(43;0.104)		Menadione(DB00170)													---	---	---	---	capture		Missense_Mutation	SNP	113814408	113814408	13005	13	G	A	A	37	37	PROZ	A	1	1
POTEG	404785	broad.mit.edu	37	14	19553804	19553804	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:19553804G>T	uc001vuz.1	+	1	440	c.388G>T	c.(388-390)GAG>TAG	p.E130*	POTEG_uc001vva.1_RNA|POTEG_uc010ahc.1_RNA	NM_001005356	NP_001005356	Q6S5H5	POTEG_HUMAN	POTE ankyrin domain family, member G	130										ovary(1)	1																		---	---	---	---	capture		Nonsense_Mutation	SNP	19553804	19553804	12696	14	G	T	T	41	41	POTEG	T	5	2
POTEG	404785	broad.mit.edu	37	14	19563531	19563531	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:19563531C>A	uc001vuz.1	+	5	1097	c.1045C>A	c.(1045-1047)CAT>AAT	p.H349N	POTEG_uc001vva.1_RNA|POTEG_uc010ahc.1_RNA|uc001vvb.2_RNA	NM_001005356	NP_001005356	Q6S5H5	POTEG_HUMAN	POTE ankyrin domain family, member G	349				H -> R (in Ref. 1; AAS58868/AAS58871).						ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	19563531	19563531	12696	14	C	A	A	29	29	POTEG	A	2	2
OR4M1	441670	broad.mit.edu	37	14	20249222	20249222	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20249222C>A	uc010tku.1	+	1	741	c.741C>A	c.(739-741)ACC>ACA	p.T247T		NM_001005500	NP_001005500	Q8NGD0	OR4M1_HUMAN	olfactory receptor, family 4, subfamily M,	247	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;2.95e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---	capture		Silent	SNP	20249222	20249222	11485	14	C	A	A	21	21	OR4M1	A	2	2
OR4N2	390429	broad.mit.edu	37	14	20296240	20296240	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20296240T>A	uc010tkv.1	+	1	633	c.633T>A	c.(631-633)TTT>TTA	p.F211L		NM_001004723	NP_001004723	Q8NGD1	OR4N2_HUMAN	olfactory receptor, family 4, subfamily N,	211	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|central_nervous_system(1)|skin(1)	4	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;2.95e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---	capture		Missense_Mutation	SNP	20296240	20296240	11487	14	T	A	A	62	62	OR4N2	A	4	4
OR4K15	81127	broad.mit.edu	37	14	20444459	20444459	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20444459G>T	uc010tkx.1	+	1	782	c.782G>T	c.(781-783)CGC>CTC	p.R261L		NM_001005486	NP_001005486	Q8NH41	OR4KF_HUMAN	olfactory receptor, family 4, subfamily K,	261	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;3.58e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---	capture		Missense_Mutation	SNP	20444459	20444459	11480	14	G	T	T	38	38	OR4K15	T	1	1
OR4K13	390433	broad.mit.edu	37	14	20502373	20502373	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20502373G>T	uc010tkz.1	-	1	545	c.545C>A	c.(544-546)CCC>CAC	p.P182H		NM_001004714	NP_001004714	Q8NH42	OR4KD_HUMAN	olfactory receptor, family 4, subfamily K,	182	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	all_cancers(95;0.00108)		Epithelial(56;4.65e-07)|all cancers(55;2.9e-06)	GBM - Glioblastoma multiforme(265;0.0064)														---	---	---	---	capture		Missense_Mutation	SNP	20502373	20502373	11478	14	G	T	T	43	43	OR4K13	T	2	2
SLC7A8	23428	broad.mit.edu	37	14	23598872	23598872	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23598872G>T	uc001wiz.2	-	9	1976	c.1250C>A	c.(1249-1251)CCC>CAC	p.P417H	SLC7A8_uc001wiw.2_Missense_Mutation_p.P34H|SLC7A8_uc001wix.2_Missense_Mutation_p.P214H|SLC7A8_uc010tnk.1_Missense_Mutation_p.P193H|SLC7A8_uc010tnl.1_Missense_Mutation_p.P312H|SLC7A8_uc001wiy.2_RNA|SLC7A8_uc010akj.2_Intron	NM_012244	NP_036376	Q9UHI5	LAT2_HUMAN	solute carrier family 7 (cationic amino acid	417					blood coagulation|cellular amino acid metabolic process|leukocyte migration|metal ion homeostasis|response to toxin	basolateral plasma membrane|cytoplasm|integral to plasma membrane	neutral amino acid transmembrane transporter activity|organic cation transmembrane transporter activity|peptide antigen binding|protein binding|toxin transporter activity			ovary(1)	1	all_cancers(95;4.6e-05)			GBM - Glioblastoma multiforme(265;0.00809)	L-Alanine(DB00160)|L-Glutamine(DB00130)|L-Phenylalanine(DB00120)													---	---	---	---	capture		Missense_Mutation	SNP	23598872	23598872	15201	14	G	T	T	43	43	SLC7A8	T	2	2
MYH6	4624	broad.mit.edu	37	14	23874503	23874503	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23874503C>G	uc001wjv.2	-	5	498	c.431G>C	c.(430-432)GGC>GCC	p.G144A	MYH6_uc010akp.1_Missense_Mutation_p.G144A	NM_002471	NP_002462	P13533	MYH6_HUMAN	myosin heavy chain 6	144	Myosin head-like.				adult heart development|atrial cardiac muscle tissue morphogenesis|cardiac muscle fiber development|in utero embryonic development|muscle filament sliding|regulation of ATPase activity|regulation of blood pressure|regulation of heart rate|regulation of the force of heart contraction|sarcomere organization|striated muscle contraction|ventricular cardiac muscle tissue morphogenesis|visceral muscle development	cytosol|focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|protein kinase binding|structural constituent of muscle			pancreas(2)|ovary(1)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00764)|READ - Rectum adenocarcinoma(4;0.0289)|Colorectal(4;0.0441)														---	---	---	---	capture		Missense_Mutation	SNP	23874503	23874503	10433	14	C	G	G	26	26	MYH6	G	3	3
MYH6	4624	broad.mit.edu	37	14	23874944	23874944	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23874944C>G	uc001wjv.2	-	4	304	c.237G>C	c.(235-237)CAG>CAC	p.Q79H	MYH6_uc010akp.1_Missense_Mutation_p.Q79H	NM_002471	NP_002462	P13533	MYH6_HUMAN	myosin heavy chain 6	79	Myosin head-like.				adult heart development|atrial cardiac muscle tissue morphogenesis|cardiac muscle fiber development|in utero embryonic development|muscle filament sliding|regulation of ATPase activity|regulation of blood pressure|regulation of heart rate|regulation of the force of heart contraction|sarcomere organization|striated muscle contraction|ventricular cardiac muscle tissue morphogenesis|visceral muscle development	cytosol|focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|protein kinase binding|structural constituent of muscle			pancreas(2)|ovary(1)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00764)|READ - Rectum adenocarcinoma(4;0.0289)|Colorectal(4;0.0441)														---	---	---	---	capture		Missense_Mutation	SNP	23874944	23874944	10433	14	C	G	G	32	32	MYH6	G	3	3
RABGGTA	5875	broad.mit.edu	37	14	24735655	24735655	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24735655C>A	uc001wof.2	-	15	1958	c.1536G>T	c.(1534-1536)GAG>GAT	p.E512D	RABGGTA_uc001woe.2_RNA|RABGGTA_uc001wog.2_Missense_Mutation_p.E512D|RABGGTA_uc001woh.2_RNA|RABGGTA_uc001woi.2_RNA	NM_004581	NP_004572	Q92696	PGTA_HUMAN	Rab geranylgeranyltransferase alpha	512	LRR 4.				visual perception		Rab geranylgeranyltransferase activity|zinc ion binding				0				GBM - Glioblastoma multiforme(265;0.0184)														---	---	---	---	capture		Missense_Mutation	SNP	24735655	24735655	13426	14	C	A	A	28	28	RABGGTA	A	2	2
FOXG1	2290	broad.mit.edu	37	14	29237355	29237355	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:29237355G>C	uc001wqe.2	+	1	1069	c.870G>C	c.(868-870)GCG>GCC	p.A290A		NM_005249	NP_005240	P55316	FOXG1_HUMAN	forkhead box G1	290				FKRGAR -> AFRWCA (in Ref. 1; CAA52241).	axon midline choice point recognition|central nervous system neuron development|dorsal/ventral pattern formation|embryo development ending in birth or egg hatching|hindbrain development|inner ear morphogenesis|negative regulation of neuron differentiation|negative regulation of transcription, DNA-dependent|nonmotile primary cilium assembly|nose development|positive regulation of cell cycle|positive regulation of neuroblast proliferation|positive regulation of transcription from RNA polymerase II promoter|regulation of mitotic cell cycle|regulation of sequence-specific DNA binding transcription factor activity|tissue development	transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding			ovary(2)|lung(2)	4			LUAD - Lung adenocarcinoma(48;0.011)|Lung(238;0.0575)	GBM - Glioblastoma multiforme(265;0.00413)														---	---	---	---	capture		Silent	SNP	29237355	29237355	6252	14	G	C	C	38	38	FOXG1	C	3	3
PRKD1	5587	broad.mit.edu	37	14	30100056	30100056	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:30100056T>A	uc001wqh.2	-	10	1745	c.1564A>T	c.(1564-1566)AGT>TGT	p.S522C		NM_002742	NP_002733	Q15139	KPCD1_HUMAN	protein kinase D1	522	PH.				cell proliferation|intracellular signal transduction|sphingolipid metabolic process	cytosol|integral to plasma membrane	ATP binding|metal ion binding|protein binding|protein kinase C activity			lung(3)|large_intestine(2)|ovary(2)|skin(1)	8	Hepatocellular(127;0.0604)		LUAD - Lung adenocarcinoma(48;0.00527)|Lung(238;0.0252)	GBM - Glioblastoma multiforme(265;0.00888)														---	---	---	---	capture		Missense_Mutation	SNP	30100056	30100056	12961	14	T	A	A	55	55	PRKD1	A	4	4
COCH	1690	broad.mit.edu	37	14	31354783	31354783	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31354783C>A	uc001wqr.2	+	10	997	c.917C>A	c.(916-918)CCT>CAT	p.P306H	COCH_uc001wqp.2_Missense_Mutation_p.P306H|COCH_uc001wqq.3_Missense_Mutation_p.P306H|uc001wqs.2_RNA|COCH_uc001wqt.1_Missense_Mutation_p.P157H	NM_004086	NP_004077	O43405	COCH_HUMAN	cochlin precursor	306	VWFA 1.				sensory perception of sound	proteinaceous extracellular matrix				pancreas(1)|central_nervous_system(1)|skin(1)	3	Hepatocellular(127;0.0877)|Breast(36;0.148)		LUAD - Lung adenocarcinoma(48;0.00192)|Lung(238;0.0119)|BRCA - Breast invasive adenocarcinoma(188;0.0805)	GBM - Glioblastoma multiforme(265;0.00645)														---	---	---	---	capture		Missense_Mutation	SNP	31354783	31354783	3794	14	C	A	A	24	24	COCH	A	2	2
CFL2	1073	broad.mit.edu	37	14	35182474	35182474	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:35182474T>C	uc001wsg.3	-	2	438	c.297A>G	c.(295-297)CTA>CTG	p.L99L	CFL2_uc010tpn.1_Silent_p.L82L|CFL2_uc001wsh.3_Silent_p.L99L|CFL2_uc001wsi.3_Intron|CFL2_uc001wsj.3_Intron	NM_021914	NP_068733	Q9Y281	COF2_HUMAN	cofilin 2	99	ADF-H.					cytoplasm|cytoskeleton|nuclear matrix	actin binding			breast(2)	2	Breast(36;0.0361)|Hepatocellular(127;0.158)		LUAD - Lung adenocarcinoma(48;6.07e-06)|Lung(238;2.23e-05)|Epithelial(34;0.0387)|all cancers(34;0.0814)	GBM - Glioblastoma multiforme(112;0.0424)														---	---	---	---	capture		Silent	SNP	35182474	35182474	3424	14	T	C	C	53	53	CFL2	C	4	4
KLHDC1	122773	broad.mit.edu	37	14	50201309	50201309	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50201309G>A	uc001www.2	+	10	854	c.826G>A	c.(826-828)GAT>AAT	p.D276N	SDCCAG1_uc010anj.1_Intron|KLHDC1_uc010tqg.1_Missense_Mutation_p.D231N|KLHDC1_uc010tqh.1_Missense_Mutation_p.D191N	NM_172193	NP_751943	Q8N7A1	KLDC1_HUMAN	kelch domain containing 1	276	Kelch 5.					cytoplasm				pancreas(1)	1	all_epithelial(31;0.00244)|Breast(41;0.00964)																	---	---	---	---	capture		Missense_Mutation	SNP	50201309	50201309	8666	14	G	A	A	45	45	KLHDC1	A	2	2
SOS2	6655	broad.mit.edu	37	14	50626482	50626482	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50626482C>T	uc001wxs.3	-	10	1617	c.1519G>A	c.(1519-1521)GAG>AAG	p.E507K	SOS2_uc010tql.1_Missense_Mutation_p.E474K|SOS2_uc010tqm.1_RNA|SOS2_uc001wxt.2_Missense_Mutation_p.E195K	NM_006939	NP_008870	Q07890	SOS2_HUMAN	son of sevenless homolog 2	507	PH.				apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	DNA binding|protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(2)	2	all_epithelial(31;0.000822)|Breast(41;0.0065)																	---	---	---	---	capture		Missense_Mutation	SNP	50626482	50626482	15437	14	C	T	T	29	29	SOS2	T	2	2
SOS2	6655	broad.mit.edu	37	14	50671113	50671113	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50671113C>A	uc001wxs.3	-	2	200	c.102G>T	c.(100-102)GTG>GTT	p.V34V	SOS2_uc010tql.1_Silent_p.V34V	NM_006939	NP_008870	Q07890	SOS2_HUMAN	son of sevenless homolog 2	34					apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	DNA binding|protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(2)	2	all_epithelial(31;0.000822)|Breast(41;0.0065)																	---	---	---	---	capture		Silent	SNP	50671113	50671113	15437	14	C	A	A	25	25	SOS2	A	2	2
NIN	51199	broad.mit.edu	37	14	51219373	51219373	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:51219373C>A	uc001wym.2	-	21	5004	c.4813G>T	c.(4813-4815)GAA>TAA	p.E1605*	NIN_uc001wyi.2_Nonsense_Mutation_p.E1605*|NIN_uc001wyj.2_RNA|NIN_uc001wyk.2_Nonsense_Mutation_p.E892*|NIN_uc010tqp.1_Nonsense_Mutation_p.E1611*|NIN_uc001wyo.2_Nonsense_Mutation_p.E1605*	NM_182946	NP_891991	Q8N4C6	NIN_HUMAN	ninein isoform 5	1605	Potential.				centrosome localization	centrosome|microtubule	calcium ion binding|GTP binding|protein binding			skin(3)|ovary(1)|kidney(1)|central_nervous_system(1)	6	all_epithelial(31;0.00244)|Breast(41;0.127)							T	PDGFRB	MPD								---	---	---	---	capture		Nonsense_Mutation	SNP	51219373	51219373	10818	14	C	A	A	30	30	NIN	A	5	2
DDHD1	80821	broad.mit.edu	37	14	53513567	53513567	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:53513567C>A	uc001xai.2	-	13	2852	c.2622G>T	c.(2620-2622)TTG>TTT	p.L874F	DDHD1_uc001xaj.2_Missense_Mutation_p.L853F|DDHD1_uc001xah.2_Missense_Mutation_p.L846F|DDHD1_uc001xag.2_Missense_Mutation_p.L428F	NM_001160148	NP_001153620	Q8NEL9	DDHD1_HUMAN	DDHD domain containing 1 isoform c	874	DDHD.				lipid catabolic process	cytoplasm	hydrolase activity|metal ion binding			ovary(2)	2	Breast(41;0.037)																	---	---	---	---	capture		Missense_Mutation	SNP	53513567	53513567	4497	14	C	A	A	21	21	DDHD1	A	2	2
RTN1	6252	broad.mit.edu	37	14	60069930	60069930	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:60069930C>G	uc001xen.1	-	7	2438	c.2229G>C	c.(2227-2229)CAG>CAC	p.Q743H	RTN1_uc001xem.1_Missense_Mutation_p.Q323H|RTN1_uc001xek.1_Missense_Mutation_p.Q175H|RTN1_uc001xel.1_RNA|RTN1_uc010apl.1_Missense_Mutation_p.Q160H	NM_021136	NP_066959	Q16799	RTN1_HUMAN	reticulon 1 isoform A	743	Reticulon.				neuron differentiation	integral to endoplasmic reticulum membrane	signal transducer activity			ovary(2)|central_nervous_system(2)	4				OV - Ovarian serous cystadenocarcinoma(108;0.0968)														---	---	---	---	capture		Missense_Mutation	SNP	60069930	60069930	14205	14	C	G	G	24	24	RTN1	G	3	3
ZFYVE26	23503	broad.mit.edu	37	14	68251916	68251916	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:68251916T>A	uc001xka.2	-	19	3522	c.3383A>T	c.(3382-3384)CAG>CTG	p.Q1128L	ZFYVE26_uc010tsz.1_RNA|ZFYVE26_uc001xkc.3_Missense_Mutation_p.Q1128L	NM_015346	NP_056161	Q68DK2	ZFY26_HUMAN	zinc finger, FYVE domain containing 26	1128					cell cycle|cell death|cytokinesis|double-strand break repair via homologous recombination	centrosome|midbody	metal ion binding|phosphatidylinositol-3-phosphate binding|protein binding			ovary(9)|breast(2)	11				all cancers(60;0.000763)|OV - Ovarian serous cystadenocarcinoma(108;0.0011)|BRCA - Breast invasive adenocarcinoma(234;0.0115)														---	---	---	---	capture		Missense_Mutation	SNP	68251916	68251916	18258	14	T	A	A	55	55	ZFYVE26	A	4	4
PCNX	22990	broad.mit.edu	37	14	71568774	71568774	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:71568774A>T	uc001xmo.2	+	31	6103	c.5657A>T	c.(5656-5658)GAG>GTG	p.E1886V	PCNX_uc010are.1_Missense_Mutation_p.E1775V|PCNX_uc010arf.1_Missense_Mutation_p.E674V|PCNX_uc001xmp.2_5'UTR	NM_014982	NP_055797	Q96RV3	PCX1_HUMAN	pecanex-like 1	1886						integral to membrane				ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(12;0.206)	all cancers(60;0.00835)|BRCA - Breast invasive adenocarcinoma(234;0.00951)|OV - Ovarian serous cystadenocarcinoma(108;0.0417)														---	---	---	---	capture		Missense_Mutation	SNP	71568774	71568774	12011	14	A	T	T	11	11	PCNX	T	4	4
LTBP2	4053	broad.mit.edu	37	14	74971752	74971752	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:74971752C>T	uc001xqa.2	-	29	4690	c.4303G>A	c.(4303-4305)GAA>AAA	p.E1435K		NM_000428	NP_000419	Q14767	LTBP2_HUMAN	latent transforming growth factor beta binding	1435	TB 3.				protein secretion|protein targeting|transforming growth factor beta receptor signaling pathway	extracellular space|proteinaceous extracellular matrix	calcium ion binding|growth factor binding			liver(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(234;0.00219)|READ - Rectum adenocarcinoma(1;0.0649)														---	---	---	---	capture		Missense_Mutation	SNP	74971752	74971752	9450	14	C	T	T	29	29	LTBP2	T	2	2
DLST	1743	broad.mit.edu	37	14	75366627	75366627	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75366627G>A	uc001xqv.2	+	12	966	c.903G>A	c.(901-903)GTG>GTA	p.V301V	DLST_uc001xqu.2_Silent_p.V213V|DLST_uc001xqt.2_Silent_p.V217V|DLST_uc010tuw.1_Silent_p.V215V	NM_001933	NP_001924	P36957	ODO2_HUMAN	dihydrolipoamide S-succinyltransferase (E2	301					lysine catabolic process|tricarboxylic acid cycle	mitochondrial matrix|nucleus	dihydrolipoyllysine-residue succinyltransferase activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(234;0.00698)														---	---	---	---	capture		Silent	SNP	75366627	75366627	4749	14	G	A	A	45	45	DLST	A	2	2
TTLL5	23093	broad.mit.edu	37	14	76286427	76286427	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:76286427C>T	uc001xrx.2	+	28	3454	c.3249C>T	c.(3247-3249)ATC>ATT	p.I1083I	TTLL5_uc010ask.1_Silent_p.I1098I|TTLL5_uc001xrz.2_Silent_p.I658I|TTLL5_uc001xsa.2_Silent_p.I157I	NM_015072	NP_055887	Q6EMB2	TTLL5_HUMAN	tubulin tyrosine ligase-like family, member 5	1083					protein modification process|transcription, DNA-dependent	centrosome|cilium|microtubule basal body|nucleus	tubulin-tyrosine ligase activity			ovary(2)|central_nervous_system(1)	3				BRCA - Breast invasive adenocarcinoma(234;0.029)														---	---	---	---	capture		Silent	SNP	76286427	76286427	17285	14	C	T	T	29	29	TTLL5	T	2	2
ANGEL1	23357	broad.mit.edu	37	14	77255657	77255657	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77255657C>A	uc001xsv.2	-	10	2040	c.1927G>T	c.(1927-1929)GCT>TCT	p.A643S	uc001xsu.1_5'Flank|ANGEL1_uc010tvf.1_Intron	NM_015305	NP_056120	Q9UNK9	ANGE1_HUMAN	angel homolog 1	643										ovary(2)|central_nervous_system(1)|skin(1)	4			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0285)														---	---	---	---	capture		Missense_Mutation	SNP	77255657	77255657	611	14	C	A	A	26	26	ANGEL1	A	2	2
GTF2A1	2957	broad.mit.edu	37	14	81670361	81670361	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:81670361G>A	uc001xvf.1	-	3	652	c.220C>T	c.(220-222)CAT>TAT	p.H74Y	GTF2A1_uc010atb.1_Missense_Mutation_p.H24Y|GTF2A1_uc001xvg.1_Missense_Mutation_p.H35Y|GTF2A1_uc001xvh.1_Missense_Mutation_p.H35Y|SNORA79_uc001xvi.1_5'Flank	NM_015859	NP_056943	P52655	TF2AA_HUMAN	TFIIA alpha, p55 isoform 1	74	Poly-Gln.				regulation of transcription, DNA-dependent|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|viral reproduction	cytoplasm|transcription factor TFIIA complex	DNA binding|protein binding|protein heterodimerization activity|TBP-class protein binding|transcription coactivator activity			breast(1)	1				BRCA - Breast invasive adenocarcinoma(234;0.0287)														---	---	---	---	capture		Missense_Mutation	SNP	81670361	81670361	7132	14	G	A	A	46	46	GTF2A1	A	2	2
KIAA1409	57578	broad.mit.edu	37	14	94046632	94046632	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94046632G>T	uc001ybv.1	+	16	2123	c.2040G>T	c.(2038-2040)GAG>GAT	p.E680D	KIAA1409_uc001ybs.1_Missense_Mutation_p.E680D	NM_020818	NP_065869	Q9P2D8	UNC79_HUMAN	hypothetical protein LOC57578	857						integral to membrane				ovary(10)|skin(4)|large_intestine(3)	17		all_cancers(154;0.0354)|all_epithelial(191;0.216)		Epithelial(152;0.188)														---	---	---	---	capture		Missense_Mutation	SNP	94046632	94046632	8539	14	G	T	T	36	36	KIAA1409	T	2	2
SERPINA4	5267	broad.mit.edu	37	14	95030031	95030031	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95030031C>A	uc001ydk.2	+	2	278	c.212C>A	c.(211-213)CCG>CAG	p.P71Q	SERPINA4_uc010avd.2_Missense_Mutation_p.P108Q|SERPINA4_uc001ydl.2_Missense_Mutation_p.P71Q	NM_006215	NP_006206	P29622	KAIN_HUMAN	serine (or cysteine) proteinase inhibitor, clade	71					regulation of proteolysis	extracellular space	serine-type endopeptidase inhibitor activity			ovary(3)|skin(1)	4				COAD - Colon adenocarcinoma(157;0.211)														---	---	---	---	capture		Missense_Mutation	SNP	95030031	95030031	14579	14	C	A	A	23	23	SERPINA4	A	1	1
SERPINA4	5267	broad.mit.edu	37	14	95033402	95033402	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95033402G>T	uc001ydk.2	+	3	811	c.745G>T	c.(745-747)GAC>TAC	p.D249Y	SERPINA4_uc010avd.2_Missense_Mutation_p.D286Y|SERPINA4_uc001ydl.2_Missense_Mutation_p.D249Y	NM_006215	NP_006206	P29622	KAIN_HUMAN	serine (or cysteine) proteinase inhibitor, clade	249					regulation of proteolysis	extracellular space	serine-type endopeptidase inhibitor activity			ovary(3)|skin(1)	4				COAD - Colon adenocarcinoma(157;0.211)														---	---	---	---	capture		Missense_Mutation	SNP	95033402	95033402	14579	14	G	T	T	41	41	SERPINA4	T	2	2
ATG2B	55102	broad.mit.edu	37	14	96807901	96807901	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:96807901C>T	uc001yfi.2	-	6	1247	c.882G>A	c.(880-882)TTG>TTA	p.L294L		NM_018036	NP_060506	Q96BY7	ATG2B_HUMAN	ATG2 autophagy related 2 homolog B	294										ovary(1)|kidney(1)|skin(1)	3		all_cancers(154;0.0462)|all_epithelial(191;0.123)|Melanoma(154;0.155)		Epithelial(152;0.21)|COAD - Colon adenocarcinoma(157;0.244)														---	---	---	---	capture		Silent	SNP	96807901	96807901	1113	14	C	T	T	29	29	ATG2B	T	2	2
WARS	7453	broad.mit.edu	37	14	100808747	100808747	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:100808747C>A	uc001yhf.1	-	8	1185	c.1101G>T	c.(1099-1101)CAG>CAT	p.Q367H	WARS_uc001yhe.1_Missense_Mutation_p.Q173H|WARS_uc001yhg.1_Missense_Mutation_p.Q367H|WARS_uc001yhh.1_Missense_Mutation_p.Q367H|WARS_uc001yhi.1_Missense_Mutation_p.Q326H|WARS_uc001yhj.1_Missense_Mutation_p.Q326H|WARS_uc001yhk.1_Missense_Mutation_p.Q326H|WARS_uc001yhl.1_Missense_Mutation_p.Q367H	NM_173701	NP_776049	P23381	SYWC_HUMAN	tryptophanyl-tRNA synthetase isoform a	367					angiogenesis|negative regulation of cell proliferation|regulation of angiogenesis|tryptophanyl-tRNA aminoacylation	cytosol|soluble fraction	ATP binding|protein binding|tryptophan-tRNA ligase activity			breast(1)	1		all_cancers(154;0.00223)|all_lung(585;2.48e-06)|all_epithelial(191;0.000564)|Melanoma(154;0.152)			L-Tryptophan(DB00150)													---	---	---	---	capture		Missense_Mutation	SNP	100808747	100808747	17821	14	C	A	A	32	32	WARS	A	2	2
WARS	7453	broad.mit.edu	37	14	100808790	100808790	+	Missense_Mutation	SNP	C	A	A	rs145597356		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:100808790C>A	uc001yhf.1	-	8	1142	c.1058G>T	c.(1057-1059)AGC>ATC	p.S353I	WARS_uc001yhe.1_Missense_Mutation_p.S159I|WARS_uc001yhg.1_Missense_Mutation_p.S353I|WARS_uc001yhh.1_Missense_Mutation_p.S353I|WARS_uc001yhi.1_Missense_Mutation_p.S312I|WARS_uc001yhj.1_Missense_Mutation_p.S312I|WARS_uc001yhk.1_Missense_Mutation_p.S312I|WARS_uc001yhl.1_Missense_Mutation_p.S353I	NM_173701	NP_776049	P23381	SYWC_HUMAN	tryptophanyl-tRNA synthetase isoform a	353	KMSKS region.				angiogenesis|negative regulation of cell proliferation|regulation of angiogenesis|tryptophanyl-tRNA aminoacylation	cytosol|soluble fraction	ATP binding|protein binding|tryptophan-tRNA ligase activity			breast(1)	1		all_cancers(154;0.00223)|all_lung(585;2.48e-06)|all_epithelial(191;0.000564)|Melanoma(154;0.152)			L-Tryptophan(DB00150)													---	---	---	---	capture		Missense_Mutation	SNP	100808790	100808790	17821	14	C	A	A	28	28	WARS	A	2	2
BEGAIN	57596	broad.mit.edu	37	14	101010249	101010249	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:101010249G>C	uc010txa.1	-	4	443	c.297C>G	c.(295-297)CTC>CTG	p.L99L	BEGAIN_uc001yhp.2_Silent_p.L35L|BEGAIN_uc001yhq.2_Silent_p.L99L	NM_001159531	NP_001153003	Q9BUH8	BEGIN_HUMAN	brain-enriched guanylate kinase-associated	99						cytoplasm|membrane	protein binding				0		Melanoma(154;0.212)																---	---	---	---	capture		Silent	SNP	101010249	101010249	1420	14	G	C	C	45	45	BEGAIN	C	3	3
CDC42BPB	9578	broad.mit.edu	37	14	103406189	103406189	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103406189C>T	uc001ymi.1	-	33	4919	c.4687G>A	c.(4687-4689)GAA>AAA	p.E1563K		NM_006035	NP_006026	Q9Y5S2	MRCKB_HUMAN	CDC42-binding protein kinase beta	1563					actin cytoskeleton reorganization|establishment or maintenance of cell polarity|intracellular signal transduction	cell leading edge|cell-cell junction|cytoplasm|cytoskeleton	ATP binding|magnesium ion binding|protein serine/threonine kinase activity|small GTPase regulator activity			large_intestine(3)|skin(3)|lung(2)|stomach(1)|breast(1)|ovary(1)	11		Melanoma(154;0.155)		Colorectal(3;0.0129)|READ - Rectum adenocarcinoma(2;0.0419)|Epithelial(152;0.0474)|all cancers(159;0.199)														---	---	---	---	capture		Missense_Mutation	SNP	103406189	103406189	3201	14	C	T	T	30	30	CDC42BPB	T	2	2
CDC42BPB	9578	broad.mit.edu	37	14	103406192	103406192	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103406192C>T	uc001ymi.1	-	33	4916	c.4684G>A	c.(4684-4686)GAG>AAG	p.E1562K		NM_006035	NP_006026	Q9Y5S2	MRCKB_HUMAN	CDC42-binding protein kinase beta	1562					actin cytoskeleton reorganization|establishment or maintenance of cell polarity|intracellular signal transduction	cell leading edge|cell-cell junction|cytoplasm|cytoskeleton	ATP binding|magnesium ion binding|protein serine/threonine kinase activity|small GTPase regulator activity			large_intestine(3)|skin(3)|lung(2)|stomach(1)|breast(1)|ovary(1)	11		Melanoma(154;0.155)		Colorectal(3;0.0129)|READ - Rectum adenocarcinoma(2;0.0419)|Epithelial(152;0.0474)|all cancers(159;0.199)														---	---	---	---	capture		Missense_Mutation	SNP	103406192	103406192	3201	14	C	T	T	32	32	CDC42BPB	T	2	2
TDRD9	122402	broad.mit.edu	37	14	104470664	104470664	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:104470664G>C	uc001yom.3	+	14	1603	c.1573G>C	c.(1573-1575)GAG>CAG	p.E525Q	TDRD9_uc001yon.3_Missense_Mutation_p.E263Q	NM_153046	NP_694591	Q8NDG6	TDRD9_HUMAN	tudor domain containing 9	525	Helicase C-terminal.				cell differentiation|DNA methylation involved in gamete generation|fertilization|gene silencing by RNA|male meiosis|multicellular organismal development|piRNA metabolic process|spermatogenesis	nucleus|piP-body	ATP binding|ATP-dependent helicase activity|nucleic acid binding			ovary(2)|central_nervous_system(1)	3		all_cancers(154;0.109)|Melanoma(154;0.0525)|all_epithelial(191;0.0768)																---	---	---	---	capture		Missense_Mutation	SNP	104470664	104470664	16263	14	G	C	C	45	45	TDRD9	C	3	3
AHNAK2	113146	broad.mit.edu	37	14	105410407	105410407	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:105410407T>C	uc010axc.1	-	7	11501	c.11381A>G	c.(11380-11382)AAG>AGG	p.K3794R	AHNAK2_uc001ypx.2_Missense_Mutation_p.K3694R	NM_138420	NP_612429	Q8IVF2	AHNK2_HUMAN	AHNAK nucleoprotein 2	3794						nucleus				ovary(1)	1		all_cancers(154;0.115)|Melanoma(154;0.155)|all_epithelial(191;0.183)	all cancers(16;0.000479)|OV - Ovarian serous cystadenocarcinoma(23;0.00659)|Epithelial(46;0.0151)|GBM - Glioblastoma multiforme(11;0.116)															---	---	---	---	capture		Missense_Mutation	SNP	105410407	105410407	418	14	T	C	C	56	56	AHNAK2	C	4	4
AHNAK2	113146	broad.mit.edu	37	14	105414568	105414568	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:105414568G>C	uc010axc.1	-	7	7340	c.7220C>G	c.(7219-7221)CCC>CGC	p.P2407R	AHNAK2_uc001ypx.2_Missense_Mutation_p.P2307R	NM_138420	NP_612429	Q8IVF2	AHNK2_HUMAN	AHNAK nucleoprotein 2	2407						nucleus				ovary(1)	1		all_cancers(154;0.115)|Melanoma(154;0.155)|all_epithelial(191;0.183)	all cancers(16;0.000479)|OV - Ovarian serous cystadenocarcinoma(23;0.00659)|Epithelial(46;0.0151)|GBM - Glioblastoma multiforme(11;0.116)															---	---	---	---	capture		Missense_Mutation	SNP	105414568	105414568	418	14	G	C	C	43	43	AHNAK2	C	3	3
GABRB3	2562	broad.mit.edu	37	15	26866565	26866565	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:26866565G>T	uc001zaz.2	-	4	499	c.357C>A	c.(355-357)CCC>CCA	p.P119P	GABRB3_uc010uae.1_Silent_p.P34P|GABRB3_uc001zba.2_Silent_p.P119P|GABRB3_uc001zbb.2_Silent_p.P175P|GABRB3_uc001zbc.2_RNA	NM_000814	NP_000805	P28472	GBRB3_HUMAN	gamma-aminobutyric acid (GABA) A receptor, beta	119	Extracellular (Probable).				synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			upper_aerodigestive_tract(1)|ovary(1)|lung(1)|liver(1)|central_nervous_system(1)	5		all_cancers(20;1.89e-22)|all_lung(180;6.35e-15)|Breast(32;0.000279)|Colorectal(260;0.232)		all cancers(64;1.46e-07)|Epithelial(43;2.89e-07)|BRCA - Breast invasive adenocarcinoma(123;0.0251)|COAD - Colon adenocarcinoma(236;0.235)|Lung(196;0.243)	Ethchlorvynol(DB00189)|Flurazepam(DB00690)|Lorazepam(DB00186)|Midazolam(DB00683)													---	---	---	---	capture		Silent	SNP	26866565	26866565	6419	15	G	T	T	39	39	GABRB3	T	1	1
ARHGAP11B	89839	broad.mit.edu	37	15	30919108	30919108	+	Nonsense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:30919108C>T	uc001zet.1	+	1	230	c.85C>T	c.(85-87)CAG>TAG	p.Q29*	ARHGAP11B_uc010azv.1_Intron|ARHGAP11B_uc001zeu.2_RNA	NM_001039841	NP_001034930	Q3KRB8	RHGBB_HUMAN	Rho GTPase activating protein 11B	29					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity				0		all_lung(180;2.71e-09)|Breast(32;0.00116)		all cancers(64;1.9e-15)|Epithelial(43;3.59e-12)|GBM - Glioblastoma multiforme(186;9e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00177)|Lung(196;0.153)														---	---	---	---	capture		Nonsense_Mutation	SNP	30919108	30919108	875	15	C	T	T	25	25	ARHGAP11B	T	5	2
ARHGAP11A	9824	broad.mit.edu	37	15	32929102	32929102	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:32929102G>C	uc001zgy.1	+	12	2850	c.2128G>C	c.(2128-2130)GAT>CAT	p.D710H	ARHGAP11A_uc010ubw.1_Missense_Mutation_p.D521H|ARHGAP11A_uc010ubx.1_Missense_Mutation_p.D521H	NM_014783	NP_055598	Q6P4F7	RHGBA_HUMAN	Rho GTPase activating protein 11A isoform 1	710					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			skin(3)|breast(2)|urinary_tract(1)	6		all_lung(180;1.3e-11)		all cancers(64;3.34e-21)|Epithelial(43;2.64e-15)|GBM - Glioblastoma multiforme(186;5.17e-06)|BRCA - Breast invasive adenocarcinoma(123;0.00112)|Lung(196;0.227)														---	---	---	---	capture		Missense_Mutation	SNP	32929102	32929102	874	15	G	C	C	33	33	ARHGAP11A	C	3	3
RYR3	6263	broad.mit.edu	37	15	33991934	33991934	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:33991934C>A	uc001zhi.2	+	41	6349	c.6279C>A	c.(6277-6279)TGC>TGA	p.C2093*	RYR3_uc010bar.2_Nonsense_Mutation_p.C2093*	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	2093	4 X approximate repeats.|Cytoplasmic (By similarity).				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---	capture		Nonsense_Mutation	SNP	33991934	33991934	14250	15	C	A	A	28	28	RYR3	A	5	2
RYR3	6263	broad.mit.edu	37	15	34065783	34065783	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34065783C>A	uc001zhi.2	+	64	9174	c.9104C>A	c.(9103-9105)TCC>TAC	p.S3035Y	RYR3_uc010bar.2_Missense_Mutation_p.S3035Y	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	3035					cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---	capture		Missense_Mutation	SNP	34065783	34065783	14250	15	C	A	A	30	30	RYR3	A	2	2
RYR3	6263	broad.mit.edu	37	15	34131112	34131112	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34131112G>T	uc001zhi.2	+	89	13001	c.12931G>T	c.(12931-12933)GAA>TAA	p.E4311*	RYR3_uc010bar.2_Nonsense_Mutation_p.E4306*	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	4311					cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---	capture		Nonsense_Mutation	SNP	34131112	34131112	14250	15	G	T	T	45	45	RYR3	T	5	2
MEIS2	4212	broad.mit.edu	37	15	37187378	37187378	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:37187378T>A	uc001zjr.2	-	11	2158	c.1121A>T	c.(1120-1122)CAG>CTG	p.Q374L	MEIS2_uc001zjl.2_Missense_Mutation_p.Q361L|MEIS2_uc010ucj.1_Missense_Mutation_p.Q354L|MEIS2_uc001zjm.2_Missense_Mutation_p.Q279L|MEIS2_uc001zjn.2_Missense_Mutation_p.Q228L|MEIS2_uc001zjo.2_Missense_Mutation_p.Q374L|MEIS2_uc001zjp.2_Missense_Mutation_p.Q367L|MEIS2_uc001zjs.2_Missense_Mutation_p.Q367L|MEIS2_uc001zju.2_Missense_Mutation_p.Q354L|MEIS2_uc001zjt.2_Missense_Mutation_p.Q367L|MEIS2_uc001zjj.2_Missense_Mutation_p.Q70L|MEIS2_uc001zjk.2_Missense_Mutation_p.Q63L	NM_170675	NP_733775	O14770	MEIS2_HUMAN	Meis homeobox 2 isoform c	374					negative regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(2)	2		all_epithelial(112;9.77e-14)|Lung NSC(122;1.42e-09)|all_lung(180;2.2e-08)|Ovarian(310;0.134)|Melanoma(134;0.155)		all cancers(64;9.33e-21)|GBM - Glioblastoma multiforme(113;1.71e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0288)														---	---	---	---	capture		Missense_Mutation	SNP	37187378	37187378	9857	15	T	A	A	55	55	MEIS2	A	4	4
MEIS2	4212	broad.mit.edu	37	15	37390191	37390191	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:37390191C>A	uc001zjr.2	-	2	1259	c.222G>T	c.(220-222)AAG>AAT	p.K74N	MEIS2_uc001zjl.2_Missense_Mutation_p.K61N|MEIS2_uc010ucj.1_Missense_Mutation_p.K61N|MEIS2_uc001zjm.2_5'UTR|MEIS2_uc001zjn.2_5'UTR|MEIS2_uc001zjo.2_Missense_Mutation_p.K74N|MEIS2_uc001zjp.2_Missense_Mutation_p.K74N|MEIS2_uc001zjs.2_Missense_Mutation_p.K74N|MEIS2_uc001zju.2_Missense_Mutation_p.K61N|MEIS2_uc001zjt.2_Missense_Mutation_p.K74N	NM_170675	NP_733775	O14770	MEIS2_HUMAN	Meis homeobox 2 isoform c	74					negative regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(2)	2		all_epithelial(112;9.77e-14)|Lung NSC(122;1.42e-09)|all_lung(180;2.2e-08)|Ovarian(310;0.134)|Melanoma(134;0.155)		all cancers(64;9.33e-21)|GBM - Glioblastoma multiforme(113;1.71e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0288)														---	---	---	---	capture		Missense_Mutation	SNP	37390191	37390191	9857	15	C	A	A	28	28	MEIS2	A	2	2
NDUFAF1	51103	broad.mit.edu	37	15	41680695	41680695	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41680695G>C	uc001znx.2	-	4	1167	c.785C>G	c.(784-786)TCT>TGT	p.S262C	NDUFAF1_uc010bcf.2_RNA	NM_016013	NP_057097	Q9Y375	CIA30_HUMAN	NADH dehydrogenase (ubiquinone) 1 alpha	262					mitochondrial electron transport, NADH to ubiquinone|protein complex assembly	mitochondrial respiratory chain complex I	unfolded protein binding			ovary(1)	1		all_cancers(109;5.07e-19)|all_epithelial(112;2.43e-16)|Lung NSC(122;1.81e-11)|all_lung(180;4.81e-10)|Melanoma(134;0.0179)|Colorectal(260;0.0946)|Ovarian(310;0.143)		OV - Ovarian serous cystadenocarcinoma(18;8e-17)|GBM - Glioblastoma multiforme(113;1.38e-06)|BRCA - Breast invasive adenocarcinoma(123;0.114)														---	---	---	---	capture		Missense_Mutation	SNP	41680695	41680695	10673	15	G	C	C	33	33	NDUFAF1	C	3	3
PLA2G4F	255189	broad.mit.edu	37	15	42442310	42442310	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42442310C>A	uc001zoz.2	-	10	978	c.915G>T	c.(913-915)GTG>GTT	p.V305V	PLA2G4F_uc001zoy.2_5'Flank|PLA2G4F_uc010bcr.2_Silent_p.V56V|PLA2G4F_uc001zpa.2_Silent_p.V56V|PLA2G4F_uc010bcs.2_Silent_p.V92V	NM_213600	NP_998765	Q68DD2	PA24F_HUMAN	phospholipase A2, group IVF	305					phospholipid catabolic process	cytosol|lysosomal membrane	metal ion binding|phospholipase A2 activity			ovary(4)	4		all_cancers(109;4.82e-12)|all_epithelial(112;5.64e-11)|Lung NSC(122;2.17e-07)|all_lung(180;8.79e-07)|Melanoma(134;0.091)		GBM - Glioblastoma multiforme(94;8.97e-07)														---	---	---	---	capture		Silent	SNP	42442310	42442310	12432	15	C	A	A	21	21	PLA2G4F	A	2	2
ADAL	161823	broad.mit.edu	37	15	43641146	43641146	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43641146G>A	uc010udo.1	+	10	1168	c.594G>A	c.(592-594)CTG>CTA	p.L198L	ADAL_uc001zrh.2_Silent_p.L225L|ADAL_uc001zri.1_Silent_p.L110L	NM_001159280	NP_001152752	Q6DHV7	ADAL_HUMAN	adenosine deaminase-like isoform 1	225					adenosine catabolic process|inosine biosynthetic process|purine ribonucleoside monophosphate biosynthetic process		adenosine deaminase activity|metal ion binding				0		all_cancers(109;7.96e-11)|all_epithelial(112;2.96e-09)|Lung NSC(122;8.91e-07)|all_lung(180;8.8e-06)|Melanoma(134;0.0728)		GBM - Glioblastoma multiforme(94;9.31e-07)														---	---	---	---	capture		Silent	SNP	43641146	43641146	234	15	G	A	A	46	46	ADAL	A	2	2
SLC27A2	11001	broad.mit.edu	37	15	50475061	50475061	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:50475061G>A	uc001zxw.2	+	1	669	c.437G>A	c.(436-438)TGC>TAC	p.C146Y	SLC27A2_uc010bes.2_Missense_Mutation_p.C146Y	NM_003645	NP_003636	O14975	S27A2_HUMAN	solute carrier family 27 (fatty acid	146	Lumenal (Potential).				bile acid biosynthetic process|fatty acid alpha-oxidation	endoplasmic reticulum membrane|integral to membrane|peroxisomal matrix|peroxisomal membrane	ATP binding|long-chain fatty acid-CoA ligase activity|phytanate-CoA ligase activity|pristanate-CoA ligase activity			ovary(1)|skin(1)	2		all_lung(180;0.00177)		all cancers(107;1.16e-06)|GBM - Glioblastoma multiforme(94;0.000113)														---	---	---	---	capture		Missense_Mutation	SNP	50475061	50475061	15023	15	G	A	A	46	46	SLC27A2	A	2	2
SCG3	29106	broad.mit.edu	37	15	51973991	51973991	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:51973991A>G	uc002abh.2	+	1	447	c.39A>G	c.(37-39)TTA>TTG	p.L13L	SCG3_uc010ufz.1_5'UTR	NM_013243	NP_037375	Q8WXD2	SCG3_HUMAN	secretogranin III isoform 1 precursor	13					platelet activation|platelet degranulation	extracellular region|stored secretory granule				ovary(1)	1				all cancers(107;0.00488)														---	---	---	---	capture		Silent	SNP	51973991	51973991	14373	15	A	G	G	15	15	SCG3	G	4	4
UNC13C	440279	broad.mit.edu	37	15	54307002	54307002	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:54307002G>C	uc002ack.2	+	1	1902	c.1902G>C	c.(1900-1902)GTG>GTC	p.V634V		NM_001080534	NP_001074003	Q8NB66	UN13C_HUMAN	unc-13 homolog C	634					exocytosis|intracellular signal transduction	cell junction|cytoplasm|presynaptic membrane	metal ion binding			ovary(5)|pancreas(2)	7				GBM - Glioblastoma multiforme(80;0.0789)|all cancers(107;0.124)														---	---	---	---	capture		Silent	SNP	54307002	54307002	17544	15	G	C	C	48	48	UNC13C	C	3	3
GCNT3	9245	broad.mit.edu	37	15	59910815	59910815	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59910815A>G	uc002age.2	+	3	827	c.378A>G	c.(376-378)AAA>AAG	p.K126K	GCNT3_uc002agd.2_Silent_p.K126K	NM_004751	NP_004742	O95395	GCNT3_HUMAN	glucosaminyl (N-acetyl) transferase 3, mucin	126	Lumenal (Potential).				protein O-linked glycosylation	Golgi membrane|integral to membrane|membrane fraction	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity|N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	59910815	59910815	6568	15	A	G	G	3	3	GCNT3	G	4	4
FBXL22	283807	broad.mit.edu	37	15	63893539	63893539	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63893539C>A	uc002amn.2	+	2	394	c.380C>A	c.(379-381)CCG>CAG	p.P127Q	uc002amj.2_5'Flank|uc002amk.2_5'Flank|uc002aml.2_5'Flank	NM_203373	NP_976307	Q6P050	FXL22_HUMAN	F-box and leucine-rich repeat protein 22	127											0																		---	---	---	---	capture		Missense_Mutation	SNP	63893539	63893539	5956	15	C	A	A	23	23	FBXL22	A	1	1
HCN4	10021	broad.mit.edu	37	15	73614857	73614857	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:73614857C>G	uc002avp.2	-	8	4571	c.3577G>C	c.(3577-3579)GAG>CAG	p.E1193Q		NM_005477	NP_005468	Q9Y3Q4	HCN4_HUMAN	hyperpolarization activated cyclic	1193	Cytoplasmic (Potential).				blood circulation|muscle contraction	integral to membrane	cAMP binding|protein binding|sodium channel activity|voltage-gated potassium channel activity			ovary(5)|liver(1)	6				COAD - Colon adenocarcinoma(1;0.142)														---	---	---	---	capture		Missense_Mutation	SNP	73614857	73614857	7281	15	C	G	G	29	29	HCN4	G	3	3
CCDC33	80125	broad.mit.edu	37	15	74574143	74574143	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:74574143G>A	uc002axo.2	+	10	1442	c.1048G>A	c.(1048-1050)GAT>AAT	p.D350N	CCDC33_uc002axp.2_Missense_Mutation_p.D172N	NM_025055	NP_079331	Q8N5R6	CCD33_HUMAN	coiled-coil domain containing 33 isoform 1	553							protein binding			ovary(3)|skin(2)	5																		---	---	---	---	capture		Missense_Mutation	SNP	74574143	74574143	2928	15	G	A	A	45	45	CCDC33	A	2	2
CRABP1	1381	broad.mit.edu	37	15	78635882	78635882	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:78635882G>T	uc002bdp.2	+	3	396	c.291G>T	c.(289-291)ACG>ACT	p.T97T		NM_004378	NP_004369	P29762	RABP1_HUMAN	cellular retinoic acid binding protein 1	97					multicellular organismal development|signal transduction	cytoplasm	retinal binding|retinol binding|transporter activity				0					Alitretinoin(DB00523)|Etretinate(DB00926)													---	---	---	---	capture		Silent	SNP	78635882	78635882	3982	15	G	T	T	38	38	CRABP1	T	1	1
RASGRF1	5923	broad.mit.edu	37	15	79290512	79290512	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:79290512G>T	uc002beq.2	-	20	3315	c.2940C>A	c.(2938-2940)ATC>ATA	p.I980I	RASGRF1_uc002bep.2_Silent_p.I964I|RASGRF1_uc010blm.1_Silent_p.I889I|RASGRF1_uc002ber.3_Silent_p.I964I|RASGRF1_uc010unh.1_Silent_p.I375I|RASGRF1_uc002beo.2_Silent_p.I196I	NM_002891	NP_002882	Q13972	RGRF1_HUMAN	Ras protein-specific guanine	982					activation of Rac GTPase activity|apoptosis|induction of apoptosis by extracellular signals|long-term memory|nerve growth factor receptor signaling pathway|neuron projection development|regulation of Rac protein signal transduction|small GTPase mediated signal transduction|synaptic transmission	cytosol|growth cone|plasma membrane|synaptosome	Rho guanyl-nucleotide exchange factor activity			skin(4)|ovary(1)|central_nervous_system(1)	6																		---	---	---	---	capture		Silent	SNP	79290512	79290512	13533	15	G	T	T	37	37	RASGRF1	T	1	1
KIAA1024	23251	broad.mit.edu	37	15	79750590	79750590	+	Nonsense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:79750590A>T	uc002bew.1	+	2	2176	c.2101A>T	c.(2101-2103)AAA>TAA	p.K701*	KIAA1024_uc010unk.1_Nonsense_Mutation_p.K701*	NM_015206	NP_056021	Q9UPX6	K1024_HUMAN	hypothetical protein LOC23251	701						integral to membrane				pancreas(2)|ovary(1)|central_nervous_system(1)	4																		---	---	---	---	capture		Nonsense_Mutation	SNP	79750590	79750590	8512	15	A	T	T	1	1	KIAA1024	T	5	4
IL16	3603	broad.mit.edu	37	15	81578086	81578086	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:81578086T>A	uc002bgh.3	+	10	1623	c.1247T>A	c.(1246-1248)CTG>CAG	p.L416Q	IL16_uc002bgc.2_RNA|IL16_uc010blq.1_Missense_Mutation_p.L416Q|IL16_uc002bge.3_RNA|IL16_uc010unp.1_Missense_Mutation_p.L458Q|IL16_uc002bgg.2_Missense_Mutation_p.L416Q|IL16_uc002bgi.1_5'UTR	NM_172217	NP_757366	Q14005	IL16_HUMAN	interleukin 16 isoform 2	416	PDZ 2.|Interaction with GRIN2A.				immune response|interspecies interaction between organisms|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|extracellular space|nucleus|plasma membrane	cytokine activity			ovary(2)|lung(1)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	81578086	81578086	7934	15	T	A	A	55	55	IL16	A	4	4
TMC3	342125	broad.mit.edu	37	15	81625278	81625278	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:81625278C>T	uc002bgo.1	-	22	2785	c.2785G>A	c.(2785-2787)GCA>ACA	p.A929T	TMC3_uc010blr.1_RNA	NM_001080532	NP_001074001	Q7Z5M5	TMC3_HUMAN	transmembrane channel-like 3	929	Cytoplasmic (Potential).					integral to membrane				ovary(1)|liver(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	81625278	81625278	16516	15	C	T	T	25	25	TMC3	T	2	2
TMC3	342125	broad.mit.edu	37	15	81637256	81637256	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:81637256G>T	uc002bgo.1	-	13	1369	c.1369C>A	c.(1369-1371)CGG>AGG	p.R457R	TMC3_uc010blr.1_RNA|TMC3_uc002bgp.2_Silent_p.R457R	NM_001080532	NP_001074001	Q7Z5M5	TMC3_HUMAN	transmembrane channel-like 3	457	Cytoplasmic (Potential).					integral to membrane				ovary(1)|liver(1)	2																		---	---	---	---	capture		Silent	SNP	81637256	81637256	16516	15	G	T	T	37	37	TMC3	T	1	1
AGBL1	123624	broad.mit.edu	37	15	86697678	86697678	+	Missense_Mutation	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:86697678A>C	uc002blz.1	+	3	222	c.142A>C	c.(142-144)AAG>CAG	p.K48Q		NM_152336	NP_689549	Q96MI9	CBPC4_HUMAN	ATP/GTP binding protein-like 1	48					C-terminal protein deglutamylation|protein side chain deglutamylation|proteolysis	cytosol	metallocarboxypeptidase activity|tubulin binding|zinc ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	86697678	86697678	377	15	A	C	C	9	9	AGBL1	C	4	4
MSLN	10232	broad.mit.edu	37	16	818700	818700	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:818700C>T	uc002cjw.1	+	17	1911	c.1860C>T	c.(1858-1860)GTC>GTT	p.V620V	MSLN_uc002cjt.1_Silent_p.V612V|MSLN_uc002cju.1_Silent_p.V612V|MSLN_uc010brd.1_Silent_p.V611V|MSLN_uc002cjv.1_Silent_p.V602V|MSLN_uc002cjx.1_Silent_p.V612V|MSLN_uc002cjy.1_Missense_Mutation_p.P305S|MIR662_hsa-mir-662|MI0003670_5'Flank	NM_013404	NP_037536	Q13421	MSLN_HUMAN	mesothelin isoform 2 preproprotein	620					cell adhesion	anchored to membrane|extracellular region|Golgi apparatus|plasma membrane				pancreas(1)	1		Hepatocellular(780;0.00335)																---	---	---	---	capture		Silent	SNP	818700	818700	10274	16	C	T	T	30	30	MSLN	T	2	2
ABCA3	21	broad.mit.edu	37	16	2373534	2373534	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2373534G>T	uc002cpy.1	-	7	1315	c.603C>A	c.(601-603)GGC>GGA	p.G201G	ABCA3_uc010bsk.1_Silent_p.G201G|ABCA3_uc010bsl.1_Silent_p.G201G|ABCA3_uc002cpz.1_Silent_p.G201G	NM_001089	NP_001080	Q99758	ABCA3_HUMAN	ATP-binding cassette, sub-family A member 3	201					response to drug	integral to membrane|lamellar body|membrane fraction|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			breast(5)|ovary(5)|central_nervous_system(3)|upper_aerodigestive_tract(1)|lung(1)|skin(1)	16		Ovarian(90;0.17)																---	---	---	---	capture		Silent	SNP	2373534	2373534	34	16	G	T	T	38	38	ABCA3	T	1	1
MMP25	64386	broad.mit.edu	37	16	3100051	3100051	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3100051C>A	uc002cth.2	+	3	511	c.274C>A	c.(274-276)CTG>ATG	p.L92M	MMP25_uc002cti.1_Missense_Mutation_p.L28M	NM_022468	NP_071913	Q9NPA2	MMP25_HUMAN	matrix metalloproteinase 25 preproprotein	92	Cysteine switch (By similarity).				inflammatory response|proteolysis	anchored to membrane|cell surface|plasma membrane|proteinaceous extracellular matrix	calcium ion binding|metalloendopeptidase activity|zinc ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	3100051	3100051	10053	16	C	A	A	24	24	MMP25	A	2	2
SEC14L5	9717	broad.mit.edu	37	16	5058478	5058478	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:5058478G>T	uc002cye.2	+	14	1809	c.1629G>T	c.(1627-1629)CTG>CTT	p.L543L		NM_014692	NP_055507	O43304	S14L5_HUMAN	SEC14-like 5	543	GOLD.					integral to membrane|intracellular	transporter activity				0																		---	---	---	---	capture		Silent	SNP	5058478	5058478	14471	16	G	T	T	46	46	SEC14L5	T	2	2
NOMO1	23420	broad.mit.edu	37	16	14989462	14989462	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:14989462C>T	uc002dcv.2	+	31	3695	c.3629C>T	c.(3628-3630)GCA>GTA	p.A1210V		NM_014287	NP_055102	Q15155	NOMO1_HUMAN	nodal modulator 1 precursor	1210	Cytoplasmic (Potential).					integral to membrane	carbohydrate binding|carboxypeptidase activity|protein binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	14989462	14989462	10934	16	C	T	T	25	25	NOMO1	T	2	2
XYLT1	64131	broad.mit.edu	37	16	17202698	17202698	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:17202698C>A	uc002dfa.2	-	12	2819	c.2734G>T	c.(2734-2736)GGG>TGG	p.G912W		NM_022166	NP_071449	Q86Y38	XYLT1_HUMAN	xylosyltransferase I	912	Lumenal (Potential).				glycosaminoglycan biosynthetic process	endoplasmic reticulum membrane|extracellular region|Golgi membrane|integral to membrane	acetylglucosaminyltransferase activity|protein xylosyltransferase activity			ovary(4)	4																		---	---	---	---	capture		Missense_Mutation	SNP	17202698	17202698	18046	16	C	A	A	23	23	XYLT1	A	1	1
GP2	2813	broad.mit.edu	37	16	20329729	20329729	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20329729C>T	uc002dgv.2	-	8	1123	c.1040G>A	c.(1039-1041)GGG>GAG	p.G347E	GP2_uc002dgw.2_Missense_Mutation_p.G344E|GP2_uc002dgx.2_Missense_Mutation_p.G200E|GP2_uc002dgy.2_Missense_Mutation_p.G197E	NM_001007240	NP_001007241	P55259	GP2_HUMAN	zymogen granule membrane glycoprotein 2 isoform	347	ZP.					anchored to membrane|extracellular region|plasma membrane				ovary(3)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	20329729	20329729	6856	16	C	T	T	22	22	GP2	T	2	2
DNAH3	55567	broad.mit.edu	37	16	21093016	21093016	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21093016G>A	uc010vbe.1	-	20	2910	c.2910C>T	c.(2908-2910)CCC>CCT	p.P970P		NM_017539	NP_060009	Q8TD57	DYH3_HUMAN	dynein, axonemal, heavy chain 3	970	Stem (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(10)|skin(3)|large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)	18				GBM - Glioblastoma multiforme(48;0.207)														---	---	---	---	capture		Silent	SNP	21093016	21093016	4786	16	G	A	A	47	47	DNAH3	A	2	2
EEF2K	29904	broad.mit.edu	37	16	22260121	22260121	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:22260121C>G	uc002dki.2	+	4	878	c.393C>G	c.(391-393)ATC>ATG	p.I131M	EEF2K_uc002dkh.2_RNA	NM_013302	NP_037434	O00418	EF2K_HUMAN	elongation factor-2 kinase	131	Alpha-type protein kinase.				insulin receptor signaling pathway|translational elongation	cytosol	ATP binding|calcium ion binding|calmodulin binding|elongation factor-2 kinase activity|translation factor activity, nucleic acid binding			large_intestine(1)	1				GBM - Glioblastoma multiforme(48;0.0223)														---	---	---	---	capture		Missense_Mutation	SNP	22260121	22260121	5117	16	C	G	G	29	29	EEF2K	G	3	3
TNRC6A	27327	broad.mit.edu	37	16	24802560	24802560	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24802560G>T	uc002dmm.2	+	6	2711	c.2597G>T	c.(2596-2598)TGG>TTG	p.W866L	TNRC6A_uc010bxs.2_Missense_Mutation_p.W613L|TNRC6A_uc010vcc.1_Missense_Mutation_p.W613L|TNRC6A_uc002dmn.2_Missense_Mutation_p.W613L|TNRC6A_uc002dmo.2_Missense_Mutation_p.W613L	NM_014494	NP_055309	Q8NDV7	TNR6A_HUMAN	trinucleotide repeat containing 6A	866	Sufficient for interaction with EIF2C1 and EIF2C4.				negative regulation of translation involved in gene silencing by miRNA	cytoplasmic mRNA processing body|micro-ribonucleoprotein complex	nucleotide binding|RNA binding			ovary(2)	2				GBM - Glioblastoma multiforme(48;0.0394)														---	---	---	---	capture		Missense_Mutation	SNP	24802560	24802560	16881	16	G	T	T	47	47	TNRC6A	T	2	2
ARHGAP17	55114	broad.mit.edu	37	16	24953356	24953356	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24953356C>A	uc002dnb.2	-	16	1535	c.1442G>T	c.(1441-1443)CGG>CTG	p.R481L	ARHGAP17_uc002dmz.2_5'Flank|ARHGAP17_uc002dna.2_Missense_Mutation_p.R208L|ARHGAP17_uc002dnc.2_Missense_Mutation_p.R481L|ARHGAP17_uc010vcf.1_Missense_Mutation_p.R302L	NM_001006634	NP_001006635	Q68EM7	RHG17_HUMAN	nadrin isoform 1	481					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|tight junction	GTPase activator activity|SH3 domain binding				0				GBM - Glioblastoma multiforme(48;0.0407)														---	---	---	---	capture		Missense_Mutation	SNP	24953356	24953356	878	16	C	A	A	23	23	ARHGAP17	A	1	1
C16orf82	162083	broad.mit.edu	37	16	27078550	27078550	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:27078550G>A	uc010vcm.1	+	1	332	c.234G>A	c.(232-234)AGG>AGA	p.R78R		NM_001145545	NP_001139017	Q7Z2V1	TNT_HUMAN	hypothetical protein LOC162083	141											0																		---	---	---	---	capture		Silent	SNP	27078550	27078550	1891	16	G	A	A	42	42	C16orf82	A	2	2
SPN	6693	broad.mit.edu	37	16	29675658	29675658	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29675658C>A	uc002dtm.2	+	2	745	c.609C>A	c.(607-609)CCC>CCA	p.P203P	uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|SPN_uc002dtn.2_Silent_p.P203P|SPN_uc010bzd.2_RNA	NM_001030288	NP_001025459	P16150	LEUK_HUMAN	sialophorin precursor	203	Extracellular (Potential).				blood coagulation|cellular defense response|chemotaxis|defense response to bacterium|establishment or maintenance of cell polarity|immune response|leukocyte migration|negative regulation of cell adhesion|positive regulation of tumor necrosis factor biosynthetic process	extracellular space|integral to plasma membrane	bacterial cell surface binding|transmembrane receptor activity			central_nervous_system(2)	2																		---	---	---	---	capture		Silent	SNP	29675658	29675658	15586	16	C	A	A	22	22	SPN	A	2	2
ITGAD	3681	broad.mit.edu	37	16	31435470	31435470	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31435470C>T	uc002ebv.1	+	28	3256	c.3207C>T	c.(3205-3207)TTC>TTT	p.F1069F	ITGAD_uc010cap.1_Silent_p.F1070F	NM_005353	NP_005344	Q13349	ITAD_HUMAN	integrin, alpha D precursor	1069	Extracellular (Potential).				cell-cell adhesion|cell-matrix adhesion|immune response|integrin-mediated signaling pathway	integrin complex	receptor activity			skin(1)	1																		---	---	---	---	capture		Silent	SNP	31435470	31435470	8188	16	C	T	T	31	31	ITGAD	T	1	1
ITGAD	3681	broad.mit.edu	37	16	31435806	31435806	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31435806G>A	uc002ebv.1	+	29	3329	c.3280G>A	c.(3280-3282)GAA>AAA	p.E1094K	ITGAD_uc010cap.1_Missense_Mutation_p.E1095K	NM_005353	NP_005344	Q13349	ITAD_HUMAN	integrin, alpha D precursor	1094	Extracellular (Potential).				cell-cell adhesion|cell-matrix adhesion|immune response|integrin-mediated signaling pathway	integrin complex	receptor activity			skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	31435806	31435806	8188	16	G	A	A	33	33	ITGAD	A	2	2
NETO2	81831	broad.mit.edu	37	16	47117419	47117419	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:47117419C>A	uc002eer.1	-	9	1676	c.1291G>T	c.(1291-1293)GCC>TCC	p.A431S	NETO2_uc002eeq.1_Missense_Mutation_p.A166S|NETO2_uc010vgf.1_Missense_Mutation_p.A288S	NM_018092	NP_060562	Q8NC67	NETO2_HUMAN	neuropilin- and tolloid-like protein 2	431	Cytoplasmic (Potential).					integral to membrane	receptor activity				0		all_cancers(37;0.00114)|all_lung(18;0.00432)|Lung NSC(13;0.0384)|Breast(268;0.174)													HNSCC(25;0.065)			---	---	---	---	capture		Missense_Mutation	SNP	47117419	47117419	10739	16	C	A	A	27	27	NETO2	A	1	1
NOD2	64127	broad.mit.edu	37	16	50746191	50746191	+	Missense_Mutation	SNP	G	T	T	rs5743279	byFrequency;by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:50746191G>T	uc002egm.1	+	4	2474	c.2369G>T	c.(2368-2370)CGG>CTG	p.R790L	NOD2_uc010cbk.1_Missense_Mutation_p.R763L|NOD2_uc002egl.1_Missense_Mutation_p.R568L|NOD2_uc010cbl.1_Missense_Mutation_p.R568L|NOD2_uc010cbm.1_Missense_Mutation_p.R568L|NOD2_uc010cbn.1_RNA|NOD2_uc010cbo.1_RNA|NOD2_uc010cbp.1_RNA|NOD2_uc010cbq.1_5'UTR|NOD2_uc010cbr.1_RNA	NM_022162	NP_071445	Q9HC29	NOD2_HUMAN	nucleotide-binding oligomerization domain	790					activation of MAPK activity involved in innate immune response|cytokine production involved in immune response|detection of bacterium|detection of muramyl dipeptide|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of macrophage apoptosis|nucleotide-binding oligomerization domain containing 2 signaling pathway|positive regulation of B cell activation|positive regulation of dendritic cell antigen processing and presentation|positive regulation of epithelial cell proliferation|positive regulation of ERK1 and ERK2 cascade|positive regulation of gamma-delta T cell activation|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-1 beta secretion|positive regulation of interleukin-10 production|positive regulation of interleukin-17 production|positive regulation of interleukin-6 production|positive regulation of JNK cascade|positive regulation of NF-kappaB transcription factor activity|positive regulation of nitric-oxide synthase biosynthetic process|positive regulation of Notch signaling pathway|positive regulation of phosphatidylinositol 3-kinase activity|positive regulation of prostaglandin-E synthase activity|positive regulation of prostaglandin-endoperoxide synthase activity|positive regulation of stress-activated MAPK cascade|positive regulation of tumor necrosis factor production|positive regulation of type 2 immune response|protein oligomerization|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cell surface|cytosol|plasma membrane|vesicle	ATP binding|CARD domain binding|muramyl dipeptide binding|protein kinase binding			ovary(3)|skin(1)	4		all_cancers(37;0.0156)																---	---	---	---	capture		Missense_Mutation	SNP	50746191	50746191	10920	16	G	T	T	39	39	NOD2	T	1	1
CNOT1	23019	broad.mit.edu	37	16	58559117	58559117	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:58559117G>C	uc002env.2	-	46	7043	c.6750C>G	c.(6748-6750)ATC>ATG	p.I2250M	CNOT1_uc002enw.2_RNA|CNOT1_uc002enu.3_Missense_Mutation_p.I2245M|CNOT1_uc002ent.2_Missense_Mutation_p.I188M|CNOT1_uc010vik.1_Missense_Mutation_p.I1207M	NM_016284	NP_057368	A5YKK6	CNOT1_HUMAN	CCR4-NOT transcription complex, subunit 1	2250					nuclear-transcribed mRNA poly(A) tail shortening|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol				ovary(4)|central_nervous_system(2)	6				Kidney(780;0.0722)|OV - Ovarian serous cystadenocarcinoma(108;0.173)|Epithelial(162;0.239)														---	---	---	---	capture		Missense_Mutation	SNP	58559117	58559117	3755	16	G	C	C	33	33	CNOT1	C	3	3
CDH8	1006	broad.mit.edu	37	16	61687817	61687817	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:61687817C>A	uc002eog.1	-	12	2347	c.2095G>T	c.(2095-2097)GAT>TAT	p.D699Y		NM_001796	NP_001787	P55286	CADH8_HUMAN	cadherin 8, type 2 preproprotein	699	Cytoplasmic (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|skin(2)|breast(1)	9		Ovarian(137;0.0799)|Melanoma(118;0.16)		UCEC - Uterine corpus endometrioid carcinoma (183;0.196)|Epithelial(162;0.0155)|all cancers(182;0.0305)|OV - Ovarian serous cystadenocarcinoma(108;0.0499)|BRCA - Breast invasive adenocarcinoma(181;0.249)														---	---	---	---	capture		Missense_Mutation	SNP	61687817	61687817	3245	16	C	A	A	30	30	CDH8	A	2	2
PMFBP1	83449	broad.mit.edu	37	16	72153940	72153940	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72153940C>G	uc002fcc.3	-	20	3004	c.2832G>C	c.(2830-2832)CTG>CTC	p.L944L	PMFBP1_uc002fcd.2_Silent_p.L939L|PMFBP1_uc002fce.2_RNA|PMFBP1_uc002fcf.2_Silent_p.L814L	NM_031293	NP_112583	Q8TBY8	PMFBP_HUMAN	polyamine modulated factor 1 binding protein 1	944	Potential.									ovary(2)	2		Ovarian(137;0.179)																---	---	---	---	capture		Silent	SNP	72153940	72153940	12560	16	C	G	G	29	29	PMFBP1	G	3	3
NUDT7	283927	broad.mit.edu	37	16	77769814	77769814	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:77769814C>A	uc010chd.2	+	3	348	c.279C>A	c.(277-279)GCC>GCA	p.A93A	NUDT7_uc010vnj.1_Intron	NM_001105663	NP_001099133	P0C024	NUDT7_HUMAN	nudix motif 7	93	Nudix hydrolase.|Nudix box.				nucleoside diphosphate metabolic process	peroxisome	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides|magnesium ion binding|manganese ion binding			ovary(1)|kidney(1)	2																		---	---	---	---	capture		Silent	SNP	77769814	77769814	11149	16	C	A	A	22	22	NUDT7	A	2	2
VAT1L	57687	broad.mit.edu	37	16	77913097	77913097	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:77913097G>T	uc002ffg.1	+	6	955	c.858G>T	c.(856-858)AAG>AAT	p.K286N		NM_020927	NP_065978	Q9HCJ6	VAT1L_HUMAN	vesicle amine transport protein 1 homolog (T.	286							oxidoreductase activity|zinc ion binding			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	77913097	77913097	17695	16	G	T	T	33	33	VAT1L	T	2	2
WWOX	51741	broad.mit.edu	37	16	79245630	79245630	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:79245630C>G	uc002ffk.2	+	9	1307	c.1182C>G	c.(1180-1182)GCC>GCG	p.A394A	WWOX_uc010vnk.1_Silent_p.A281A|WWOX_uc002ffl.2_Silent_p.A214A|WWOX_uc010che.2_Missense_Mutation_p.P179A	NM_016373	NP_057457	Q9NZC7	WWOX_HUMAN	WW domain-containing oxidoreductase isoform 1	394	Interaction with MAPT (By similarity).				apoptosis|negative regulation of Wnt receptor signaling pathway|steroid metabolic process|Wnt receptor signaling pathway	Golgi apparatus|mitochondrion|nucleus	coenzyme binding|oxidoreductase activity|protein dimerization activity				0		all_cancers(2;1.97e-181)|all_epithelial(2;3.85e-160)|all_lung(2;2.03e-39)|Lung NSC(2;7.16e-35)|Colorectal(2;6.96e-21)|all_hematologic(2;1.13e-16)|Melanoma(2;5.16e-06)|all_neural(2;8.84e-06)|Renal(2;5.26e-05)|Medulloblastoma(2;0.00498)|Breast(2;0.00631)|Lung SC(2;0.0261)|Prostate(104;0.167)		UCEC - Uterine corpus endometrioid carcinoma (2;0.012)|Epithelial(1;2.65e-39)|all cancers(1;3.26e-34)|STAD - Stomach adenocarcinoma(1;5.1e-20)|COAD - Colon adenocarcinoma(1;1.04e-11)|Colorectal(1;3.4e-11)|OV - Ovarian serous cystadenocarcinoma(1;1.01e-10)|BRCA - Breast invasive adenocarcinoma(1;0.00196)|Kidney(780;0.232)														---	---	---	---	capture		Silent	SNP	79245630	79245630	17988	16	C	G	G	22	22	WWOX	G	3	3
KCNG4	93107	broad.mit.edu	37	16	84271026	84271026	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84271026A>G	uc010voc.1	-	2	187	c.66T>C	c.(64-66)CCT>CCC	p.P22P	KCNG4_uc002fhu.1_Silent_p.P22P	NM_172347	NP_758857	Q8TDN1	KCNG4_HUMAN	potassium voltage-gated channel, subfamily G,	22	Cytoplasmic (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity			breast(3)	3																		---	---	---	---	capture		Silent	SNP	84271026	84271026	8335	16	A	G	G	3	3	KCNG4	G	4	4
BANP	54971	broad.mit.edu	37	16	88061218	88061218	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88061218C>A	uc002fkr.2	+	8	1222	c.998C>A	c.(997-999)TCG>TAG	p.S333*	BANP_uc002fkp.2_Nonsense_Mutation_p.S303*|BANP_uc002fkq.2_Nonsense_Mutation_p.S303*|BANP_uc010vow.1_Nonsense_Mutation_p.S341*|BANP_uc002fks.3_Nonsense_Mutation_p.S302*|BANP_uc002fko.1_Nonsense_Mutation_p.S239*|BANP_uc010vov.1_Nonsense_Mutation_p.S308*	NM_079837	NP_524576	Q8N9N5	BANP_HUMAN	BTG3 associated nuclear protein isoform b	334	Necessary and sufficient for TP53 activation (By similarity).|Interaction with CUX1 and HDAC1 (By similarity).				cell cycle|chromatin modification|multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding				0				BRCA - Breast invasive adenocarcinoma(80;0.00551)														---	---	---	---	capture		Nonsense_Mutation	SNP	88061218	88061218	1331	16	C	A	A	31	31	BANP	A	5	1
ZC3H18	124245	broad.mit.edu	37	16	88691009	88691009	+	Splice_Site	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88691009G>C	uc002fky.2	+	12	2099	c.1899_splice	c.e12-1	p.G633_splice	ZC3H18_uc010voz.1_Splice_Site_p.G657_splice|ZC3H18_uc010chw.2_Splice_Site|ZC3H18_uc002fkz.2_5'Flank	NM_144604	NP_653205			zinc finger CCCH-type containing 18							nucleus	nucleic acid binding|zinc ion binding			skin(1)	1				BRCA - Breast invasive adenocarcinoma(80;0.0542)														---	---	---	---	capture		Splice_Site	SNP	88691009	88691009	18156	16	G	C	C	33	33	ZC3H18	C	5	3
MVD	4597	broad.mit.edu	37	16	88722558	88722558	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88722558C>G	uc002flg.1	-	5	565	c.558G>C	c.(556-558)GTG>GTC	p.V186V	MVD_uc002flf.1_Silent_p.V55V	NM_002461	NP_002452	P53602	MVD1_HUMAN	diphosphomevalonate decarboxylase	186					cholesterol biosynthetic process|positive regulation of cell proliferation	cytosol	ATP binding|diphosphomevalonate decarboxylase activity|Hsp70 protein binding|kinase activity|protein homodimerization activity				0				BRCA - Breast invasive adenocarcinoma(80;0.0478)														---	---	---	---	capture		Silent	SNP	88722558	88722558	10388	16	C	G	G	21	21	MVD	G	3	3
PAFAH1B1	5048	broad.mit.edu	37	17	2541586	2541586	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:2541586G>T	uc002fuw.3	+	2	572	c.4G>T	c.(4-6)GTG>TTG	p.V2L	PAFAH1B1_uc010ckb.1_RNA	NM_000430	NP_000421	P43034	LIS1_HUMAN	platelet-activating factor acetylhydrolase,	2	Required for self-association and interaction with PAFAH1B2 and PAFAH1B3 (By similarity).|Interaction with NDEL1 (By similarity).|Interaction with NDE1 (By similarity).				acrosome assembly|actin cytoskeleton organization|adult locomotory behavior|brain morphogenesis|corpus callosum morphogenesis|establishment of mitotic spindle orientation|G2/M transition of mitotic cell cycle|hippocampus development|layer formation in cerebral cortex|learning or memory|lipid catabolic process|microtubule organizing center organization|mitotic prometaphase|neuroblast proliferation|neuromuscular process controlling balance|neuron migration|platelet activating factor metabolic process|regulation of Rho GTPase activity|retrograde axon cargo transport|synaptic transmission|vesicle transport along microtubule	astral microtubule|cell cortex|centrosome|cytosol|kinetochore|motile primary cilium|nuclear membrane|perinuclear region of cytoplasm	dynactin binding|heparin binding|microtubule binding|phospholipase binding|phosphoprotein binding|protein homodimerization activity			skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	2541586	2541586	11800	17	G	T	T	44	44	PAFAH1B1	T	2	2
SLC16A11	162515	broad.mit.edu	37	17	6946295	6946295	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:6946295G>T	uc002gei.1	-	2	710	c.372C>A	c.(370-372)TTC>TTA	p.F124L		NM_153357	NP_699188	Q8NCK7	MOT11_HUMAN	solute carrier family 16, member 11	124	Helical; (Potential).					integral to membrane|plasma membrane	symporter activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	6946295	6946295	14900	17	G	T	T	37	37	SLC16A11	T	1	1
TMEM102	284114	broad.mit.edu	37	17	7339853	7339853	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7339853C>G	uc002ggx.1	+	3	828	c.555C>G	c.(553-555)GAC>GAG	p.D185E	FGF11_uc010vtw.1_Intron|TMEM102_uc002ggy.1_Missense_Mutation_p.D185E	NM_178518	NP_848613	Q8N9M5	TM102_HUMAN	transmembrane protein 102	185	Extracellular (Potential).				regulation of apoptosis|response to cytokine stimulus|signal transduction	cell surface|integral to membrane|intracellular	protein binding				0		Prostate(122;0.173)																---	---	---	---	capture		Missense_Mutation	SNP	7339853	7339853	16547	17	C	G	G	20	20	TMEM102	G	3	3
ODF4	146852	broad.mit.edu	37	17	8243550	8243550	+	Missense_Mutation	SNP	C	A	A	rs147153349		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8243550C>A	uc002gle.1	+	1	363	c.181C>A	c.(181-183)CGC>AGC	p.R61S		NM_153007	NP_694552	Q2M2E3	ODFP4_HUMAN	outer dense fiber of sperm tails 4	61					cell differentiation|multicellular organismal development|spermatogenesis	integral to membrane				ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	8243550	8243550	11238	17	C	A	A	27	27	ODF4	A	1	1
PIK3R5	23533	broad.mit.edu	37	17	8784233	8784233	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8784233C>A	uc002glt.2	-	18	2551	c.2484G>T	c.(2482-2484)CAG>CAT	p.Q828H	PIK3R5_uc010vuz.1_Missense_Mutation_p.Q828H|PIK3R5_uc002glu.3_Missense_Mutation_p.Q442H	NM_014308	NP_055123	Q8WYR1	PI3R5_HUMAN	phosphoinositide-3-kinase, regulatory subunit 5	828					platelet activation	cytosol|membrane|nucleus				breast(2)|large_intestine(1)|central_nervous_system(1)|skin(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	8784233	8784233	12346	17	C	A	A	32	32	PIK3R5	A	2	2
MYH8	4626	broad.mit.edu	37	17	10298521	10298521	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10298521G>T	uc002gmm.2	-	34	4986	c.4891C>A	c.(4891-4893)CAG>AAG	p.Q1631K	uc002gml.1_Intron	NM_002472	NP_002463	P13535	MYH8_HUMAN	myosin, heavy chain 8, skeletal muscle,	1631	Potential.				muscle filament sliding	cytosol|muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			skin(6)|ovary(3)|breast(2)	11														Trismus-Pseudocamptodactyly_Syndrome_with_Cardiac_Myxoma_and_Freckling				---	---	---	---	capture		Missense_Mutation	SNP	10298521	10298521	10436	17	G	T	T	47	47	MYH8	T	2	2
MYH8	4626	broad.mit.edu	37	17	10302972	10302972	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10302972C>A	uc002gmm.2	-	28	3845	c.3750G>T	c.(3748-3750)AAG>AAT	p.K1250N	uc002gml.1_Intron	NM_002472	NP_002463	P13535	MYH8_HUMAN	myosin, heavy chain 8, skeletal muscle,	1250	Potential.				muscle filament sliding	cytosol|muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			skin(6)|ovary(3)|breast(2)	11														Trismus-Pseudocamptodactyly_Syndrome_with_Cardiac_Myxoma_and_Freckling				---	---	---	---	capture		Missense_Mutation	SNP	10302972	10302972	10436	17	C	A	A	32	32	MYH8	A	2	2
MYH4	4622	broad.mit.edu	37	17	10356530	10356530	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10356530T>A	uc002gmn.2	-	24	3161	c.3050A>T	c.(3049-3051)GAG>GTG	p.E1017V	uc002gml.1_Intron	NM_017533	NP_060003	Q9Y623	MYH4_HUMAN	myosin, heavy polypeptide 4, skeletal muscle	1017	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(10)|skin(2)|central_nervous_system(1)	13																		---	---	---	---	capture		Missense_Mutation	SNP	10356530	10356530	10432	17	T	A	A	54	54	MYH4	A	4	4
MYH1	4619	broad.mit.edu	37	17	10398576	10398576	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10398576C>T	uc002gmo.2	-	36	5322	c.5228G>A	c.(5227-5229)GGA>GAA	p.G1743E	uc002gml.1_Intron	NM_005963	NP_005954	P12882	MYH1_HUMAN	myosin, heavy chain 1, skeletal muscle, adult	1743	Potential.					muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity			ovary(10)|skin(6)|breast(3)|upper_aerodigestive_tract(1)|kidney(1)	21																		---	---	---	---	capture		Missense_Mutation	SNP	10398576	10398576	10424	17	C	T	T	30	30	MYH1	T	2	2
MYH1	4619	broad.mit.edu	37	17	10404776	10404776	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10404776C>G	uc002gmo.2	-	27	3483	c.3389G>C	c.(3388-3390)CGG>CCG	p.R1130P	uc002gml.1_Intron	NM_005963	NP_005954	P12882	MYH1_HUMAN	myosin, heavy chain 1, skeletal muscle, adult	1130	Potential.					muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity			ovary(10)|skin(6)|breast(3)|upper_aerodigestive_tract(1)|kidney(1)	21																		---	---	---	---	capture		Missense_Mutation	SNP	10404776	10404776	10424	17	C	G	G	23	23	MYH1	G	3	3
MYH2	4620	broad.mit.edu	37	17	10432232	10432232	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10432232C>A	uc010coi.2	-	27	3647	c.3519G>T	c.(3517-3519)CGG>CGT	p.R1173R	uc002gml.1_Intron|MYH2_uc002gmp.3_Silent_p.R1173R|MYH2_uc010coj.2_Intron	NM_001100112	NP_001093582	Q9UKX2	MYH2_HUMAN	myosin heavy chain IIa	1173	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(5)|pancreas(4)|skin(3)|lung(1)|kidney(1)	14																		---	---	---	---	capture		Silent	SNP	10432232	10432232	10430	17	C	A	A	22	22	MYH2	A	2	2
TMEM220	388335	broad.mit.edu	37	17	10628381	10628381	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10628381C>A	uc002gmx.2	-	4	712	c.234G>T	c.(232-234)GCG>GCT	p.A78A	TMEM220_uc002gmy.2_Silent_p.A68A	NM_001004313	NP_001004313	Q6QAJ8	TM220_HUMAN	transmembrane protein 220	78	Helical; (Potential).					integral to membrane					0																		---	---	---	---	capture		Silent	SNP	10628381	10628381	16680	17	C	A	A	19	19	TMEM220	A	1	1
TRPV2	51393	broad.mit.edu	37	17	16323463	16323463	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:16323463C>A	uc002gpy.2	+	3	602	c.235C>A	c.(235-237)CTC>ATC	p.L79I	TRPV2_uc002gpz.2_5'UTR	NM_016113	NP_057197	Q9Y5S1	TRPV2_HUMAN	transient receptor potential cation channel,	79	Cytoplasmic (Potential).|Required for interaction with SLC50A1 (By similarity).|ANK 1.				sensory perception	integral to plasma membrane|melanosome	calcium channel activity			ovary(1)	1				UCEC - Uterine corpus endometrioid carcinoma (92;0.0837)														---	---	---	---	capture		Missense_Mutation	SNP	16323463	16323463	17147	17	C	A	A	28	28	TRPV2	A	2	2
MAP2K3	5606	broad.mit.edu	37	17	21203906	21203906	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:21203906G>T	uc002gys.2	+	4	480	c.215G>T	c.(214-216)CGT>CTT	p.R72L	MAP2K3_uc002gyt.2_Missense_Mutation_p.R43L|MAP2K3_uc002gyu.2_Missense_Mutation_p.R43L	NM_145109	NP_659731	P46734	MP2K3_HUMAN	mitogen-activated protein kinase kinase 3	72	ATP (By similarity).|Protein kinase.				activation of MAPK activity|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of transcription, DNA-dependent|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	ATP binding|MAP kinase kinase activity|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity				0				COAD - Colon adenocarcinoma(3;0.0131)|Colorectal(15;0.0553)														---	---	---	---	capture		Missense_Mutation	SNP	21203906	21203906	9621	17	G	T	T	40	40	MAP2K3	T	1	1
SEZ6	124925	broad.mit.edu	37	17	27306729	27306729	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27306729G>A	uc002hdp.2	-	3	1021	c.827C>T	c.(826-828)TCT>TTT	p.S276F	SEZ6_uc002hdm.2_RNA|SEZ6_uc010cry.1_Missense_Mutation_p.S276F|SEZ6_uc002hdq.1_Missense_Mutation_p.S151F|SEZ6_uc010crz.1_Missense_Mutation_p.S276F	NM_178860	NP_849191	Q53EL9	SEZ6_HUMAN	seizure related 6 homolog isoform 1	276	Extracellular (Potential).					integral to membrane|plasma membrane				large_intestine(1)|central_nervous_system(1)	2	Lung NSC(42;0.0137)		Epithelial(11;4.73e-06)|all cancers(11;2.91e-05)|BRCA - Breast invasive adenocarcinoma(11;8.06e-05)|OV - Ovarian serous cystadenocarcinoma(11;0.111)															---	---	---	---	capture		Missense_Mutation	SNP	27306729	27306729	14631	17	G	A	A	33	33	SEZ6	A	2	2
TAOK1	57551	broad.mit.edu	37	17	27869857	27869857	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27869857C>T	uc002hdz.1	+	20	3017	c.2823C>T	c.(2821-2823)CCC>CCT	p.P941P	TAOK1_uc010wbe.1_Silent_p.P793P|TAOK1_uc010wbf.1_Silent_p.P941P	NM_020791	NP_065842	Q7L7X3	TAOK1_HUMAN	TAO kinase 1	941					mitotic prometaphase	cytosol|intracellular membrane-bounded organelle	ATP binding|protein serine/threonine kinase activity			upper_aerodigestive_tract(1)|lung(1)|central_nervous_system(1)|skin(1)	4			Colorectal(6;0.198)															---	---	---	---	capture		Silent	SNP	27869857	27869857	16068	17	C	T	T	22	22	TAOK1	T	2	2
NF1	4763	broad.mit.edu	37	17	29684054	29684054	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:29684054G>T	uc002hgg.2	+	53	8148	c.7815G>T	c.(7813-7815)TTG>TTT	p.L2605F	NF1_uc002hgh.2_Missense_Mutation_p.L2584F|NF1_uc010cso.2_Missense_Mutation_p.L793F|NF1_uc010wbt.1_Missense_Mutation_p.L83F|NF1_uc010wbu.1_RNA	NM_001042492	NP_001035957	P21359	NF1_HUMAN	neurofibromin isoform 1	2605					actin cytoskeleton organization|adrenal gland development|artery morphogenesis|camera-type eye morphogenesis|cerebral cortex development|collagen fibril organization|forebrain astrocyte development|forebrain morphogenesis|heart development|liver development|MAPKKK cascade|metanephros development|myelination in peripheral nervous system|negative regulation of cell migration|negative regulation of endothelial cell proliferation|negative regulation of MAP kinase activity|negative regulation of MAPKKK cascade|negative regulation of neuroblast proliferation|negative regulation of oligodendrocyte differentiation|negative regulation of transcription factor import into nucleus|osteoblast differentiation|phosphatidylinositol 3-kinase cascade|pigmentation|positive regulation of adenylate cyclase activity|positive regulation of neuron apoptosis|Ras protein signal transduction|regulation of blood vessel endothelial cell migration|regulation of bone resorption|response to hypoxia|smooth muscle tissue development|spinal cord development|sympathetic nervous system development|visual learning|wound healing	axon|cytoplasm|dendrite|intrinsic to internal side of plasma membrane|nucleus	protein binding|Ras GTPase activator activity			soft_tissue(159)|central_nervous_system(56)|lung(28)|large_intestine(27)|haematopoietic_and_lymphoid_tissue(18)|ovary(18)|autonomic_ganglia(12)|breast(3)|skin(3)|stomach(2)|thyroid(1)|prostate(1)|kidney(1)|pancreas(1)	330		all_cancers(10;1.29e-12)|all_epithelial(10;0.00347)|all_hematologic(16;0.00556)|Acute lymphoblastic leukemia(14;0.00593)|Breast(31;0.014)|Myeloproliferative disorder(56;0.0255)|all_lung(9;0.0321)|Lung NSC(157;0.0659)		UCEC - Uterine corpus endometrioid carcinoma (4;4.38e-05)|all cancers(4;1.64e-26)|Epithelial(4;9.15e-23)|OV - Ovarian serous cystadenocarcinoma(4;3.58e-21)|GBM - Glioblastoma multiforme(4;0.00146)				D|Mis|N|F|S|O		neurofibroma|glioma	neurofibroma|glioma			Neurofibromatosis_type_1	TCGA GBM(6;<1E-08)|TSP Lung(7;0.0071)|TCGA Ovarian(3;0.0088)			---	---	---	---	capture		Missense_Mutation	SNP	29684054	29684054	10756	17	G	T	T	47	47	NF1	T	2	2
SLFN12	55106	broad.mit.edu	37	17	33738500	33738500	+	Nonsense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:33738500T>A	uc002hji.3	-	4	1971	c.1594A>T	c.(1594-1596)AAA>TAA	p.K532*	SLFN12_uc002hjj.3_Nonsense_Mutation_p.K532*|SLFN12_uc010cts.2_Nonsense_Mutation_p.K532*	NM_018042	NP_060512	Q8IYM2	SLN12_HUMAN	schlafen family member 12	532							ATP binding			skin(1)	1		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0182)														---	---	---	---	capture		Nonsense_Mutation	SNP	33738500	33738500	15231	17	T	A	A	62	62	SLFN12	A	5	4
TNS4	84951	broad.mit.edu	37	17	38638626	38638626	+	Missense_Mutation	SNP	G	C	C	rs142919679		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38638626G>C	uc010cxb.2	-	7	1708	c.1544C>G	c.(1543-1545)TCG>TGG	p.S515W	TNS4_uc002huu.3_5'Flank	NM_032865	NP_116254	Q8IZW8	TENS4_HUMAN	tensin 4 precursor	515	SH2.				apoptosis|protein localization	cytoplasm|cytoskeleton|focal adhesion	actin binding			large_intestine(1)|ovary(1)|central_nervous_system(1)|skin(1)	4		Breast(137;0.000496)	STAD - Stomach adenocarcinoma(5;5.91e-05)															---	---	---	---	capture		Missense_Mutation	SNP	38638626	38638626	16886	17	G	C	C	37	37	TNS4	C	3	3
KRT39	390792	broad.mit.edu	37	17	39116541	39116541	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39116541C>T	uc002hvo.1	-	6	1245	c.1209G>A	c.(1207-1209)TCG>TCA	p.S403S	KRT39_uc010wfm.1_Silent_p.S136S	NM_213656	NP_998821	Q6A163	K1C39_HUMAN	type I hair keratin KA35	403	Coil 2.|Rod.					intermediate filament	structural molecule activity				0		Breast(137;0.00043)|Ovarian(249;0.15)																---	---	---	---	capture		Silent	SNP	39116541	39116541	8791	17	C	T	T	23	23	KRT39	T	1	1
KRT40	125115	broad.mit.edu	37	17	39140113	39140113	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39140113C>G	uc010cxh.1	-	3	574	c.413G>C	c.(412-414)CGT>CCT	p.R138P	KRT40_uc002hvq.1_RNA	NM_182497	NP_872303	Q6A162	K1C40_HUMAN	type I hair keratin KA36	138	Rod.|Coil 1B.					intermediate filament	structural molecule activity				0		Breast(137;0.00043)																---	---	---	---	capture		Missense_Mutation	SNP	39140113	39140113	8793	17	C	G	G	19	19	KRT40	G	3	3
KRT36	8689	broad.mit.edu	37	17	39642717	39642717	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39642717C>A	uc002hwt.2	-	7	1315	c.1315G>T	c.(1315-1317)GTT>TTT	p.V439F		NM_003771	NP_003762	O76013	KRT36_HUMAN	keratin 36	439	Tail.					intermediate filament	protein binding|structural constituent of epidermis				0		Breast(137;0.000286)																---	---	---	---	capture		Missense_Mutation	SNP	39642717	39642717	8788	17	C	A	A	18	18	KRT36	A	2	2
PTRF	284119	broad.mit.edu	37	17	40556972	40556972	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40556972C>A	uc002hzo.2	-	2	1065	c.906G>T	c.(904-906)ACG>ACT	p.T302T	PTRF_uc010wgi.1_Silent_p.T284T	NM_012232	NP_036364	Q6NZI2	PTRF_HUMAN	polymerase I and transcript release factor	302					regulation of transcription, DNA-dependent|termination of RNA polymerase I transcription|transcription initiation from RNA polymerase I promoter	caveola|cytosol|endoplasmic reticulum|microsome|mitochondrion|nucleoplasm	protein binding|rRNA primary transcript binding			breast(1)	1		all_cancers(22;0.00146)|Breast(137;0.00116)|all_epithelial(22;0.0134)		BRCA - Breast invasive adenocarcinoma(366;0.193)														---	---	---	---	capture		Silent	SNP	40556972	40556972	13273	17	C	A	A	27	27	PTRF	A	1	1
BRCA1	672	broad.mit.edu	37	17	41244070	41244070	+	Nonsense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:41244070T>A	uc002icq.2	-	10	3710	c.3478A>T	c.(3478-3480)AAG>TAG	p.K1160*	BRCA1_uc010whp.1_Intron|BRCA1_uc010whl.1_Intron|BRCA1_uc010whm.1_Intron|BRCA1_uc002icp.3_Nonsense_Mutation_p.K1089*|BRCA1_uc002icu.2_Intron|BRCA1_uc010cyx.2_Nonsense_Mutation_p.K1113*|BRCA1_uc002ict.2_Nonsense_Mutation_p.K1160*|BRCA1_uc010whn.1_Intron|BRCA1_uc010who.1_Intron|BRCA1_uc010whq.1_Intron|BRCA1_uc002idc.1_Intron|BRCA1_uc010whr.1_Intron|BRCA1_uc002idd.2_Nonsense_Mutation_p.K1160*|BRCA1_uc002ide.1_Nonsense_Mutation_p.K991*|BRCA1_uc010cyy.1_Nonsense_Mutation_p.K1160*|BRCA1_uc010whs.1_Nonsense_Mutation_p.K1160*|BRCA1_uc010cyz.2_Nonsense_Mutation_p.K1113*|BRCA1_uc010cza.2_Nonsense_Mutation_p.K1134*|BRCA1_uc010wht.1_Nonsense_Mutation_p.K864*	NM_007294	NP_009225	P38398	BRCA1_HUMAN	breast cancer 1, early onset isoform 1	1160					androgen receptor signaling pathway|apoptosis|cellular response to indole-3-methanol|chromosome segregation|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|DNA damage response, signal transduction resulting in induction of apoptosis|double-strand break repair via homologous recombination|fatty acid biosynthetic process|G2/M transition DNA damage checkpoint|negative regulation of centriole replication|negative regulation of fatty acid biosynthetic process|negative regulation of histone H3-K9 methylation|negative regulation of transcription, DNA-dependent|positive regulation of cell cycle arrest|positive regulation of DNA repair|positive regulation of histone acetylation|positive regulation of histone H3-K4 methylation|positive regulation of histone H4-K20 methylation|positive regulation of protein ubiquitination|positive regulation of transcription from RNA polymerase II promoter|postreplication repair|protein autoubiquitination|protein K6-linked ubiquitination|regulation of cell motility|regulation of cell proliferation|regulation of transcription from RNA polymerase III promoter|response to estrogen stimulus|response to ionizing radiation|substrate adhesion-dependent cell spreading	BRCA1-A complex|BRCA1-BARD1 complex|gamma-tubulin ring complex|nucleoplasm|plasma membrane|ribonucleoprotein complex|ruffle	androgen receptor binding|identical protein binding|protein binding|RNA binding|transcription coactivator activity|transcription regulatory region DNA binding|tubulin binding|ubiquitin protein ligase binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(24)|breast(21)|lung(4)|central_nervous_system(1)|endometrium(1)|urinary_tract(1)	52		Breast(137;0.000717)		BRCA - Breast invasive adenocarcinoma(366;0.126)				D|Mis|N|F|S		ovarian	breast|ovarian		Homologous_recombination	Hereditary_Breast-Ovarian_Cancer_BRCA1_type	TCGA Ovarian(2;0.000030)			---	---	---	---	capture		Nonsense_Mutation	SNP	41244070	41244070	1529	17	T	A	A	64	64	BRCA1	A	5	4
NBR1	4077	broad.mit.edu	37	17	41341074	41341074	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:41341074C>G	uc010czd.2	+	7	558	c.418C>G	c.(418-420)CCA>GCA	p.P140A	NBR1_uc010diz.2_Missense_Mutation_p.P140A|NBR1_uc010whu.1_Missense_Mutation_p.P140A|NBR1_uc010whv.1_Missense_Mutation_p.P140A|NBR1_uc010whw.1_Missense_Mutation_p.P119A|NBR1_uc010whx.1_5'Flank	NM_031862	NP_114068	Q14596	NBR1_HUMAN	neighbor of BRCA1 gene 1	140					macroautophagy|protein oligomerization	autophagic vacuole|cytoplasmic vesicle|cytosol|late endosome|lysosome|sarcomere	ubiquitin binding|zinc ion binding			skin(1)	1		Breast(137;0.00086)		BRCA - Breast invasive adenocarcinoma(366;0.0934)														---	---	---	---	capture		Missense_Mutation	SNP	41341074	41341074	10599	17	C	G	G	30	30	NBR1	G	3	3
HOXB3	3213	broad.mit.edu	37	17	46628422	46628422	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:46628422C>A	uc002inn.2	-	2	970	c.570G>T	c.(568-570)CGG>CGT	p.R190R	HOXB3_uc010wlm.1_Silent_p.R117R|HOXB3_uc010dbf.2_Silent_p.R190R|HOXB3_uc010dbg.2_Silent_p.R190R|HOXB3_uc002ino.2_Silent_p.R190R|HOXB3_uc010wlk.1_Silent_p.R58R|HOXB3_uc010wll.1_Silent_p.R117R	NM_002146	NP_002137	P14651	HXB3_HUMAN	homeobox B3	190	Homeobox.				angiogenesis	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---	capture		Silent	SNP	46628422	46628422	7594	17	C	A	A	22	22	HOXB3	A	2	2
HOXB6	3216	broad.mit.edu	37	17	46673923	46673923	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:46673923C>A	uc002ins.1	-	4	852	c.527G>T	c.(526-528)CGC>CTC	p.R176L	HOXB5_uc002inr.2_5'Flank|HOXB6_uc010dbh.1_Missense_Mutation_p.R176L|HOXB6_uc002int.1_3'UTR	NM_018952	NP_061825	P17509	HXB6_HUMAN	homeobox B6	176	Homeobox.				anterior/posterior axis specification, embryo	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	46673923	46673923	7597	17	C	A	A	27	27	HOXB6	A	1	1
SGCA	6442	broad.mit.edu	37	17	48245004	48245004	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48245004C>A	uc002iqi.2	+	3	255	c.219C>A	c.(217-219)CCC>CCA	p.P73P	SGCA_uc010wmh.1_Intron|SGCA_uc002iqj.2_Silent_p.P73P|SGCA_uc010wmi.1_RNA	NM_000023	NP_000014	Q16586	SGCA_HUMAN	sarcoglycan, alpha isoform 1 precursor	73	Extracellular (Potential).				muscle contraction|muscle organ development	cytoplasm|cytoskeleton|integral to membrane|sarcoglycan complex|sarcolemma	calcium ion binding			ovary(2)	2																		---	---	---	---	capture		Silent	SNP	48245004	48245004	14690	17	C	A	A	22	22	SGCA	A	2	2
KIF2B	84643	broad.mit.edu	37	17	51900869	51900869	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:51900869C>A	uc002iua.2	+	1	631	c.475C>A	c.(475-477)CAG>AAG	p.Q159K	uc010wna.1_RNA	NM_032559	NP_115948	Q8N4N8	KIF2B_HUMAN	kinesin family member 2B	159	Potential.				blood coagulation|cell division|microtubule depolymerization|microtubule-based movement|mitotic prometaphase|regulation of chromosome segregation	condensed chromosome kinetochore|cytosol|microtubule|microtubule organizing center|nucleolus|spindle	ATP binding|microtubule motor activity			ovary(5)|skin(3)	8																		---	---	---	---	capture		Missense_Mutation	SNP	51900869	51900869	8609	17	C	A	A	25	25	KIF2B	A	2	2
KIF2B	84643	broad.mit.edu	37	17	51901186	51901186	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:51901186C>A	uc002iua.2	+	1	948	c.792C>A	c.(790-792)TTC>TTA	p.F264L	uc010wna.1_Intron	NM_032559	NP_115948	Q8N4N8	KIF2B_HUMAN	kinesin family member 2B	264	Kinesin-motor.				blood coagulation|cell division|microtubule depolymerization|microtubule-based movement|mitotic prometaphase|regulation of chromosome segregation	condensed chromosome kinetochore|cytosol|microtubule|microtubule organizing center|nucleolus|spindle	ATP binding|microtubule motor activity			ovary(5)|skin(3)	8																		---	---	---	---	capture		Missense_Mutation	SNP	51901186	51901186	8609	17	C	A	A	32	32	KIF2B	A	2	2
MSI2	124540	broad.mit.edu	37	17	55693342	55693342	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:55693342G>C	uc002iuz.1	+	9	722	c.549G>C	c.(547-549)AAG>AAC	p.K183N	MSI2_uc010wnm.1_Missense_Mutation_p.K161N|MSI2_uc002iva.2_Missense_Mutation_p.K179N	NM_138962	NP_620412	Q96DH6	MSI2H_HUMAN	musashi 2 isoform a	183	RRM 2.					cytoplasm	nucleotide binding|RNA binding			central_nervous_system(1)|pancreas(1)	2	Breast(9;1.78e-08)			GBM - Glioblastoma multiforme(1;0.0025)				T	HOXA9	CML								---	---	---	---	capture		Missense_Mutation	SNP	55693342	55693342	10269	17	G	C	C	33	33	MSI2	C	3	3
MKS1	54903	broad.mit.edu	37	17	56293532	56293532	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56293532G>A	uc002ivr.1	-	4	409	c.334C>T	c.(334-336)CTG>TTG	p.L112L	MKS1_uc010wnq.1_5'UTR|MKS1_uc002ivs.1_Silent_p.L112L	NM_017777	NP_060247	Q9NXB0	MKS1_HUMAN	Meckel syndrome type 1 protein isoform 1	112					cilium assembly	centrosome|cilium|microtubule basal body	protein binding			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	56293532	56293532	9999	17	G	A	A	35	35	MKS1	A	2	2
MARCH10	162333	broad.mit.edu	37	17	60814365	60814365	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:60814365G>T	uc010ddr.2	-	6	1102	c.864C>A	c.(862-864)AGC>AGA	p.S288R	MARCH10_uc002jag.3_Missense_Mutation_p.S288R|MARCH10_uc010dds.2_Missense_Mutation_p.S326R|MARCH10_uc002jah.2_Missense_Mutation_p.S287R|uc002jaj.1_RNA|uc002jak.2_RNA	NM_001100875	NP_001094345	Q8NA82	MARHA_HUMAN	ring finger protein 190	288							ligase activity|zinc ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	60814365	60814365	9682	17	G	T	T	38	38	MARCH10	T	1	1
SCN4A	6329	broad.mit.edu	37	17	62049739	62049739	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:62049739C>A	uc002jds.1	-	2	442	c.365G>T	c.(364-366)CGC>CTC	p.R122L		NM_000334	NP_000325	P35499	SCN4A_HUMAN	voltage-gated sodium channel type 4 alpha	122					muscle contraction	voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(1)|pancreas(1)|skin(1)	3					Lamotrigine(DB00555)													---	---	---	---	capture		Missense_Mutation	SNP	62049739	62049739	14402	17	C	A	A	27	27	SCN4A	A	1	1
ABCA8	10351	broad.mit.edu	37	17	66878019	66878019	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66878019A>G	uc002jhp.2	-	29	3990	c.3811T>C	c.(3811-3813)TTC>CTC	p.F1271L	ABCA8_uc002jhq.2_Missense_Mutation_p.F1311L|ABCA8_uc010wqq.1_Missense_Mutation_p.F1306L	NM_007168	NP_009099	O94911	ABCA8_HUMAN	ATP-binding cassette, sub-family A member 8	1271	ABC transporter 2.					integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(2)|skin(1)	3	Breast(10;4.56e-13)																	---	---	---	---	capture		Missense_Mutation	SNP	66878019	66878019	39	17	A	G	G	3	3	ABCA8	G	4	4
ABCA9	10350	broad.mit.edu	37	17	66982358	66982358	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66982358C>A	uc002jhu.2	-	32	4298	c.4155G>T	c.(4153-4155)GTG>GTT	p.V1385V	ABCA9_uc010dez.2_Silent_p.V1347V	NM_080283	NP_525022	Q8IUA7	ABCA9_HUMAN	ATP-binding cassette, sub-family A, member 9	1385	ABC transporter 2.				transport	integral to membrane	ATP binding|ATPase activity			ovary(4)|upper_aerodigestive_tract(1)|central_nervous_system(1)	6	Breast(10;1.47e-12)																	---	---	---	---	capture		Silent	SNP	66982358	66982358	40	17	C	A	A	17	17	ABCA9	A	2	2
ABCA9	10350	broad.mit.edu	37	17	67029935	67029935	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:67029935A>T	uc002jhu.2	-	9	1351	c.1208T>A	c.(1207-1209)CTT>CAT	p.L403H	ABCA9_uc010dez.2_Missense_Mutation_p.L403H	NM_080283	NP_525022	Q8IUA7	ABCA9_HUMAN	ATP-binding cassette, sub-family A, member 9	403	Helical; (Potential).				transport	integral to membrane	ATP binding|ATPase activity			ovary(4)|upper_aerodigestive_tract(1)|central_nervous_system(1)	6	Breast(10;1.47e-12)																	---	---	---	---	capture		Missense_Mutation	SNP	67029935	67029935	40	17	A	T	T	3	3	ABCA9	T	4	4
GPR142	350383	broad.mit.edu	37	17	72368181	72368181	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:72368181G>T	uc010wqy.1	+	4	831	c.831G>T	c.(829-831)CGG>CGT	p.R277R	GPR142_uc010wqx.1_Silent_p.R189R	NM_181790	NP_861455	Q7Z601	GP142_HUMAN	G protein-coupled receptor 142	277	Cytoplasmic (Potential).					cell junction|cytoplasm|integral to membrane	G-protein coupled receptor activity			ovary(2)|central_nervous_system(1)|skin(1)	4																		---	---	---	---	capture		Silent	SNP	72368181	72368181	6924	17	G	T	T	43	43	GPR142	T	2	2
ENPP7	339221	broad.mit.edu	37	17	77704931	77704931	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:77704931G>C	uc002jxa.2	+	1	50	c.30G>C	c.(28-30)GTG>GTC	p.V10V		NM_178543	NP_848638	Q6UWV6	ENPP7_HUMAN	ectonucleotide pyrophosphatase/phosphodiesterase	10					negative regulation of cell proliferation|negative regulation of DNA replication|sphingomyelin metabolic process	Golgi apparatus|integral to membrane|microvillus	sphingomyelin phosphodiesterase activity			central_nervous_system(2)|ovary(1)	3			OV - Ovarian serous cystadenocarcinoma(97;0.016)|BRCA - Breast invasive adenocarcinoma(99;0.0224)															---	---	---	---	capture		Silent	SNP	77704931	77704931	5328	17	G	C	C	47	47	ENPP7	C	3	3
ENPP7	339221	broad.mit.edu	37	17	77711788	77711788	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:77711788G>C	uc002jxa.2	+	5	1340	c.1320G>C	c.(1318-1320)AGG>AGC	p.R440S		NM_178543	NP_848638	Q6UWV6	ENPP7_HUMAN	ectonucleotide pyrophosphatase/phosphodiesterase	440	Helical; (Potential).				negative regulation of cell proliferation|negative regulation of DNA replication|sphingomyelin metabolic process	Golgi apparatus|integral to membrane|microvillus	sphingomyelin phosphodiesterase activity			central_nervous_system(2)|ovary(1)	3			OV - Ovarian serous cystadenocarcinoma(97;0.016)|BRCA - Breast invasive adenocarcinoma(99;0.0224)															---	---	---	---	capture		Missense_Mutation	SNP	77711788	77711788	5328	17	G	C	C	42	42	ENPP7	C	3	3
RNF213	57674	broad.mit.edu	37	17	78323667	78323667	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78323667A>G	uc002jyh.1	+	5	4491	c.4268A>G	c.(4267-4269)CAG>CGG	p.Q1423R		NM_020914	NP_065965	Q9HCF4	ALO17_HUMAN	ring finger protein 213	Error:Variant_position_missing_in_Q9HCF4_after_alignment										ovary(8)|lung(6)|breast(3)|large_intestine(2)|central_nervous_system(1)|pancreas(1)	21	all_neural(118;0.0538)		BRCA - Breast invasive adenocarcinoma(99;0.0252)|OV - Ovarian serous cystadenocarcinoma(97;0.057)															---	---	---	---	capture		Missense_Mutation	SNP	78323667	78323667	13955	17	A	G	G	7	7	RNF213	G	4	4
SLC25A10	1468	broad.mit.edu	37	17	79686896	79686896	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79686896C>G	uc002kbi.2	+	10	827	c.741C>G	c.(739-741)CTC>CTG	p.L247L	SLC25A10_uc010wut.1_Silent_p.L402L|SLC25A10_uc010dif.2_Silent_p.L256L|SLC25A10_uc010wuu.1_Silent_p.L201L	NM_012140	NP_036272	Q9UBX3	DIC_HUMAN	solute carrier family 25 (mitochondrial carrier;	247	Solcar 3.				gluconeogenesis|mitochondrial transport	integral to membrane|mitochondrial inner membrane|nucleus	protein binding				0	all_neural(118;0.0878)|Ovarian(332;0.12)|all_lung(278;0.23)		BRCA - Breast invasive adenocarcinoma(99;0.0117)|OV - Ovarian serous cystadenocarcinoma(97;0.0955)		Succinic acid(DB00139)													---	---	---	---	capture		Silent	SNP	79686896	79686896	14969	17	C	G	G	31	31	SLC25A10	G	3	3
KIAA0802	23255	broad.mit.edu	37	18	8819111	8819111	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:8819111G>A	uc002knr.2	+	13	3152	c.3010G>A	c.(3010-3012)GAA>AAA	p.E1004K	KIAA0802_uc002knq.2_Missense_Mutation_p.E963K|KIAA0802_uc002kns.2_Missense_Mutation_p.E344K	NM_015210	NP_056025	Q9Y4B5	CC165_HUMAN	hypothetical protein LOC23255	1314											0																		---	---	---	---	capture		Missense_Mutation	SNP	8819111	8819111	8501	18	G	A	A	45	45	KIAA0802	A	2	2
OSBPL1A	114876	broad.mit.edu	37	18	21957471	21957471	+	Silent	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21957471A>T	uc002kve.2	-	2	201	c.27T>A	c.(25-27)CTT>CTA	p.L9L		NM_080597	NP_542164	Q9BXW6	OSBL1_HUMAN	oxysterol-binding protein-like 1A isoform B	9					cholesterol metabolic process|lipid transport|vesicle-mediated transport		phospholipid binding			ovary(4)	4	all_cancers(21;0.000396)|all_epithelial(16;4.36e-06)|Lung NSC(20;0.00171)|all_lung(20;0.0055)|Colorectal(14;0.0505)|Ovarian(20;0.17)																	---	---	---	---	capture		Silent	SNP	21957471	21957471	11688	18	A	T	T	9	9	OSBPL1A	T	4	4
DSG3	1830	broad.mit.edu	37	18	29055842	29055842	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29055842C>A	uc002kws.2	+	16	2728	c.2619C>A	c.(2617-2619)CCC>CCA	p.P873P	DSG3_uc002kwt.2_Silent_p.P155P	NM_001944	NP_001935	P32926	DSG3_HUMAN	desmoglein 3 preproprotein	873	Cytoplasmic (Potential).				cellular component disassembly involved in apoptosis|homophilic cell adhesion	cytosol|desmosome|integral to membrane	calcium ion binding			skin(4)|ovary(3)|lung(1)|central_nervous_system(1)	9			OV - Ovarian serous cystadenocarcinoma(10;0.00504)															---	---	---	---	capture		Silent	SNP	29055842	29055842	4962	18	C	A	A	24	24	DSG3	A	2	2
DSG2	1829	broad.mit.edu	37	18	29099864	29099864	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29099864G>C	uc002kwu.3	+	3	368	c.180G>C	c.(178-180)GAG>GAC	p.E60D		NM_001943	NP_001934	Q14126	DSG2_HUMAN	desmoglein 2 preproprotein	60	Extracellular (Potential).|Cadherin 1.				cellular component disassembly involved in apoptosis|homophilic cell adhesion	desmosome|integral to membrane	calcium ion binding			central_nervous_system(5)|ovary(2)|breast(1)|skin(1)	9			OV - Ovarian serous cystadenocarcinoma(10;0.0068)															---	---	---	---	capture		Missense_Mutation	SNP	29099864	29099864	4961	18	G	C	C	35	35	DSG2	C	3	3
ELP2	55250	broad.mit.edu	37	18	33725955	33725955	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:33725955G>T	uc002kzk.1	+	10	947	c.937G>T	c.(937-939)GAT>TAT	p.D313Y	ELP2_uc010xcg.1_Missense_Mutation_p.D378Y|ELP2_uc002kzl.1_RNA|ELP2_uc002kzm.1_Missense_Mutation_p.D287Y|ELP2_uc010xch.1_Missense_Mutation_p.D352Y|ELP2_uc002kzn.1_Missense_Mutation_p.D287Y|ELP2_uc002kzo.1_Missense_Mutation_p.D243Y	NM_018255	NP_060725	Q6IA86	ELP2_HUMAN	elongator protein 2	313	WD 6.				regulation of transcription from RNA polymerase II promoter	Golgi apparatus|transcription elongation factor complex				breast(2)|ovary(1)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	33725955	33725955	5272	18	G	T	T	41	41	ELP2	T	2	2
RIT2	6014	broad.mit.edu	37	18	40503725	40503725	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:40503725C>G	uc002lav.2	-	4	411	c.238G>C	c.(238-240)GAA>CAA	p.E80Q	RIT2_uc010dnf.2_Missense_Mutation_p.E80Q	NM_002930	NP_002921	Q99578	RIT2_HUMAN	Ras-like without CAAX 2	80					nerve growth factor receptor signaling pathway|small GTPase mediated signal transduction|synaptic transmission	intracellular|plasma membrane	calmodulin binding|GTP binding|GTPase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	40503725	40503725	13864	18	C	G	G	32	32	RIT2	G	3	3
FECH	2235	broad.mit.edu	37	18	55247367	55247367	+	Silent	SNP	G	A	A	rs147500247		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:55247367G>A	uc002lgq.3	-	2	249	c.132C>T	c.(130-132)GCC>GCT	p.A44A	FECH_uc002lgp.3_Silent_p.A44A|FECH_uc002lgr.3_5'UTR	NM_000140	NP_000131	P22830	HEMH_HUMAN	ferrochelatase isoform b precursor	44					generation of precursor metabolites and energy|heme biosynthetic process|protoporphyrinogen IX metabolic process|response to light stimulus	mitochondrial inner membrane|mitochondrial matrix	2 iron, 2 sulfur cluster binding|ferrochelatase activity|ferrous iron binding|protein binding			central_nervous_system(1)	1		Colorectal(73;0.227)																---	---	---	---	capture		Silent	SNP	55247367	55247367	6045	18	G	A	A	39	39	FECH	A	1	1
SERPINB12	89777	broad.mit.edu	37	18	61226897	61226897	+	Nonsense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:61226897C>G	uc010xen.1	+	3	330	c.330C>G	c.(328-330)TAC>TAG	p.Y110*	SERPINB12_uc010xeo.1_Nonsense_Mutation_p.Y130*	NM_080474	NP_536722	Q96P63	SPB12_HUMAN	serine (or cysteine) proteinase inhibitor, clade	110					negative regulation of protein catabolic process|regulation of proteolysis	cytoplasm	enzyme binding|serine-type endopeptidase inhibitor activity				0																		---	---	---	---	capture		Nonsense_Mutation	SNP	61226897	61226897	14587	18	C	G	G	17	17	SERPINB12	G	5	3
SERPINB4	6318	broad.mit.edu	37	18	61306500	61306500	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:61306500G>T	uc002ljf.2	-	7	773	c.687C>A	c.(685-687)GCC>GCA	p.A229A	SERPINB4_uc002lje.2_Silent_p.A208A|SERPINB4_uc002ljg.2_Intron	NM_002974	NP_002965	P48594	SPB4_HUMAN	serine (or cysteine) proteinase inhibitor, clade	229					immune response|regulation of proteolysis	cytoplasm|extracellular region	protein binding|serine-type endopeptidase inhibitor activity			ovary(2)|lung(1)	3																		---	---	---	---	capture		Silent	SNP	61306500	61306500	14591	18	G	T	T	47	47	SERPINB4	T	2	2
SERPINB7	8710	broad.mit.edu	37	18	61459629	61459629	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:61459629G>T	uc002ljl.2	+	3	267	c.171G>T	c.(169-171)TTG>TTT	p.L57F	SERPINB7_uc002ljm.2_Missense_Mutation_p.L57F|SERPINB7_uc010xet.1_Intron|SERPINB7_uc010dqg.2_Missense_Mutation_p.L57F	NM_001040147	NP_001035237	O75635	SPB7_HUMAN	serine (or cysteine) proteinase inhibitor, clade	57					regulation of proteolysis	cytoplasm	serine-type endopeptidase inhibitor activity			lung(2)|central_nervous_system(1)	3		Esophageal squamous(42;0.129)																---	---	---	---	capture		Missense_Mutation	SNP	61459629	61459629	14594	18	G	T	T	46	46	SERPINB7	T	2	2
NETO1	81832	broad.mit.edu	37	18	70532107	70532107	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:70532107G>T	uc002lkw.2	-	3	440	c.156C>A	c.(154-156)ATC>ATA	p.I52I	NETO1_uc002lkx.1_Silent_p.I51I|NETO1_uc002lky.1_Silent_p.I52I|NETO1_uc002lkz.2_Silent_p.I51I	NM_138966	NP_620416	Q8TDF5	NETO1_HUMAN	neuropilin- and tolloid-like protein 1 isoform 3	52	CUB 1.|Extracellular (Potential).				memory|regulation of long-term neuronal synaptic plasticity|visual learning	cell junction|excitatory synapse|extracellular region|integral to membrane|postsynaptic density|postsynaptic membrane	receptor activity			ovary(2)|skin(2)	4		Esophageal squamous(42;0.129)		READ - Rectum adenocarcinoma(1;0.0487)														---	---	---	---	capture		Silent	SNP	70532107	70532107	10738	18	G	T	T	33	33	NETO1	T	2	2
TSHZ1	10194	broad.mit.edu	37	18	72998837	72998837	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:72998837G>T	uc002lly.2	+	2	1903	c.1340G>T	c.(1339-1341)GGG>GTG	p.G447V		NM_005786	NP_005777	Q6ZSZ6	TSH1_HUMAN	teashirt family zinc finger 1	492						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Esophageal squamous(42;0.129)|Prostate(75;0.142)|Melanoma(33;0.211)		Colorectal(1;0.000501)|READ - Rectum adenocarcinoma(2;0.00226)|BRCA - Breast invasive adenocarcinoma(31;0.246)														---	---	---	---	capture		Missense_Mutation	SNP	72998837	72998837	17174	18	G	T	T	43	43	TSHZ1	T	2	2
ZNF236	7776	broad.mit.edu	37	18	74631815	74631815	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74631815G>T	uc002lmi.2	+	20	3550	c.3352G>T	c.(3352-3354)GAG>TAG	p.E1118*	ZNF236_uc002lmj.2_RNA	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	1118					cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)														---	---	---	---	capture		Nonsense_Mutation	SNP	74631815	74631815	18380	18	G	T	T	41	41	ZNF236	T	5	2
C18orf22	79863	broad.mit.edu	37	18	77794505	77794505	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77794505G>T	uc002lns.2	+	1	148	c.10G>T	c.(10-12)GCG>TCG	p.A4S	TXNL4A_uc010drg.2_5'Flank|C18orf22_uc010drh.2_Missense_Mutation_p.A4S|C18orf22_uc010dri.1_RNA	NM_024805	NP_079081	Q8N0V3	RBFA_HUMAN	hypothetical protein LOC79863 precursor	4					rRNA processing	mitochondrion					0		all_cancers(4;3.21e-14)|all_epithelial(4;7.11e-09)|all_lung(4;0.00366)|Lung NSC(4;0.00683)|Esophageal squamous(42;0.0212)|Ovarian(4;0.0545)|all_hematologic(56;0.15)|Melanoma(33;0.2)		OV - Ovarian serous cystadenocarcinoma(15;6.46e-08)|BRCA - Breast invasive adenocarcinoma(31;0.00376)														---	---	---	---	capture		Missense_Mutation	SNP	77794505	77794505	1959	18	G	T	T	46	46	C18orf22	T	2	2
MIER2	54531	broad.mit.edu	37	19	313641	313641	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:313641A>G	uc002lok.1	-	8	667	c.658T>C	c.(658-660)TAC>CAC	p.Y220H		NM_017550	NP_060020	Q8N344	MIER2_HUMAN	mesoderm induction early response 1, family	220	ELM2.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding				0		all_cancers(10;1.05e-30)|all_epithelial(18;3.04e-19)|Acute lymphoblastic leukemia(61;4.36e-14)|all_hematologic(61;4.84e-09)|Lung NSC(49;2.49e-05)|all_lung(49;4.36e-05)|Breast(49;0.000304)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Missense_Mutation	SNP	313641	313641	9971	19	A	G	G	15	15	MIER2	G	4	4
ABCA7	10347	broad.mit.edu	37	19	1043053	1043053	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1043053G>T	uc002lqw.3	+	8	824	c.593G>T	c.(592-594)CGC>CTC	p.R198L	ABCA7_uc010dsb.1_Missense_Mutation_p.R60L	NM_019112	NP_061985	Q8IZY2	ABCA7_HUMAN	ATP-binding cassette, sub-family A, member 7	198	Extracellular (By similarity).				phagocytosis|transmembrane transport	ATP-binding cassette (ABC) transporter complex|endosome membrane|Golgi membrane|integral to membrane|plasma membrane	ATP binding|ATPase activity|transporter activity			pancreas(7)|ovary(1)|central_nervous_system(1)	9		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.04e-05)|all_lung(49;1.53e-05)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Missense_Mutation	SNP	1043053	1043053	38	19	G	T	T	38	38	ABCA7	T	1	1
ABCA7	10347	broad.mit.edu	37	19	1056367	1056367	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1056367C>G	uc002lqw.3	+	33	4686	c.4455C>G	c.(4453-4455)GCC>GCG	p.A1485A	ABCA7_uc002lqy.2_5'Flank|ABCA7_uc010dsc.2_5'Flank	NM_019112	NP_061985	Q8IZY2	ABCA7_HUMAN	ATP-binding cassette, sub-family A, member 7	1485	Extracellular (By similarity).				phagocytosis|transmembrane transport	ATP-binding cassette (ABC) transporter complex|endosome membrane|Golgi membrane|integral to membrane|plasma membrane	ATP binding|ATPase activity|transporter activity			pancreas(7)|ovary(1)|central_nervous_system(1)	9		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.04e-05)|all_lung(49;1.53e-05)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Silent	SNP	1056367	1056367	38	19	C	G	G	24	24	ABCA7	G	3	3
C19orf29	58509	broad.mit.edu	37	19	3611925	3611925	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3611925C>A	uc002lyh.2	-	10	2326	c.2273G>T	c.(2272-2274)CGG>CTG	p.R758L	C19orf29_uc010xho.1_Missense_Mutation_p.R217L|C19orf29_uc010dtn.2_Missense_Mutation_p.R606L|C19orf29_uc002lyi.3_Missense_Mutation_p.R758L|C19orf29_uc010dto.2_RNA	NM_001080543	NP_001074012	Q8WUQ7	CS029_HUMAN	chromosome 19 open reading frame 29	758						catalytic step 2 spliceosome	protein binding				0		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.00253)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---	capture		Missense_Mutation	SNP	3611925	3611925	1981	19	C	A	A	23	23	C19orf29	A	1	1
ZNRF4	148066	broad.mit.edu	37	19	5456134	5456134	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5456134C>T	uc002mca.3	+	1	709	c.632C>T	c.(631-633)TCA>TTA	p.S211L		NM_181710	NP_859061	Q8WWF5	ZNRF4_HUMAN	zinc and ring finger 4 precursor	211	Extracellular (Potential).|PA.					integral to membrane	zinc ion binding			large_intestine(2)	2				UCEC - Uterine corpus endometrioid carcinoma (162;0.0002)														---	---	---	---	capture		Missense_Mutation	SNP	5456134	5456134	18818	19	C	T	T	29	29	ZNRF4	T	2	2
SAFB2	9667	broad.mit.edu	37	19	5622569	5622569	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5622569T>A	uc002mcd.2	-	1	370	c.158A>T	c.(157-159)AAG>ATG	p.K53M	SAFB_uc010xiq.1_5'Flank|SAFB_uc002mcf.2_5'Flank|SAFB_uc002mcg.2_5'Flank|SAFB_uc002mce.3_5'Flank|SAFB_uc010xir.1_5'Flank|SAFB_uc010xis.1_5'Flank|SAFB_uc010xit.1_5'Flank|SAFB_uc010xiu.1_5'Flank|SAFB2_uc010xio.1_Missense_Mutation_p.K53M|SAFB2_uc010xip.1_RNA	NM_014649	NP_055464	Q14151	SAFB2_HUMAN	scaffold attachment factor B2	53	SAP.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|nucleotide binding|protein binding|RNA binding				0				UCEC - Uterine corpus endometrioid carcinoma (162;0.000228)														---	---	---	---	capture		Missense_Mutation	SNP	5622569	5622569	14287	19	T	A	A	56	56	SAFB2	A	4	4
FBN3	84467	broad.mit.edu	37	19	8175984	8175984	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8175984C>G	uc002mjf.2	-	32	4189	c.4168G>C	c.(4168-4170)GAG>CAG	p.E1390Q		NM_032447	NP_115823	Q75N90	FBN3_HUMAN	fibrillin 3 precursor	1390	EGF-like 21; calcium-binding.					proteinaceous extracellular matrix	calcium ion binding|extracellular matrix structural constituent			ovary(6)|skin(3)|pancreas(1)|central_nervous_system(1)	11																		---	---	---	---	capture		Missense_Mutation	SNP	8175984	8175984	5940	19	C	G	G	29	29	FBN3	G	3	3
ACTL9	284382	broad.mit.edu	37	19	8808237	8808237	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8808237G>T	uc002mkl.2	-	1	936	c.815C>A	c.(814-816)CCG>CAG	p.P272Q		NM_178525	NP_848620	Q8TC94	ACTL9_HUMAN	actin-like 9	272						cytoplasm|cytoskeleton				large_intestine(2)|pancreas(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	8808237	8808237	204	19	G	T	T	39	39	ACTL9	T	1	1
MUC16	94025	broad.mit.edu	37	19	9010658	9010658	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9010658G>A	uc002mkp.2	-	38	39207	c.39003C>T	c.(39001-39003)CCC>CCT	p.P13001P	MUC16_uc010xki.1_Intron	NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	13003	Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---	capture		Silent	SNP	9010658	9010658	10367	19	G	A	A	47	47	MUC16	A	2	2
MUC16	94025	broad.mit.edu	37	19	9069470	9069470	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9069470C>A	uc002mkp.2	-	3	18180	c.17976G>T	c.(17974-17976)GAG>GAT	p.E5992D		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	5994	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---	capture		Missense_Mutation	SNP	9069470	9069470	10367	19	C	A	A	32	32	MUC16	A	2	2
MUC16	94025	broad.mit.edu	37	19	9083474	9083474	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9083474C>G	uc002mkp.2	-	1	8545	c.8341G>C	c.(8341-8343)GAG>CAG	p.E2781Q		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	2781	Ser-rich.|Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---	capture		Missense_Mutation	SNP	9083474	9083474	10367	19	C	G	G	29	29	MUC16	G	3	3
COL5A3	50509	broad.mit.edu	37	19	10076996	10076996	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10076996A>T	uc002mmq.1	-	64	4862	c.4776T>A	c.(4774-4776)TTT>TTA	p.F1592L		NM_015719	NP_056534	P25940	CO5A3_HUMAN	collagen, type V, alpha 3 preproprotein	1592	Fibrillar collagen NC1.				collagen fibril organization|skin development	collagen type V	collagen binding|extracellular matrix structural constituent			ovary(7)|lung(1)|central_nervous_system(1)|skin(1)	10			Epithelial(33;7.11e-05)															---	---	---	---	capture		Missense_Mutation	SNP	10076996	10076996	3836	19	A	T	T	5	5	COL5A3	T	4	4
SLC44A2	57153	broad.mit.edu	37	19	10753987	10753987	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10753987G>A	uc002mpf.2	+	22	2186	c.2047G>A	c.(2047-2049)GAG>AAG	p.E683K	SLC44A2_uc002mpe.3_Missense_Mutation_p.E681K|SLC44A2_uc002mpg.1_3'UTR|SLC44A2_uc002mph.2_Missense_Mutation_p.E232K|SLC44A2_uc002mpi.2_3'UTR	NM_020428	NP_065161	Q8IWA5	CTL2_HUMAN	solute carrier family 44, member 2 isoform 1	683	Cytoplasmic (Potential).				positive regulation of I-kappaB kinase/NF-kappaB cascade	integral to membrane|plasma membrane	choline transmembrane transporter activity|signal transducer activity			ovary(1)	1			Epithelial(33;8.7e-06)|all cancers(31;2.77e-05)		Choline(DB00122)													---	---	---	---	capture		Missense_Mutation	SNP	10753987	10753987	15133	19	G	A	A	37	37	SLC44A2	A	1	1
DNASE2	1777	broad.mit.edu	37	19	12989370	12989370	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12989370G>T	uc002mvn.1	-	5	681	c.535C>A	c.(535-537)CCC>ACC	p.P179T	DNASE2_uc010xmr.1_Missense_Mutation_p.P124T	NM_001375	NP_001366	O00115	DNS2A_HUMAN	deoxyribonuclease II, lysosomal precursor	179					apoptosis	lysosome	deoxyribonuclease II activity|DNA binding|protein binding				0													Direct_reversal_of_damage					---	---	---	---	capture		Missense_Mutation	SNP	12989370	12989370	4847	19	G	T	T	43	43	DNASE2	T	2	2
SLC1A6	6511	broad.mit.edu	37	19	15072908	15072908	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15072908C>G	uc002naa.1	-	5	849	c.841G>C	c.(841-843)GTC>CTC	p.V281L	SLC1A6_uc010dzu.1_Missense_Mutation_p.V281L|SLC1A6_uc010xod.1_Missense_Mutation_p.V217L|SLC1A6_uc002nab.2_Missense_Mutation_p.V281L|SLC1A6_uc002nac.2_Missense_Mutation_p.V281L	NM_005071	NP_005062	P48664	EAA4_HUMAN	solute carrier family 1 (high affinity	281	Helical; (Potential).				synaptic transmission	integral to plasma membrane|membrane fraction	high-affinity glutamate transmembrane transporter activity|L-aspartate transmembrane transporter activity|sodium:dicarboxylate symporter activity			pancreas(3)|ovary(2)|skin(1)	6					L-Glutamic Acid(DB00142)													---	---	---	---	capture		Missense_Mutation	SNP	15072908	15072908	14932	19	C	G	G	18	18	SLC1A6	G	3	3
CCDC105	126402	broad.mit.edu	37	19	15133834	15133834	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15133834G>A	uc002nae.2	+	7	1502	c.1403G>A	c.(1402-1404)CGG>CAG	p.R468Q		NM_173482	NP_775753	Q8IYK2	CC105_HUMAN	coiled-coil domain containing 105	468					microtubule cytoskeleton organization	microtubule				ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	15133834	15133834	2860	19	G	A	A	39	39	CCDC105	A	1	1
OR10H5	284433	broad.mit.edu	37	19	15905716	15905716	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15905716C>A	uc010xos.1	+	1	858	c.858C>A	c.(856-858)CTC>CTA	p.L286L		NM_001004466	NP_001004466	Q8NGA6	O10H5_HUMAN	olfactory receptor, family 10, subfamily H,	286	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	15905716	15905716	11315	19	C	A	A	29	29	OR10H5	A	2	2
MYO9B	4650	broad.mit.edu	37	19	17212909	17212909	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17212909C>A	uc010eak.2	+	2	534	c.382C>A	c.(382-384)CAG>AAG	p.Q128K	MYO9B_uc002nfi.2_Missense_Mutation_p.Q128K|MYO9B_uc002nfj.1_Missense_Mutation_p.Q128K	NM_004145	NP_004136	Q13459	MYO9B_HUMAN	myosin IXB isoform 1	128	Myosin head-like.				actin filament-based movement	cell cortex|cytosol|filamentous actin|myosin complex|perinuclear region of cytoplasm	actin binding|ADP binding|ATP binding|ATPase activity|calmodulin binding|metal ion binding|microfilament motor activity|Rho GTPase activator activity			breast(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	17212909	17212909	10480	19	C	A	A	25	25	MYO9B	A	2	2
B3GNT3	10331	broad.mit.edu	37	19	17922653	17922653	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17922653G>A	uc002nhk.1	+	3	926	c.841G>A	c.(841-843)GCT>ACT	p.A281T	B3GNT3_uc002nhl.1_Missense_Mutation_p.A281T|B3GNT3_uc010ebd.1_Missense_Mutation_p.A281T|B3GNT3_uc010ebe.1_Missense_Mutation_p.A281T	NM_014256	NP_055071	Q9Y2A9	B3GN3_HUMAN	UDP-GlcNAc:betaGal	281	Lumenal (Potential).				protein glycosylation	Golgi membrane|integral to plasma membrane	galactosyltransferase activity			upper_aerodigestive_tract(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	17922653	17922653	1279	19	G	A	A	38	38	B3GNT3	A	1	1
ZNF208	7757	broad.mit.edu	37	19	22156135	22156135	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22156135G>T	uc002nqp.2	-	5	1550	c.1401C>A	c.(1399-1401)ACC>ACA	p.T467T	ZNF208_uc002nqo.1_Intron	NM_007153	NP_009084			zinc finger protein 208											ovary(5)|skin(2)	7		all_lung(12;0.0961)|Lung NSC(12;0.103)																---	---	---	---	capture		Silent	SNP	22156135	22156135	18357	19	G	T	T	43	43	ZNF208	T	2	2
ZNF536	9745	broad.mit.edu	37	19	31040208	31040208	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:31040208G>T	uc002nsu.1	+	4	3820	c.3682G>T	c.(3682-3684)GCA>TCA	p.A1228S	ZNF536_uc010edd.1_Missense_Mutation_p.A1228S	NM_014717	NP_055532	O15090	ZN536_HUMAN	zinc finger protein 536	1228					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(7)|large_intestine(2)|skin(2)	11	Esophageal squamous(110;0.0834)																	---	---	---	---	capture		Missense_Mutation	SNP	31040208	31040208	18568	19	G	T	T	34	34	ZNF536	T	2	2
TSHZ3	57616	broad.mit.edu	37	19	31767965	31767965	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:31767965C>A	uc002nsy.3	-	2	2799	c.2734G>T	c.(2734-2736)GCC>TCC	p.A912S		NM_020856	NP_065907	Q63HK5	TSH3_HUMAN	zinc finger protein 537	912	Homeobox; atypical.				negative regulation of transcription, DNA-dependent|regulation of respiratory gaseous exchange by neurological system process	growth cone|nucleus	chromatin binding|protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)|skin(2)|pancreas(1)|lung(1)	8	Esophageal squamous(110;0.226)																	---	---	---	---	capture		Missense_Mutation	SNP	31767965	31767965	17176	19	C	A	A	27	27	TSHZ3	A	1	1
CEBPA	1050	broad.mit.edu	37	19	33792245	33792245	+	Nonstop_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33792245C>G	uc002nun.2	-	1	1186	c.1076G>C	c.(1075-1077)TGA>TCA	p.*359S	LOC80054_uc002nuo.2_5'Flank	NM_004364	NP_004355	P49715	CEBPA_HUMAN	CCAAT/enhancer binding protein alpha	359					cytokine-mediated signaling pathway|generation of precursor metabolites and energy|interspecies interaction between organisms|positive regulation of transcription from RNA polymerase III promoter		sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|transcription factor binding|transcription regulatory region DNA binding	p.?(5)		haematopoietic_and_lymphoid_tissue(728)|lung(4)|stomach(1)|prostate(1)	734	Esophageal squamous(110;0.137)							Mis|N|F		AML|MDS				Acute_Myeloid_Leukemia_Familial_associated_with_CEBPA_germline_mutation				---	---	---	---	capture		Nonstop_Mutation	SNP	33792245	33792245	3332	19	C	G	G	29	29	CEBPA	G	5	3
PEPD	5184	broad.mit.edu	37	19	33984220	33984220	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33984220C>A	uc002nur.3	-	5	552	c.417G>T	c.(415-417)CAG>CAT	p.Q139H	PEPD_uc010xrr.1_Missense_Mutation_p.Q139H|PEPD_uc010xrs.1_Missense_Mutation_p.Q75H	NM_000285	NP_000276	P12955	PEPD_HUMAN	prolidase isoform 1	139					cellular amino acid metabolic process|collagen catabolic process|proteolysis		aminopeptidase activity|dipeptidase activity|manganese ion binding|metallocarboxypeptidase activity			ovary(2)	2	Esophageal squamous(110;0.137)																	---	---	---	---	capture		Missense_Mutation	SNP	33984220	33984220	12149	19	C	A	A	32	32	PEPD	A	2	2
HAUS5	23354	broad.mit.edu	37	19	36110360	36110360	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36110360A>G	uc002oam.1	+	14	1265	c.1214A>G	c.(1213-1215)AAG>AGG	p.K405R		NM_015302	NP_056117	O94927	HAUS5_HUMAN	HAUS augmin-like complex, subunit 5	405					cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|spindle					0																		---	---	---	---	capture		Missense_Mutation	SNP	36110360	36110360	7251	19	A	G	G	3	3	HAUS5	G	4	4
SARS2	54938	broad.mit.edu	37	19	39421117	39421117	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39421117G>A	uc002oka.2	-	1	420	c.260C>T	c.(259-261)CCC>CTC	p.P87L	SARS2_uc002ojz.2_5'Flank|SARS2_uc010xup.1_Missense_Mutation_p.P87L|SARS2_uc002okb.2_Missense_Mutation_p.P87L|SARS2_uc010xuq.1_Intron|SARS2_uc010xur.1_RNA|SARS2_uc010xus.1_Missense_Mutation_p.P87L|MRPS12_uc002okc.2_5'Flank|MRPS12_uc002okd.2_5'Flank|MRPS12_uc002oke.2_5'Flank	NM_017827	NP_060297	Q9NP81	SYSM_HUMAN	seryl-tRNA synthetase 2 isoform b precursor	87					seryl-tRNA aminoacylation	mitochondrial matrix	ATP binding|protein binding|serine-tRNA ligase activity			ovary(1)|pancreas(1)|skin(1)	3	all_cancers(60;2.74e-06)|all_epithelial(25;4.36e-06)|Ovarian(47;0.0454)		Lung(45;0.000419)|LUSC - Lung squamous cell carcinoma(53;0.000554)													OREG0032101|OREG0025455	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)|type=REGULATORY REGION|TFbs=RELA|Dataset=RELA (p65) ChIP-PET Binding Sites|EvidenceSubtype=Chromatin immunoprecipitation with paired-end diTag sequencing (ChIP-PET)	---	---	---	---	capture		Missense_Mutation	SNP	39421117	39421117	14326	19	G	A	A	43	43	SARS2	A	2	2
SHKBP1	92799	broad.mit.edu	37	19	41083301	41083301	+	Splice_Site	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41083301G>T	uc002oob.2	+	3	190	c.141_splice	c.e3-1	p.S47_splice	SHKBP1_uc002ooc.2_Splice_Site_p.S47_splice|SHKBP1_uc002ood.2_Splice_Site_p.S47_splice|SHKBP1_uc010xvl.1_Splice_Site|SHKBP1_uc002ooe.2_5'UTR|SHKBP1_uc002oof.2_5'Flank|SHKBP1_uc010xvm.1_5'Flank|SHKBP1_uc010xvn.1_5'Flank	NM_138392	NP_612401			SH3KBP1 binding protein 1							voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(1)|pancreas(1)	2			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)															---	---	---	---	capture		Splice_Site	SNP	41083301	41083301	14779	19	G	T	T	36	36	SHKBP1	T	5	2
ADCK4	79934	broad.mit.edu	37	19	41220008	41220008	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41220008G>A	uc002oor.2	-	4	555	c.253C>T	c.(253-255)CCT>TCT	p.P85S	ADCK4_uc002ooq.1_Missense_Mutation_p.P85S|ADCK4_uc002oos.2_Missense_Mutation_p.P85S|ITPKC_uc002oot.2_5'Flank	NM_024876	NP_079152	Q96D53	ADCK4_HUMAN	aarF domain containing kinase 4 isoform a	85						integral to membrane	protein serine/threonine kinase activity				0			Lung(22;9.49e-05)|LUSC - Lung squamous cell carcinoma(20;0.000219)															---	---	---	---	capture		Missense_Mutation	SNP	41220008	41220008	291	19	G	A	A	42	42	ADCK4	A	2	2
PHLDB3	653583	broad.mit.edu	37	19	44001416	44001416	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44001416C>A	uc002own.3	-	6	938	c.679G>T	c.(679-681)GAT>TAT	p.D227Y	PHLDB3_uc010eit.2_5'Flank|PHLDB3_uc002owo.2_Missense_Mutation_p.D227Y	NM_198850	NP_942147	Q6NSJ2	PHLB3_HUMAN	pleckstrin homology-like domain, family B,	227	Potential.										0		Prostate(69;0.0153)																---	---	---	---	capture		Missense_Mutation	SNP	44001416	44001416	12277	19	C	A	A	30	30	PHLDB3	A	2	2
PLAUR	5329	broad.mit.edu	37	19	44159726	44159726	+	Splice_Site	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44159726C>T	uc002oxf.1	-	5	703	c.473_splice	c.e5-1	p.G158_splice	PLAUR_uc002oxd.1_Splice_Site_p.G158_splice|PLAUR_uc002oxe.1_Splice_Site_p.G153_splice|PLAUR_uc002oxg.1_Intron	NM_002659	NP_002650			plasminogen activator, urokinase receptor						attachment of GPI anchor to protein|blood coagulation|C-terminal protein lipidation|cellular component movement|chemotaxis|fibrinolysis|regulation of proteolysis	anchored to membrane|cell surface|endoplasmic reticulum lumen|endoplasmic reticulum membrane|extracellular region|extrinsic to membrane|integral to membrane|plasma membrane	enzyme binding|U-plasminogen activator receptor activity			ovary(1)	1		Prostate(69;0.0153)			Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Streptokinase(DB00086)|Tenecteplase(DB00031)|Urokinase(DB00013)													---	---	---	---	capture		Splice_Site	SNP	44159726	44159726	12449	19	C	T	T	24	24	PLAUR	T	5	2
IRGC	56269	broad.mit.edu	37	19	44223323	44223323	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44223323G>C	uc002oxh.2	+	2	760	c.613G>C	c.(613-615)GCC>CCC	p.A205P		NM_019612	NP_062558	Q6NXR0	IIGP5_HUMAN	immunity-related GTPase family, cinema	205						membrane	GTP binding|hydrolase activity, acting on acid anhydrides			ovary(1)|central_nervous_system(1)|skin(1)	3		Prostate(69;0.0435)																---	---	---	---	capture		Missense_Mutation	SNP	44223323	44223323	8141	19	G	C	C	42	42	IRGC	C	3	3
ZNF222	7673	broad.mit.edu	37	19	44537160	44537160	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44537160T>C	uc002oyc.2	+	4	1516	c.1333T>C	c.(1333-1335)TCA>CCA	p.S445P	ZNF284_uc010ejd.2_Intron|ZNF222_uc002oye.2_Missense_Mutation_p.S485P|ZNF222_uc002oyd.2_Missense_Mutation_p.S391P	NM_013360	NP_037492	Q9UK12	ZN222_HUMAN	zinc finger protein 222 isoform 2	445					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)	3		Prostate(69;0.0435)																---	---	---	---	capture		Missense_Mutation	SNP	44537160	44537160	18367	19	T	C	C	50	50	ZNF222	C	4	4
MYADM	91663	broad.mit.edu	37	19	54377402	54377402	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54377402G>T	uc002qcl.2	+	3	767	c.619G>T	c.(619-621)GTG>TTG	p.V207L	MYADM_uc002qcm.2_Missense_Mutation_p.V207L|MYADM_uc002qcn.2_Missense_Mutation_p.V207L|MYADM_uc002qco.2_Missense_Mutation_p.V207L|MYADM_uc002qcp.2_Missense_Mutation_p.V207L	NM_001020820	NP_001018656	Q96S97	MYADM_HUMAN	myeloid-associated differentiation marker	207	MARVEL 2.|Helical; (Potential).					integral to membrane				ovary(1)	1	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(134;0.0488)														---	---	---	---	capture		Missense_Mutation	SNP	54377402	54377402	10400	19	G	T	T	40	40	MYADM	T	1	1
LILRB2	10288	broad.mit.edu	37	19	54782788	54782788	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54782788C>T	uc002qfb.2	-	6	1100	c.834G>A	c.(832-834)CAG>CAA	p.Q278Q	LILRA6_uc002qew.1_Intron|LILRB2_uc010eri.2_Silent_p.Q278Q|LILRB2_uc010erj.2_RNA|LILRB2_uc002qfc.2_Silent_p.Q278Q|LILRB2_uc010yet.1_Silent_p.Q162Q|LILRB2_uc010yeu.1_RNA	NM_005874	NP_005865	Q8N423	LIRB2_HUMAN	leukocyte immunoglobulin-like receptor,	278	Extracellular (Potential).|Ig-like C2-type 3.				cell surface receptor linked signaling pathway|cell-cell signaling|cellular defense response|immune response|regulation of immune response	integral to plasma membrane|membrane fraction	receptor activity			skin(1)	1	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.105)														---	---	---	---	capture		Silent	SNP	54782788	54782788	9117	19	C	T	T	24	24	LILRB2	T	2	2
LILRA3	11026	broad.mit.edu	37	19	54803513	54803513	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54803513G>C	uc002qfd.2	-	3	376	c.311C>G	c.(310-312)ACT>AGT	p.T104S	LILRA6_uc002qew.1_Intron|LILRA3_uc010erk.2_Missense_Mutation_p.T104S	NM_006865	NP_006856	Q8N6C8	LIRA3_HUMAN	leukocyte immunoglobulin-like receptor,	104	Ig-like C2-type 1.				defense response	extracellular region|plasma membrane	antigen binding|receptor activity			ovary(1)	1	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.105)														---	---	---	---	capture		Missense_Mutation	SNP	54803513	54803513	9112	19	G	C	C	36	36	LILRA3	C	3	3
LILRA4	23547	broad.mit.edu	37	19	54848834	54848834	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54848834G>A	uc002qfj.2	-	5	846	c.789C>T	c.(787-789)CTC>CTT	p.L263L	LILRA4_uc002qfi.2_Silent_p.L197L	NM_012276	NP_036408	P59901	LIRA4_HUMAN	leukocyte immunoglobulin-like receptor subfamily	263	Extracellular (Potential).|Ig-like C2-type 3.					integral to membrane	receptor activity			upper_aerodigestive_tract(1)|central_nervous_system(1)	2	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.0565)														---	---	---	---	capture		Silent	SNP	54848834	54848834	9113	19	G	A	A	41	41	LILRA4	A	2	2
LILRA2	11027	broad.mit.edu	37	19	55086444	55086444	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55086444C>T	uc002qgg.3	+	4	688	c.599C>T	c.(598-600)TCG>TTG	p.S200L	LILRA2_uc010ern.2_Missense_Mutation_p.S200L|LILRA2_uc002qgf.2_Missense_Mutation_p.S200L|LILRA2_uc010yfe.1_Missense_Mutation_p.S200L|LILRA2_uc010yff.1_Missense_Mutation_p.S188L|LILRA2_uc010ero.2_Missense_Mutation_p.S188L|LILRA2_uc010yfg.1_Missense_Mutation_p.S200L	NM_001130917	NP_001124389	Q8N149	LIRA2_HUMAN	leukocyte immunoglobulin-like receptor,	200	Extracellular (Potential).|Ig-like C2-type 2.				defense response	integral to membrane	antigen binding|receptor activity			ovary(1)	1				GBM - Glioblastoma multiforme(193;0.0963)														---	---	---	---	capture		Missense_Mutation	SNP	55086444	55086444	9111	19	C	T	T	31	31	LILRA2	T	1	1
LILRA2	11027	broad.mit.edu	37	19	55087395	55087395	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55087395G>T	uc002qgg.3	+	6	1163	c.1074G>T	c.(1072-1074)GAG>GAT	p.E358D	LILRA2_uc010ern.2_Missense_Mutation_p.E358D|LILRA2_uc002qgf.2_Missense_Mutation_p.E358D|LILRA2_uc010yfe.1_Missense_Mutation_p.E358D|LILRA2_uc010yff.1_Missense_Mutation_p.E346D|LILRA2_uc010ero.2_Missense_Mutation_p.E346D|LILRA2_uc010yfg.1_Intron	NM_001130917	NP_001124389	Q8N149	LIRA2_HUMAN	leukocyte immunoglobulin-like receptor,	358	Ig-like C2-type 4.|Extracellular (Potential).				defense response	integral to membrane	antigen binding|receptor activity			ovary(1)	1				GBM - Glioblastoma multiforme(193;0.0963)														---	---	---	---	capture		Missense_Mutation	SNP	55087395	55087395	9111	19	G	T	T	35	35	LILRA2	T	2	2
ZSCAN5B	342933	broad.mit.edu	37	19	56701752	56701752	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56701752G>T	uc010ygh.1	-	4	932	c.932C>A	c.(931-933)CCT>CAT	p.P311H		NM_001080456	NP_001073925	A6NJL1	ZSA5B_HUMAN	zinc finger and SCAN domain containing 5B	311					viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	56701752	56701752	18843	19	G	T	T	35	35	ZSCAN5B	T	2	2
PEG3	5178	broad.mit.edu	37	19	57327351	57327351	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57327351G>T	uc002qnu.2	-	7	2810	c.2459C>A	c.(2458-2460)GCT>GAT	p.A820D	ZIM2_uc010ygq.1_Intron|ZIM2_uc010ygr.1_Intron|ZIM2_uc002qnr.2_Intron|ZIM2_uc002qnq.2_Intron|ZIM2_uc010etp.2_Intron|ZIM2_uc010ygs.1_Intron|PEG3_uc002qnt.2_Missense_Mutation_p.A791D|PEG3_uc002qnv.2_Missense_Mutation_p.A820D|PEG3_uc002qnw.2_Missense_Mutation_p.A696D|PEG3_uc002qnx.2_Missense_Mutation_p.A694D|PEG3_uc010etr.2_Missense_Mutation_p.A820D	NM_001146186	NP_001139658	Q9GZU2	PEG3_HUMAN	paternally expressed 3 isoform 1	820					apoptosis|viral reproduction	cytoplasm|nucleus	nucleic acid binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(7)|skin(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	12		Colorectal(82;0.000256)|all_neural(62;0.103)|Ovarian(87;0.243)		GBM - Glioblastoma multiforme(193;0.0269)														---	---	---	---	capture		Missense_Mutation	SNP	57327351	57327351	12141	19	G	T	T	34	34	PEG3	T	2	2
PEG3	5178	broad.mit.edu	37	19	57328094	57328094	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57328094G>C	uc002qnu.2	-	7	2067	c.1716C>G	c.(1714-1716)TTC>TTG	p.F572L	ZIM2_uc010ygq.1_Intron|ZIM2_uc010ygr.1_Intron|ZIM2_uc002qnr.2_Intron|ZIM2_uc002qnq.2_Intron|ZIM2_uc010etp.2_Intron|ZIM2_uc010ygs.1_Intron|PEG3_uc002qnt.2_Missense_Mutation_p.F543L|PEG3_uc002qnv.2_Missense_Mutation_p.F572L|PEG3_uc002qnw.2_Missense_Mutation_p.F448L|PEG3_uc002qnx.2_Missense_Mutation_p.F446L|PEG3_uc010etr.2_Missense_Mutation_p.F572L	NM_001146186	NP_001139658	Q9GZU2	PEG3_HUMAN	paternally expressed 3 isoform 1	572	C2H2-type 3.				apoptosis|viral reproduction	cytoplasm|nucleus	nucleic acid binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(7)|skin(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	12		Colorectal(82;0.000256)|all_neural(62;0.103)|Ovarian(87;0.243)		GBM - Glioblastoma multiforme(193;0.0269)														---	---	---	---	capture		Missense_Mutation	SNP	57328094	57328094	12141	19	G	C	C	41	41	PEG3	C	3	3
ZNF749	388567	broad.mit.edu	37	19	57955212	57955212	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57955212G>A	uc002qoq.2	+	3	950	c.696G>A	c.(694-696)TTG>TTA	p.L232L	ZNF547_uc002qpm.3_Intron	NM_001023561	NP_001018855	O43361	ZN749_HUMAN	zinc finger protein 749	232	C2H2-type 3; degenerate.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.221)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0264)|Lung(386;0.177)														---	---	---	---	capture		Silent	SNP	57955212	57955212	18729	19	G	A	A	48	48	ZNF749	A	2	2
ZNF530	348327	broad.mit.edu	37	19	58118382	58118382	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58118382G>A	uc002qpk.2	+	3	1709	c.1489G>A	c.(1489-1491)GGG>AGG	p.G497R	ZNF547_uc002qpm.3_Intron|ZNF530_uc002qpl.2_RNA	NM_020880	NP_065931	Q6P9A1	ZN530_HUMAN	zinc finger protein 530	497	C2H2-type 10.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Colorectal(82;5.46e-05)|all_neural(62;0.0218)|Ovarian(87;0.0443)|Breast(46;0.0848)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0257)														---	---	---	---	capture		Missense_Mutation	SNP	58118382	58118382	18565	19	G	A	A	47	47	ZNF530	A	2	2
TMEM18	129787	broad.mit.edu	37	2	675608	675608	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:675608C>A	uc002qwl.2	-	2	174	c.80G>T	c.(79-81)TGG>TTG	p.W27L	TMEM18_uc002qwk.2_RNA|uc002qwm.1_5'Flank	NM_152834	NP_690047	Q96B42	TMM18_HUMAN	transmembrane protein 18	27	Helical; (Potential).				cell migration	integral to membrane|nuclear membrane				ovary(1)	1	all_hematologic(175;0.0429)|Acute lymphoblastic leukemia(172;0.0627)	all_cancers(51;5.27e-05)|all_epithelial(98;2.11e-06)|Ovarian(717;0.0253)		all cancers(51;1.95e-21)|Epithelial(75;9.47e-21)|OV - Ovarian serous cystadenocarcinoma(76;8.15e-18)|GBM - Glioblastoma multiforme(21;0.0285)														---	---	---	---	capture		Missense_Mutation	SNP	675608	675608	16632	2	C	A	A	21	21	TMEM18	A	2	2
MYT1L	23040	broad.mit.edu	37	2	1926494	1926494	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1926494C>T	uc002qxe.2	-	10	1874	c.1047G>A	c.(1045-1047)AGG>AGA	p.R349R	MYT1L_uc002qxd.2_Silent_p.R349R|MYT1L_uc010ewl.1_RNA	NM_015025	NP_055840	Q9UL68	MYT1L_HUMAN	myelin transcription factor 1-like	349					cell differentiation|nervous system development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(5)|central_nervous_system(1)	6	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.037)|all_epithelial(98;0.241)		OV - Ovarian serous cystadenocarcinoma(76;0.169)|all cancers(51;0.244)														---	---	---	---	capture		Silent	SNP	1926494	1926494	10502	2	C	T	T	30	30	MYT1L	T	2	2
MYT1L	23040	broad.mit.edu	37	2	1927027	1927027	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1927027G>A	uc002qxe.2	-	10	1341	c.514C>T	c.(514-516)CAA>TAA	p.Q172*	MYT1L_uc002qxd.2_Nonsense_Mutation_p.Q172*|MYT1L_uc010ewl.1_RNA	NM_015025	NP_055840	Q9UL68	MYT1L_HUMAN	myelin transcription factor 1-like	172					cell differentiation|nervous system development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(5)|central_nervous_system(1)	6	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.037)|all_epithelial(98;0.241)		OV - Ovarian serous cystadenocarcinoma(76;0.169)|all cancers(51;0.244)														---	---	---	---	capture		Nonsense_Mutation	SNP	1927027	1927027	10502	2	G	A	A	45	45	MYT1L	A	5	2
KCNS3	3790	broad.mit.edu	37	2	18113462	18113462	+	Nonsense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:18113462T>A	uc002rcv.2	+	3	1638	c.1187T>A	c.(1186-1188)TTG>TAG	p.L396*	KCNS3_uc002rcw.2_Nonsense_Mutation_p.L396*	NM_002252	NP_002243	Q9BQ31	KCNS3_HUMAN	potassium voltage-gated channel	396	Helical; Name=Segment S6; (Potential).				energy reserve metabolic process|regulation of insulin secretion	Golgi apparatus|voltage-gated potassium channel complex	delayed rectifier potassium channel activity|potassium channel regulator activity			ovary(4)	4	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.158)																	---	---	---	---	capture		Nonsense_Mutation	SNP	18113462	18113462	8395	2	T	A	A	63	63	KCNS3	A	5	4
NT5C1B	93034	broad.mit.edu	37	2	18765908	18765908	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:18765908G>A	uc002rcz.2	-	5	879	c.775C>T	c.(775-777)CTG>TTG	p.L259L	NT5C1B_uc002rcy.2_Silent_p.L259L|NT5C1B_uc010exr.2_Silent_p.L201L|NT5C1B_uc010yju.1_Silent_p.L199L|NT5C1B_uc002rda.2_Silent_p.L199L|NT5C1B_uc010yjv.1_Silent_p.L276L|NT5C1B_uc010yjw.1_Silent_p.L242L|NT5C1B_uc010exs.2_Silent_p.L261L|NT5C1B_uc002rdb.1_Silent_p.L51L	NM_001002006	NP_001002006	Q96P26	5NT1B_HUMAN	5' nucleotidase, cytosolic IB isoform 1	259					purine base metabolic process|purine nucleotide catabolic process	cytosol	5'-nucleotidase activity|magnesium ion binding|nucleotide binding			skin(2)|ovary(1)	3	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.177)	Ovarian(717;0.208)																---	---	---	---	capture		Silent	SNP	18765908	18765908	11091	2	G	A	A	34	34	NT5C1B	A	2	2
APOB	338	broad.mit.edu	37	2	21234330	21234330	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:21234330T>C	uc002red.2	-	26	5538	c.5410A>G	c.(5410-5412)AAT>GAT	p.N1804D		NM_000384	NP_000375	P04114	APOB_HUMAN	apolipoprotein B precursor	1804					cholesterol homeostasis|cholesterol metabolic process|leukocyte migration|low-density lipoprotein particle clearance|low-density lipoprotein particle remodeling|platelet activation|positive regulation of cholesterol storage|positive regulation of macrophage derived foam cell differentiation|receptor-mediated endocytosis|response to virus	chylomicron remnant|clathrin-coated endocytic vesicle membrane|endoplasmic reticulum lumen|endoplasmic reticulum membrane|endosome lumen|endosome membrane|intermediate-density lipoprotein particle|low-density lipoprotein particle|mature chylomicron|microsome|plasma membrane|very-low-density lipoprotein particle	cholesterol transporter activity|enzyme binding|heparin binding|low-density lipoprotein particle receptor binding|phospholipid binding|protein heterodimerization activity			ovary(11)|skin(9)|central_nervous_system(3)|large_intestine(2)|upper_aerodigestive_tract(1)|pancreas(1)	27	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				Atorvastatin(DB01076)													---	---	---	---	capture		Missense_Mutation	SNP	21234330	21234330	796	2	T	C	C	63	63	APOB	C	4	4
ADCY3	109	broad.mit.edu	37	2	25061456	25061456	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:25061456A>T	uc002rfs.3	-	7	1590	c.1391T>A	c.(1390-1392)CTG>CAG	p.L464Q	ADCY3_uc002rfr.3_Missense_Mutation_p.L97Q|ADCY3_uc010ykm.1_Missense_Mutation_p.L464Q	NM_004036	NP_004027	O60266	ADCY3_HUMAN	adenylate cyclase 3	464	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|sensory perception of smell|synaptic transmission|transmembrane transport|water transport	cytoplasm|integral to plasma membrane	ATP binding|calmodulin binding|metal ion binding			breast(3)|ovary(1)	4	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.203)																	---	---	---	---	capture		Missense_Mutation	SNP	25061456	25061456	296	2	A	T	T	7	7	ADCY3	T	4	4
HADHA	3030	broad.mit.edu	37	2	26424190	26424190	+	Splice_Site	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:26424190C>G	uc002rgy.2	-	13	1351	c.1221_splice	c.e13-1	p.G407_splice	HADHA_uc010yks.1_Splice_Site_p.G320_splice	NM_000182	NP_000173			mitochondrial trifunctional protein, alpha						fatty acid beta-oxidation	fatty acid beta-oxidation multienzyme complex|mitochondrial nucleoid|nucleolus	3-hydroxyacyl-CoA dehydrogenase activity|acetyl-CoA C-acetyltransferase activity|coenzyme binding|enoyl-CoA hydratase activity|long-chain-3-hydroxyacyl-CoA dehydrogenase activity|protein binding			ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				NADH(DB00157)													---	---	---	---	capture		Splice_Site	SNP	26424190	26424190	7225	2	C	G	G	32	32	HADHA	G	5	3
DPYSL5	56896	broad.mit.edu	37	2	27167686	27167686	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27167686C>A	uc002rhu.3	+	12	1761	c.1603C>A	c.(1603-1605)CTC>ATC	p.L535I	DPYSL5_uc002rhv.3_Missense_Mutation_p.L535I	NM_020134	NP_064519	Q9BPU6	DPYL5_HUMAN	dihydropyrimidinase-like 5	535					axon guidance|pyrimidine base catabolic process|signal transduction	cytosol	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides			ovary(2)	2	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---	capture		Missense_Mutation	SNP	27167686	27167686	4934	2	C	A	A	24	24	DPYSL5	A	2	2
AGBL5	60509	broad.mit.edu	37	2	27293106	27293106	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27293106C>A	uc002rie.2	+	15	2853	c.2636C>A	c.(2635-2637)CCA>CAA	p.P879Q	AGBL5_uc002rif.2_RNA	NM_021831	NP_068603	Q8NDL9	CBPC5_HUMAN	ATP/GTP binding protein-like 5 isoform 1	879					protein branching point deglutamylation|proteolysis	cytosol|nucleus	metallocarboxypeptidase activity|tubulin binding|zinc ion binding			ovary(1)|breast(1)	2	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---	capture		Missense_Mutation	SNP	27293106	27293106	381	2	C	A	A	21	21	AGBL5	A	2	2
GTF3C2	2976	broad.mit.edu	37	2	27552333	27552333	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27552333G>C	uc002rjv.1	-	14	2153	c.1790C>G	c.(1789-1791)TCT>TGT	p.S597C	GTF3C2_uc010eyy.1_Missense_Mutation_p.S52C|GTF3C2_uc002rju.1_Missense_Mutation_p.S608C|GTF3C2_uc002rjw.1_Missense_Mutation_p.S597C	NM_001521	NP_001512	Q8WUA4	TF3C2_HUMAN	general transcription factor IIIC, polypeptide	597						transcription factor TFIIIC complex				ovary(1)|skin(1)	2	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---	capture		Missense_Mutation	SNP	27552333	27552333	7153	2	G	C	C	33	33	GTF3C2	C	3	3
IFT172	26160	broad.mit.edu	37	2	27684180	27684180	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27684180C>G	uc002rku.2	-	22	2449	c.2398G>C	c.(2398-2400)GAA>CAA	p.E800Q		NM_015662	NP_056477	Q9UG01	IF172_HUMAN	selective LIM binding factor homolog	800					cilium assembly	cilium	binding			large_intestine(1)|ovary(1)	2	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---	capture		Missense_Mutation	SNP	27684180	27684180	7858	2	C	G	G	32	32	IFT172	G	3	3
CAPN13	92291	broad.mit.edu	37	2	30998812	30998812	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:30998812C>G	uc002rnn.2	-	4	547	c.371G>C	c.(370-372)GGC>GCC	p.G124A	CAPN13_uc002rnp.1_Missense_Mutation_p.G124A	NM_144575	NP_653176	Q6MZZ7	CAN13_HUMAN	calpain 13	124	Calpain catalytic.				proteolysis	intracellular	calcium ion binding|calcium-dependent cysteine-type endopeptidase activity			large_intestine(1)|ovary(1)	2	all_hematologic(175;0.0487)|Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---	capture		Missense_Mutation	SNP	30998812	30998812	2743	2	C	G	G	26	26	CAPN13	G	3	3
LTBP1	4052	broad.mit.edu	37	2	33500942	33500942	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:33500942G>T	uc002ros.2	+	18	2947	c.2947G>T	c.(2947-2949)GAA>TAA	p.E983*	LTBP1_uc002rot.2_Nonsense_Mutation_p.E657*|LTBP1_uc002rou.2_Nonsense_Mutation_p.E656*|LTBP1_uc002rov.2_Nonsense_Mutation_p.E603*|LTBP1_uc010ymz.1_Nonsense_Mutation_p.E656*|LTBP1_uc010yna.1_Nonsense_Mutation_p.E603*	NM_206943	NP_996826	Q14766	LTBP1_HUMAN	latent transforming growth factor beta binding	982	EGF-like 6; calcium-binding (Potential).				negative regulation of transforming growth factor beta receptor signaling pathway by extracellular sequestering of TGFbeta	proteinaceous extracellular matrix	calcium ion binding|growth factor binding|transforming growth factor beta receptor activity			ovary(3)|skin(2)|upper_aerodigestive_tract(1)|lung(1)|central_nervous_system(1)	8	all_hematologic(175;0.115)	Medulloblastoma(90;0.215)																---	---	---	---	capture		Nonsense_Mutation	SNP	33500942	33500942	9449	2	G	T	T	45	45	LTBP1	T	5	2
VIT	5212	broad.mit.edu	37	2	37002155	37002155	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:37002155G>A	uc002rpl.2	+	9	968	c.747G>A	c.(745-747)AGG>AGA	p.R249R	VIT_uc002rpm.2_Silent_p.R242R|VIT_uc010ezv.2_Intron|VIT_uc010ezw.2_Silent_p.R242R	NM_053276	NP_444506	Q6UXI7	VITRN_HUMAN	vitrin	249						proteinaceous extracellular matrix				ovary(1)|pancreas(1)	2		all_hematologic(82;0.248)																---	---	---	---	capture		Silent	SNP	37002155	37002155	17738	2	G	A	A	42	42	VIT	A	2	2
DHX57	90957	broad.mit.edu	37	2	39089399	39089399	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:39089399C>A	uc002rrf.2	-	4	559	c.460G>T	c.(460-462)GAA>TAA	p.E154*	DHX57_uc002rre.2_5'UTR|DHX57_uc002rrg.2_Nonsense_Mutation_p.E154*	NM_198963	NP_945314	Q6P158	DHX57_HUMAN	DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57	154							ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding|zinc ion binding			ovary(1)|lung(1)|skin(1)	3		all_hematologic(82;0.248)																---	---	---	---	capture		Nonsense_Mutation	SNP	39089399	39089399	4692	2	C	A	A	30	30	DHX57	A	5	2
SRBD1	55133	broad.mit.edu	37	2	45832512	45832512	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:45832512T>A	uc002rus.2	-	2	145	c.69A>T	c.(67-69)TCA>TCT	p.S23S		NM_018079	NP_060549	Q8N5C6	SRBD1_HUMAN	S1 RNA binding domain 1	23					nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		hydrolase activity, acting on ester bonds|RNA binding			central_nervous_system(1)	1		all_hematologic(82;0.166)|Acute lymphoblastic leukemia(82;0.17)	LUSC - Lung squamous cell carcinoma(58;0.0917)|Lung(47;0.154)															---	---	---	---	capture		Silent	SNP	45832512	45832512	15647	2	T	A	A	51	51	SRBD1	A	4	4
KLRAQ1	129285	broad.mit.edu	37	2	48713811	48713811	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48713811G>C	uc002rwm.2	+	14	1545	c.1360G>C	c.(1360-1362)GAA>CAA	p.E454Q	KLRAQ1_uc002rwj.2_Missense_Mutation_p.E454Q|KLRAQ1_uc002rwl.2_Missense_Mutation_p.E408Q|KLRAQ1_uc002rwk.2_Missense_Mutation_p.E454Q|KLRAQ1_uc010yok.1_Missense_Mutation_p.E454Q	NM_001135629	NP_001129101	Q6ZMI0	KLRAQ_HUMAN	KLRAQ motif containing 1 isoform 1	454										ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	48713811	48713811	8727	2	G	C	C	45	45	KLRAQ1	C	3	3
FSHR	2492	broad.mit.edu	37	2	49190184	49190184	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:49190184G>T	uc002rww.2	-	10	1850	c.1776C>A	c.(1774-1776)GCC>GCA	p.A592A	FSHR_uc002rwx.2_Silent_p.A530A|FSHR_uc010fbn.2_Silent_p.A566A	NM_000145	NP_000136	P23945	FSHR_HUMAN	follicle stimulating hormone receptor isoform 1	592	Helical; Name=6; (Potential).				female gamete generation|male gonad development|spermatogenesis	integral to membrane|plasma membrane	follicle-stimulating hormone receptor activity|protein binding			ovary(4)|lung(2)|central_nervous_system(1)|skin(1)	8		all_hematologic(82;0.152)|Acute lymphoblastic leukemia(82;0.181)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)		Choriogonadotropin alfa(DB00097)|Follitropin beta(DB00066)|Menotropins(DB00032)|Urofollitropin(DB00094)									Gonadal_Dysgenesis_46_XX				---	---	---	---	capture		Silent	SNP	49190184	49190184	6324	2	G	T	T	47	47	FSHR	T	2	2
NRXN1	9378	broad.mit.edu	37	2	50699459	50699459	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:50699459C>A	uc010fbq.2	-	16	4818	c.3341G>T	c.(3340-3342)GGA>GTA	p.G1114V	NRXN1_uc002rxb.3_Missense_Mutation_p.G746V|NRXN1_uc002rxe.3_Missense_Mutation_p.G1074V|NRXN1_uc002rxc.1_RNA	NM_001135659	NP_001129131	P58400	NRX1B_HUMAN	neurexin 1 isoform alpha2 precursor	Error:Variant_position_missing_in_P58400_after_alignment					angiogenesis|neuron cell-cell adhesion|neuronal signal transduction	cell surface|endocytic vesicle|integral to membrane|presynaptic membrane	cell adhesion molecule binding|receptor binding			ovary(2)	2		all_hematologic(82;0.152)|Acute lymphoblastic leukemia(82;0.192)	Lung(47;0.0813)|LUSC - Lung squamous cell carcinoma(58;0.116)															---	---	---	---	capture		Missense_Mutation	SNP	50699459	50699459	11070	2	C	A	A	30	30	NRXN1	A	2	2
GPR75	10936	broad.mit.edu	37	2	54080608	54080608	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:54080608G>A	uc002rxo.3	-	2	1557	c.1286C>T	c.(1285-1287)TCT>TTT	p.S429F	ASB3_uc002rxi.3_Intron	NM_006794	NP_006785	O95800	GPR75_HUMAN	G protein-coupled receptor 75	429	Cytoplasmic (Potential).					integral to plasma membrane	G-protein coupled receptor activity			ovary(1)|skin(1)	2			Lung(47;0.125)|LUSC - Lung squamous cell carcinoma(58;0.181)															---	---	---	---	capture		Missense_Mutation	SNP	54080608	54080608	6983	2	G	A	A	33	33	GPR75	A	2	2
PAPOLG	64895	broad.mit.edu	37	2	61002258	61002258	+	Nonsense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61002258C>T	uc002sai.2	+	8	925	c.694C>T	c.(694-696)CGA>TGA	p.R232*	PAPOLG_uc002saj.2_Translation_Start_Site|PAPOLG_uc002sak.2_Translation_Start_Site	NM_022894	NP_075045	Q9BWT3	PAPOG_HUMAN	poly(A) polymerase gamma	232					mRNA processing|RNA polyadenylation|transcription, DNA-dependent	nucleus	ATP binding|metal ion binding|polynucleotide adenylyltransferase activity|RNA binding			ovary(1)|central_nervous_system(1)	2	all_hematologic(2;0.0797)		LUSC - Lung squamous cell carcinoma(5;1.19e-07)|Lung(5;2.86e-06)|Epithelial(17;0.0768)															---	---	---	---	capture		Nonsense_Mutation	SNP	61002258	61002258	11848	2	C	T	T	19	19	PAPOLG	T	5	1
EHBP1	23301	broad.mit.edu	37	2	63176204	63176204	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:63176204G>A	uc002sby.2	+	14	2810	c.2328G>A	c.(2326-2328)AAG>AAA	p.K776K	EHBP1_uc010fcp.2_Silent_p.K741K|EHBP1_uc002sbz.2_Silent_p.K741K|EHBP1_uc002scb.2_Silent_p.K741K	NM_015252	NP_056067	Q8NDI1	EHBP1_HUMAN	EH domain binding protein 1 isoform 1	776						cytoplasm|membrane				ovary(1)|breast(1)	2	Lung NSC(7;0.0951)|all_lung(7;0.169)		LUSC - Lung squamous cell carcinoma(7;7.74e-05)|Epithelial(17;0.189)											Hereditary_Prostate_Cancer				---	---	---	---	capture		Silent	SNP	63176204	63176204	5164	2	G	A	A	33	33	EHBP1	A	2	2
ARHGAP25	9938	broad.mit.edu	37	2	69046400	69046400	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:69046400G>T	uc002seu.2	+	9	1510	c.1146G>T	c.(1144-1146)TGG>TGT	p.W382C	ARHGAP25_uc010fdg.2_Missense_Mutation_p.W383C|ARHGAP25_uc010yql.1_Missense_Mutation_p.W343C|ARHGAP25_uc002sev.2_Missense_Mutation_p.W376C|ARHGAP25_uc002sew.2_Missense_Mutation_p.W375C|ARHGAP25_uc002sex.2_Missense_Mutation_p.W376C|ARHGAP25_uc002sey.2_Missense_Mutation_p.W109C	NM_001007231	NP_001007232	P42331	RHG25_HUMAN	Rho GTPase activating protein 25 isoform a	382					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(2)|breast(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	69046400	69046400	886	2	G	T	T	43	43	ARHGAP25	T	2	2
ANTXR1	84168	broad.mit.edu	37	2	69409643	69409643	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:69409643G>T	uc002sfg.2	+	16	1560	c.1204G>T	c.(1204-1206)GGC>TGC	p.G402C		NM_032208	NP_115584	Q9H6X2	ANTR1_HUMAN	anthrax toxin receptor 1 isoform 1 precursor	402	Cytoplasmic (Potential).				actin cytoskeleton reorganization|substrate adhesion-dependent cell spreading	filopodium membrane|integral to membrane|lamellipodium membrane	actin filament binding|collagen binding|metal ion binding|protein binding|transmembrane receptor activity			ovary(2)|skin(2)	4														Familial_Infantile_Hemangioma				---	---	---	---	capture		Missense_Mutation	SNP	69409643	69409643	719	2	G	T	T	43	43	ANTXR1	T	2	2
ASPRV1	151516	broad.mit.edu	37	2	70187820	70187820	+	Nonsense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:70187820G>C	uc002sfz.3	-	1	1578	c.1001C>G	c.(1000-1002)TCA>TGA	p.S334*		NM_152792	NP_690005	Q53RT3	APRV1_HUMAN	aspartic peptidase, retroviral-like 1 precursor	334	Extracellular (Potential).				protein maturation by peptide bond cleavage|skin development		aspartic-type endopeptidase activity			ovary(1)	1																		---	---	---	---	capture		Nonsense_Mutation	SNP	70187820	70187820	1077	2	G	C	C	45	45	ASPRV1	C	5	3
MCEE	84693	broad.mit.edu	37	2	71351516	71351516	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71351516C>A	uc002shs.2	-	2	243	c.198G>T	c.(196-198)AAG>AAT	p.K66N		NM_032601	NP_115990	Q96PE7	MCEE_HUMAN	methylmalonyl CoA epimerase precursor	66					fatty acid beta-oxidation|L-methylmalonyl-CoA metabolic process	mitochondrial matrix	methylmalonyl-CoA epimerase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	71351516	71351516	9766	2	C	A	A	32	32	MCEE	A	2	2
DYSF	8291	broad.mit.edu	37	2	71838380	71838380	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71838380G>T	uc002sie.2	+	37	4285	c.3909G>T	c.(3907-3909)GAG>GAT	p.E1303D	DYSF_uc010feg.2_Missense_Mutation_p.E1334D|DYSF_uc010feh.2_Missense_Mutation_p.E1289D|DYSF_uc002sig.3_Missense_Mutation_p.E1289D|DYSF_uc010yqx.1_RNA|DYSF_uc010fee.2_Missense_Mutation_p.E1303D|DYSF_uc010fef.2_Missense_Mutation_p.E1320D|DYSF_uc010fei.2_Missense_Mutation_p.E1320D|DYSF_uc010fek.2_Missense_Mutation_p.E1321D|DYSF_uc010fej.2_Missense_Mutation_p.E1290D|DYSF_uc010fel.2_Missense_Mutation_p.E1290D|DYSF_uc010feo.2_Missense_Mutation_p.E1335D|DYSF_uc010fem.2_Missense_Mutation_p.E1304D|DYSF_uc010fen.2_Missense_Mutation_p.E1321D|DYSF_uc002sif.2_Missense_Mutation_p.E1304D|DYSF_uc010yqy.1_Missense_Mutation_p.E184D|DYSF_uc010yqz.1_Missense_Mutation_p.E43D	NM_003494	NP_003485	O75923	DYSF_HUMAN	dysferlin isoform 8	1303	Cytoplasmic (Potential).					cytoplasmic vesicle membrane|integral to membrane|sarcolemma	calcium-dependent phospholipid binding			ovary(3)|breast(2)|pancreas(1)|skin(1)	7																		---	---	---	---	capture		Missense_Mutation	SNP	71838380	71838380	5045	2	G	T	T	35	35	DYSF	T	2	2
CCT7	10574	broad.mit.edu	37	2	73476157	73476157	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73476157C>G	uc002siz.2	+	8	924	c.822C>G	c.(820-822)CTC>CTG	p.L274L	CCT7_uc002sja.2_Silent_p.L70L|CCT7_uc010yrf.1_Silent_p.L230L|CCT7_uc010feu.2_Silent_p.L232L|CCT7_uc010yrg.1_Silent_p.L174L|CCT7_uc010yrh.1_Silent_p.L146L|CCT7_uc010yri.1_Silent_p.L187L	NM_006429	NP_006420	Q99832	TCPH_HUMAN	chaperonin containing TCP1, subunit 7 isoform a	274					'de novo' posttranslational protein folding		ATP binding|unfolded protein binding				0																		---	---	---	---	capture		Silent	SNP	73476157	73476157	3086	2	C	G	G	32	32	CCT7	G	3	3
ACTG2	72	broad.mit.edu	37	2	74141957	74141957	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74141957G>T	uc002sjw.2	+	7	886	c.764G>T	c.(763-765)CGC>CTC	p.R255L	ACTG2_uc010fey.2_Missense_Mutation_p.R255L|ACTG2_uc010yrn.1_Missense_Mutation_p.R212L	NM_001615	NP_001606	P63267	ACTH_HUMAN	actin, gamma 2 propeptide	255					muscle contraction	cytoskeleton|cytosol	ATP binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	74141957	74141957	198	2	G	T	T	38	38	ACTG2	T	1	1
LRRTM4	80059	broad.mit.edu	37	2	77745792	77745792	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:77745792T>A	uc002snr.2	-	3	1618	c.1203A>T	c.(1201-1203)ACA>ACT	p.T401T	LRRTM4_uc002snq.2_Silent_p.T401T|LRRTM4_uc002sns.2_Silent_p.T401T|LRRTM4_uc002snt.2_Silent_p.T402T	NM_001134745	NP_001128217	Q86VH4	LRRT4_HUMAN	leucine rich repeat transmembrane neuronal 4	401	Extracellular (Potential).					integral to membrane				pancreas(3)|ovary(1)	4				Colorectal(11;0.059)														---	---	---	---	capture		Silent	SNP	77745792	77745792	9418	2	T	A	A	59	59	LRRTM4	A	4	4
REG1A	5967	broad.mit.edu	37	2	79347993	79347993	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:79347993T>A	uc002snz.2	+	2	109	c.6T>A	c.(4-6)GCT>GCA	p.A2A	REG1A_uc010ffx.1_Silent_p.A2A|REG1A_uc010ysd.1_Silent_p.A2A	NM_002909	NP_002900	P05451	REG1A_HUMAN	regenerating islet-derived 1 alpha precursor	2					positive regulation of cell proliferation	extracellular region	growth factor activity|sugar binding				0																		---	---	---	---	capture		Silent	SNP	79347993	79347993	13679	2	T	A	A	54	54	REG1A	A	4	4
ZAP70	7535	broad.mit.edu	37	2	98351741	98351741	+	Missense_Mutation	SNP	C	A	A	rs56202620		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:98351741C>A	uc002syd.1	+	10	1318	c.1111C>A	c.(1111-1113)CTG>ATG	p.L371M	ZAP70_uc010yvf.1_3'UTR|ZAP70_uc002sye.1_Missense_Mutation_p.L261M|ZAP70_uc002syf.1_Missense_Mutation_p.L64M	NM_001079	NP_001070	P43403	ZAP70_HUMAN	zeta-chain associated protein kinase 70kDa	371	Protein kinase.				immune response|intracellular protein kinase cascade|positive thymic T cell selection|T cell receptor signaling pathway	cytosol|T cell receptor complex	ATP binding|non-membrane spanning protein tyrosine kinase activity			lung(4)|upper_aerodigestive_tract(1)|ovary(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	98351741	98351741	18097	2	C	A	A	28	28	ZAP70	A	2	2
MRPL30	51263	broad.mit.edu	37	2	99812039	99812039	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:99812039C>G	uc002szu.2	+	6	519	c.357C>G	c.(355-357)ATC>ATG	p.I119M	MRPL30_uc002szl.1_RNA|MRPL30_uc002szt.1_RNA|MRPL30_uc002szv.2_Missense_Mutation_p.I119M	NM_145213	NP_660214	Q8TCC3	RM30_HUMAN	RecName: Full=39S ribosomal protein L30, mitochondrial;          Short=L30mt; AltName: Full=MRP-L30; AltName: Full=MRP-L28; Flags: Precursor;	119					translation	mitochondrion|ribosome	structural constituent of ribosome			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	99812039	99812039	10187	2	C	G	G	29	29	MRPL30	G	3	3
NPAS2	4862	broad.mit.edu	37	2	101592003	101592003	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:101592003G>T	uc002tap.1	+	14	1652	c.1366G>T	c.(1366-1368)GGG>TGG	p.G456W	NPAS2_uc010yvt.1_Missense_Mutation_p.G521W|NPAS2_uc010fit.1_Missense_Mutation_p.G34W	NM_002518	NP_002509	Q99743	NPAS2_HUMAN	neuronal PAS domain protein 2	456					central nervous system development|positive regulation of transcription from RNA polymerase II promoter|rhythmic process	transcription factor complex	DNA binding|Hsp90 protein binding|sequence-specific DNA binding transcription factor activity|signal transducer activity			ovary(3)|upper_aerodigestive_tract(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	101592003	101592003	10967	2	G	T	T	39	39	NPAS2	T	1	1
SLC5A7	60482	broad.mit.edu	37	2	108618456	108618456	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:108618456C>T	uc002tdv.2	+	6	977	c.701C>T	c.(700-702)TCA>TTA	p.S234L	SLC5A7_uc010ywm.1_5'UTR|SLC5A7_uc010fjj.2_Missense_Mutation_p.S234L|SLC5A7_uc010ywn.1_Missense_Mutation_p.S121L	NM_021815	NP_068587	Q9GZV3	SC5A7_HUMAN	solute carrier family 5 (choline transporter),	234	Cytoplasmic (Potential).				acetylcholine biosynthetic process|neurotransmitter secretion	integral to membrane|plasma membrane	choline:sodium symporter activity			ovary(2)|central_nervous_system(1)|skin(1)	4					Choline(DB00122)													---	---	---	---	capture		Missense_Mutation	SNP	108618456	108618456	15167	2	C	T	T	29	29	SLC5A7	T	2	2
SLC5A7	60482	broad.mit.edu	37	2	108626752	108626752	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:108626752C>A	uc002tdv.2	+	9	1454	c.1178C>A	c.(1177-1179)ACA>AAA	p.T393K	SLC5A7_uc010ywm.1_Missense_Mutation_p.T146K|SLC5A7_uc010fjj.2_Missense_Mutation_p.T393K|SLC5A7_uc010ywn.1_Missense_Mutation_p.T280K	NM_021815	NP_068587	Q9GZV3	SC5A7_HUMAN	solute carrier family 5 (choline transporter),	393	Helical; (Potential).				acetylcholine biosynthetic process|neurotransmitter secretion	integral to membrane|plasma membrane	choline:sodium symporter activity			ovary(2)|central_nervous_system(1)|skin(1)	4					Choline(DB00122)													---	---	---	---	capture		Missense_Mutation	SNP	108626752	108626752	15167	2	C	A	A	17	17	SLC5A7	A	2	2
SH3RF3	344558	broad.mit.edu	37	2	110049062	110049062	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:110049062G>C	uc010ywt.1	+	6	1509	c.1509G>C	c.(1507-1509)AAG>AAC	p.K503N		NM_001099289	NP_001092759	Q8TEJ3	SH3R3_HUMAN	SH3 domain containing ring finger 3	503	SH3 3.						zinc ion binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	110049062	110049062	14752	2	G	C	C	35	35	SH3RF3	C	3	3
CNTNAP5	129684	broad.mit.edu	37	2	124999952	124999952	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:124999952A>T	uc002tno.2	+	3	727	c.363A>T	c.(361-363)AAA>AAT	p.K121N	CNTNAP5_uc010flu.2_Missense_Mutation_p.K121N	NM_130773	NP_570129	Q8WYK1	CNTP5_HUMAN	contactin associated protein-like 5 precursor	121	F5/8 type C.|Extracellular (Potential).				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(10)	10				BRCA - Breast invasive adenocarcinoma(221;0.248)														---	---	---	---	capture		Missense_Mutation	SNP	124999952	124999952	3788	2	A	T	T	2	2	CNTNAP5	T	4	4
CNTNAP5	129684	broad.mit.edu	37	2	125281886	125281886	+	Missense_Mutation	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:125281886A>C	uc002tno.2	+	9	1695	c.1331A>C	c.(1330-1332)AAC>ACC	p.N444T	CNTNAP5_uc010flu.2_Missense_Mutation_p.N445T	NM_130773	NP_570129	Q8WYK1	CNTP5_HUMAN	contactin associated protein-like 5 precursor	444	Laminin G-like 2.|Extracellular (Potential).				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(10)	10				BRCA - Breast invasive adenocarcinoma(221;0.248)														---	---	---	---	capture		Missense_Mutation	SNP	125281886	125281886	3788	2	A	C	C	2	2	CNTNAP5	C	4	4
CNTNAP5	129684	broad.mit.edu	37	2	125530503	125530503	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:125530503C>A	uc002tno.2	+	17	3022	c.2658C>A	c.(2656-2658)ACC>ACA	p.T886T	CNTNAP5_uc010flu.2_Silent_p.T887T	NM_130773	NP_570129	Q8WYK1	CNTP5_HUMAN	contactin associated protein-like 5 precursor	886	Laminin G-like 3.|Extracellular (Potential).				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(10)	10				BRCA - Breast invasive adenocarcinoma(221;0.248)														---	---	---	---	capture		Silent	SNP	125530503	125530503	3788	2	C	A	A	24	24	CNTNAP5	A	2	2
CNTNAP5	129684	broad.mit.edu	37	2	125669111	125669111	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:125669111C>T	uc002tno.2	+	23	4084	c.3720C>T	c.(3718-3720)ATC>ATT	p.I1240I	CNTNAP5_uc010flu.2_Silent_p.I1241I	NM_130773	NP_570129	Q8WYK1	CNTP5_HUMAN	contactin associated protein-like 5 precursor	1240	Helical; (Potential).				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(10)	10				BRCA - Breast invasive adenocarcinoma(221;0.248)														---	---	---	---	capture		Silent	SNP	125669111	125669111	3788	2	C	T	T	31	31	CNTNAP5	T	1	1
GPR148	344561	broad.mit.edu	37	2	131487661	131487661	+	Missense_Mutation	SNP	C	T	T	rs147627830		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:131487661C>T	uc002trv.1	+	1	939	c.937C>T	c.(937-939)CGT>TGT	p.R313C		NM_207364	NP_997247	Q8TDV2	GP148_HUMAN	G protein-coupled receptor 148	313	Helical; Name=7; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			skin(1)	1	Colorectal(110;0.1)																	---	---	---	---	capture		Missense_Mutation	SNP	131487661	131487661	6928	2	C	T	T	23	23	GPR148	T	1	1
THSD7B	80731	broad.mit.edu	37	2	137814637	137814637	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:137814637G>T	uc002tva.1	+	2	694	c.694G>T	c.(694-696)GGA>TGA	p.G232*	THSD7B_uc010zbj.1_RNA|THSD7B_uc002tvb.2_Nonsense_Mutation_p.G122*	NM_001080427	NP_001073896			thrombospondin, type I, domain containing 7B											ovary(4)|central_nervous_system(2)|pancreas(1)	7				BRCA - Breast invasive adenocarcinoma(221;0.19)														---	---	---	---	capture		Nonsense_Mutation	SNP	137814637	137814637	16408	2	G	T	T	39	39	THSD7B	T	5	1
LRP1B	53353	broad.mit.edu	37	2	142004852	142004852	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:142004852T>A	uc002tvj.1	-	5	1507	c.535A>T	c.(535-537)AGT>TGT	p.S179C	LRP1B_uc010fnl.1_Intron	NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	179	Extracellular (Potential).|EGF-like 2; calcium-binding (Potential).				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)											TSP Lung(27;0.18)			---	---	---	---	capture		Missense_Mutation	SNP	142004852	142004852	9328	2	T	A	A	55	55	LRP1B	A	4	4
EPC2	26122	broad.mit.edu	37	2	149539297	149539297	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:149539297A>T	uc010zbt.1	+	11	1832	c.1805A>T	c.(1804-1806)CAG>CTG	p.Q602L		NM_015630	NP_056445	Q52LR7	EPC2_HUMAN	enhancer of polycomb homolog 2	602	Gln-rich.				chromatin modification|DNA repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(1)|breast(1)|pancreas(1)	3				BRCA - Breast invasive adenocarcinoma(221;0.0516)														---	---	---	---	capture		Missense_Mutation	SNP	149539297	149539297	5354	2	A	T	T	7	7	EPC2	T	4	4
NEB	4703	broad.mit.edu	37	2	152374923	152374923	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152374923T>C	uc010fnx.2	-	128	17797	c.17606A>G	c.(17605-17607)AAG>AGG	p.K5869R	NEB_uc002txr.2_Missense_Mutation_p.K2292R|NEB_uc002txt.3_Missense_Mutation_p.K374R	NM_004543	NP_004534	P20929	NEBU_HUMAN	nebulin isoform 3	5869	Nebulin 160.				muscle filament sliding|muscle organ development|regulation of actin filament length|somatic muscle development	actin cytoskeleton|cytosol|Z disc	actin binding|structural constituent of muscle			ovary(8)|large_intestine(5)|breast(3)|central_nervous_system(2)|skin(1)|pancreas(1)	20				BRCA - Breast invasive adenocarcinoma(221;0.219)														---	---	---	---	capture		Missense_Mutation	SNP	152374923	152374923	10701	2	T	C	C	56	56	NEB	C	4	4
TANC1	85461	broad.mit.edu	37	2	160076237	160076237	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160076237G>A	uc002uag.2	+	22	3811	c.3537G>A	c.(3535-3537)CTG>CTA	p.L1179L	TANC1_uc010zcm.1_Silent_p.L1171L|TANC1_uc010fom.1_Silent_p.L985L|TANC1_uc010fon.2_Silent_p.L23L	NM_033394	NP_203752	Q9C0D5	TANC1_HUMAN	tetratricopeptide repeat, ankyrin repeat and	1179	ANK 9.					cell junction|postsynaptic density|postsynaptic membrane	binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---	capture		Silent	SNP	160076237	160076237	16065	2	G	A	A	48	48	TANC1	A	2	2
SLC4A10	57282	broad.mit.edu	37	2	162760565	162760565	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:162760565G>T	uc002ubx.3	+	13	1678	c.1494G>T	c.(1492-1494)TGG>TGT	p.W498C	SLC4A10_uc010zcr.1_RNA|SLC4A10_uc002uby.3_Missense_Mutation_p.W468C|SLC4A10_uc010zcs.1_Missense_Mutation_p.W479C	NM_022058	NP_071341	Q6U841	S4A10_HUMAN	solute carrier family 4, sodium bicarbonate	498	Cytoplasmic (Potential).				bicarbonate transport|chloride transport|sodium ion transport	integral to membrane|plasma membrane	inorganic anion exchanger activity|symporter activity			ovary(2)|lung(2)|pancreas(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	162760565	162760565	15148	2	G	T	T	41	41	SLC4A10	T	2	2
DPP4	1803	broad.mit.edu	37	2	162873370	162873370	+	Missense_Mutation	SNP	C	G	G	rs17848907		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:162873370C>G	uc002ubz.2	-	18	2036	c.1475G>C	c.(1474-1476)AGA>ACA	p.R492T	DPP4_uc010fpb.2_Missense_Mutation_p.R168T	NM_001935	NP_001926	P27487	DPP4_HUMAN	dipeptidylpeptidase IV	492	Extracellular (Potential).				cell adhesion|endothelial cell migration|negative regulation of extracellular matrix disassembly|positive regulation of cell proliferation|proteolysis|regulation of cell-cell adhesion mediated by integrin|response to hypoxia|T cell activation|T cell costimulation	apical plasma membrane|cell surface|endocytic vesicle|extracellular region|integral to membrane|invadopodium membrane|lamellipodium membrane|membrane raft	aminopeptidase activity|dipeptidyl-peptidase activity|protease binding|protein homodimerization activity|receptor activity|receptor binding|serine-type endopeptidase activity			ovary(3)	3					Sitagliptin(DB01261)													---	---	---	---	capture		Missense_Mutation	SNP	162873370	162873370	4913	2	C	G	G	32	32	DPP4	G	3	3
XIRP2	129446	broad.mit.edu	37	2	168101798	168101798	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:168101798C>T	uc002udx.2	+	8	3914	c.3896C>T	c.(3895-3897)ACA>ATA	p.T1299I	XIRP2_uc010fpn.2_Intron|XIRP2_uc010fpo.2_Intron|XIRP2_uc010fpp.2_Intron|XIRP2_uc002udy.2_Missense_Mutation_p.T1124I|XIRP2_uc010fpq.2_Missense_Mutation_p.T1077I|XIRP2_uc010fpr.2_Intron|XIRP2_uc010fps.1_5'Flank	NM_152381	NP_689594	A4UGR9	XIRP2_HUMAN	xin actin-binding repeat containing 2 isoform 1	1124					actin cytoskeleton organization	cell junction	actin binding			skin(7)|ovary(6)|pancreas(1)	14																		---	---	---	---	capture		Missense_Mutation	SNP	168101798	168101798	18011	2	C	T	T	17	17	XIRP2	T	2	2
XIRP2	129446	broad.mit.edu	37	2	168102608	168102608	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:168102608G>T	uc002udx.2	+	8	4724	c.4706G>T	c.(4705-4707)GGA>GTA	p.G1569V	XIRP2_uc010fpn.2_Intron|XIRP2_uc010fpo.2_Intron|XIRP2_uc010fpp.2_Intron|XIRP2_uc002udy.2_Missense_Mutation_p.G1394V|XIRP2_uc010fpq.2_Missense_Mutation_p.G1347V|XIRP2_uc010fpr.2_Intron|XIRP2_uc010fps.1_5'Flank	NM_152381	NP_689594	A4UGR9	XIRP2_HUMAN	xin actin-binding repeat containing 2 isoform 1	1394					actin cytoskeleton organization	cell junction	actin binding			skin(7)|ovary(6)|pancreas(1)	14																		---	---	---	---	capture		Missense_Mutation	SNP	168102608	168102608	18011	2	G	T	T	41	41	XIRP2	T	2	2
ABCB11	8647	broad.mit.edu	37	2	169814626	169814626	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:169814626G>T	uc002ueo.1	-	19	2317	c.2191C>A	c.(2191-2193)CCT>ACT	p.P731T	ABCB11_uc010zda.1_Missense_Mutation_p.P173T|ABCB11_uc010zdb.1_Missense_Mutation_p.P207T	NM_003742	NP_003733	O95342	ABCBB_HUMAN	ATP-binding cassette, sub-family B (MDR/TAP),	731	Cytoplasmic (Potential).				bile acid biosynthetic process	apical plasma membrane|Golgi membrane|integral to plasma membrane|intercellular canaliculus|membrane fraction	ATP binding|bile acid-exporting ATPase activity|canalicular bile acid transmembrane transporter activity|sodium-exporting ATPase activity, phosphorylative mechanism			ovary(2)|large_intestine(2)|breast(1)	5					Adenosine triphosphate(DB00171)|Bosentan(DB00559)|Glibenclamide(DB01016)													---	---	---	---	capture		Missense_Mutation	SNP	169814626	169814626	43	2	G	T	T	41	41	ABCB11	T	2	2
GAD1	2571	broad.mit.edu	37	2	171709293	171709293	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:171709293C>A	uc002ugi.2	+	13	1676	c.1254C>A	c.(1252-1254)GTC>GTA	p.V418V	GAD1_uc010fqc.2_Silent_p.V37V	NM_000817	NP_000808	Q99259	DCE1_HUMAN	glutamate decarboxylase 1 isoform GAD67	418					glutamate decarboxylation to succinate|neurotransmitter biosynthetic process|neurotransmitter secretion|protein-pyridoxal-5-phosphate linkage	clathrin sculpted gamma-aminobutyric acid transport vesicle membrane|plasma membrane	glutamate decarboxylase activity|protein binding|pyridoxal phosphate binding			ovary(1)	1					L-Glutamic Acid(DB00142)|Pyridoxal Phosphate(DB00114)													---	---	---	---	capture		Silent	SNP	171709293	171709293	6430	2	C	A	A	29	29	GAD1	A	2	2
SLC25A12	8604	broad.mit.edu	37	2	172712451	172712451	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:172712451G>C	uc002uhh.2	-	4	307	c.218C>G	c.(217-219)TCC>TGC	p.S73C	SLC25A12_uc010fqh.2_Intron|SLC25A12_uc010zdv.1_RNA	NM_003705	NP_003696	O75746	CMC1_HUMAN	solute carrier family 25, member 12	73	1.|EF-hand 1.				gluconeogenesis|malate-aspartate shuttle|response to calcium ion	integral to membrane|mitochondrial inner membrane	calcium ion binding|L-aspartate transmembrane transporter activity|L-glutamate transmembrane transporter activity|protein binding				0			OV - Ovarian serous cystadenocarcinoma(117;0.216)		L-Aspartic Acid(DB00128)													---	---	---	---	capture		Missense_Mutation	SNP	172712451	172712451	14971	2	G	C	C	41	41	SLC25A12	C	3	3
HOXD10	3236	broad.mit.edu	37	2	176982280	176982280	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:176982280C>A	uc002ukj.2	+	1	789	c.719C>A	c.(718-720)CCC>CAC	p.P240H		NM_002148	NP_002139	P28358	HXD10_HUMAN	homeobox D10	240						nucleus	sequence-specific DNA binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.0207)|Epithelial(96;0.18)	Colorectal(32;0.0226)|READ - Rectum adenocarcinoma(9;0.0556)														---	---	---	---	capture		Missense_Mutation	SNP	176982280	176982280	7611	2	C	A	A	22	22	HOXD10	A	2	2
HOXD3	3232	broad.mit.edu	37	2	177034272	177034272	+	Nonsense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:177034272A>T	uc002ukt.1	+	2	606	c.430A>T	c.(430-432)AAA>TAA	p.K144*		NM_006898	NP_008829	P31249	HXD3_HUMAN	homeobox D3	144					anterior/posterior pattern formation|cartilage development|cell-matrix adhesion|embryonic skeletal system morphogenesis|Notch signaling pathway|positive regulation of gene expression|positive regulation of neuron differentiation|thyroid gland development		sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0			OV - Ovarian serous cystadenocarcinoma(117;0.00569)|Epithelial(96;0.0864)|all cancers(119;0.226)	Colorectal(32;0.247)														---	---	---	---	capture		Nonsense_Mutation	SNP	177034272	177034272	7615	2	A	T	T	5	5	HOXD3	T	5	4
MTX2	10651	broad.mit.edu	37	2	177202252	177202252	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:177202252C>T	uc002ukx.2	+	10	887	c.652C>T	c.(652-654)CAT>TAT	p.H218Y	MTX2_uc002ukw.2_Missense_Mutation_p.H208Y	NM_006554	NP_006545	O75431	MTX2_HUMAN	metaxin 2	218					protein targeting to mitochondrion	mitochondrial outer membrane				ovary(1)|central_nervous_system(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.00365)|Epithelial(96;0.0654)|all cancers(119;0.181)															---	---	---	---	capture		Missense_Mutation	SNP	177202252	177202252	10361	2	C	T	T	21	21	MTX2	T	2	2
TTN	7273	broad.mit.edu	37	2	179412919	179412919	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179412919A>T	uc010zfg.1	-	288	85954	c.85730T>A	c.(85729-85731)ATC>AAC	p.I28577N	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.I22272N|TTN_uc010zfi.1_Missense_Mutation_p.I22205N|TTN_uc010zfj.1_Missense_Mutation_p.I22080N	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	29504							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179412919	179412919	17290	2	A	T	T	12	12	TTN	T	4	4
TTN	7273	broad.mit.edu	37	2	179443892	179443892	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179443892G>T	uc010zfg.1	-	269	60385	c.60161C>A	c.(60160-60162)ACA>AAA	p.T20054K	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.T13749K|TTN_uc010zfi.1_Missense_Mutation_p.T13682K|TTN_uc010zfj.1_Missense_Mutation_p.T13557K|uc002umv.1_Missense_Mutation_p.V40L	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	20981							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179443892	179443892	17290	2	G	T	T	48	48	TTN	T	2	2
TTN	7273	broad.mit.edu	37	2	179452854	179452854	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179452854C>A	uc010zfg.1	-	254	55800	c.55576G>T	c.(55576-55578)GCA>TCA	p.A18526S	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.A12221S|TTN_uc010zfi.1_Missense_Mutation_p.A12154S|TTN_uc010zfj.1_Missense_Mutation_p.A12029S	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	19453							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179452854	179452854	17290	2	C	A	A	25	25	TTN	A	2	2
TTN	7273	broad.mit.edu	37	2	179455492	179455492	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179455492G>T	uc010zfg.1	-	253	53480	c.53256C>A	c.(53254-53256)GTC>GTA	p.V17752V	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Silent_p.V11447V|TTN_uc010zfi.1_Silent_p.V11380V|TTN_uc010zfj.1_Silent_p.V11255V	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	18679							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Silent	SNP	179455492	179455492	17290	2	G	T	T	45	45	TTN	T	2	2
TTN	7273	broad.mit.edu	37	2	179460333	179460333	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179460333G>A	uc010zfg.1	-	244	50268	c.50044C>T	c.(50044-50046)CAA>TAA	p.Q16682*	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Nonsense_Mutation_p.Q10377*|TTN_uc010zfi.1_Nonsense_Mutation_p.Q10310*|TTN_uc010zfj.1_Nonsense_Mutation_p.Q10185*	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	17609							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Nonsense_Mutation	SNP	179460333	179460333	17290	2	G	A	A	45	45	TTN	A	5	2
TTN	7273	broad.mit.edu	37	2	179475959	179475959	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179475959A>T	uc010zfg.1	-	219	43417	c.43193T>A	c.(43192-43194)GTT>GAT	p.V14398D	uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.V8093D|TTN_uc010zfi.1_Missense_Mutation_p.V8026D|TTN_uc010zfj.1_Missense_Mutation_p.V7901D	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	15325							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179475959	179475959	17290	2	A	T	T	2	2	TTN	T	4	4
TTN	7273	broad.mit.edu	37	2	179482066	179482066	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179482066C>T	uc010zfg.1	-	203	40266	c.40042G>A	c.(40042-40044)GAA>AAA	p.E13348K	TTN_uc010zfh.1_Missense_Mutation_p.E7043K|TTN_uc010zfi.1_Missense_Mutation_p.E6976K|TTN_uc010zfj.1_Missense_Mutation_p.E6851K	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	14275							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179482066	179482066	17290	2	C	T	T	29	29	TTN	T	2	2
TTN	7273	broad.mit.edu	37	2	179575619	179575619	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179575619C>A	uc010zfg.1	-	95	24697	c.24473G>T	c.(24472-24474)CGT>CTT	p.R8158L	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Missense_Mutation_p.R4819L	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	9085							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179575619	179575619	17290	2	C	A	A	19	19	TTN	A	1	1
TTN	7273	broad.mit.edu	37	2	179595510	179595510	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179595510A>T	uc010zfg.1	-	58	14242	c.14018T>A	c.(14017-14019)ATA>AAA	p.I4673K	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Missense_Mutation_p.I1334K	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	5600							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179595510	179595510	17290	2	A	T	T	16	16	TTN	T	4	4
TTN	7273	broad.mit.edu	37	2	179610930	179610930	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179610930G>C	uc002unb.2	-	46	16421	c.16197C>G	c.(16195-16197)TTC>TTG	p.F5399L	TTN_uc010zfg.1_Intron|TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Intron	NM_133379	NP_596870	Q8WZ42	TITIN_HUMAN	titin isoform novex-3	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179610930	179610930	17290	2	G	C	C	45	45	TTN	C	3	3
ZNF804A	91752	broad.mit.edu	37	2	185803014	185803014	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:185803014C>A	uc002uph.2	+	4	3485	c.2891C>A	c.(2890-2892)TCA>TAA	p.S964*		NM_194250	NP_919226	Q7Z570	Z804A_HUMAN	zinc finger protein 804A	964						intracellular	zinc ion binding			ovary(6)|skin(3)|large_intestine(1)|pancreas(1)	11																		---	---	---	---	capture		Nonsense_Mutation	SNP	185803014	185803014	18768	2	C	A	A	29	29	ZNF804A	A	5	2
WDR75	84128	broad.mit.edu	37	2	190331241	190331241	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:190331241C>G	uc002uql.1	+	13	1440	c.1380C>G	c.(1378-1380)ACC>ACG	p.T460T	WDR75_uc002uqm.1_Silent_p.T396T|WDR75_uc002uqn.1_Silent_p.T238T|WDR75_uc002uqo.1_Silent_p.T238T	NM_032168	NP_115544	Q8IWA0	WDR75_HUMAN	WD repeat domain 75	460	WD 7.					nucleolus				ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.00105)|Epithelial(96;0.0129)|all cancers(119;0.0456)															---	---	---	---	capture		Silent	SNP	190331241	190331241	17898	2	C	G	G	24	24	WDR75	G	3	3
MSTN	2660	broad.mit.edu	37	2	190924989	190924989	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:190924989G>A	uc002urp.2	-	2	679	c.546C>T	c.(544-546)GAC>GAT	p.D182D		NM_005259	NP_005250	O14793	GDF8_HUMAN	myostatin precursor	182					muscle organ development|positive regulation of transcription, DNA-dependent	extracellular space	cytokine activity|growth factor activity			lung(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.000742)|Epithelial(96;0.0121)|all cancers(119;0.0395)															---	---	---	---	capture		Silent	SNP	190924989	190924989	10286	2	G	A	A	40	40	MSTN	A	1	1
PIKFYVE	200576	broad.mit.edu	37	2	209190082	209190082	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:209190082G>C	uc002vcz.2	+	20	2705	c.2547G>C	c.(2545-2547)CTG>CTC	p.L849L	PIKFYVE_uc010fun.1_Silent_p.L530L|PIKFYVE_uc002vcy.1_Silent_p.L793L	NM_015040	NP_055855	Q9Y2I7	FYV1_HUMAN	phosphatidylinositol-3-phosphate 5-kinase type	849					cellular protein metabolic process|intracellular signal transduction|protein localization to nucleus|retrograde transport, endosome to Golgi	early endosome membrane|membrane raft	1-phosphatidylinositol-3-phosphate 5-kinase activity|1-phosphatidylinositol-4-phosphate 5-kinase activity|ATP binding|metal ion binding|protein binding			ovary(5)|kidney(2)|pancreas(1)|central_nervous_system(1)|skin(1)	10																		---	---	---	---	capture		Silent	SNP	209190082	209190082	12348	2	G	C	C	47	47	PIKFYVE	C	3	3
TTLL4	9654	broad.mit.edu	37	2	219602602	219602602	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219602602G>T	uc002viy.2	+	3	573	c.203G>T	c.(202-204)GGC>GTC	p.G68V	TTLL4_uc010zkl.1_Intron|TTLL4_uc010fvx.2_Missense_Mutation_p.G68V	NM_014640	NP_055455	Q14679	TTLL4_HUMAN	tubulin tyrosine ligase-like family, member 4	68					protein polyglutamylation	cilium|microtubule basal body	ATP binding|tubulin binding|tubulin-tyrosine ligase activity			ovary(2)|skin(1)	3		Renal(207;0.0915)		Epithelial(149;5.03e-07)|all cancers(144;0.000106)|LUSC - Lung squamous cell carcinoma(224;0.00829)|Lung(261;0.0101)														---	---	---	---	capture		Missense_Mutation	SNP	219602602	219602602	17284	2	G	T	T	42	42	TTLL4	T	2	2
SPEG	10290	broad.mit.edu	37	2	220354143	220354143	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220354143C>A	uc010fwg.2	+	36	8403	c.8403C>A	c.(8401-8403)ACC>ACA	p.T2801T		NM_005876	NP_005867	Q15772	SPEG_HUMAN	SPEG complex locus	2801	Pro-rich.				muscle organ development|negative regulation of cell proliferation	nucleus	ATP binding|protein serine/threonine kinase activity			stomach(9)|ovary(4)|central_nervous_system(1)	14		Renal(207;0.0183)		Epithelial(149;4.5e-10)|all cancers(144;7.93e-08)|Lung(261;0.00639)|LUSC - Lung squamous cell carcinoma(224;0.00829)|READ - Rectum adenocarcinoma(5;0.163)														---	---	---	---	capture		Silent	SNP	220354143	220354143	15548	2	C	A	A	24	24	SPEG	A	2	2
SCG2	7857	broad.mit.edu	37	2	224462280	224462280	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:224462280G>T	uc002vnm.2	-	2	1854	c.1721C>A	c.(1720-1722)CCG>CAG	p.P574Q		NM_003469	NP_003460	P13521	SCG2_HUMAN	secretogranin II precursor	574					angiogenesis|endothelial cell migration|eosinophil chemotaxis|induction of positive chemotaxis|inflammatory response|MAPKKK cascade|negative regulation of apoptosis|negative regulation of endothelial cell proliferation|positive regulation of endothelial cell proliferation|protein secretion	extracellular space|stored secretory granule	chemoattractant activity|cytokine activity			ovary(1)	1		Renal(207;0.0112)|Lung NSC(271;0.0185)|all_lung(227;0.0271)		Epithelial(121;8.16e-11)|all cancers(144;4.66e-08)|Lung(261;0.00714)|LUSC - Lung squamous cell carcinoma(224;0.008)														---	---	---	---	capture		Missense_Mutation	SNP	224462280	224462280	14372	2	G	T	T	39	39	SCG2	T	1	1
EFHD1	80303	broad.mit.edu	37	2	233527618	233527618	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233527618G>T	uc002vtc.2	+	2	617	c.409G>T	c.(409-411)GAG>TAG	p.E137*	EFHD1_uc010fyf.2_Nonsense_Mutation_p.E41*|EFHD1_uc002vtd.2_Nonsense_Mutation_p.E25*	NM_025202	NP_079478	Q9BUP0	EFHD1_HUMAN	EF-hand domain family, member D1	137	EF-hand 2.						calcium ion binding|protein binding				0		all_hematologic(139;0.0123)|Acute lymphoblastic leukemia(138;0.0182)|Breast(86;0.0199)|Renal(207;0.025)		Epithelial(121;2.08e-16)|BRCA - Breast invasive adenocarcinoma(100;0.000383)|LUSC - Lung squamous cell carcinoma(224;0.00825)|Lung(119;0.0101)														---	---	---	---	capture		Nonsense_Mutation	SNP	233527618	233527618	5136	2	G	T	T	41	41	EFHD1	T	5	2
INPP5D	3635	broad.mit.edu	37	2	233986827	233986827	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233986827G>T	uc010zmo.1	+	3	362	c.209G>T	c.(208-210)GGC>GTC	p.G70V	INPP5D_uc010zmp.1_Missense_Mutation_p.G70V	NM_001017915	NP_001017915	Q92835	SHIP1_HUMAN	SH2 containing inositol phosphatase isoform a	70	SH2.				apoptosis|blood coagulation|leukocyte migration|T cell receptor signaling pathway	cytosol	inositol-polyphosphate 5-phosphatase activity|phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity|SH3 domain binding			ovary(1)|central_nervous_system(1)	2		Breast(86;0.0013)|Renal(207;0.00339)|all_hematologic(139;0.0116)|all_lung(227;0.0273)|Acute lymphoblastic leukemia(138;0.0328)|Lung NSC(271;0.0843)		Epithelial(121;1.16e-17)|BRCA - Breast invasive adenocarcinoma(100;0.000479)|LUSC - Lung squamous cell carcinoma(224;0.00655)|Lung(119;0.00802)|GBM - Glioblastoma multiforme(43;0.0185)														---	---	---	---	capture		Missense_Mutation	SNP	233986827	233986827	8057	2	G	T	T	42	42	INPP5D	T	2	2
UGT1A7	54577	broad.mit.edu	37	2	234591121	234591121	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:234591121G>T	uc002vut.2	+	1	538	c.538G>T	c.(538-540)GGT>TGT	p.G180C	UGT1A8_uc010zmv.1_Intron|UGT1A8_uc002vup.2_Intron|UGT1A10_uc002vuq.3_Intron|UGT1A10_uc002vur.2_Intron|UGT1A9_uc010zmw.1_Intron|UGT1A9_uc002vus.2_Intron|UGT1A7_uc010zmx.1_Missense_Mutation_p.G180C	NM_019077	NP_061950	Q9HAW7	UD17_HUMAN	UDP glycosyltransferase 1 family, polypeptide A7	180					drug metabolic process|negative regulation of fatty acid metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	drug binding|enzyme inhibitor activity|glucuronosyltransferase activity|protein heterodimerization activity|protein homodimerization activity|protein kinase C binding|retinoic acid binding			ovary(1)	1		Breast(86;0.000765)|all_lung(227;0.00267)|Renal(207;0.00339)|all_hematologic(139;0.0116)|Acute lymphoblastic leukemia(138;0.0328)|Lung NSC(271;0.0457)|Lung SC(224;0.128)		Epithelial(121;8.93e-18)|BRCA - Breast invasive adenocarcinoma(100;0.000412)|Lung(119;0.00333)|LUSC - Lung squamous cell carcinoma(224;0.00746)														---	---	---	---	capture		Missense_Mutation	SNP	234591121	234591121	17508	2	G	T	T	35	35	UGT1A7	T	2	2
HDAC4	9759	broad.mit.edu	37	2	240016748	240016748	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:240016748C>T	uc002vyk.3	-	17	3015	c.2223G>A	c.(2221-2223)TCG>TCA	p.S741S	HDAC4_uc010fyz.1_Silent_p.S736S|HDAC4_uc010zoa.1_Silent_p.S741S|HDAC4_uc010fza.2_Silent_p.S746S|HDAC4_uc010fyy.2_Silent_p.S698S|HDAC4_uc010znz.1_Silent_p.S624S	NM_006037	NP_006028	P56524	HDAC4_HUMAN	histone deacetylase 4	741	Histone deacetylase.				B cell differentiation|cardiac muscle hypertrophy in response to stress|chromatin remodeling|histone H3 deacetylation|histone H4 deacetylation|inflammatory response|negative regulation of glycolysis|negative regulation of myotube differentiation|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of transcription from RNA polymerase II promoter|nervous system development|peptidyl-lysine deacetylation|positive regulation of cell proliferation|positive regulation of protein sumoylation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|regulation of protein binding|response to denervation involved in regulation of muscle adaptation|response to interleukin-1|transcription, DNA-dependent	histone deacetylase complex|transcriptional repressor complex	activating transcription factor binding|histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|potassium ion binding|repressing transcription factor binding|zinc ion binding			breast(3)|skin(2)|ovary(1)	6		all_epithelial(40;1.45e-17)|Breast(86;1.53e-05)|Renal(207;0.000355)|all_lung(227;0.0121)|Ovarian(221;0.0183)|Lung NSC(271;0.0413)|Melanoma(123;0.0749)|all_hematologic(139;0.159)		Epithelial(121;6.38e-25)|OV - Ovarian serous cystadenocarcinoma(60;2.48e-12)|Kidney(56;6.04e-08)|KIRC - Kidney renal clear cell carcinoma(57;1.18e-06)|BRCA - Breast invasive adenocarcinoma(100;3.99e-05)|Lung(119;0.00942)|LUSC - Lung squamous cell carcinoma(224;0.04)														---	---	---	---	capture		Silent	SNP	240016748	240016748	7292	2	C	T	T	27	27	HDAC4	T	1	1
KIF1A	547	broad.mit.edu	37	2	241658612	241658612	+	Silent	SNP	C	A	A	rs148176695	by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:241658612C>A	uc002vzy.2	-	45	4868	c.4722G>T	c.(4720-4722)CCG>CCT	p.P1574P	KIF1A_uc010fzk.2_Silent_p.P1675P|KIF1A_uc002vzw.2_Silent_p.P235P|KIF1A_uc002vzx.2_Silent_p.P301P	NM_004321	NP_004312	Q12756	KIF1A_HUMAN	axonal transport of synaptic vesicles	1574					anterograde axon cargo transport	cytoplasm|microtubule|nucleus	ATP binding|microtubule motor activity			lung(1)	1		all_epithelial(40;1.35e-15)|Breast(86;2.14e-05)|Renal(207;0.00183)|Ovarian(221;0.0228)|all_lung(227;0.0295)|all_neural(83;0.0459)|Lung NSC(271;0.0942)|all_hematologic(139;0.158)|Melanoma(123;0.16)|Hepatocellular(293;0.244)		Epithelial(32;6.12e-30)|all cancers(36;3.46e-27)|OV - Ovarian serous cystadenocarcinoma(60;1.38e-14)|Kidney(56;5e-09)|KIRC - Kidney renal clear cell carcinoma(57;5e-08)|BRCA - Breast invasive adenocarcinoma(100;5.87e-06)|Lung(119;0.00209)|LUSC - Lung squamous cell carcinoma(224;0.00902)|Colorectal(34;0.0282)|COAD - Colon adenocarcinoma(134;0.176)														---	---	---	---	capture		Silent	SNP	241658612	241658612	8594	2	C	A	A	31	31	KIF1A	A	1	1
HDLBP	3069	broad.mit.edu	37	2	242192394	242192394	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242192394G>C	uc002waz.2	-	11	1578	c.1350C>G	c.(1348-1350)CTC>CTG	p.L450L	HDLBP_uc002wba.2_Silent_p.L450L|HDLBP_uc002wbb.2_Silent_p.L402L	NM_203346	NP_976221	Q00341	VIGLN_HUMAN	high density lipoprotein binding protein	450	KH 5.				cholesterol metabolic process|lipid transport	cytoplasm|high-density lipoprotein particle|nucleus|plasma membrane	lipid binding|protein binding|RNA binding			breast(3)|skin(1)	4		all_cancers(19;7.77e-41)|all_epithelial(40;1.74e-18)|Breast(86;1.53e-05)|Renal(207;0.00179)|all_lung(227;0.00338)|Ovarian(221;0.00556)|Lung NSC(271;0.0121)|Esophageal squamous(248;0.129)|all_hematologic(139;0.158)|Melanoma(123;0.16)|all_neural(83;0.243)|Hepatocellular(293;0.244)		Epithelial(32;8.13e-34)|all cancers(36;4.71e-31)|OV - Ovarian serous cystadenocarcinoma(60;2.34e-15)|Kidney(56;3.72e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.76e-08)|BRCA - Breast invasive adenocarcinoma(100;3.38e-06)|Lung(119;0.000109)|LUSC - Lung squamous cell carcinoma(224;0.000964)|Colorectal(34;0.0132)|COAD - Colon adenocarcinoma(134;0.0928)														---	---	---	---	capture		Silent	SNP	242192394	242192394	7308	2	G	C	C	45	45	HDLBP	C	3	3
PDYN	5173	broad.mit.edu	37	20	1961250	1961250	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:1961250A>T	uc010gaj.2	-	3	726	c.484T>A	c.(484-486)TAT>AAT	p.Y162N	uc002wfu.1_Intron|PDYN_uc002wfv.2_Missense_Mutation_p.Y162N|PDYN_uc010zpt.1_Missense_Mutation_p.Y7N	NM_024411	NP_077722	P01213	PDYN_HUMAN	beta-neoendorphin-dynorphin preproprotein	162					cell death|neuropeptide signaling pathway|synaptic transmission	extracellular region|plasma membrane	opioid peptide activity			upper_aerodigestive_tract(1)|ovary(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	1961250	1961250	12120	20	A	T	T	15	15	PDYN	T	4	4
PLCB4	5332	broad.mit.edu	37	20	9401951	9401951	+	Nonsense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:9401951C>G	uc002wnf.2	+	25	2262	c.2126C>G	c.(2125-2127)TCA>TGA	p.S709*	PLCB4_uc010gbw.1_Nonsense_Mutation_p.S709*|PLCB4_uc010gbx.2_Nonsense_Mutation_p.S721*|PLCB4_uc002wne.2_Nonsense_Mutation_p.S709*|PLCB4_uc002wnh.2_Nonsense_Mutation_p.S556*	NM_182797	NP_877949	Q15147	PLCB4_HUMAN	phospholipase C beta 4 isoform b	709	C2.				intracellular signal transduction|lipid catabolic process	cytosol	calcium ion binding|phosphatidylinositol phospholipase C activity|protein binding|signal transducer activity			skin(11)|ovary(3)|pancreas(1)	15																		---	---	---	---	capture		Nonsense_Mutation	SNP	9401951	9401951	12456	20	C	G	G	29	29	PLCB4	G	5	3
C20orf26	26074	broad.mit.edu	37	20	20171995	20171995	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:20171995C>A	uc002wru.2	+	15	1598	c.1522C>A	c.(1522-1524)CTG>ATG	p.L508M	C20orf26_uc010zse.1_Missense_Mutation_p.L488M	NM_015585	NP_056400	Q8NHU2	CT026_HUMAN	hypothetical protein LOC26074	508										ovary(3)|pancreas(1)	4				READ - Rectum adenocarcinoma(2;0.171)														---	---	---	---	capture		Missense_Mutation	SNP	20171995	20171995	2186	20	C	A	A	20	20	C20orf26	A	2	2
RALGAPA2	57186	broad.mit.edu	37	20	20621385	20621385	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:20621385T>A	uc002wrz.2	-	6	653	c.510A>T	c.(508-510)ACA>ACT	p.T170T	RALGAPA2_uc010zsg.1_5'UTR	NM_020343	NP_065076	Q2PPJ7	RGPA2_HUMAN	akt substrate AS250	170					activation of Ral GTPase activity	cytosol|nucleus	protein heterodimerization activity|Ral GTPase activator activity			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	20621385	20621385	13474	20	T	A	A	59	59	RALGAPA2	A	4	4
PAX1	5075	broad.mit.edu	37	20	21687608	21687608	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:21687608C>A	uc002wsj.2	+	2	873	c.819C>A	c.(817-819)GTC>GTA	p.V273V	PAX1_uc010zsl.1_Silent_p.V273V|PAX1_uc010zsm.1_Silent_p.V249V	NM_006192	NP_006183	P15863	PAX1_HUMAN	paired box 1	273					regulation of transcription, DNA-dependent|skeletal system development|transcription from RNA polymerase II promoter	nucleus	DNA binding			upper_aerodigestive_tract(1)|kidney(1)	2																		---	---	---	---	capture		Silent	SNP	21687608	21687608	11898	20	C	A	A	30	30	PAX1	A	2	2
NINL	22981	broad.mit.edu	37	20	25456757	25456757	+	Missense_Mutation	SNP	T	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:25456757T>G	uc002wux.1	-	17	3244	c.3170A>C	c.(3169-3171)GAC>GCC	p.D1057A	NINL_uc010gdn.1_Intron	NM_025176	NP_079452	Q9Y2I6	NINL_HUMAN	ninein-like	1057	Potential.				G2/M transition of mitotic cell cycle	cytosol|microtubule|microtubule organizing center	calcium ion binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	25456757	25456757	10821	20	T	G	G	58	58	NINL	G	4	4
C20orf160	140706	broad.mit.edu	37	20	30602789	30602789	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:30602789C>A	uc002wxf.2	+	2	126	c.113C>A	c.(112-114)CCC>CAC	p.P38H		NM_080625	NP_542192	Q9NUG4	CT160_HUMAN	hypothetical protein LOC140706	38										central_nervous_system(3)|ovary(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	30602789	30602789	2170	20	C	A	A	22	22	C20orf160	A	2	2
SUN5	140732	broad.mit.edu	37	20	31590677	31590677	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31590677G>A	uc002wyi.2	-	2	219	c.126C>T	c.(124-126)TCC>TCT	p.S42S		NM_080675	NP_542406	Q8TC36	SUN5_HUMAN	sperm associated antigen 4-like	42					spermatogenesis					skin(1)	1																		---	---	---	---	capture		Silent	SNP	31590677	31590677	15914	20	G	A	A	43	43	SUN5	A	2	2
BPIL1	80341	broad.mit.edu	37	20	31607502	31607502	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31607502G>T	uc002wyj.2	+	11	1220	c.1026G>T	c.(1024-1026)GAG>GAT	p.E342D		NM_025227	NP_079503	Q8N4F0	BPIL1_HUMAN	bactericidal/permeability-increasing	342						extracellular region	lipid binding			skin(2)|large_intestine(1)|ovary(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	31607502	31607502	1519	20	G	T	T	35	35	BPIL1	T	2	2
C20orf186	149954	broad.mit.edu	37	20	31671497	31671497	+	Missense_Mutation	SNP	C	T	T	rs143050216	byFrequency	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31671497C>T	uc010zue.1	+	3	509	c.494C>T	c.(493-495)GCG>GTG	p.A165V		NM_182519	NP_872325	P59827	LPLC4_HUMAN	antimicrobial peptide RY2G5 precursor	165	Gly-rich.					cytoplasm|extracellular region	lipid binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	31671497	31671497	2176	20	C	T	T	27	27	C20orf186	T	1	1
C20orf71	128861	broad.mit.edu	37	20	31811649	31811649	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31811649G>A	uc002wyr.2	+	2	368	c.160G>A	c.(160-162)GAA>AAA	p.E54K	C20orf71_uc002wys.2_Missense_Mutation_p.E54K	NM_178466	NP_848561	Q9BQP9	SPLC3_HUMAN	short long palate, lung and nasal epithelium	54						extracellular region	lipid binding			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	31811649	31811649	2197	20	G	A	A	33	33	C20orf71	A	2	2
C20orf114	92747	broad.mit.edu	37	20	31873902	31873902	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31873902C>G	uc002wyw.1	+	2	184	c.23C>G	c.(22-24)ACC>AGC	p.T8S	C20orf114_uc010gej.1_Missense_Mutation_p.T8S	NM_033197	NP_149974	Q8TDL5	LPLC1_HUMAN	LPLUNC1 protein precursor	8						extracellular space	lipid binding			central_nervous_system(2)|skin(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	31873902	31873902	2158	20	C	G	G	18	18	C20orf114	G	3	3
RBM12	10137	broad.mit.edu	37	20	34242934	34242934	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34242934C>A	uc002xdq.2	-	3	543	c.311G>T	c.(310-312)AGA>ATA	p.R104I	CPNE1_uc010zvj.1_5'Flank|CPNE1_uc002xde.2_Intron|CPNE1_uc002xdf.2_Intron|CPNE1_uc002xdg.2_Intron|CPNE1_uc010gfi.2_Intron|CPNE1_uc010gfj.2_Intron|CPNE1_uc002xdh.2_Intron|CPNE1_uc002xdi.2_Intron|CPNE1_uc002xdj.2_Intron|CPNE1_uc002xdk.2_Intron|CPNE1_uc002xdl.2_Intron|CPNE1_uc002xdm.2_Intron|CPNE1_uc010gfk.1_Intron|CPNE1_uc002xdn.1_Intron|CPNE1_uc002xdo.1_Intron|CPNE1_uc002xdp.1_Intron|RBM12_uc002xdr.2_Missense_Mutation_p.R104I|RBM12_uc002xds.2_Missense_Mutation_p.R104I	NM_152838	NP_690051	Q9NTZ6	RBM12_HUMAN	RNA binding motif protein 12	104						nucleus	nucleotide binding|protein binding|RNA binding			ovary(3)	3	Lung NSC(9;0.00608)|all_lung(11;0.00918)		BRCA - Breast invasive adenocarcinoma(18;0.00953)													OREG0004046	type=REGULATORY REGION|Gene=RBM12|Dataset=Stanford ENCODE Dataset|EvidenceSubtype=Transient transfection luciferase assay	---	---	---	---	capture		Missense_Mutation	SNP	34242934	34242934	13574	20	C	A	A	32	32	RBM12	A	2	2
DLGAP4	22839	broad.mit.edu	37	20	35128704	35128704	+	Silent	SNP	G	T	T	rs150480623		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35128704G>T	uc002xff.2	+	10	2628	c.2193G>T	c.(2191-2193)CCG>CCT	p.P731P	DLGAP4_uc010zvp.1_Silent_p.P731P|DLGAP4_uc002xfg.2_Silent_p.P27P|DLGAP4_uc002xfh.2_Silent_p.P195P|DLGAP4_uc002xfi.2_Silent_p.P40P|DLGAP4_uc002xfj.2_Silent_p.P27P	NM_014902	NP_055717	Q9Y2H0	DLGP4_HUMAN	disks large-associated protein 4 isoform a	734					cell-cell signaling	membrane	protein binding			skin(2)|ovary(1)	3	Breast(12;0.0192)	Myeloproliferative disorder(115;0.00878)																---	---	---	---	capture		Silent	SNP	35128704	35128704	4742	20	G	T	T	39	39	DLGAP4	T	1	1
PTPRT	11122	broad.mit.edu	37	20	41306547	41306547	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:41306547C>A	uc002xkg.2	-	7	1296	c.1112G>T	c.(1111-1113)GGA>GTA	p.G371V	PTPRT_uc010ggj.2_Missense_Mutation_p.G371V	NM_007050	NP_008981	O14522	PTPRT_HUMAN	protein tyrosine phosphatase, receptor type, T	371	Extracellular (Potential).|Fibronectin type-III 1.				homophilic cell adhesion|transmembrane receptor protein tyrosine kinase signaling pathway	cell surface|integral to membrane|plasma membrane	alpha-catenin binding|beta-catenin binding|cadherin binding|delta-catenin binding|gamma-catenin binding|protein tyrosine phosphatase activity|receptor activity			skin(8)|ovary(7)|lung(5)	20		Myeloproliferative disorder(115;0.00452)|Lung NSC(126;0.0573)|all_lung(126;0.0783)																---	---	---	---	capture		Missense_Mutation	SNP	41306547	41306547	13270	20	C	A	A	30	30	PTPRT	A	2	2
MYBL2	4605	broad.mit.edu	37	20	42315650	42315650	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:42315650C>T	uc002xlb.1	+	5	653	c.438C>T	c.(436-438)ATC>ATT	p.I146I	MYBL2_uc010zwj.1_Silent_p.I122I|MYBL2_uc002xla.1_Silent_p.I146I	NM_002466	NP_002457	P10244	MYBB_HUMAN	MYB-related protein B	146	HTH myb-type 3.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			lung(3)|kidney(2)	5		Myeloproliferative disorder(115;0.00452)	COAD - Colon adenocarcinoma(18;0.0031)															---	---	---	---	capture		Silent	SNP	42315650	42315650	10405	20	C	T	T	32	32	MYBL2	T	2	2
ACOT8	10005	broad.mit.edu	37	20	44483870	44483870	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44483870G>C	uc002xqa.1	-	2	271	c.190C>G	c.(190-192)CTG>GTG	p.L64V	ACOT8_uc010zxe.1_Missense_Mutation_p.L64V|ACOT8_uc002xqc.1_Intron|ACOT8_uc010zxf.1_Intron|ZSWIM3_uc002xqd.2_5'Flank|ZSWIM3_uc010zxg.1_5'Flank	NM_005469	NP_005460	O14734	ACOT8_HUMAN	peroxisomal acyl-CoA thioesterase 1 isoform a	64					bile acid biosynthetic process|fatty acid beta-oxidation using acyl-CoA oxidase|interspecies interaction between organisms|peroxisome organization	peroxisomal matrix	acetyl-CoA hydrolase activity|acyl-CoA thioesterase activity|carboxylesterase activity|choloyl-CoA hydrolase activity|protein binding			skin(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---	capture		Missense_Mutation	SNP	44483870	44483870	157	20	G	C	C	35	35	ACOT8	C	3	3
PCIF1	63935	broad.mit.edu	37	20	44569823	44569823	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44569823G>T	uc002xqs.2	+	7	964	c.650G>T	c.(649-651)CGG>CTG	p.R217L		NM_022104	NP_071387	Q9H4Z3	PCIF1_HUMAN	phosphorylated CTD interacting factor 1	217						nucleus				skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	44569823	44569823	12000	20	G	T	T	39	39	PCIF1	T	1	1
ELMO2	63916	broad.mit.edu	37	20	45016067	45016067	+	Missense_Mutation	SNP	C	G	G	rs4992415		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:45016067C>G	uc002xrt.1	-	8	645	c.435G>C	c.(433-435)GAG>GAC	p.E145D	ELMO2_uc002xru.1_Missense_Mutation_p.E145D|ELMO2_uc010zxr.1_Missense_Mutation_p.E145D|ELMO2_uc010zxs.1_Intron|ELMO2_uc002xrw.2_5'Flank|ELMO2_uc002xrx.1_Missense_Mutation_p.E145D	NM_133171	NP_573403	Q96JJ3	ELMO2_HUMAN	engulfment and cell motility 2	145					apoptosis|cell chemotaxis|phagocytosis	cytoskeleton|cytosol|membrane	lyase activity|receptor tyrosine kinase binding|SH3 domain binding			ovary(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---	capture		Missense_Mutation	SNP	45016067	45016067	5258	20	C	G	G	32	32	ELMO2	G	3	3
KCNB1	3745	broad.mit.edu	37	20	47990134	47990134	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47990134C>T	uc002xur.1	-	2	2127	c.1963G>A	c.(1963-1965)GAG>AAG	p.E655K	KCNB1_uc002xus.1_Missense_Mutation_p.E655K	NM_004975	NP_004966	Q14721	KCNB1_HUMAN	potassium voltage-gated channel, Shab-related	655	Cytoplasmic (Potential).				energy reserve metabolic process|regulation of insulin secretion	voltage-gated potassium channel complex	protein binding|voltage-gated potassium channel activity			pancreas(1)|skin(1)	2			BRCA - Breast invasive adenocarcinoma(12;0.000405)|COAD - Colon adenocarcinoma(4;0.14)|Colorectal(8;0.166)															---	---	---	---	capture		Missense_Mutation	SNP	47990134	47990134	8317	20	C	T	T	31	31	KCNB1	T	1	1
ZFP64	55734	broad.mit.edu	37	20	50776752	50776752	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:50776752G>A	uc002xwl.2	-	5	1022	c.673C>T	c.(673-675)CAC>TAC	p.H225Y	ZFP64_uc002xwk.2_Missense_Mutation_p.H225Y|ZFP64_uc002xwm.2_Missense_Mutation_p.H223Y|ZFP64_uc002xwn.2_Missense_Mutation_p.H171Y	NM_018197	NP_060667	Q9NPA5	ZF64A_HUMAN	zinc finger protein 64 isoform a	225	C2H2-type 2.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			upper_aerodigestive_tract(1)|ovary(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	50776752	50776752	18241	20	G	A	A	47	47	ZFP64	A	2	2
CASS4	57091	broad.mit.edu	37	20	55027043	55027043	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:55027043G>T	uc002xxp.2	+	6	1036	c.811G>T	c.(811-813)GCT>TCT	p.A271S	CASS4_uc002xxq.3_Missense_Mutation_p.A271S|CASS4_uc002xxr.2_Missense_Mutation_p.A271S|CASS4_uc010zze.1_Missense_Mutation_p.A217S|CASS4_uc010gio.2_Intron	NM_001164116	NP_001157588	Q9NQ75	CASS4_HUMAN	HEF-like protein isoform a	271					cell adhesion	cytoplasm|cytoskeleton|focal adhesion	two-component sensor activity			ovary(2)|skin(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	55027043	55027043	2802	20	G	T	T	38	38	CASS4	T	1	1
CTCFL	140690	broad.mit.edu	37	20	56099117	56099117	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:56099117C>A	uc010gix.1	-	1	807	c.145G>T	c.(145-147)GCC>TCC	p.A49S	CTCFL_uc010giw.1_Missense_Mutation_p.A49S|CTCFL_uc002xym.2_Missense_Mutation_p.A49S|CTCFL_uc010giz.1_Intron|CTCFL_uc010giy.1_Intron|CTCFL_uc010gja.1_Missense_Mutation_p.A49S|CTCFL_uc010gjb.1_Missense_Mutation_p.A49S|CTCFL_uc010gjc.1_Missense_Mutation_p.A49S|CTCFL_uc010gjd.1_Missense_Mutation_p.A49S|CTCFL_uc010gje.2_Missense_Mutation_p.A49S|CTCFL_uc010gjf.2_Intron|CTCFL_uc010gjg.2_Intron|CTCFL_uc010gjh.1_Missense_Mutation_p.A49S|CTCFL_uc010gji.1_Intron|CTCFL_uc010gjj.1_Missense_Mutation_p.A49S|CTCFL_uc010gjk.1_Missense_Mutation_p.A49S|CTCFL_uc010gjl.1_Missense_Mutation_p.A49S	NM_080618	NP_542185	Q8NI51	CTCFL_HUMAN	CCCTC-binding factor-like protein	49					cell cycle|DNA methylation involved in gamete generation|histone methylation|positive regulation of transcription, DNA-dependent|regulation of gene expression by genetic imprinting|regulation of histone H3-K4 methylation|transcription, DNA-dependent	cytoplasm|nucleus	histone binding|sequence-specific DNA binding|transcription regulatory region DNA binding|zinc ion binding			ovary(2)|large_intestine(1)|skin(1)	4	Lung NSC(12;0.00132)|all_lung(29;0.00433)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(13;3.95e-12)|Epithelial(14;3.41e-08)|all cancers(14;2.09e-07)															---	---	---	---	capture		Missense_Mutation	SNP	56099117	56099117	4160	20	C	A	A	26	26	CTCFL	A	2	2
STX16	8675	broad.mit.edu	37	20	57242623	57242623	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:57242623A>G	uc002xzi.2	+	3	957	c.222A>G	c.(220-222)CCA>CCG	p.P74P	STX16_uc010zzq.1_5'UTR|STX16_uc002xzk.2_Silent_p.P57P|STX16_uc002xzm.2_Silent_p.P70P|STX16_uc002xzj.2_Silent_p.P53P|STX16_uc002xzl.2_5'UTR	NM_001001433	NP_001001433	O14662	STX16_HUMAN	syntaxin 16 isoform a	74	Cytoplasmic (Potential).				intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde transport, endosome to Golgi	Golgi membrane|integral to membrane|microsome|SNARE complex	SNAP receptor activity			ovary(1)	1	all_lung(29;0.0175)		BRCA - Breast invasive adenocarcinoma(13;3.73e-09)|Epithelial(14;8.54e-06)|all cancers(14;6.89e-05)															---	---	---	---	capture		Silent	SNP	57242623	57242623	15859	20	A	G	G	6	6	STX16	G	4	4
CDH4	1002	broad.mit.edu	37	20	60503462	60503462	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:60503462G>T	uc002ybn.1	+	12	2000	c.1986G>T	c.(1984-1986)TGG>TGT	p.W662C	CDH4_uc002ybp.1_Missense_Mutation_p.W588C	NM_001794	NP_001785	P55283	CADH4_HUMAN	cadherin 4, type 1 preproprotein	662	Extracellular (Potential).|Cadherin 5.				adherens junction organization|cell junction assembly		calcium ion binding			lung(3)|ovary(2)|skin(1)	6			BRCA - Breast invasive adenocarcinoma(19;2.36e-08)															---	---	---	---	capture		Missense_Mutation	SNP	60503462	60503462	3241	20	G	T	T	41	41	CDH4	T	2	2
MYT1	4661	broad.mit.edu	37	20	62842683	62842683	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62842683C>T	uc002yii.2	+	8	1780	c.1416C>T	c.(1414-1416)ATC>ATT	p.I472I	MYT1_uc002yih.2_Silent_p.I174I|MYT1_uc002yij.2_Silent_p.I104I	NM_004535	NP_004526	Q01538	MYT1_HUMAN	myelin transcription factor 1	472					cell differentiation|nervous system development	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2	all_cancers(38;1.82e-11)|all_epithelial(29;3.3e-13)|Lung NSC(23;5.21e-10)|all_lung(23;1.92e-09)																	---	---	---	---	capture		Silent	SNP	62842683	62842683	10501	20	C	T	T	30	30	MYT1	T	2	2
TPTE	7179	broad.mit.edu	37	21	10910396	10910396	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:10910396G>T	uc002yip.1	-	22	1728	c.1360C>A	c.(1360-1362)CTT>ATT	p.L454I	TPTE_uc002yis.1_RNA|TPTE_uc002yiq.1_Missense_Mutation_p.L436I|TPTE_uc002yir.1_Missense_Mutation_p.L416I|TPTE_uc010gkv.1_Missense_Mutation_p.L316I	NM_199261	NP_954870	P56180	TPTE_HUMAN	transmembrane phosphatase with tensin homology	454	C2 tensin-type.				signal transduction	integral to membrane	ion channel activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			ovary(2)|lung(1)|breast(1)|skin(1)	5			Colorectal(6;3.44e-05)|COAD - Colon adenocarcinoma(6;0.00727)|READ - Rectum adenocarcinoma(6;0.0723)	UCEC - Uterine corpus endometrioid carcinoma (6;0.0974)|all cancers(6;2.54e-22)|Epithelial(6;4.21e-19)|OV - Ovarian serous cystadenocarcinoma(6;1.16e-09)|BRCA - Breast invasive adenocarcinoma(6;7.72e-05)|Lung(8;0.000189)|LUSC - Lung squamous cell carcinoma(6;0.00379)|GBM - Glioblastoma multiforme(6;0.00391)|Kidney(17;0.0773)|LUAD - Lung adenocarcinoma(8;0.247)														---	---	---	---	capture		Missense_Mutation	SNP	10910396	10910396	16974	21	G	T	T	36	36	TPTE	T	2	2
LIPI	149998	broad.mit.edu	37	21	15554098	15554098	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:15554098G>C	uc002yjm.2	-	4	697	c.687C>G	c.(685-687)GTC>GTG	p.V229V	LIPI_uc010gkw.1_Silent_p.V162V	NM_198996	NP_945347	Q6XZB0	LIPI_HUMAN	lipase, member I	208					lipid catabolic process	extracellular region|extracellular space|membrane|plasma membrane	heparin binding|phospholipase activity			ovary(2)	2				Epithelial(23;0.000155)|COAD - Colon adenocarcinoma(22;0.0015)|Colorectal(24;0.00693)|Lung(58;0.166)														---	---	---	---	capture		Silent	SNP	15554098	15554098	9152	21	G	C	C	45	45	LIPI	C	3	3
JAM2	58494	broad.mit.edu	37	21	27066164	27066164	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:27066164C>A	uc002ylp.1	+	4	883	c.338C>A	c.(337-339)GCC>GAC	p.A113D	JAM2_uc011ace.1_Missense_Mutation_p.A113D|JAM2_uc002ylq.1_RNA|JAM2_uc011acf.1_Missense_Mutation_p.A77D|JAM2_uc010glh.1_RNA|JAM2_uc002ylr.1_Missense_Mutation_p.A113D|JAM2_uc010gli.1_Missense_Mutation_p.A113D	NM_021219	NP_067042	P57087	JAM2_HUMAN	junctional adhesion molecule 2 precursor	113	Ig-like V-type.|Extracellular (Potential).				blood coagulation|cell-cell adhesion|leukocyte migration	integral to plasma membrane|tight junction					0																		---	---	---	---	capture		Missense_Mutation	SNP	27066164	27066164	8247	21	C	A	A	26	26	JAM2	A	2	2
GABPA	2551	broad.mit.edu	37	21	27141330	27141330	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:27141330G>T	uc002ylx.3	+	10	1679	c.1152G>T	c.(1150-1152)GGG>GGT	p.G384G	GABPA_uc002yly.3_Silent_p.G384G	NM_002040	NP_002031	Q06546	GABPA_HUMAN	GA binding protein transcription factor, alpha	384	ETS.				positive regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	nucleus	protein heterodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription regulatory region DNA binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	27141330	27141330	6408	21	G	T	T	43	43	GABPA	T	2	2
APP	351	broad.mit.edu	37	21	27372439	27372439	+	Nonsense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:27372439G>C	uc002ylz.2	-	7	1124	c.924C>G	c.(922-924)TAC>TAG	p.Y308*	APP_uc010glk.2_Nonsense_Mutation_p.Y303*|APP_uc002yma.2_Nonsense_Mutation_p.Y308*|APP_uc011ach.1_Nonsense_Mutation_p.Y252*|APP_uc002ymb.2_Intron|APP_uc010glj.2_Intron|APP_uc011aci.1_Intron	NM_000484	NP_000475	P05067	A4_HUMAN	amyloid beta A4 protein isoform a precursor	308	Extracellular (Potential).|BPTI/Kunitz inhibitor.				adult locomotory behavior|axon cargo transport|axon midline choice point recognition|cell adhesion|cellular copper ion homeostasis|collateral sprouting in absence of injury|dendrite development|endocytosis|extracellular matrix organization|G2 phase of mitotic cell cycle|innate immune response|ionotropic glutamate receptor signaling pathway|mating behavior|mRNA polyadenylation|neuron apoptosis|neuron remodeling|Notch signaling pathway|platelet activation|platelet degranulation|positive regulation of mitotic cell cycle|protein phosphorylation|regulation of epidermal growth factor receptor activity|regulation of multicellular organism growth|regulation of synapse structure and activity|regulation of translation|visual learning	axon|cell surface|coated pit|dendritic shaft|dendritic spine|extracellular region|Golgi apparatus|integral to plasma membrane|platelet alpha granule lumen	acetylcholine receptor binding|DNA binding|heparin binding|identical protein binding|metal ion binding|protein binding|protein binding|PTB domain binding|serine-type endopeptidase inhibitor activity			ovary(1)	1		Breast(209;0.00295)																---	---	---	---	capture		Nonsense_Mutation	SNP	27372439	27372439	826	21	G	C	C	36	36	APP	C	5	3
SON	6651	broad.mit.edu	37	21	34924260	34924260	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:34924260C>T	uc002yse.1	+	3	2772	c.2723C>T	c.(2722-2724)TCA>TTA	p.S908L	SON_uc002ysb.1_Missense_Mutation_p.S908L|SON_uc002ysc.2_Missense_Mutation_p.S908L|SON_uc002ysd.2_Intron|SON_uc002ysf.1_Intron|SON_uc002ysg.2_5'Flank	NM_138927	NP_620305	P18583	SON_HUMAN	SON DNA-binding protein isoform F	908					anti-apoptosis|cytokinesis|mRNA processing|regulation of cell cycle|regulation of RNA splicing|RNA splicing|spindle pole body separation	nuclear speck	DNA binding|double-stranded RNA binding			ovary(4)|skin(2)	6																		---	---	---	---	capture		Missense_Mutation	SNP	34924260	34924260	15426	21	C	T	T	29	29	SON	T	2	2
KRTAP10-4	386672	broad.mit.edu	37	21	45994747	45994747	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45994747C>A	uc002zfk.1	+	1	1142	c.1112C>A	c.(1111-1113)CCC>CAC	p.P371H	C21orf29_uc002zfe.1_Intron|C21orf29_uc010gpv.1_Intron	NM_198687	NP_941960	P60372	KR104_HUMAN	keratin associated protein 10-4	371	36 X 5 AA repeats of C-C-X(3).					keratin filament					0																		---	---	---	---	capture		Missense_Mutation	SNP	45994747	45994747	8826	21	C	A	A	22	22	KRTAP10-4	A	2	2
COL18A1	80781	broad.mit.edu	37	21	46925829	46925829	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:46925829C>T	uc011afs.1	+	37	4422	c.4401C>T	c.(4399-4401)GCC>GCT	p.A1467A	COL18A1_uc002zhg.2_Silent_p.A1052A|COL18A1_uc002zhi.2_Silent_p.A1232A|SLC19A1_uc010gpy.1_Intron|COL18A1_uc002zhj.2_Silent_p.A33A|COL18A1_uc002zhk.2_5'Flank	NM_130444	NP_569711	P39060	COIA1_HUMAN	alpha 1 type XVIII collagen isoform 3 precursor	1470	Nonhelical region 11 (NC11).				cell adhesion|negative regulation of cell proliferation|organ morphogenesis|visual perception	collagen|extracellular space	extracellular matrix structural constituent|metal ion binding|protein binding			central_nervous_system(1)	1				Colorectal(79;0.0157)|READ - Rectum adenocarcinoma(84;0.0929)														---	---	---	---	capture		Silent	SNP	46925829	46925829	3813	21	C	T	T	23	23	COL18A1	T	1	1
PCNT	5116	broad.mit.edu	37	21	47836082	47836082	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:47836082A>T	uc002zji.3	+	30	6357	c.6250A>T	c.(6250-6252)ATG>TTG	p.M2084L	PCNT_uc002zjj.2_Missense_Mutation_p.M1966L	NM_006031	NP_006022	O95613	PCNT_HUMAN	pericentrin	2084					cilium assembly|G2/M transition of mitotic cell cycle	cytosol|microtubule	calmodulin binding			ovary(4)|breast(2)|pancreas(2)	8	Breast(49;0.112)																	---	---	---	---	capture		Missense_Mutation	SNP	47836082	47836082	12010	21	A	T	T	8	8	PCNT	T	4	4
DIP2A	23181	broad.mit.edu	37	21	47918562	47918562	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:47918562C>A	uc002zjo.2	+	5	654	c.471C>A	c.(469-471)CTC>CTA	p.L157L	DIP2A_uc011afy.1_Silent_p.L93L|DIP2A_uc011afz.1_Silent_p.L157L|DIP2A_uc002zjl.2_Silent_p.L157L|DIP2A_uc002zjm.2_Silent_p.L157L|DIP2A_uc010gql.2_Silent_p.L157L|DIP2A_uc002zjn.2_Silent_p.L157L	NM_015151	NP_055966	Q14689	DIP2A_HUMAN	disco-interacting protein 2A isoform a	157					multicellular organismal development	nucleus	catalytic activity|transcription factor binding			ovary(2)	2	Breast(49;0.0933)			Epithelial(3;3.12e-06)|OV - Ovarian serous cystadenocarcinoma(3;5.68e-06)|all cancers(3;4.08e-05)|Colorectal(79;0.0129)|COAD - Colon adenocarcinoma(84;0.0824)														---	---	---	---	capture		Silent	SNP	47918562	47918562	4706	21	C	A	A	30	30	DIP2A	A	2	2
GAB4	128954	broad.mit.edu	37	22	17447154	17447154	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:17447154G>T	uc002zlw.2	-	6	1232	c.1124C>A	c.(1123-1125)GCA>GAA	p.A375E	GAB4_uc010gqs.1_3'UTR	NM_001037814	NP_001032903	Q2WGN9	GAB4_HUMAN	GRB2-associated binding protein family, member	375										large_intestine(1)|ovary(1)	2		all_epithelial(15;0.112)|Lung NSC(13;0.248)																---	---	---	---	capture		Missense_Mutation	SNP	17447154	17447154	6402	22	G	T	T	46	46	GAB4	T	2	2
CLDN5	7122	broad.mit.edu	37	22	19511547	19511547	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19511547G>T	uc002zpu.2	-	2	702	c.487C>A	c.(487-489)CAG>AAG	p.Q163K	CLDN5_uc010grr.2_Missense_Mutation_p.Q163K	NM_003277	NP_003268	O00501	CLD5_HUMAN	claudin 5	78	Extracellular (Potential).				calcium-independent cell-cell adhesion	integral to membrane|tight junction	identical protein binding|structural molecule activity				0	Colorectal(54;0.0993)																	---	---	---	---	capture		Missense_Mutation	SNP	19511547	19511547	3625	22	G	T	T	46	46	CLDN5	T	2	2
PI4KA	5297	broad.mit.edu	37	22	21096603	21096603	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21096603G>A	uc002zsz.3	-	32	3711	c.3480C>T	c.(3478-3480)CCC>CCT	p.P1160P		NM_058004	NP_477352	P42356	PI4KA_HUMAN	phosphatidylinositol 4-kinase type 3 alpha	1160					phosphatidylinositol biosynthetic process|phosphatidylinositol-mediated signaling|synaptic transmission	Golgi-associated vesicle	1-phosphatidylinositol 4-kinase activity|ATP binding|protein binding			lung(2)|upper_aerodigestive_tract(1)|salivary_gland(1)	4	all_cancers(11;7.59e-25)|all_epithelial(7;1.34e-22)|Melanoma(16;0.000465)|Ovarian(15;0.00167)|Colorectal(54;0.0332)|all_neural(72;0.142)	Lung SC(17;0.0262)	LUSC - Lung squamous cell carcinoma(15;0.000536)|Lung(15;0.0108)|Epithelial(17;0.196)													OREG0026324	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	21096603	21096603	12297	22	G	A	A	43	43	PI4KA	A	2	2
CRKL	1399	broad.mit.edu	37	22	21288526	21288526	+	Silent	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21288526A>C	uc002ztf.2	+	2	1280	c.771A>C	c.(769-771)GCA>GCC	p.A257A	CRKL_uc002ztg.1_RNA	NM_005207	NP_005198	P46109	CRKL_HUMAN	v-crk sarcoma virus CT10 oncogene homolog	257	SH3 2.				JNK cascade|Ras protein signal transduction	cytosol	protein tyrosine kinase activity|SH3/SH2 adaptor activity|signal transducer activity				0	all_cancers(11;1.16e-25)|all_epithelial(7;3.37e-24)|Lung NSC(8;7.25e-16)|all_lung(8;1.37e-14)|Melanoma(16;0.000465)|Ovarian(15;0.00167)|Colorectal(54;0.0332)|all_neural(72;0.142)	Lung SC(17;0.0262)	LUSC - Lung squamous cell carcinoma(15;0.000204)|Lung(15;0.00494)|Epithelial(17;0.176)															---	---	---	---	capture		Silent	SNP	21288526	21288526	4024	22	A	C	C	8	8	CRKL	C	4	4
RTDR1	27156	broad.mit.edu	37	22	23401853	23401853	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:23401853C>A	uc002zwt.2	-	7	992	c.834G>T	c.(832-834)CTG>CTT	p.L278L		NM_014433	NP_055248	Q9UHP6	RTDR1_HUMAN	rhabdoid tumor deletion region protein 1	278							binding			ovary(1)	1	all_hematologic(9;0.0197)|Acute lymphoblastic leukemia(84;0.181)			READ - Rectum adenocarcinoma(21;0.175)														---	---	---	---	capture		Silent	SNP	23401853	23401853	14199	22	C	A	A	21	21	RTDR1	A	2	2
MYO18B	84700	broad.mit.edu	37	22	26224836	26224836	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26224836G>T	uc003abz.1	+	15	3130	c.2880G>T	c.(2878-2880)GCG>GCT	p.A960A	MYO18B_uc003aca.1_Silent_p.A841A|MYO18B_uc010guy.1_Silent_p.A841A|MYO18B_uc010guz.1_Silent_p.A841A|MYO18B_uc011aka.1_Silent_p.A114A|MYO18B_uc011akb.1_Silent_p.A473A	NM_032608	NP_115997	Q8IUG5	MY18B_HUMAN	myosin XVIIIB	960	Myosin head-like.					nucleus|sarcomere|unconventional myosin complex	actin binding|ATP binding|motor activity			ovary(5)|central_nervous_system(3)|large_intestine(2)|breast(2)	12																		---	---	---	---	capture		Silent	SNP	26224836	26224836	10461	22	G	T	T	39	39	MYO18B	T	1	1
CRYBA4	1413	broad.mit.edu	37	22	27026306	27026306	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:27026306G>T	uc003acz.3	+	6	481	c.446G>T	c.(445-447)TGG>TTG	p.W149L		NM_001886	NP_001877	P53673	CRBA4_HUMAN	crystallin, beta A4	149	Beta/gamma crystallin 'Greek key' 4.	Susceptible to oxidation.			camera-type eye development|visual perception	soluble fraction	structural constituent of eye lens				0																		---	---	---	---	capture		Missense_Mutation	SNP	27026306	27026306	4048	22	G	T	T	47	47	CRYBA4	T	2	2
GAS2L1	10634	broad.mit.edu	37	22	29707967	29707967	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:29707967C>T	uc003afa.1	+	7	1726	c.1527C>T	c.(1525-1527)CTC>CTT	p.L509L	GAS2L1_uc010gvm.1_Intron|GAS2L1_uc003afb.1_3'UTR|GAS2L1_uc003afc.1_Silent_p.L509L|GAS2L1_uc003afd.1_Missense_Mutation_p.S509L|GAS2L1_uc003afe.1_Missense_Mutation_p.S509L	NM_152236	NP_689422	Q99501	GA2L1_HUMAN	growth arrest-specific 2 like 1 isoform a	509					cell cycle arrest	cytoplasm|cytoskeleton					0																		---	---	---	---	capture		Silent	SNP	29707967	29707967	6510	22	C	T	T	31	31	GAS2L1	T	1	1
NF2	4771	broad.mit.edu	37	22	30035098	30035098	+	Nonsense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:30035098C>G	uc003age.3	+	3	703	c.260C>G	c.(259-261)TCA>TGA	p.S87*	NF2_uc003afy.3_Nonsense_Mutation_p.S87*|NF2_uc003afz.3_Intron|NF2_uc003agf.3_Nonsense_Mutation_p.S87*|NF2_uc003agb.3_Nonsense_Mutation_p.S10*|NF2_uc003agc.3_Nonsense_Mutation_p.S49*|NF2_uc003agd.3_Intron|NF2_uc003agg.3_Nonsense_Mutation_p.S87*|NF2_uc003aga.3_Nonsense_Mutation_p.S45*|NF2_uc003agh.3_Intron|NF2_uc003agi.3_Intron|NF2_uc003agj.3_Nonsense_Mutation_p.S87*|NF2_uc003agk.3_Nonsense_Mutation_p.S49*	NM_000268	NP_000259	P35240	MERL_HUMAN	neurofibromin 2 isoform 1	87	FERM.				actin cytoskeleton organization|negative regulation of cell migration|negative regulation of cell proliferation|negative regulation of cell-cell adhesion|negative regulation of cell-matrix adhesion|negative regulation of DNA replication|negative regulation of tyrosine phosphorylation of Stat3 protein|negative regulation of tyrosine phosphorylation of Stat5 protein|positive regulation of stress fiber assembly|regulation of hippo signaling cascade|Schwann cell proliferation	cytoskeleton|early endosome|extrinsic to membrane|filopodium membrane|nucleolus|perinuclear region of cytoplasm|ruffle membrane	cytoskeletal protein binding|protein binding	p.H84_F100del(1)|p.V86_Q111>E(1)|p.S87fs*36(1)|p.S87*(1)		meninges(372)|soft_tissue(284)|central_nervous_system(20)|kidney(10)|pleura(9)|skin(7)|large_intestine(5)|breast(5)|urinary_tract(3)|thyroid(2)|endometrium(2)|ovary(2)|lung(2)|stomach(2)|bone(2)|pituitary(1)	728								D|Mis|N|F|S|O		meningioma|acoustic neuroma|renal 	meningioma|acoustic neuroma			Neurofibromatosis_type_2				---	---	---	---	capture		Nonsense_Mutation	SNP	30035098	30035098	10757	22	C	G	G	29	29	NF2	G	5	3
MYH9	4627	broad.mit.edu	37	22	36691011	36691011	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:36691011C>A	uc003apg.2	-	27	3828	c.3597G>T	c.(3595-3597)GAG>GAT	p.E1199D		NM_002473	NP_002464	P35579	MYH9_HUMAN	myosin, heavy polypeptide 9, non-muscle	1199	Potential.				actin cytoskeleton reorganization|actin filament-based movement|angiogenesis|axon guidance|blood vessel endothelial cell migration|cytokinesis|integrin-mediated signaling pathway|leukocyte migration|membrane protein ectodomain proteolysis|monocyte differentiation|platelet formation|protein transport|regulation of cell shape	actomyosin contractile ring|cleavage furrow|cytosol|myosin complex|nucleus|ruffle|stress fiber|uropod	actin filament binding|actin-dependent ATPase activity|ADP binding|ATP binding|calmodulin binding|microfilament motor activity|protein anchor|protein homodimerization activity			breast(3)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|lung(1)|skin(1)|kidney(1)|pancreas(1)	11								T	ALK	ALCL		Deafness|autosomal dominant 17|Epstein syndrome|Fechtner syndrome|May-Hegglin anomaly|Sebastian syndrome		Hereditary_Macrothrombocytopenia_MYH9-associated				---	---	---	---	capture		Missense_Mutation	SNP	36691011	36691011	10437	22	C	A	A	24	24	MYH9	A	2	2
MYH9	4627	broad.mit.edu	37	22	36692951	36692951	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:36692951C>A	uc003apg.2	-	25	3441	c.3210G>T	c.(3208-3210)CAG>CAT	p.Q1070H		NM_002473	NP_002464	P35579	MYH9_HUMAN	myosin, heavy polypeptide 9, non-muscle	1070	Potential.		Missing (in MHA and SBS).		actin cytoskeleton reorganization|actin filament-based movement|angiogenesis|axon guidance|blood vessel endothelial cell migration|cytokinesis|integrin-mediated signaling pathway|leukocyte migration|membrane protein ectodomain proteolysis|monocyte differentiation|platelet formation|protein transport|regulation of cell shape	actomyosin contractile ring|cleavage furrow|cytosol|myosin complex|nucleus|ruffle|stress fiber|uropod	actin filament binding|actin-dependent ATPase activity|ADP binding|ATP binding|calmodulin binding|microfilament motor activity|protein anchor|protein homodimerization activity			breast(3)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|lung(1)|skin(1)|kidney(1)|pancreas(1)	11								T	ALK	ALCL		Deafness|autosomal dominant 17|Epstein syndrome|Fechtner syndrome|May-Hegglin anomaly|Sebastian syndrome		Hereditary_Macrothrombocytopenia_MYH9-associated				---	---	---	---	capture		Missense_Mutation	SNP	36692951	36692951	10437	22	C	A	A	32	32	MYH9	A	2	2
TRIOBP	11078	broad.mit.edu	37	22	38130844	38130844	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38130844G>A	uc003atr.2	+	9	4772	c.4501G>A	c.(4501-4503)GAG>AAG	p.E1501K	TRIOBP_uc003atu.2_Missense_Mutation_p.E1329K	NM_001039141	NP_001034230	Q9H2D6	TARA_HUMAN	TRIO and F-actin binding protein isoform 6	1501					actin modification|barbed-end actin filament capping	actin cytoskeleton|cytoplasm|nucleus	actin binding|GTP-Rho binding|myosin II binding|protein binding|ubiquitin protein ligase binding			central_nervous_system(1)	1	Melanoma(58;0.0574)																	---	---	---	---	capture		Missense_Mutation	SNP	38130844	38130844	17103	22	G	A	A	45	45	TRIOBP	A	2	2
TRIOBP	11078	broad.mit.edu	37	22	38130997	38130997	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38130997G>C	uc003atr.2	+	9	4925	c.4654G>C	c.(4654-4656)GAG>CAG	p.E1552Q	TRIOBP_uc003atu.2_Missense_Mutation_p.E1380Q	NM_001039141	NP_001034230	Q9H2D6	TARA_HUMAN	TRIO and F-actin binding protein isoform 6	1552					actin modification|barbed-end actin filament capping	actin cytoskeleton|cytoplasm|nucleus	actin binding|GTP-Rho binding|myosin II binding|protein binding|ubiquitin protein ligase binding			central_nervous_system(1)	1	Melanoma(58;0.0574)															OREG0026548	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	38130997	38130997	17103	22	G	C	C	45	45	TRIOBP	C	3	3
TRIOBP	11078	broad.mit.edu	37	22	38131246	38131246	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38131246G>A	uc003atr.2	+	9	5174	c.4903G>A	c.(4903-4905)GAG>AAG	p.E1635K	TRIOBP_uc003atu.2_Missense_Mutation_p.E1463K	NM_001039141	NP_001034230	Q9H2D6	TARA_HUMAN	TRIO and F-actin binding protein isoform 6	1635					actin modification|barbed-end actin filament capping	actin cytoskeleton|cytoplasm|nucleus	actin binding|GTP-Rho binding|myosin II binding|protein binding|ubiquitin protein ligase binding			central_nervous_system(1)	1	Melanoma(58;0.0574)															OREG0026548	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	38131246	38131246	17103	22	G	A	A	37	37	TRIOBP	A	1	1
PDGFB	5155	broad.mit.edu	37	22	39629506	39629506	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:39629506G>A	uc003axf.2	-	3	1173	c.184C>T	c.(184-186)CTG>TTG	p.L62L	PDGFB_uc003axe.2_Silent_p.L47L	NM_002608	NP_002599	P01127	PDGFB_HUMAN	platelet-derived growth factor beta isoform 1	62					activation of protein kinase B activity|cellular response to mycophenolic acid|embryonic placenta development|heart development|hemopoiesis|metanephric glomerular mesangial cell development|monocyte chemotaxis|negative regulation of phosphatidylinositol biosynthetic process|negative regulation of platelet activation|negative regulation of transcription, DNA-dependent|paracrine signaling|peptidyl-serine phosphorylation|peptidyl-tyrosine phosphorylation|platelet activation|platelet degranulation|positive regulation of blood vessel endothelial cell migration|positive regulation of calcium ion import|positive regulation of cell division|positive regulation of chemotaxis|positive regulation of cyclin-dependent protein kinase activity|positive regulation of DNA biosynthetic process|positive regulation of DNA replication|positive regulation of endothelial cell proliferation|positive regulation of ERK1 and ERK2 cascade|positive regulation of fibroblast proliferation|positive regulation of glomerular filtration|positive regulation of glomerular mesangial cell proliferation|positive regulation of MAP kinase activity|positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway|positive regulation of mitosis|positive regulation of phosphatidylinositol 3-kinase activity|positive regulation of phosphatidylinositol 3-kinase cascade|positive regulation of protein autophosphorylation|positive regulation of protein tyrosine kinase activity|positive regulation of reactive oxygen species metabolic process|positive regulation of smooth muscle cell migration|positive regulation of smooth muscle cell proliferation|positive regulation of transcription, DNA-dependent|reactive oxygen species metabolic process|transforming growth factor beta receptor signaling pathway	basolateral plasma membrane|cell surface|endoplasmic reticulum lumen|extracellular region|Golgi membrane|platelet alpha granule lumen	collagen binding|eukaryotic cell surface binding|growth factor activity|platelet-derived growth factor binding|platelet-derived growth factor receptor binding|protein heterodimerization activity|protein homodimerization activity|superoxide-generating NADPH oxidase activator activity		COL1A1/PDGFB(372)	soft_tissue(372)|central_nervous_system(1)	373	Melanoma(58;0.04)				Becaplermin(DB00102)			T	COL1A1	DFSP								---	---	---	---	capture		Silent	SNP	39629506	39629506	12079	22	G	A	A	35	35	PDGFB	A	2	2
FAM116B	414918	broad.mit.edu	37	22	50750580	50750580	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50750580C>T	uc011aru.1	-	21	1818	c.1746G>A	c.(1744-1746)TTG>TTA	p.L582L	FAM116B_uc011arv.1_Silent_p.L582L	NM_001001794	NP_001001794	Q8NEG7	F116B_HUMAN	family with sequence similarity 116, member B	582											0		all_cancers(38;4.34e-09)|all_epithelial(38;3.03e-08)|all_lung(38;0.00141)|Breast(42;0.00387)|Lung NSC(38;0.0199)|Ovarian(80;0.104)|Lung SC(80;0.162)|Hepatocellular(38;0.178)		BRCA - Breast invasive adenocarcinoma(115;0.205)|LUAD - Lung adenocarcinoma(64;0.247)														---	---	---	---	capture		Silent	SNP	50750580	50750580	5605	22	C	T	T	17	17	FAM116B	T	2	2
IL5RA	3568	broad.mit.edu	37	3	3139615	3139615	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:3139615G>T	uc011ask.1	-	8	1292	c.648C>A	c.(646-648)AAC>AAA	p.N216K	IL5RA_uc010hbq.2_Missense_Mutation_p.N216K|IL5RA_uc010hbr.2_Intron|IL5RA_uc010hbs.2_Missense_Mutation_p.N216K|IL5RA_uc011asl.1_Missense_Mutation_p.N216K|IL5RA_uc011asm.1_Missense_Mutation_p.N216K|IL5RA_uc010hbt.2_Missense_Mutation_p.N216K|IL5RA_uc011asn.1_Missense_Mutation_p.N216K|IL5RA_uc010hbu.2_Missense_Mutation_p.N216K	NM_000564	NP_000555	Q01344	IL5RA_HUMAN	interleukin 5 receptor, alpha isoform 1	216	Extracellular (Potential).				cell proliferation	extracellular space|integral to membrane|plasma membrane	interleukin-5 receptor activity			ovary(1)	1				Epithelial(13;0.00278)|all cancers(10;0.00809)|OV - Ovarian serous cystadenocarcinoma(96;0.00944)														---	---	---	---	capture		Missense_Mutation	SNP	3139615	3139615	8001	3	G	T	T	40	40	IL5RA	T	1	1
SUMF1	285362	broad.mit.edu	37	3	4459813	4459813	+	Silent	SNP	C	A	A	rs141957829		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:4459813C>A	uc003bpz.1	-	5	631	c.606G>T	c.(604-606)CCG>CCT	p.P202P	SUMF1_uc003bps.1_RNA|SUMF1_uc011ass.1_Silent_p.P177P|SUMF1_uc010hby.1_Silent_p.P202P|SUMF1_uc011ast.1_Intron	NM_182760	NP_877437	Q8NBK3	SUMF1_HUMAN	sulfatase modifying factor 1 isoform 1	202						endoplasmic reticulum lumen	metal ion binding|oxidoreductase activity			upper_aerodigestive_tract(1)	1		Melanoma(143;0.068)|Colorectal(144;0.233)		Epithelial(13;0.0147)|OV - Ovarian serous cystadenocarcinoma(96;0.0444)|all cancers(10;0.0549)														---	---	---	---	capture		Silent	SNP	4459813	4459813	15905	3	C	A	A	23	23	SUMF1	A	1	1
BRPF1	7862	broad.mit.edu	37	3	9782562	9782562	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:9782562G>T	uc003bse.2	+	4	2058	c.1659G>T	c.(1657-1659)GGG>GGT	p.G553G	BRPF1_uc003bsf.2_Silent_p.G553G|BRPF1_uc003bsg.2_Silent_p.G553G|BRPF1_uc011ati.1_Silent_p.G553G	NM_004634	NP_004625	P55201	BRPF1_HUMAN	bromodomain and PHD finger-containing protein 1	553	Required for RUNX1 and RUNX2 transcriptional activation.|Interaction with MEAF6 and ING5.				histone H3 acetylation|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|MOZ/MORF histone acetyltransferase complex|plasma membrane	DNA binding|zinc ion binding			ovary(2)|central_nervous_system(1)	3	Medulloblastoma(99;0.227)																	---	---	---	---	capture		Silent	SNP	9782562	9782562	1551	3	G	T	T	43	43	BRPF1	T	2	2
SLC6A11	6538	broad.mit.edu	37	3	10861482	10861482	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10861482C>A	uc003bvz.2	+	3	511	c.477C>A	c.(475-477)AGC>AGA	p.S159R	SLC6A11_uc003bvy.1_Missense_Mutation_p.S159R	NM_014229	NP_055044	P48066	S6A11_HUMAN	solute carrier family 6 (neurotransmitter	159	Extracellular (Potential).				neurotransmitter secretion	integral to plasma membrane	gamma-aminobutyric acid:sodium symporter activity|neurotransmitter:sodium symporter activity			skin(3)|ovary(1)	4				OV - Ovarian serous cystadenocarcinoma(96;0.229)														---	---	---	---	capture		Missense_Mutation	SNP	10861482	10861482	15171	3	C	A	A	25	25	SLC6A11	A	2	2
ATG7	10533	broad.mit.edu	37	3	11383696	11383696	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:11383696C>G	uc003bwc.2	+	11	1185	c.1068C>G	c.(1066-1068)GTC>GTG	p.V356V	ATG7_uc003bwd.2_Silent_p.V356V|ATG7_uc011aum.1_Silent_p.V317V	NM_006395	NP_006386	O95352	ATG7_HUMAN	APG7 autophagy 7-like isoform a	356					autophagy|cellular membrane fusion|positive regulation of protein modification process|protein lipidation|protein transport	cytoplasm	APG12 activating enzyme activity|protein homodimerization activity|ubiquitin activating enzyme activity			central_nervous_system(1)	1																		---	---	---	---	capture		Silent	SNP	11383696	11383696	1120	3	C	G	G	29	29	ATG7	G	3	3
GALNTL2	117248	broad.mit.edu	37	3	16254180	16254180	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:16254180G>A	uc003car.3	+	6	1777	c.1302G>A	c.(1300-1302)CTG>CTA	p.L434L	GALNTL2_uc003caq.3_Silent_p.L167L	NM_054110	NP_473451	Q8N3T1	GLTL2_HUMAN	UDP-N-acetyl-alpha-D-galactosamine:polypeptide	434	Lumenal (Potential).					Golgi membrane|integral to membrane|transport vesicle	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			breast(1)	1																		---	---	---	---	capture		Silent	SNP	16254180	16254180	6486	3	G	A	A	45	45	GALNTL2	A	2	2
NEK10	152110	broad.mit.edu	37	3	27244048	27244048	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:27244048G>A	uc010hfk.2	-	3	256	c.27C>T	c.(25-27)CCC>CCT	p.P9P	NEK10_uc003cds.1_Silent_p.C94C|NEK10_uc010hfj.2_Silent_p.P9P			Q6ZWH5	NEK10_HUMAN	RecName: Full=Serine/threonine-protein kinase Nek10;          EC=2.7.11.1; AltName: Full=NimA-related protein kinase 10;	Error:Variant_position_missing_in_Q6ZWH5_after_alignment							ATP binding|metal ion binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(5)|stomach(2)|central_nervous_system(2)|lung(2)|skin(1)|pancreas(1)	13																		---	---	---	---	capture		Silent	SNP	27244048	27244048	10721	3	G	A	A	42	42	NEK10	A	2	2
STAC	6769	broad.mit.edu	37	3	36422172	36422172	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:36422172G>T	uc003cgh.1	+	1	76	c.37G>T	c.(37-39)GAC>TAC	p.D13Y	STAC_uc010hgd.1_RNA|STAC_uc011aya.1_Missense_Mutation_p.D13Y	NM_003149	NP_003140	Q99469	STAC_HUMAN	SH3 and cysteine rich domain	13					intracellular signal transduction	cytoplasm|soluble fraction	metal ion binding			skin(2)|ovary(1)|pancreas(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	36422172	36422172	15757	3	G	T	T	41	41	STAC	T	2	2
SCN10A	6336	broad.mit.edu	37	3	38770299	38770299	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38770299T>C	uc003ciq.2	-	15	2374	c.2374A>G	c.(2374-2376)ATC>GTC	p.I792V		NM_006514	NP_006505	Q9Y5Y9	SCNAA_HUMAN	sodium channel, voltage-gated, type X, alpha	792	Helical; Name=S5 of repeat II; (Potential).|II.				sensory perception	voltage-gated sodium channel complex				ovary(5)|skin(3)|large_intestine(1)|kidney(1)	10				KIRC - Kidney renal clear cell carcinoma(284;0.0769)|Kidney(284;0.0945)	Benzocaine(DB01086)|Bupivacaine(DB00297)|Chloroprocaine(DB01161)|Cocaine(DB00907)|Dibucaine(DB00527)|Dyclonine(DB00645)|Hexylcaine(DB00473)|Levobupivacaine(DB01002)|Lidocaine(DB00281)|Mepivacaine(DB00961)|Oxybuprocaine(DB00892)|Procaine(DB00721)|Proparacaine(DB00807)|Ropivacaine(DB00296)													---	---	---	---	capture		Missense_Mutation	SNP	38770299	38770299	14394	3	T	C	C	51	51	SCN10A	C	4	4
SCN10A	6336	broad.mit.edu	37	3	38781048	38781048	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38781048C>A	uc003ciq.2	-	14	2238	c.2238G>T	c.(2236-2238)GTG>GTT	p.V746V		NM_006514	NP_006505	Q9Y5Y9	SCNAA_HUMAN	sodium channel, voltage-gated, type X, alpha	746	Helical; Name=S3 of repeat II; (Potential).|II.				sensory perception	voltage-gated sodium channel complex				ovary(5)|skin(3)|large_intestine(1)|kidney(1)	10				KIRC - Kidney renal clear cell carcinoma(284;0.0769)|Kidney(284;0.0945)	Benzocaine(DB01086)|Bupivacaine(DB00297)|Chloroprocaine(DB01161)|Cocaine(DB00907)|Dibucaine(DB00527)|Dyclonine(DB00645)|Hexylcaine(DB00473)|Levobupivacaine(DB01002)|Lidocaine(DB00281)|Mepivacaine(DB00961)|Oxybuprocaine(DB00892)|Procaine(DB00721)|Proparacaine(DB00807)|Ropivacaine(DB00296)													---	---	---	---	capture		Silent	SNP	38781048	38781048	14394	3	C	A	A	21	21	SCN10A	A	2	2
SCN11A	11280	broad.mit.edu	37	3	38968411	38968411	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38968411G>A	uc011ays.1	-	4	699	c.500C>T	c.(499-501)ACT>ATT	p.T167I		NM_014139	NP_054858	Q9UI33	SCNBA_HUMAN	sodium channel, voltage-gated, type XI, alpha	167	Helical; Name=S2 of repeat I; (By similarity).|I.				response to drug	voltage-gated sodium channel complex	voltage-gated sodium channel activity			skin(6)|ovary(1)|haematopoietic_and_lymphoid_tissue(1)|pancreas(1)	9				Kidney(284;0.00202)|KIRC - Kidney renal clear cell carcinoma(284;0.00226)	Cocaine(DB00907)													---	---	---	---	capture		Missense_Mutation	SNP	38968411	38968411	14395	3	G	A	A	36	36	SCN11A	A	2	2
CX3CR1	1524	broad.mit.edu	37	3	39307072	39307072	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:39307072T>A	uc003cjl.2	-	2	1021	c.929A>T	c.(928-930)AAA>ATA	p.K310I		NM_001337	NP_001328	P49238	CX3C1_HUMAN	chemokine (C-X3-C motif) receptor 1	310	Cytoplasmic (Potential).				cell adhesion|cellular defense response|chemotaxis|interspecies interaction between organisms|response to wounding	integral to plasma membrane	chemokine receptor activity			lung(3)	3				KIRC - Kidney renal clear cell carcinoma(284;0.0557)|Kidney(284;0.0699)														---	---	---	---	capture		Missense_Mutation	SNP	39307072	39307072	4235	3	T	A	A	64	64	CX3CR1	A	4	4
ZNF621	285268	broad.mit.edu	37	3	40571728	40571728	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:40571728G>A	uc003ckm.2	+	4	396	c.180G>A	c.(178-180)CTG>CTA	p.L60L	ZNF621_uc003ckn.2_Silent_p.L60L|ZNF621_uc003cko.2_Silent_p.L25L|ZNF621_uc011aze.1_Silent_p.L52L	NM_001098414	NP_001091884	Q6ZSS3	ZN621_HUMAN	zinc finger protein 621	60	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.0515)|Kidney(284;0.0648)														---	---	---	---	capture		Silent	SNP	40571728	40571728	18640	3	G	A	A	45	45	ZNF621	A	2	2
RTP3	83597	broad.mit.edu	37	3	46541960	46541960	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:46541960C>A	uc003cps.1	+	2	338	c.270C>A	c.(268-270)ACC>ACA	p.T90T		NM_031440	NP_113628	Q9BQQ7	RTP3_HUMAN	transmembrane protein 7	90	Cytoplasmic (Potential).				detection of chemical stimulus involved in sensory perception of bitter taste|protein targeting to membrane	cytoplasm|integral to membrane	protein binding			ovary(2)	2				BRCA - Breast invasive adenocarcinoma(193;0.00114)|KIRC - Kidney renal clear cell carcinoma(197;0.0173)|Kidney(197;0.0204)														---	---	---	---	capture		Silent	SNP	46541960	46541960	14215	3	C	A	A	22	22	RTP3	A	2	2
PTH1R	5745	broad.mit.edu	37	3	46945048	46945048	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:46945048G>A	uc003cqm.2	+	16	1887	c.1684G>A	c.(1684-1686)GGG>AGG	p.G562R	PTH1R_uc003cqn.2_Missense_Mutation_p.G562R	NM_000316	NP_000307	Q03431	PTH1R_HUMAN	parathyroid hormone receptor 1 precursor	562	Cytoplasmic (Potential).					cytoplasm|integral to plasma membrane|nucleus	parathyroid hormone receptor activity|peptide hormone binding|protein self-association			breast(1)	1														Ollier_disease_/_Maffuci_syndrome				---	---	---	---	capture		Missense_Mutation	SNP	46945048	46945048	13213	3	G	A	A	47	47	PTH1R	A	2	2
CCDC51	79714	broad.mit.edu	37	3	48473987	48473987	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48473987G>T	uc003csz.2	-	4	1188	c.1067C>A	c.(1066-1068)GCT>GAT	p.A356D	PLXNB1_uc003csx.2_5'Flank|CCDC51_uc003cta.2_Missense_Mutation_p.A247D|CCDC51_uc003ctb.2_Missense_Mutation_p.A247D|CCDC51_uc003ctc.2_Missense_Mutation_p.A356D|CCDC51_uc003ctd.2_Missense_Mutation_p.A247D	NM_024661	NP_078937	Q96ER9	CCD51_HUMAN	coiled-coil domain containing 51	356						integral to membrane					0				BRCA - Breast invasive adenocarcinoma(193;0.000293)|KIRC - Kidney renal clear cell carcinoma(197;0.00551)|Kidney(197;0.00621)														---	---	---	---	capture		Missense_Mutation	SNP	48473987	48473987	2944	3	G	T	T	34	34	CCDC51	T	2	2
BSN	8927	broad.mit.edu	37	3	49689900	49689900	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49689900C>A	uc003cxe.3	+	5	3025	c.2911C>A	c.(2911-2913)CCT>ACT	p.P971T		NM_003458	NP_003449	Q9UPA5	BSN_HUMAN	bassoon protein	971					synaptic transmission	cell junction|cytoplasm|cytoskeleton|nucleus|synaptosome	metal ion binding			ovary(5)|pancreas(1)|central_nervous_system(1)|skin(1)	8				BRCA - Breast invasive adenocarcinoma(193;6.66e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.0032)|Kidney(197;0.00336)														---	---	---	---	capture		Missense_Mutation	SNP	49689900	49689900	1561	3	C	A	A	22	22	BSN	A	2	2
PRICKLE2	166336	broad.mit.edu	37	3	64142967	64142967	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:64142967C>A	uc003dmf.2	-	5	1057	c.471G>T	c.(469-471)CCG>CCT	p.P157P		NM_198859	NP_942559	Q7Z3G6	PRIC2_HUMAN	prickle-like 2	157	LIM zinc-binding 1.					cytoplasm|nuclear membrane	zinc ion binding			ovary(4)|skin(1)	5		Lung NSC(201;0.136)		BRCA - Breast invasive adenocarcinoma(55;0.000971)|KIRC - Kidney renal clear cell carcinoma(15;0.00443)|Kidney(15;0.00497)														---	---	---	---	capture		Silent	SNP	64142967	64142967	12930	3	C	A	A	27	27	PRICKLE2	A	1	1
ADAMTS9	56999	broad.mit.edu	37	3	64547256	64547256	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:64547256C>T	uc003dmg.2	-	30	4728	c.4696G>A	c.(4696-4698)GAA>AAA	p.E1566K	ADAMTS9_uc011bfo.1_Missense_Mutation_p.E1538K|ADAMTS9_uc003dmh.1_Missense_Mutation_p.E1395K|ADAMTS9_uc011bfp.1_Missense_Mutation_p.E477K|uc003dmi.1_5'Flank	NM_182920	NP_891550	Q9P2N4	ATS9_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1566	TSP type-1 13.				glycoprotein catabolic process|multicellular organismal development|proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(2)|urinary_tract(1)|skin(1)	4		Lung NSC(201;0.00682)		BRCA - Breast invasive adenocarcinoma(55;0.00142)|Kidney(15;0.00202)|KIRC - Kidney renal clear cell carcinoma(15;0.00221)														---	---	---	---	capture		Missense_Mutation	SNP	64547256	64547256	274	3	C	T	T	32	32	ADAMTS9	T	2	2
LRIG1	26018	broad.mit.edu	37	3	66502051	66502051	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:66502051G>C	uc003dmx.2	-	3	311	c.297C>G	c.(295-297)CTC>CTG	p.L99L	LRIG1_uc010hnz.2_5'UTR|LRIG1_uc010hoa.2_Silent_p.L99L	NM_015541	NP_056356	Q96JA1	LRIG1_HUMAN	leucine-rich repeats and immunoglobulin-like	99	Extracellular (Potential).|LRR 2.					integral to membrane				skin(3)|ovary(2)	5		Lung NSC(201;0.0101)		BRCA - Breast invasive adenocarcinoma(55;0.00047)														---	---	---	---	capture		Silent	SNP	66502051	66502051	9317	3	G	C	C	45	45	LRIG1	C	3	3
EPHA6	285220	broad.mit.edu	37	3	97356890	97356890	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97356890G>C	uc010how.1	+	14	2791	c.2748G>C	c.(2746-2748)GTG>GTC	p.V916V	EPHA6_uc011bgp.1_3'UTR|EPHA6_uc003drs.3_Silent_p.V308V|EPHA6_uc003drr.3_Silent_p.V308V|EPHA6_uc003drt.2_Silent_p.V308V|EPHA6_uc010hox.1_RNA	NM_001080448	NP_001073917	Q9UF33	EPHA6_HUMAN	EPH receptor A6 isoform a	821	Protein kinase.|Cytoplasmic (Potential).					integral to plasma membrane	ATP binding|ephrin receptor activity			stomach(5)|lung(4)|central_nervous_system(3)|breast(1)|skin(1)|ovary(1)|kidney(1)	16																		---	---	---	---	capture		Silent	SNP	97356890	97356890	5364	3	G	C	C	46	46	EPHA6	C	3	3
OR5H6	79295	broad.mit.edu	37	3	97983218	97983218	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97983218C>T	uc003dsi.1	+	1	90	c.90C>T	c.(88-90)CTC>CTT	p.L30L		NM_001005479	NP_001005479	Q8NGV6	OR5H6_HUMAN	olfactory receptor, family 5, subfamily H,	30	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|large_intestine(1)	3																		---	---	---	---	capture		Silent	SNP	97983218	97983218	11573	3	C	T	T	29	29	OR5H6	T	2	2
OR5H6	79295	broad.mit.edu	37	3	97983944	97983944	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97983944C>A	uc003dsi.1	+	1	816	c.816C>A	c.(814-816)ACC>ACA	p.T272T		NM_001005479	NP_001005479	Q8NGV6	OR5H6_HUMAN	olfactory receptor, family 5, subfamily H,	272	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|large_intestine(1)	3																		---	---	---	---	capture		Silent	SNP	97983944	97983944	11573	3	C	A	A	24	24	OR5H6	A	2	2
TMEM45A	55076	broad.mit.edu	37	3	100287758	100287758	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100287758G>T	uc003dtz.1	+	5	994	c.681G>T	c.(679-681)TGG>TGT	p.W227C	TMEM45A_uc003dua.1_Missense_Mutation_p.W243C|TMEM45A_uc003dub.1_RNA	NM_018004	NP_060474	Q9NWC5	TM45A_HUMAN	transmembrane protein 45A	227	Helical; (Potential).					integral to membrane				skin(2)|ovary(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	100287758	100287758	16708	3	G	T	T	42	42	TMEM45A	T	2	2
RG9MTD1	54931	broad.mit.edu	37	3	101283908	101283908	+	Nonsense_Mutation	SNP	A	T	T	rs71684018		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:101283908A>T	uc003duz.2	+	2	431	c.283A>T	c.(283-285)AGA>TGA	p.R95*		NM_017819	NP_060289	Q7L0Y3	MRRP1_HUMAN	RNA (guanine-9-) methyltransferase domain	95					tRNA processing	mitochondrion	methyltransferase activity|protein binding			ovary(1)	1																		---	---	---	---	capture		Nonsense_Mutation	SNP	101283908	101283908	13744	3	A	T	T	7	7	RG9MTD1	T	5	4
ALCAM	214	broad.mit.edu	37	3	105252517	105252517	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:105252517T>A	uc003dvx.2	+	5	1070	c.530T>A	c.(529-531)CTA>CAA	p.L177Q	ALCAM_uc003dvw.1_Missense_Mutation_p.L177Q|ALCAM_uc003dvy.2_Missense_Mutation_p.L177Q|ALCAM_uc011bhh.1_Missense_Mutation_p.L126Q|ALCAM_uc010hpp.2_5'UTR	NM_001627	NP_001618	Q13740	CD166_HUMAN	activated leukocyte cell adhesion molecule	177	Extracellular (Potential).|Ig-like V-type 2.				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(2)|breast(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	105252517	105252517	490	3	T	A	A	53	53	ALCAM	A	4	4
DPPA4	55211	broad.mit.edu	37	3	109047846	109047846	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:109047846C>A	uc003dxq.3	-	6	824	c.769G>T	c.(769-771)GTT>TTT	p.V257F	DPPA4_uc011bho.1_Missense_Mutation_p.G158V	NM_018189	NP_060659	Q7L190	DPPA4_HUMAN	developmental pluripotency associated 4	257						nucleus	protein binding			upper_aerodigestive_tract(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	109047846	109047846	4920	3	C	A	A	18	18	DPPA4	A	2	2
SIDT1	54847	broad.mit.edu	37	3	113329854	113329854	+	Splice_Site	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113329854G>C	uc003eak.2	+	18	2372	c.1721_splice	c.e18-1	p.D574_splice	SIDT1_uc011bif.1_Splice_Site|SIDT1_uc003eaj.1_Splice_Site_p.D574_splice|SIDT1_uc011big.1_Splice_Site_p.D327_splice|SIDT1_uc011bih.1_Splice_Site|SIDT1_uc011bii.1_Splice_Site_p.D27_splice	NM_017699	NP_060169			SID1 transmembrane family, member 1 precursor							integral to membrane				ovary(3)|pancreas(1)|skin(1)	5																		---	---	---	---	capture		Splice_Site	SNP	113329854	113329854	14797	3	G	C	C	33	33	SIDT1	C	5	3
LSAMP	4045	broad.mit.edu	37	3	115571360	115571360	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:115571360C>T	uc003ebt.2	-	4	1119	c.619G>A	c.(619-621)GAT>AAT	p.D207N	LSAMP_uc011bis.1_Missense_Mutation_p.D207N	NM_002338	NP_002329	Q13449	LSAMP_HUMAN	limbic system-associated membrane protein	207	Ig-like C2-type 2.				cell adhesion|nervous system development	anchored to membrane|plasma membrane					0		all_cancers(1;0.00189)|all_epithelial(1;0.0366)|Myeloproliferative disorder(1037;0.17)|all_neural(597;0.208)|Lung NSC(201;0.215)		GBM - Glioblastoma multiforme(114;0.00117)|LUSC - Lung squamous cell carcinoma(41;0.0407)|Lung(219;0.152)														---	---	---	---	capture		Missense_Mutation	SNP	115571360	115571360	9424	3	C	T	T	30	30	LSAMP	T	2	2
STXBP5L	9515	broad.mit.edu	37	3	120977893	120977893	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:120977893G>T	uc003eec.3	+	18	1976	c.1836G>T	c.(1834-1836)GTG>GTT	p.V612V	STXBP5L_uc011bji.1_Silent_p.V612V	NM_014980	NP_055795	Q9Y2K9	STB5L_HUMAN	syntaxin binding protein 5-like	612	WD 9.				exocytosis|protein transport	cytoplasm|integral to membrane|plasma membrane				ovary(7)|skin(2)	9				GBM - Glioblastoma multiforme(114;0.0694)														---	---	---	---	capture		Silent	SNP	120977893	120977893	15877	3	G	T	T	45	45	STXBP5L	T	2	2
POLQ	10721	broad.mit.edu	37	3	121230774	121230774	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121230774C>G	uc003eee.3	-	10	1700	c.1571G>C	c.(1570-1572)GGA>GCA	p.G524A		NM_199420	NP_955452	O75417	DPOLQ_HUMAN	DNA polymerase theta	524	Helicase C-terminal.				DNA repair|DNA replication	nucleoplasm	ATP binding|ATP-dependent helicase activity|damaged DNA binding|DNA-directed DNA polymerase activity|single-stranded DNA-dependent ATPase activity			ovary(4)|breast(3)|lung(2)|upper_aerodigestive_tract(1)|skin(1)	11				GBM - Glioblastoma multiforme(114;0.0915)									DNA_polymerases_(catalytic_subunits)					---	---	---	---	capture		Missense_Mutation	SNP	121230774	121230774	12636	3	C	G	G	30	30	POLQ	G	3	3
FBXO40	51725	broad.mit.edu	37	3	121340752	121340752	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121340752C>A	uc003eeg.2	+	3	686	c.476C>A	c.(475-477)ACT>AAT	p.T159N		NM_016298	NP_057382	Q9UH90	FBX40_HUMAN	F-box protein 40	159					muscle cell differentiation	centrosome|nucleus	ubiquitin-protein ligase activity|zinc ion binding			ovary(2)|lung(1)|breast(1)|central_nervous_system(1)	5				GBM - Glioblastoma multiforme(114;0.189)														---	---	---	---	capture		Missense_Mutation	SNP	121340752	121340752	5986	3	C	A	A	20	20	FBXO40	A	2	2
GOLGB1	2804	broad.mit.edu	37	3	121445853	121445853	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121445853T>C	uc003eei.3	-	5	564	c.438A>G	c.(436-438)ATA>ATG	p.I146M	GOLGB1_uc010hrc.2_Missense_Mutation_p.I146M|GOLGB1_uc003eej.3_Missense_Mutation_p.I107M|GOLGB1_uc011bjm.1_Missense_Mutation_p.I107M|GOLGB1_uc010hrd.1_Missense_Mutation_p.I146M	NM_004487	NP_004478	Q14789	GOGB1_HUMAN	golgi autoantigen, golgin subfamily b,	146	Potential.|Cytoplasmic (Potential).				Golgi organization	ER-Golgi intermediate compartment|Golgi membrane|Golgi stack|integral to membrane	protein binding			ovary(6)|breast(2)|skin(2)	10				GBM - Glioblastoma multiforme(114;0.0989)														---	---	---	---	capture		Missense_Mutation	SNP	121445853	121445853	6838	3	T	C	C	53	53	GOLGB1	C	4	4
KALRN	8997	broad.mit.edu	37	3	124114075	124114075	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124114075C>A	uc003ehg.2	+	12	2177	c.2050C>A	c.(2050-2052)CAG>AAG	p.Q684K	KALRN_uc010hrv.1_Missense_Mutation_p.Q684K|KALRN_uc003ehf.1_Missense_Mutation_p.Q684K|KALRN_uc011bjy.1_Missense_Mutation_p.Q684K|KALRN_uc003ehh.1_Missense_Mutation_p.Q43K	NM_001024660	NP_001019831	O60229	KALRN_HUMAN	kalirin, RhoGEF kinase isoform 1	684	Poly-Gln.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|nervous system development|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|vesicle-mediated transport	actin cytoskeleton|cytosol	ATP binding|GTPase activator activity|metal ion binding|protein binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(2)|ovary(2)|central_nervous_system(1)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	124114075	124114075	8279	3	C	A	A	21	21	KALRN	A	2	2
KALRN	8997	broad.mit.edu	37	3	124431863	124431863	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124431863G>A	uc003ehg.2	+	58	8284	c.8157G>A	c.(8155-8157)ATG>ATA	p.M2719I	KALRN_uc003ehk.2_Missense_Mutation_p.M1022I	NM_001024660	NP_001019831	O60229	KALRN_HUMAN	kalirin, RhoGEF kinase isoform 1	2718	Protein kinase.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|nervous system development|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|vesicle-mediated transport	actin cytoskeleton|cytosol	ATP binding|GTPase activator activity|metal ion binding|protein binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(2)|ovary(2)|central_nervous_system(1)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	124431863	124431863	8279	3	G	A	A	45	45	KALRN	A	2	2
C3orf22	152065	broad.mit.edu	37	3	126268734	126268734	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:126268734C>A	uc003ejb.2	-	4	732	c.403G>T	c.(403-405)GGG>TGG	p.G135W		NM_152533	NP_689746	Q8N5N4	CC022_HUMAN	hypothetical protein LOC152065	135											0				GBM - Glioblastoma multiforme(114;0.147)														---	---	---	---	capture		Missense_Mutation	SNP	126268734	126268734	2308	3	C	A	A	24	24	C3orf22	A	2	2
PLXNA1	5361	broad.mit.edu	37	3	126749203	126749203	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:126749203G>C	uc003ejg.2	+	28	5114	c.5110G>C	c.(5110-5112)GAC>CAC	p.D1704H	PLXNA1_uc003ejh.2_Missense_Mutation_p.D372H	NM_032242	NP_115618	Q9UIW2	PLXA1_HUMAN	plexin A1	1727	Cytoplasmic (Potential).				axon guidance	integral to membrane|intracellular|plasma membrane	semaphorin receptor activity			ovary(1)|pancreas(1)|skin(1)	3				GBM - Glioblastoma multiforme(114;0.155)														---	---	---	---	capture		Missense_Mutation	SNP	126749203	126749203	12545	3	G	C	C	37	37	PLXNA1	C	3	3
DNAJC13	23317	broad.mit.edu	37	3	132203456	132203456	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132203456G>T	uc003eor.2	+	29	3272	c.3207G>T	c.(3205-3207)CGG>CGT	p.R1069R		NM_015268	NP_056083	O75165	DJC13_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 13	1069							heat shock protein binding			ovary(1)|breast(1)	2																		---	---	---	---	capture		Silent	SNP	132203456	132203456	4815	3	G	T	T	42	42	DNAJC13	T	2	2
TMEM108	66000	broad.mit.edu	37	3	133098820	133098820	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133098820G>C	uc003eph.2	+	4	539	c.265G>C	c.(265-267)GAG>CAG	p.E89Q	TMEM108_uc003epi.2_Missense_Mutation_p.E89Q|TMEM108_uc003epj.1_Missense_Mutation_p.E89Q|TMEM108_uc003epk.2_Intron|TMEM108_uc003epm.2_Missense_Mutation_p.E40Q	NM_023943	NP_076432	Q6UXF1	TM108_HUMAN	transmembrane protein 108 precursor	89	Pro-rich.|Extracellular (Potential).					integral to membrane				ovary(2)|skin(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	133098820	133098820	16554	3	G	C	C	33	33	TMEM108	C	3	3
TOPBP1	11073	broad.mit.edu	37	3	133356823	133356823	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133356823G>T	uc003eps.2	-	14	2549	c.2417C>A	c.(2416-2418)CCA>CAA	p.P806Q		NM_007027	NP_008958	Q92547	TOPB1_HUMAN	topoisomerase (DNA) II binding protein 1	806					DNA repair|response to ionizing radiation	microtubule organizing center|PML body|spindle pole	DNA binding|protein C-terminus binding			ovary(2)|kidney(2)|skin(1)|lung(1)|pancreas(1)	7													Other_conserved_DNA_damage_response_genes					---	---	---	---	capture		Missense_Mutation	SNP	133356823	133356823	16911	3	G	T	T	47	47	TOPBP1	T	2	2
SRPRB	58477	broad.mit.edu	37	3	133526599	133526599	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133526599G>T	uc003epx.1	+	3	275	c.259G>T	c.(259-261)GGC>TGC	p.G87C		NM_021203	NP_067026	Q9Y5M8	SRPRB_HUMAN	signal recognition particle receptor, beta	87						endoplasmic reticulum membrane|integral to membrane	GTP binding|protein binding|receptor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	133526599	133526599	15677	3	G	T	T	35	35	SRPRB	T	2	2
CEP63	80254	broad.mit.edu	37	3	134269059	134269059	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:134269059G>C	uc003eqo.1	+	12	1786	c.1337G>C	c.(1336-1338)AGA>ACA	p.R446T	CEP63_uc003eql.1_Missense_Mutation_p.R400T|CEP63_uc003eqm.2_Missense_Mutation_p.R400T|CEP63_uc003eqn.1_Missense_Mutation_p.R446T|CEP63_uc003eqp.1_Missense_Mutation_p.R75T	NM_025180	NP_079456	Q96MT8	CEP63_HUMAN	centrosomal protein 63 isoform a	446	Potential.				cell division|DNA damage checkpoint|G2/M transition of mitotic cell cycle|mitosis|signal transduction in response to DNA damage|spindle assembly	centrosome|cytosol|spindle pole	protein binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	134269059	134269059	3390	3	G	C	C	33	33	CEP63	C	3	3
PRR23B	389151	broad.mit.edu	37	3	138738743	138738743	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:138738743G>A	uc003esy.1	-	1	1026	c.761C>T	c.(760-762)CCT>CTT	p.P254L		NM_001013650	NP_001013672	Q6ZRT6	PR23B_HUMAN	proline rich 23B	254	Pro-rich.									breast(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	138738743	138738743	13043	3	G	A	A	35	35	PRR23B	A	2	2
CLSTN2	64084	broad.mit.edu	37	3	140140019	140140019	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:140140019G>C	uc003etn.2	+	5	880	c.690G>C	c.(688-690)GAG>GAC	p.E230D	CLSTN2_uc003etm.2_Missense_Mutation_p.E230D	NM_022131	NP_071414	Q9H4D0	CSTN2_HUMAN	calsyntenin 2 precursor	230	Extracellular (Potential).|Cadherin 2.				homophilic cell adhesion	endoplasmic reticulum membrane|Golgi membrane|integral to membrane|plasma membrane	calcium ion binding			skin(3)|large_intestine(2)|pancreas(1)|central_nervous_system(1)	7															HNSCC(16;0.037)			---	---	---	---	capture		Missense_Mutation	SNP	140140019	140140019	3700	3	G	C	C	33	33	CLSTN2	C	3	3
TRIM42	287015	broad.mit.edu	37	3	140406890	140406890	+	Missense_Mutation	SNP	G	T	T	rs112034444	byFrequency;by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:140406890G>T	uc003eto.1	+	3	1557	c.1366G>T	c.(1366-1368)GGC>TGC	p.G456C		NM_152616	NP_689829	Q8IWZ5	TRI42_HUMAN	tripartite motif-containing 42	456	COS.					intracellular	zinc ion binding			lung(2)|skin(2)|upper_aerodigestive_tract(1)|breast(1)|central_nervous_system(1)	7																		---	---	---	---	capture		Missense_Mutation	SNP	140406890	140406890	17061	3	G	T	T	39	39	TRIM42	T	1	1
GRK7	131890	broad.mit.edu	37	3	141526697	141526697	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:141526697G>C	uc011bnd.1	+	3	1345	c.1261G>C	c.(1261-1263)GAG>CAG	p.E421Q		NM_139209	NP_631948	Q8WTQ7	GRK7_HUMAN	G-protein-coupled receptor kinase 7 precursor	421	Protein kinase.				visual perception	membrane	ATP binding|G-protein coupled receptor kinase activity|signal transducer activity			lung(2)|stomach(1)|ovary(1)|skin(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	141526697	141526697	7073	3	G	C	C	33	33	GRK7	C	3	3
TRPC1	7220	broad.mit.edu	37	3	142455268	142455268	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142455268G>C	uc003evc.2	+	2	356	c.220G>C	c.(220-222)GAC>CAC	p.D74H	TRPC1_uc003evb.2_Missense_Mutation_p.D74H	NM_003304	NP_003295	P48995	TRPC1_HUMAN	transient receptor potential cation channel,	74	Cytoplasmic (Potential).|ANK 1.				axon guidance|cytosolic calcium ion homeostasis|positive regulation of release of sequestered calcium ion into cytosol|response to calcium ion	cytosol|integral to plasma membrane	protein binding|store-operated calcium channel activity			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	142455268	142455268	17129	3	G	C	C	45	45	TRPC1	C	3	3
IGSF10	285313	broad.mit.edu	37	3	151171201	151171201	+	Nonsense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:151171201C>T	uc011bod.1	-	3	686	c.686G>A	c.(685-687)TGG>TAG	p.W229*		NM_178822	NP_849144	Q6WRI0	IGS10_HUMAN	immunoglobulin superfamily, member 10 precursor	229	LRRCT.				cell differentiation|multicellular organismal development|ossification	extracellular region				skin(7)|ovary(5)|central_nervous_system(1)	13			LUSC - Lung squamous cell carcinoma(72;0.0394)|Lung(72;0.0517)															---	---	---	---	capture		Nonsense_Mutation	SNP	151171201	151171201	7898	3	C	T	T	21	21	IGSF10	T	5	2
GPR149	344758	broad.mit.edu	37	3	154147144	154147144	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:154147144G>T	uc003faa.2	-	1	361	c.261C>A	c.(259-261)ATC>ATA	p.I87I		NM_001038705	NP_001033794	Q86SP6	GP149_HUMAN	G protein-coupled receptor 149	87	Helical; Name=2; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(6)	6			LUSC - Lung squamous cell carcinoma(72;0.114)|Lung(72;0.173)															---	---	---	---	capture		Silent	SNP	154147144	154147144	6929	3	G	T	T	33	33	GPR149	T	2	2
MLF1	4291	broad.mit.edu	37	3	158317862	158317862	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:158317862T>A	uc003fcb.2	+	5	605	c.468T>A	c.(466-468)ATT>ATA	p.I156I	MLF1_uc003fbz.2_Silent_p.I131I|MLF1_uc003fca.2_Silent_p.I131I|MLF1_uc003fbx.2_Silent_p.I146I|MLF1_uc003fcc.2_Silent_p.I187I|MLF1_uc003fby.2_Silent_p.I82I|MLF1_uc010hvx.2_Silent_p.I88I	NM_022443	NP_071888	P58340	MLF1_HUMAN	myeloid leukemia factor 1 isoform 1	156					cell cycle arrest|myeloid progenitor cell differentiation|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|protein domain specific binding				0		Melanoma(1037;0.000458)|Prostate(884;0.0235)|all_neural(597;0.0299)	Lung(72;0.00199)|LUSC - Lung squamous cell carcinoma(72;0.00256)					T	NPM1	AML								---	---	---	---	capture		Silent	SNP	158317862	158317862	10004	3	T	A	A	63	63	MLF1	A	4	4
SI	6476	broad.mit.edu	37	3	164712057	164712057	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164712057G>T	uc003fei.2	-	41	4891	c.4829C>A	c.(4828-4830)CCC>CAC	p.P1610H		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	1610	Sucrase.|Lumenal.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---	capture		Missense_Mutation	SNP	164712057	164712057	14792	3	G	T	T	43	43	SI	T	2	2
ARPM1	84517	broad.mit.edu	37	3	169485440	169485440	+	Nonsense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169485440G>C	uc003ffs.1	-	2	1274	c.899C>G	c.(898-900)TCA>TGA	p.S300*	TERC_uc003ffr.1_5'Flank	NM_032487	NP_115876	Q9BYD9	ARPM1_HUMAN	actin related protein M1	300						cytoplasm|cytoskeleton					0	all_cancers(22;9.55e-22)|all_epithelial(15;2.04e-26)|all_lung(20;5.05e-16)|Lung NSC(18;2.19e-15)|Ovarian(172;0.000223)|Breast(254;0.197)		Epithelial(2;4.03e-64)|all cancers(2;5.01e-59)|Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.00676)															---	---	---	---	capture		Nonsense_Mutation	SNP	169485440	169485440	994	3	G	C	C	45	45	ARPM1	C	5	3
TBL1XR1	79718	broad.mit.edu	37	3	176769497	176769497	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:176769497A>G	uc003fiw.3	-	5	482	c.222T>C	c.(220-222)GAT>GAC	p.D74D	TBL1XR1_uc003fix.3_Silent_p.D74D|TBL1XR1_uc011bpz.1_5'UTR|TBL1XR1_uc003fiy.2_Silent_p.D74D	NM_024665	NP_078941	Q9BZK7	TBL1R_HUMAN	transducin (beta)-like 1 X-linked receptor 1	74	F-box-like.				canonical Wnt receptor signaling pathway|cellular lipid metabolic process|chromatin modification|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|proteasomal ubiquitin-dependent protein catabolic process|transcription, DNA-dependent	spindle microtubule|transcriptional repressor complex	beta-catenin binding|histone binding|protein N-terminus binding|transcription corepressor activity|transcription regulatory region DNA binding			ovary(1)	1	all_cancers(143;1.44e-17)|Ovarian(172;0.00163)|Breast(254;0.214)	Acute lymphoblastic leukemia(1;0.00599)|all_hematologic(1;0.0632)|Prostate(884;0.215)	OV - Ovarian serous cystadenocarcinoma(80;9.83e-31)															---	---	---	---	capture		Silent	SNP	176769497	176769497	16166	3	A	G	G	8	8	TBL1XR1	G	4	4
GNB4	59345	broad.mit.edu	37	3	179131506	179131506	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179131506G>A	uc003fjv.3	-	7	774	c.494C>T	c.(493-495)ACT>ATT	p.T165I	GNB4_uc003fju.3_Missense_Mutation_p.T76I	NM_021629	NP_067642	Q9HAV0	GBB4_HUMAN	guanine nucleotide-binding protein, beta-4	165	WD 3.				cellular response to glucagon stimulus|energy reserve metabolic process	plasma membrane	signal transducer activity			skin(2)	2	all_cancers(143;2.01e-16)|Ovarian(172;0.0172)|Breast(254;0.191)		OV - Ovarian serous cystadenocarcinoma(80;5.78e-26)|GBM - Glioblastoma multiforme(14;0.0169)|BRCA - Breast invasive adenocarcinoma(182;0.237)															---	---	---	---	capture		Missense_Mutation	SNP	179131506	179131506	6789	3	G	A	A	36	36	GNB4	A	2	2
CCDC39	339829	broad.mit.edu	37	3	180377513	180377513	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180377513C>G	uc010hxe.2	-	5	676	c.561G>C	c.(559-561)CAG>CAC	p.Q187H	CCDC39_uc003fkn.2_RNA	NM_181426	NP_852091	Q9UFE4	CCD39_HUMAN	coiled-coil domain containing 39	187	Potential.				axonemal dynein complex assembly|ciliary cell motility|cilium movement involved in determination of left/right asymmetry|flagellar cell motility	cilium axoneme|cytoplasm|cytoskeleton				ovary(4)	4	all_cancers(143;9.31e-15)|Ovarian(172;0.0212)		OV - Ovarian serous cystadenocarcinoma(80;5.62e-23)|GBM - Glioblastoma multiforme(14;0.000558)															---	---	---	---	capture		Missense_Mutation	SNP	180377513	180377513	2933	3	C	G	G	32	32	CCDC39	G	3	3
FXR1	8087	broad.mit.edu	37	3	180685922	180685922	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180685922G>A	uc003fkq.2	+	14	1304	c.1282G>A	c.(1282-1284)GAT>AAT	p.D428N	FXR1_uc003fkp.2_Missense_Mutation_p.D343N|FXR1_uc003fkr.2_Missense_Mutation_p.D428N|FXR1_uc011bqj.1_Missense_Mutation_p.D342N|FXR1_uc003fks.2_Missense_Mutation_p.D371N|FXR1_uc011bqk.1_Missense_Mutation_p.D379N|FXR1_uc011bql.1_Missense_Mutation_p.D415N	NM_005087	NP_005078	P51114	FXR1_HUMAN	fragile X mental retardation-related protein 1	428					apoptosis|cell differentiation|muscle organ development	nucleolus|polysome				breast(1)	1	all_cancers(143;6.07e-14)|Ovarian(172;0.0212)		Epithelial(37;3.05e-35)|OV - Ovarian serous cystadenocarcinoma(80;2.4e-22)															---	---	---	---	capture		Missense_Mutation	SNP	180685922	180685922	6366	3	G	A	A	33	33	FXR1	A	2	2
ABCF3	55324	broad.mit.edu	37	3	183907720	183907720	+	Splice_Site	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183907720G>A	uc003fmz.2	+	14	1524	c.1391_splice	c.e14+1	p.L464_splice	ABCF3_uc003fna.2_Splice_Site_p.L458_splice|ABCF3_uc003fnb.2_Splice_Site_p.L145_splice	NM_018358	NP_060828			ATP-binding cassette, sub-family F (GCN20),								ATP binding|ATPase activity			ovary(3)|lung(1)	4	all_cancers(143;1.12e-10)|Ovarian(172;0.0339)		Epithelial(37;2.35e-34)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)															---	---	---	---	capture		Splice_Site	SNP	183907720	183907720	68	3	G	A	A	48	48	ABCF3	A	5	2
EIF4G1	1981	broad.mit.edu	37	3	184040983	184040983	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184040983G>A	uc003fnp.2	+	14	2240	c.2042G>A	c.(2041-2043)CGT>CAT	p.R681H	EIF4G1_uc003fno.1_Missense_Mutation_p.R622H|EIF4G1_uc010hxw.1_Missense_Mutation_p.R517H|EIF4G1_uc003fnt.2_Missense_Mutation_p.R392H|EIF4G1_uc003fnq.2_Missense_Mutation_p.R594H|EIF4G1_uc003fnr.2_Missense_Mutation_p.R517H|EIF4G1_uc010hxx.2_Missense_Mutation_p.R688H|EIF4G1_uc003fns.2_Missense_Mutation_p.R641H|EIF4G1_uc010hxy.2_Missense_Mutation_p.R688H|EIF4G1_uc003fnv.3_Missense_Mutation_p.R681H|EIF4G1_uc003fnu.3_Missense_Mutation_p.R681H|EIF4G1_uc003fnw.2_Missense_Mutation_p.R688H|EIF4G1_uc003fnx.2_Missense_Mutation_p.R485H|EIF4G1_uc003fny.3_Missense_Mutation_p.R485H|SNORD66_uc003fnz.2_5'Flank	NM_198241	NP_937884	Q04637	IF4G1_HUMAN	eukaryotic translation initiation factor 4	681	MIF4G.	Cleavage; by enterovirus/rhinovirus protease 2A.			insulin receptor signaling pathway|interspecies interaction between organisms|nuclear-transcribed mRNA poly(A) tail shortening|regulation of translational initiation	cytosol|eukaryotic translation initiation factor 4F complex	protein binding|translation initiation factor activity			lung(2)|ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	all_cancers(143;1.06e-10)|Ovarian(172;0.0339)		Epithelial(37;1.53e-33)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)															---	---	---	---	capture		Missense_Mutation	SNP	184040983	184040983	5227	3	G	A	A	40	40	EIF4G1	A	1	1
EIF4G1	1981	broad.mit.edu	37	3	184041675	184041675	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184041675C>G	uc003fnp.2	+	16	2580	c.2382C>G	c.(2380-2382)CTC>CTG	p.L794L	EIF4G1_uc003fno.1_Silent_p.L735L|EIF4G1_uc010hxw.1_Silent_p.L630L|EIF4G1_uc003fnt.2_Silent_p.L505L|EIF4G1_uc003fnq.2_Silent_p.L707L|EIF4G1_uc003fnr.2_Silent_p.L630L|EIF4G1_uc010hxx.2_Silent_p.L801L|EIF4G1_uc003fns.2_Silent_p.L754L|EIF4G1_uc010hxy.2_Silent_p.L801L|EIF4G1_uc003fnv.3_Silent_p.L795L|EIF4G1_uc003fnu.3_Silent_p.L794L|EIF4G1_uc003fnw.2_Silent_p.L801L|EIF4G1_uc003fnx.2_Silent_p.L599L|EIF4G1_uc003fny.3_Silent_p.L598L|SNORD66_uc003fnz.2_5'Flank	NM_198241	NP_937884	Q04637	IF4G1_HUMAN	eukaryotic translation initiation factor 4	794	eIF3/EIF4A-binding.				insulin receptor signaling pathway|interspecies interaction between organisms|nuclear-transcribed mRNA poly(A) tail shortening|regulation of translational initiation	cytosol|eukaryotic translation initiation factor 4F complex	protein binding|translation initiation factor activity			lung(2)|ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	all_cancers(143;1.06e-10)|Ovarian(172;0.0339)		Epithelial(37;1.53e-33)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)															---	---	---	---	capture		Silent	SNP	184041675	184041675	5227	3	C	G	G	29	29	EIF4G1	G	3	3
EIF4G1	1981	broad.mit.edu	37	3	184042714	184042714	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184042714A>G	uc003fnp.2	+	18	2866	c.2668A>G	c.(2668-2670)ATA>GTA	p.I890V	EIF4G1_uc003fno.1_Missense_Mutation_p.I831V|EIF4G1_uc010hxw.1_Missense_Mutation_p.I726V|EIF4G1_uc003fnt.2_Missense_Mutation_p.I601V|EIF4G1_uc003fnq.2_Missense_Mutation_p.I803V|EIF4G1_uc003fnr.2_Missense_Mutation_p.I726V|EIF4G1_uc010hxx.2_Missense_Mutation_p.I897V|EIF4G1_uc003fns.2_Missense_Mutation_p.I850V|EIF4G1_uc010hxy.2_Missense_Mutation_p.I897V|EIF4G1_uc003fnv.3_Missense_Mutation_p.I891V|EIF4G1_uc003fnu.3_Missense_Mutation_p.I890V|EIF4G1_uc003fnw.2_Missense_Mutation_p.I897V|EIF4G1_uc003fnx.2_Missense_Mutation_p.I695V|EIF4G1_uc003fny.3_Missense_Mutation_p.I694V|SNORD66_uc003fnz.2_5'Flank	NM_198241	NP_937884	Q04637	IF4G1_HUMAN	eukaryotic translation initiation factor 4	890	eIF3/EIF4A-binding.				insulin receptor signaling pathway|interspecies interaction between organisms|nuclear-transcribed mRNA poly(A) tail shortening|regulation of translational initiation	cytosol|eukaryotic translation initiation factor 4F complex	protein binding|translation initiation factor activity			lung(2)|ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	all_cancers(143;1.06e-10)|Ovarian(172;0.0339)		Epithelial(37;1.53e-33)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)															---	---	---	---	capture		Missense_Mutation	SNP	184042714	184042714	5227	3	A	G	G	8	8	EIF4G1	G	4	4
EPHB3	2049	broad.mit.edu	37	3	184294689	184294689	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184294689G>A	uc003foz.2	+	5	1509	c.1072G>A	c.(1072-1074)GAG>AAG	p.E358K		NM_004443	NP_004434	P54753	EPHB3_HUMAN	ephrin receptor EphB3 precursor	358	Fibronectin type-III 1.|Extracellular (Potential).					integral to plasma membrane	ATP binding|ephrin receptor activity			lung(5)|breast(2)|upper_aerodigestive_tract(1)|stomach(1)|skin(1)|ovary(1)	11	all_cancers(143;1.89e-10)|Ovarian(172;0.0339)		Epithelial(37;1.27e-34)|OV - Ovarian serous cystadenocarcinoma(80;3.8e-22)															---	---	---	---	capture		Missense_Mutation	SNP	184294689	184294689	5369	3	G	A	A	37	37	EPHB3	A	1	1
MASP1	5648	broad.mit.edu	37	3	186940980	186940980	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186940980C>T	uc003frh.1	-	14	2076	c.1744G>A	c.(1744-1746)GCC>ACC	p.A582T		NM_001879	NP_001870	P48740	MASP1_HUMAN	mannan-binding lectin serine protease 1 isoform	582	Peptidase S1.				complement activation, lectin pathway|negative regulation of complement activation|proteolysis	extracellular space	calcium ion binding|calcium-dependent protein binding|protein binding|protein homodimerization activity|serine-type endopeptidase activity			ovary(2)|breast(1)|liver(1)	4	all_cancers(143;5.33e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;3.49e-18)	GBM - Glioblastoma multiforme(93;0.0366)														---	---	---	---	capture		Missense_Mutation	SNP	186940980	186940980	9706	3	C	T	T	28	28	MASP1	T	2	2
SST	6750	broad.mit.edu	37	3	187386958	187386958	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:187386958C>T	uc003frn.2	-	2	368	c.246G>A	c.(244-246)ATG>ATA	p.M82I		NM_001048	NP_001039	P61278	SMS_HUMAN	somatostatin preproprotein	82					digestion|G-protein coupled receptor protein signaling pathway|induction of apoptosis by hormones|negative regulation of cell proliferation|response to nutrient|synaptic transmission	extracellular space	hormone activity			pancreas(1)	1	all_cancers(143;4.06e-12)|Ovarian(172;0.0418)		OV - Ovarian serous cystadenocarcinoma(80;1.76e-18)	GBM - Glioblastoma multiforme(93;0.00444)	Bromocriptine(DB01200)|Cysteamine(DB00847)													---	---	---	---	capture		Missense_Mutation	SNP	187386958	187386958	15712	3	C	T	T	29	29	SST	T	2	2
CPN2	1370	broad.mit.edu	37	3	194062502	194062502	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194062502G>T	uc003fts.2	-	2	1020	c.930C>A	c.(928-930)GCC>GCA	p.A310A		NM_001080513	NP_001073982	P22792	CPN2_HUMAN	carboxypeptidase N, polypeptide 2	310	LRR 9.				protein stabilization	extracellular region	enzyme regulator activity			ovary(5)	5	all_cancers(143;5.31e-09)|Ovarian(172;0.0634)		OV - Ovarian serous cystadenocarcinoma(49;2.2e-17)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;4.65e-05)														---	---	---	---	capture		Silent	SNP	194062502	194062502	3948	3	G	T	T	43	43	CPN2	T	2	2
LSG1	55341	broad.mit.edu	37	3	194373677	194373677	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194373677C>A	uc003fui.2	-	8	1269	c.954G>T	c.(952-954)TGG>TGT	p.W318C		NM_018385	NP_060855	Q9H089	LSG1_HUMAN	large subunit GTPase 1	318					nuclear export|protein transport	Cajal body|endoplasmic reticulum	GTP binding|hydrolase activity				0	all_cancers(143;1.68e-08)|Ovarian(172;0.0634)		OV - Ovarian serous cystadenocarcinoma(49;4.34e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;7.55e-06)														---	---	---	---	capture		Missense_Mutation	SNP	194373677	194373677	9425	3	C	A	A	26	26	LSG1	A	2	2
BDH1	622	broad.mit.edu	37	3	197239159	197239159	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:197239159G>T	uc003fxr.2	-	8	1041	c.639C>A	c.(637-639)TTC>TTA	p.F213L	BDH1_uc003fxs.2_Missense_Mutation_p.F213L|BDH1_uc003fxt.2_Missense_Mutation_p.F126L|BDH1_uc003fxu.2_Missense_Mutation_p.F213L	NM_203314	NP_976059	Q02338	BDH_HUMAN	3-hydroxybutyrate dehydrogenase, type 1	213					cellular lipid metabolic process|ketone body biosynthetic process|ketone body catabolic process	mitochondrial matrix	3-hydroxybutyrate dehydrogenase activity			ovary(1)	1	all_cancers(143;3.35e-10)|Ovarian(172;0.0418)|Breast(254;0.0437)	Lung NSC(153;0.118)	Epithelial(36;3.52e-24)|all cancers(36;1.79e-22)|OV - Ovarian serous cystadenocarcinoma(49;2.32e-19)|LUSC - Lung squamous cell carcinoma(58;1.02e-06)|Lung(62;1.34e-06)	GBM - Glioblastoma multiforme(93;0.0977)	NADH(DB00157)													---	---	---	---	capture		Missense_Mutation	SNP	197239159	197239159	1412	3	G	T	T	37	37	BDH1	T	1	1
LMLN	89782	broad.mit.edu	37	3	197707242	197707242	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:197707242G>T	uc011buo.1	+	6	617	c.595G>T	c.(595-597)GGT>TGT	p.G199C	LMLN_uc003fyt.2_Missense_Mutation_p.G147C|LMLN_uc010iar.2_Missense_Mutation_p.G199C|LMLN_uc010ias.2_Missense_Mutation_p.G147C|LMLN_uc003fyu.2_5'UTR	NM_033029	NP_149018	Q96KR4	LMLN_HUMAN	leishmanolysin-like isoform 2	199					cell adhesion|cell division|mitosis|proteolysis	cytoplasm|membrane	metalloendopeptidase activity|zinc ion binding			skin(1)	1	all_cancers(143;1.15e-09)|Ovarian(172;0.0418)|Breast(254;0.0976)	Lung NSC(153;0.132)	Epithelial(36;9.84e-24)|all cancers(36;3.18e-22)|OV - Ovarian serous cystadenocarcinoma(49;5.35e-19)|LUSC - Lung squamous cell carcinoma(58;6.94e-07)|Lung(62;9.92e-07)	GBM - Glioblastoma multiforme(93;0.111)														---	---	---	---	capture		Missense_Mutation	SNP	197707242	197707242	9176	3	G	T	T	43	43	LMLN	T	2	2
CTBP1	1487	broad.mit.edu	37	4	1207352	1207352	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:1207352C>A	uc003gcv.1	-	7	1100	c.935G>T	c.(934-936)TGC>TTC	p.C312F	uc003gcs.1_Intron|CTBP1_uc003gct.1_Missense_Mutation_p.C293F|CTBP1_uc003gcu.1_Missense_Mutation_p.C301F|CTBP1_uc003gcw.2_5'UTR	NM_001328	NP_001319	Q13363	CTBP1_HUMAN	C-terminal binding protein 1 isoform 1	312	Interaction with GLIS2 2 (By similarity).				interspecies interaction between organisms|negative regulation of cell proliferation|negative regulation of histone H4 acetylation|negative regulation of transcription from RNA polymerase II promoter|positive regulation of histone deacetylation|protein phosphorylation|regulation of cell cycle|regulation of transcription by chromatin organization|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|viral genome replication|white fat cell differentiation	cytoplasm|transcriptional repressor complex	NAD binding|oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor|protein C-terminus binding|protein domain specific binding|transcription factor binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(23;0.00818)	Colorectal(103;0.2)														---	---	---	---	capture		Missense_Mutation	SNP	1207352	1207352	4156	4	C	A	A	25	25	CTBP1	A	2	2
OTOP1	133060	broad.mit.edu	37	4	4199533	4199533	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:4199533C>A	uc003ghp.1	-	5	1058	c.1028G>T	c.(1027-1029)AGC>ATC	p.S343I		NM_177998	NP_819056	Q7RTM1	OTOP1_HUMAN	otopetrin 1	343					biomineral tissue development	extracellular space|integral to membrane				ovary(2)|central_nervous_system(1)	3				UCEC - Uterine corpus endometrioid carcinoma (64;0.168)														---	---	---	---	capture		Missense_Mutation	SNP	4199533	4199533	11717	4	C	A	A	28	28	OTOP1	A	2	2
KIAA0232	9778	broad.mit.edu	37	4	6862821	6862821	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:6862821G>C	uc003gjr.3	+	7	1175	c.712G>C	c.(712-714)GAA>CAA	p.E238Q	KIAA0232_uc003gjq.3_Missense_Mutation_p.E238Q	NM_014743	NP_055558	Q92628	K0232_HUMAN	hypothetical protein LOC9778	238							ATP binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	6862821	6862821	8470	4	G	C	C	45	45	KIAA0232	C	3	3
CPZ	8532	broad.mit.edu	37	4	8609035	8609035	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:8609035C>A	uc003glm.2	+	7	1236	c.1110C>A	c.(1108-1110)ACC>ACA	p.T370T	CPZ_uc003gll.2_RNA|CPZ_uc003gln.2_Silent_p.T233T|CPZ_uc003glo.2_Silent_p.T359T|CPZ_uc003glp.2_RNA	NM_001014447	NP_001014447	Q66K79	CBPZ_HUMAN	carboxypeptidase Z isoform 1	370					proteolysis|Wnt receptor signaling pathway	proteinaceous extracellular matrix	metallocarboxypeptidase activity|zinc ion binding			ovary(2)|pancreas(1)	3																OREG0016100	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	8609035	8609035	3978	4	C	A	A	21	21	CPZ	A	2	2
BOD1L	259282	broad.mit.edu	37	4	13602546	13602546	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:13602546T>A	uc003gmz.1	-	10	6095	c.5978A>T	c.(5977-5979)AAA>ATA	p.K1993I	BOD1L_uc010idr.1_Missense_Mutation_p.K1330I	NM_148894	NP_683692	Q8NFC6	BOD1L_HUMAN	biorientation of chromosomes in cell division	1993							DNA binding			ovary(5)|breast(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	13602546	13602546	1508	4	T	A	A	64	64	BOD1L	A	4	4
STIM2	57620	broad.mit.edu	37	4	27000893	27000893	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:27000893G>A	uc003gsh.3	+	5	1026	c.810G>A	c.(808-810)TTG>TTA	p.L270L	STIM2_uc003gsg.3_Silent_p.L270L|STIM2_uc010iex.2_Silent_p.L270L	NM_020860	NP_065911	Q9P246	STIM2_HUMAN	stromal interaction molecule 2	183	SAM.|Extracellular (Potential).				activation of store-operated calcium channel activity|calcium ion transport|cellular calcium ion homeostasis|negative regulation of calcium ion transport via store-operated calcium channel activity	endoplasmic reticulum membrane|integral to membrane|plasma membrane	calcium channel regulator activity|calcium ion binding|protein binding			central_nervous_system(1)|skin(1)	2		Breast(46;0.0503)																---	---	---	---	capture		Silent	SNP	27000893	27000893	15804	4	G	A	A	45	45	STIM2	A	2	2
GNPDA2	132789	broad.mit.edu	37	4	44713028	44713028	+	Nonsense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:44713028G>C	uc003gwy.2	-	5	693	c.536C>G	c.(535-537)TCA>TGA	p.S179*	GNPDA2_uc010iga.2_Nonsense_Mutation_p.S145*|GNPDA2_uc011bzb.1_Nonsense_Mutation_p.S109*|GNPDA2_uc003gwz.1_Nonsense_Mutation_p.S179*	NM_138335	NP_612208	Q8TDQ7	GNPI2_HUMAN	glucosamine-6-phosphate deaminase 2	179					N-acetylglucosamine metabolic process	cytoplasm	glucosamine-6-phosphate deaminase activity|hydrolase activity			ovary(1)	1																		---	---	---	---	capture		Nonsense_Mutation	SNP	44713028	44713028	6812	4	G	C	C	45	45	GNPDA2	C	5	3
GABRA2	2555	broad.mit.edu	37	4	46305529	46305529	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:46305529G>T	uc003gxc.3	-	7	1477	c.804C>A	c.(802-804)TCC>TCA	p.S268S	GABRA2_uc010igc.2_Silent_p.S268S|GABRA2_uc011bzc.1_Silent_p.S213S|GABRA2_uc003gxe.2_Silent_p.S268S	NM_001114175	NP_001107647	P47869	GBRA2_HUMAN	gamma-aminobutyric acid A receptor, alpha 2	268	Helical; (Probable).				gamma-aminobutyric acid signaling pathway|neurotransmitter transport|regulation of neurotransmitter levels	cell junction|chloride channel complex|integral to synaptic vesicle membrane|postsynaptic membrane	benzodiazepine receptor activity|chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)|skin(2)	4					Alprazolam(DB00404)|Bromazepam(DB01558)|Diazepam(DB00829)|Ethchlorvynol(DB00189)|Fludiazepam(DB01567)|Flunitrazepam(DB01544)|Flurazepam(DB00690)|Lorazepam(DB00186)|Meprobamate(DB00371)|Midazolam(DB00683)													---	---	---	---	capture		Silent	SNP	46305529	46305529	6412	4	G	T	T	43	43	GABRA2	T	2	2
CNGA1	1259	broad.mit.edu	37	4	47939827	47939827	+	Silent	SNP	C	G	G	rs149504668	by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47939827C>G	uc003gxt.3	-	11	950	c.684G>C	c.(682-684)CTG>CTC	p.L228L	uc003gxr.1_Intron|CNGA1_uc003gxu.2_Silent_p.L297L	NM_000087	NP_000078	P29973	CNGA1_HUMAN	cyclic nucleotide gated channel alpha 1 isoform	228	Cytoplasmic (Potential).				response to stimulus|visual perception	integral to plasma membrane	cGMP binding|ion channel activity			ovary(2)	2																		---	---	---	---	capture		Silent	SNP	47939827	47939827	3734	4	C	G	G	25	25	CNGA1	G	3	3
TXK	7294	broad.mit.edu	37	4	48115301	48115301	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:48115301T>A	uc003gxx.3	-	3	183	c.97A>T	c.(97-99)AGC>TGC	p.S33C	TXK_uc003gxy.1_Missense_Mutation_p.S33C	NM_003328	NP_003319	P42681	TXK_HUMAN	TXK tyrosine kinase	33						cytoplasm	ATP binding|non-membrane spanning protein tyrosine kinase activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	48115301	48115301	17342	4	T	A	A	54	54	TXK	A	4	4
CHIC2	26511	broad.mit.edu	37	4	54930367	54930367	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:54930367C>A	uc003haj.1	-	1	422	c.101G>T	c.(100-102)GGC>GTC	p.G34V	PDGFRA_uc003haa.2_Intron	NM_012110	NP_036242	Q9UKJ5	CHIC2_HUMAN	cysteine-rich hydrophobic domain 2	34						plasma membrane	protein binding			central_nervous_system(1)	1	all_cancers(7;0.0193)|all_neural(26;0.0209)|Lung NSC(11;0.0281)|Glioma(25;0.08)		LUSC - Lung squamous cell carcinoma(32;0.00216)					T	ETV6	AML								---	---	---	---	capture		Missense_Mutation	SNP	54930367	54930367	3478	4	C	A	A	26	26	CHIC2	A	2	2
PDGFRA	5156	broad.mit.edu	37	4	55156543	55156543	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:55156543G>T	uc003han.3	+	22	3275	c.2944G>T	c.(2944-2946)GTG>TTG	p.V982L	PDGFRA_uc003haa.2_Missense_Mutation_p.V742L	NM_006206	NP_006197	P16234	PGFRA_HUMAN	platelet-derived growth factor receptor alpha	982	Cytoplasmic (Potential).				cardiac myofibril assembly|cell activation|luteinization|metanephric glomerular capillary formation|peptidyl-tyrosine phosphorylation|positive regulation of cell migration|positive regulation of DNA replication|positive regulation of fibroblast proliferation|protein autophosphorylation|retina vasculature development in camera-type eye	cytoplasm|integral to plasma membrane|nucleus	ATP binding|platelet-derived growth factor alpha-receptor activity|platelet-derived growth factor binding|platelet-derived growth factor receptor binding|protein homodimerization activity|vascular endothelial growth factor receptor activity			soft_tissue(572)|small_intestine(40)|stomach(16)|lung(16)|central_nervous_system(13)|haematopoietic_and_lymphoid_tissue(7)|skin(3)|ovary(3)|gastrointestinal_tract_(site_indeterminate)(1)|autonomic_ganglia(1)|prostate(1)|bone(1)	674	all_cancers(7;0.000425)|all_lung(4;0.000343)|Lung NSC(11;0.000467)|all_epithelial(27;0.0131)|all_neural(26;0.0209)|Glioma(25;0.08)		GBM - Glioblastoma multiforme(1;4.18e-71)|all cancers(1;4.76e-45)|LUSC - Lung squamous cell carcinoma(32;0.00256)		Becaplermin(DB00102)|Imatinib(DB00619)|Sunitinib(DB01268)			Mis|O|T	FIP1L1	GIST|idiopathic hypereosinophilic syndrome				Gastrointestinal_Stromal_Tumors_Sporadic_Multiple_Primary|Familial_Intestinal_Neurofibromatosis	TSP Lung(21;0.16)			---	---	---	---	capture		Missense_Mutation	SNP	55156543	55156543	12082	4	G	T	T	48	48	PDGFRA	T	2	2
KIT	3815	broad.mit.edu	37	4	55592146	55592146	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:55592146A>T	uc010igr.2	+	9	1557	c.1470A>T	c.(1468-1470)GAA>GAT	p.E490D	KIT_uc010igs.2_Missense_Mutation_p.E490D|KIT_uc011bzw.1_5'Flank|KIT_uc010igt.1_5'Flank	NM_000222	NP_000213	P10721	KIT_HUMAN	v-kit Hardy-Zuckerman 4 feline sarcoma viral	490	Extracellular (Potential).|Ig-like C2-type 5.				male gonad development|transmembrane receptor protein tyrosine kinase signaling pathway	extracellular space|integral to membrane	ATP binding|protein binding|receptor signaling protein tyrosine kinase activity	p.E490_F504>DHIVVSLTF(1)		soft_tissue(3273)|haematopoietic_and_lymphoid_tissue(1572)|skin(99)|testis(49)|bone(21)|genital_tract(18)|kidney(17)|ovary(16)|salivary_gland(15)|large_intestine(11)|thymus(6)|lung(6)|central_nervous_system(4)|NS(3)|eye(2)|endometrium(2)|breast(1)|stomach(1)|autonomic_ganglia(1)|pancreas(1)	5118	all_cancers(7;0.00453)|all_lung(4;0.000565)|Lung NSC(11;0.00129)|all_epithelial(27;0.0104)|Glioma(25;0.08)|all_neural(26;0.101)		LUSC - Lung squamous cell carcinoma(32;0.000276)|Epithelial(7;0.209)	Colorectal(1;0.0276)|COAD - Colon adenocarcinoma(1;0.171)	Dasatinib(DB01254)|Imatinib(DB00619)|Sorafenib(DB00398)|Sunitinib(DB01268)		1	Mis|O		GIST|AML|TGCT|mastocytosis|mucosal melanoma	GIST|epithelioma	Piebald trait		Mast_Cell_disease_Familial_Clustering_of|Piebaldism|Gastrointestinal_Stromal_Tumors_Sporadic_Multiple_Primary|Familial_Gastrointestinal_Stromal_Tumors				---	---	---	---	capture		Missense_Mutation	SNP	55592146	55592146	8641	4	A	T	T	4	4	KIT	T	4	4
KIT	3815	broad.mit.edu	37	4	55599352	55599352	+	Missense_Mutation	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:55599352A>C	uc010igr.2	+	17	2565	c.2478A>C	c.(2476-2478)AAA>AAC	p.K826N	KIT_uc010igs.2_Missense_Mutation_p.K822N	NM_000222	NP_000213	P10721	KIT_HUMAN	v-kit Hardy-Zuckerman 4 feline sarcoma viral	826	Protein kinase.|Cytoplasmic (Potential).				male gonad development|transmembrane receptor protein tyrosine kinase signaling pathway	extracellular space|integral to membrane	ATP binding|protein binding|receptor signaling protein tyrosine kinase activity			soft_tissue(3273)|haematopoietic_and_lymphoid_tissue(1572)|skin(99)|testis(49)|bone(21)|genital_tract(18)|kidney(17)|ovary(16)|salivary_gland(15)|large_intestine(11)|thymus(6)|lung(6)|central_nervous_system(4)|NS(3)|eye(2)|endometrium(2)|breast(1)|stomach(1)|autonomic_ganglia(1)|pancreas(1)	5118	all_cancers(7;0.00453)|all_lung(4;0.000565)|Lung NSC(11;0.00129)|all_epithelial(27;0.0104)|Glioma(25;0.08)|all_neural(26;0.101)		LUSC - Lung squamous cell carcinoma(32;0.000276)|Epithelial(7;0.209)	Colorectal(1;0.0276)|COAD - Colon adenocarcinoma(1;0.171)	Dasatinib(DB01254)|Imatinib(DB00619)|Sorafenib(DB00398)|Sunitinib(DB01268)		1	Mis|O		GIST|AML|TGCT|mastocytosis|mucosal melanoma	GIST|epithelioma	Piebald trait		Mast_Cell_disease_Familial_Clustering_of|Piebaldism|Gastrointestinal_Stromal_Tumors_Sporadic_Multiple_Primary|Familial_Gastrointestinal_Stromal_Tumors				---	---	---	---	capture		Missense_Mutation	SNP	55599352	55599352	8641	4	A	C	C	3	3	KIT	C	4	4
REST	5978	broad.mit.edu	37	4	57798239	57798239	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57798239G>A	uc003hch.2	+	4	3562	c.3215G>A	c.(3214-3216)GGA>GAA	p.G1072E	REST_uc003hci.2_Missense_Mutation_p.G1072E|REST_uc010ihf.2_Missense_Mutation_p.G746E	NM_005612	NP_005603	Q13127	REST_HUMAN	RE1-silencing transcription factor	1072	C2H2-type 9.|Interaction with RCOR1.				cardiac muscle cell myoblast differentiation|cellular response to drug|cellular response to electrical stimulus|cellular response to glucocorticoid stimulus|histone H4 deacetylation|negative regulation by host of viral transcription|negative regulation of aldosterone biosynthetic process|negative regulation of calcium ion-dependent exocytosis|negative regulation of cell proliferation|negative regulation of cortisol biosynthetic process|negative regulation of dense core granule biogenesis|negative regulation of insulin secretion|negative regulation of mesenchymal stem cell differentiation|negative regulation of neurogenesis|negative regulation of neuron differentiation|positive regulation of apoptosis|positive regulation of caspase activity|positive regulation of transcription, DNA-dependent	cytoplasm|transcriptional repressor complex	calcium channel activity|chromatin binding|core promoter proximal region sequence-specific DNA binding|core promoter sequence-specific DNA binding|outward rectifier potassium channel activity|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription|zinc ion binding			skin(5)|upper_aerodigestive_tract(1)|ovary(1)|lung(1)|central_nervous_system(1)	9	Glioma(25;0.08)|all_neural(26;0.181)																	---	---	---	---	capture		Missense_Mutation	SNP	57798239	57798239	13704	4	G	A	A	41	41	REST	A	2	2
UGT2B11	10720	broad.mit.edu	37	4	70066419	70066419	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70066419C>A	uc003heh.2	-	6	1338	c.1329G>T	c.(1327-1329)ATG>ATT	p.M443I	uc003hei.1_Intron	NM_001073	NP_001064	O75310	UDB11_HUMAN	UDP glucuronosyltransferase 2 family,	443					estrogen metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glucuronosyltransferase activity			ovary(1)|haematopoietic_and_lymphoid_tissue(1)|skin(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	70066419	70066419	17515	4	C	A	A	29	29	UGT2B11	A	2	2
UGT2B28	54490	broad.mit.edu	37	4	70146511	70146511	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70146511C>T	uc003hej.2	+	1	295	c.293C>T	c.(292-294)TCA>TTA	p.S98L	UGT2B28_uc010ihr.2_Missense_Mutation_p.S98L	NM_053039	NP_444267	Q9BY64	UDB28_HUMAN	UDP glucuronosyltransferase 2 family,	98					xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glucuronosyltransferase activity			skin(1)	1					Flunitrazepam(DB01544)													---	---	---	---	capture		Missense_Mutation	SNP	70146511	70146511	17518	4	C	T	T	29	29	UGT2B28	T	2	2
ADAMTS3	9508	broad.mit.edu	37	4	73434420	73434420	+	Silent	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73434420A>T	uc003hgk.1	-	1	97	c.60T>A	c.(58-60)GCT>GCA	p.A20A		NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	20					collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)															---	---	---	---	capture		Silent	SNP	73434420	73434420	268	4	A	T	T	7	7	ADAMTS3	T	4	4
ALB	213	broad.mit.edu	37	4	74275097	74275097	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:74275097C>T	uc003hgs.3	+	5	581	c.508C>T	c.(508-510)CAT>TAT	p.H170Y	ALB_uc003hgw.3_Intron|ALB_uc011cbe.1_5'UTR|ALB_uc003hgt.3_Missense_Mutation_p.H170Y|ALB_uc010iii.2_Missense_Mutation_p.H55Y|ALB_uc003hgu.3_Missense_Mutation_p.H20Y|ALB_uc003hgv.3_5'UTR|ALB_uc011cbf.1_Missense_Mutation_p.H60Y|ALB_uc010iij.2_RNA|ALB_uc003hgx.3_5'UTR	NM_000477	NP_000468	P02768	ALBU_HUMAN	albumin preproprotein	170	Albumin 1.				bile acid and bile salt transport|bile acid metabolic process|cellular response to starvation|hemolysis by symbiont of host erythrocytes|lipoprotein metabolic process|maintenance of mitochondrion location|negative regulation of apoptosis|platelet activation|platelet degranulation|sodium-independent organic anion transport|transmembrane transport	extracellular space|platelet alpha granule lumen|protein complex	antioxidant activity|chaperone binding|copper ion binding|DNA binding|drug binding|fatty acid binding|pyridoxal phosphate binding|toxin binding			ovary(3)|skin(3)	6	Breast(15;0.00102)		Epithelial(6;4.8e-05)|OV - Ovarian serous cystadenocarcinoma(6;0.000263)|all cancers(17;0.000472)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)		Acenocoumarol(DB01418)|Acitretin(DB00459)|Alfentanil(DB00802)|Aluminium(DB01370)|Auranofin(DB00995)|Bismuth(DB01402)|Captopril(DB01197)|Carboplatin(DB00958)|Cefalotin(DB00456)|Cefazolin(DB01327)|Cefonicid(DB01328)|Cefoperazone(DB01329)|Chlorpheniramine(DB01114)|Chlorpromazine(DB00477)|Ciprofloxacin(DB00537)|Clonazepam(DB01068)|Cloxacillin(DB01147)|Cytarabine(DB00987)|Dantrolene(DB01219)|Diclofenac(DB00586)|Diflunisal(DB00861)|Digitoxin(DB01396)|Estrone(DB00655)|Ethacrynic acid(DB00903)|Etodolac(DB00749)|Flurbiprofen(DB00712)|Gadobenate Dimeglumine(DB00743)|Gatifloxacin(DB01044)|Gliclazide(DB01120)|Halothane(DB01159)|Human Serum Albumin(DB00062)|Hyaluronidase(DB00070)|Ibuprofen(DB01050)|Insulin-detemir(DB01307)|Insulin-glargine(DB01308)|Iodipamide(DB04711)|Ketoprofen(DB01009)|Levamisole(DB00848)|Levothyroxine(DB00451)|Liothyronine(DB00279)|Mefenamic acid(DB00784)|Mephenytoin(DB00532)|Methotrexate(DB00563)|Nortriptyline(DB00540)|Oxazepam(DB00842)|Paclitaxel(DB01229)|Phenprocoumon(DB00946)|Probenecid(DB01032)|Propofol(DB00818)|Pyridoxine(DB00165)|Salicyclic acid(DB00936)|Saquinavir(DB01232)|Serum albumin(DB00096)|Serum albumin iodonated(DB00064)|Sodium lauryl sulfate(DB00815)|Sucralfate(DB00364)|Sulfamethizole(DB00576)|Sulindac(DB00605)|Suprofen(DB00870)|Testosterone(DB00624)|Xanthophyll(DB00137)													---	---	---	---	capture		Missense_Mutation	SNP	74275097	74275097	489	4	C	T	T	17	17	ALB	T	2	2
G3BP2	9908	broad.mit.edu	37	4	76570810	76570810	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:76570810C>G	uc003hir.2	-	12	1418	c.1253G>C	c.(1252-1254)AGA>ACA	p.R418T	G3BP2_uc003his.2_Missense_Mutation_p.R418T|G3BP2_uc003hit.2_Missense_Mutation_p.R385T	NM_012297	NP_036429	Q9UN86	G3BP2_HUMAN	Ras-GTPase activating protein SH3 domain-binding	418					cytoplasmic sequestering of NF-kappaB|mRNA transport|Ras protein signal transduction|regulation of small GTPase mediated signal transduction	cytosol	GTPase activator activity|nucleotide binding|receptor signaling complex scaffold activity|RNA binding			breast(2)|central_nervous_system(1)	3			Lung(101;0.0973)|LUSC - Lung squamous cell carcinoma(112;0.122)															---	---	---	---	capture		Missense_Mutation	SNP	76570810	76570810	6393	4	C	G	G	32	32	G3BP2	G	3	3
STBD1	8987	broad.mit.edu	37	4	77230773	77230773	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:77230773G>T	uc003hka.2	+	2	943	c.697G>T	c.(697-699)GAC>TAC	p.D233Y	STBD1_uc003hjy.2_3'UTR|STBD1_uc011cbv.1_3'UTR|STBD1_uc011cbw.1_Missense_Mutation_p.D84Y	NM_003943	NP_003934	O95210	STBD1_HUMAN	starch binding domain 1	233	Cytoplasmic (Potential).				carbohydrate metabolic process|muscle contraction	integral to plasma membrane|membrane fraction	carbohydrate binding|catalytic activity|protein binding			ovary(1)	1			Lung(101;0.196)															---	---	---	---	capture		Missense_Mutation	SNP	77230773	77230773	15794	4	G	T	T	41	41	STBD1	T	2	2
FRAS1	80144	broad.mit.edu	37	4	79353585	79353585	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79353585G>C	uc003hlb.2	+	38	5484	c.5044G>C	c.(5044-5046)GAC>CAC	p.D1682H	FRAS1_uc003hkw.2_Missense_Mutation_p.D1682H|FRAS1_uc010ijj.1_Missense_Mutation_p.D102H	NM_025074	NP_079350	Q86XX4	FRAS1_HUMAN	Fraser syndrome 1	1681	CSPG 5.|Extracellular (Potential).				cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5																		---	---	---	---	capture		Missense_Mutation	SNP	79353585	79353585	6288	4	G	C	C	33	33	FRAS1	C	3	3
MEPE	56955	broad.mit.edu	37	4	88766732	88766732	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:88766732G>T	uc003hqy.2	+	4	751	c.712G>T	c.(712-714)GGC>TGC	p.G238C	MEPE_uc010ikn.2_Missense_Mutation_p.G125C	NM_020203	NP_064588	Q9NQ76	MEPE_HUMAN	matrix, extracellular phosphoglycoprotein with	238					skeletal system development	proteinaceous extracellular matrix	extracellular matrix structural constituent|protein binding			ovary(1)|lung(1)|skin(1)	3		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;0.000432)														---	---	---	---	capture		Missense_Mutation	SNP	88766732	88766732	9867	4	G	T	T	35	35	MEPE	T	2	2
PKD2	5311	broad.mit.edu	37	4	88989210	88989210	+	Missense_Mutation	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:88989210A>C	uc003hre.2	+	13	2585	c.2519A>C	c.(2518-2520)CAA>CCA	p.Q840P	PKD2_uc011cdf.1_Missense_Mutation_p.Q258P|PKD2_uc011cdg.1_Missense_Mutation_p.Q166P|PKD2_uc011cdh.1_Missense_Mutation_p.Q63P	NM_000297	NP_000288	Q13563	PKD2_HUMAN	polycystin 2	840	Potential.|C-terminal coiled coil domain.|Cytoplasmic (Potential).					basal cortex|basal plasma membrane|endoplasmic reticulum|integral to membrane|lamellipodium|microtubule basal body	calcium ion binding|cytoskeletal protein binding|voltage-gated chloride channel activity|voltage-gated sodium channel activity			skin(1)	1		Hepatocellular(203;0.114)|Acute lymphoblastic leukemia(40;0.221)		OV - Ovarian serous cystadenocarcinoma(123;9.98e-10)|COAD - Colon adenocarcinoma(81;0.0237)														---	---	---	---	capture		Missense_Mutation	SNP	88989210	88989210	12391	4	A	C	C	5	5	PKD2	C	4	4
C4orf37	285555	broad.mit.edu	37	4	98893523	98893523	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:98893523G>A	uc003htt.1	-	7	931	c.841C>T	c.(841-843)CAG>TAG	p.Q281*		NM_174952	NP_777612	Q8N412	CD037_HUMAN	hypothetical protein LOC285555	281											0				OV - Ovarian serous cystadenocarcinoma(123;2.27e-08)														---	---	---	---	capture		Nonsense_Mutation	SNP	98893523	98893523	2362	4	G	A	A	48	48	C4orf37	A	5	2
MTTP	4547	broad.mit.edu	37	4	100515905	100515905	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:100515905G>C	uc003hvc.3	+	8	1030	c.774G>C	c.(772-774)CTG>CTC	p.L258L	MTTP_uc011cej.1_Silent_p.L285L	NM_000253	NP_000244	P55157	MTP_HUMAN	microsomal triglyceride transfer protein large	258	Vitellogenin.				lipid metabolic process|lipoprotein metabolic process	endoplasmic reticulum lumen	lipid binding|lipid transporter activity			ovary(3)|central_nervous_system(1)	4				OV - Ovarian serous cystadenocarcinoma(123;6.04e-09)	Hesperetin(DB01094)													---	---	---	---	capture		Silent	SNP	100515905	100515905	10357	4	G	C	C	45	45	MTTP	C	3	3
CENPE	1062	broad.mit.edu	37	4	104054854	104054854	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:104054854C>A	uc003hxb.1	-	41	6808	c.6718G>T	c.(6718-6720)GAG>TAG	p.E2240*	CENPE_uc003hxc.1_Nonsense_Mutation_p.E2119*	NM_001813	NP_001804	Q02224	CENPE_HUMAN	centromere protein E	2240	Kinetochore-binding domain.|Potential.				blood coagulation|cell division|kinetochore assembly|microtubule-based movement|mitotic chromosome movement towards spindle pole|mitotic metaphase|mitotic metaphase plate congression|mitotic prometaphase|multicellular organismal development|positive regulation of protein kinase activity	condensed chromosome kinetochore|cytosol|microtubule|nucleus|spindle	ATP binding|kinetochore binding|microtubule motor activity			ovary(5)|breast(4)	9				OV - Ovarian serous cystadenocarcinoma(123;2.95e-08)														---	---	---	---	capture		Nonsense_Mutation	SNP	104054854	104054854	3363	4	C	A	A	29	29	CENPE	A	5	2
ALPK1	80216	broad.mit.edu	37	4	113348773	113348773	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:113348773G>C	uc003iap.3	+	9	1026	c.747G>C	c.(745-747)ATG>ATC	p.M249I	ALPK1_uc003ian.3_Missense_Mutation_p.M249I|ALPK1_uc011cfx.1_Missense_Mutation_p.M171I|ALPK1_uc003iao.3_RNA|ALPK1_uc010imo.2_Missense_Mutation_p.M77I	NM_025144	NP_079420	Q96QP1	ALPK1_HUMAN	alpha-kinase 1	249							ATP binding|protein serine/threonine kinase activity			ovary(5)	5		Ovarian(17;0.0446)|Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.00325)														---	---	---	---	capture		Missense_Mutation	SNP	113348773	113348773	547	4	G	C	C	45	45	ALPK1	C	3	3
LARP7	51574	broad.mit.edu	37	4	113568585	113568585	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:113568585G>T	uc003iay.2	+	7	1155	c.877G>T	c.(877-879)GGG>TGG	p.G293W	LARP7_uc003iaz.2_Missense_Mutation_p.G300W|LARP7_uc003iba.2_Missense_Mutation_p.G214W|LARP7_uc003ibb.2_Missense_Mutation_p.G293W	NM_016648	NP_057732	Q4G0J3	LARP7_HUMAN	La ribonucleoprotein domain family, member 7	293	Lys-rich.				RNA processing	nucleoplasm|ribonucleoprotein complex	nucleotide binding|RNA binding			ovary(3)	3		Ovarian(17;0.0443)|Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.000603)														---	---	---	---	capture		Missense_Mutation	SNP	113568585	113568585	8956	4	G	T	T	35	35	LARP7	T	2	2
ANK2	287	broad.mit.edu	37	4	114282011	114282011	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:114282011A>T	uc003ibe.3	+	39	10814	c.10714A>T	c.(10714-10716)AGG>TGG	p.R3572W	ANK2_uc003ibd.3_Missense_Mutation_p.R1478W|ANK2_uc003ibf.3_Missense_Mutation_p.R1487W|ANK2_uc011cgc.1_Missense_Mutation_p.R663W|ANK2_uc003ibg.3_Missense_Mutation_p.R471W|ANK2_uc003ibh.3_Missense_Mutation_p.R161W|ANK2_uc011cgd.1_Missense_Mutation_p.R874W	NM_001148	NP_001139	Q01484	ANK2_HUMAN	ankyrin 2 isoform 1	3539	Death.				axon guidance|signal transduction	apical plasma membrane|basolateral plasma membrane|cytoskeleton|cytosol|sarcomere	protein binding|protein binding			central_nervous_system(7)|ovary(3)|large_intestine(2)|breast(1)|skin(1)	14		Ovarian(17;0.0448)|Hepatocellular(203;0.218)		OV - Ovarian serous cystadenocarcinoma(123;4.92e-05)														---	---	---	---	capture		Missense_Mutation	SNP	114282011	114282011	624	4	A	T	T	3	3	ANK2	T	4	4
NDST4	64579	broad.mit.edu	37	4	115891700	115891700	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:115891700C>A	uc003ibu.2	-	4	1786	c.1107G>T	c.(1105-1107)CGG>CGT	p.R369R	NDST4_uc010imw.2_RNA	NM_022569	NP_072091	Q9H3R1	NDST4_HUMAN	heparan sulfate N-deacetylase/N-sulfotransferase	369	Lumenal (Potential).|Heparan sulfate N-deacetylase 4.					Golgi membrane|integral to membrane	[heparan sulfate]-glucosamine N-sulfotransferase activity|hydrolase activity			skin(3)|ovary(1)	4		Ovarian(17;0.156)		OV - Ovarian serous cystadenocarcinoma(123;0.000562)														---	---	---	---	capture		Silent	SNP	115891700	115891700	10657	4	C	A	A	18	18	NDST4	A	2	2
KIAA1109	84162	broad.mit.edu	37	4	123207785	123207785	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:123207785C>A	uc003ieh.2	+	51	9172	c.9127C>A	c.(9127-9129)CCT>ACT	p.P3043T	KIAA1109_uc003iel.1_Missense_Mutation_p.P978T	NM_015312	NP_056127	Q2LD37	K1109_HUMAN	fragile site-associated protein	3043					regulation of cell growth|regulation of epithelial cell differentiation	integral to membrane|nucleus				ovary(8)|skin(2)|pancreas(1)|central_nervous_system(1)	12																		---	---	---	---	capture		Missense_Mutation	SNP	123207785	123207785	8516	4	C	A	A	30	30	KIAA1109	A	2	2
ADAD1	132612	broad.mit.edu	37	4	123333783	123333783	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:123333783C>G	uc003ieo.2	+	10	1300	c.1068C>G	c.(1066-1068)CTC>CTG	p.L356L	ADAD1_uc003iep.2_Silent_p.L345L|ADAD1_uc003ieq.2_Silent_p.L338L	NM_139243	NP_640336	Q96M93	ADAD1_HUMAN	adenosine deaminase domain containing 1	356	A to I editase.				multicellular organismal development|RNA processing	nucleus	adenosine deaminase activity|double-stranded RNA binding				0																		---	---	---	---	capture		Silent	SNP	123333783	123333783	232	4	C	G	G	32	32	ADAD1	G	3	3
ANKRD50	57182	broad.mit.edu	37	4	125599908	125599908	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:125599908T>C	uc003ifg.3	-	2	931	c.665A>G	c.(664-666)CAT>CGT	p.H222R	ANKRD50_uc011cgo.1_Missense_Mutation_p.H43R|ANKRD50_uc010inw.2_Missense_Mutation_p.H222R	NM_020337	NP_065070	Q9ULJ7	ANR50_HUMAN	ankyrin repeat domain 50	222										central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	125599908	125599908	685	4	T	C	C	51	51	ANKRD50	C	4	4
FAT4	79633	broad.mit.edu	37	4	126412468	126412468	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:126412468G>C	uc003ifj.3	+	17	14491	c.14491G>C	c.(14491-14493)GAT>CAT	p.D4831H	FAT4_uc011cgp.1_Missense_Mutation_p.D3072H|FAT4_uc003ifi.1_Missense_Mutation_p.D2308H	NM_024582	NP_078858	Q6V0I7	FAT4_HUMAN	FAT tumor suppressor homolog 4 precursor	4831	Cytoplasmic (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(9)|skin(5)|upper_aerodigestive_tract(2)|pancreas(2)	18																		---	---	---	---	capture		Missense_Mutation	SNP	126412468	126412468	5928	4	G	C	C	41	41	FAT4	C	3	3
GAB1	2549	broad.mit.edu	37	4	144390295	144390295	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:144390295G>T	uc003ije.2	+	10	2397	c.2038G>T	c.(2038-2040)GGG>TGG	p.G680W	GAB1_uc003ijd.2_Missense_Mutation_p.G710W|GAB1_uc011chq.1_Missense_Mutation_p.G577W	NM_002039	NP_002030	Q13480	GAB1_HUMAN	GRB2-associated binding protein 1 isoform b	680					cell proliferation|epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway	cytosol	SH3/SH2 adaptor activity			breast(2)|lung(1)|skin(1)	4	all_hematologic(180;0.158)																	---	---	---	---	capture		Missense_Mutation	SNP	144390295	144390295	6399	4	G	T	T	47	47	GAB1	T	2	2
DCHS2	54798	broad.mit.edu	37	4	155254549	155254549	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:155254549G>T	uc003inw.2	-	9	1314	c.1314C>A	c.(1312-1314)CCC>CCA	p.P438P	DCHS2_uc003inx.2_Silent_p.P937P	NM_017639	NP_060109	Q6V1P9	PCD23_HUMAN	dachsous 2 isoform 1	438	Cadherin 3.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|pancreas(1)	4	all_hematologic(180;0.208)	Renal(120;0.0854)		LUSC - Lung squamous cell carcinoma(193;0.107)														---	---	---	---	capture		Silent	SNP	155254549	155254549	4459	4	G	T	T	43	43	DCHS2	T	2	2
PLRG1	5356	broad.mit.edu	37	4	155459240	155459240	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:155459240G>C	uc003iny.2	-	13	1235	c.1172C>G	c.(1171-1173)TCT>TGT	p.S391C	PLRG1_uc003inz.2_Missense_Mutation_p.S382C	NM_002669	NP_002660	O43660	PLRG1_HUMAN	pleiotropic regulator 1 (PRL1 homolog,	391	WD 5.					catalytic step 2 spliceosome|nuclear speck	protein binding|signal transducer activity|transcription corepressor activity				0	all_hematologic(180;0.215)	Renal(120;0.0854)																---	---	---	---	capture		Missense_Mutation	SNP	155459240	155459240	12532	4	G	C	C	33	33	PLRG1	C	3	3
TLL1	7092	broad.mit.edu	37	4	167020663	167020663	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:167020663G>C	uc003irh.1	+	20	3538	c.2891G>C	c.(2890-2892)CGA>CCA	p.R964P	TLL1_uc011cjn.1_Missense_Mutation_p.R987P|TLL1_uc011cjo.1_Missense_Mutation_p.R788P	NM_012464	NP_036596	O43897	TLL1_HUMAN	tolloid-like 1 precursor	964	CUB 5.				cell differentiation|proteolysis|skeletal system development	extracellular region	calcium ion binding|metalloendopeptidase activity|zinc ion binding			skin(3)|ovary(2)|breast(1)|central_nervous_system(1)	7	all_hematologic(180;0.221)	Melanoma(52;0.0315)|Prostate(90;0.0405)		GBM - Glioblastoma multiforme(119;0.103)														---	---	---	---	capture		Missense_Mutation	SNP	167020663	167020663	16475	4	G	C	C	37	37	TLL1	C	3	3
DDX60L	91351	broad.mit.edu	37	4	169337864	169337864	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:169337864C>G	uc003irq.3	-	20	2916	c.2695G>C	c.(2695-2697)GCT>CCT	p.A899P	DDX60L_uc003irr.1_Missense_Mutation_p.A899P|DDX60L_uc003irs.1_Missense_Mutation_p.A594P	NM_001012967	NP_001012985	Q5H9U9	DDX6L_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like	899	Helicase ATP-binding.						ATP binding|ATP-dependent helicase activity|RNA binding			ovary(1)	1		Prostate(90;0.00876)|Renal(120;0.0183)|all_neural(102;0.0837)|Melanoma(52;0.132)		GBM - Glioblastoma multiforme(119;0.175)														---	---	---	---	capture		Missense_Mutation	SNP	169337864	169337864	4550	4	C	G	G	28	28	DDX60L	G	3	3
GALNTL6	442117	broad.mit.edu	37	4	173150831	173150831	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:173150831G>T	uc003isv.2	+	3	899	c.163G>T	c.(163-165)GGG>TGG	p.G55W		NM_001034845	NP_001030017	Q49A17	GLTL6_HUMAN	N-acetylgalactosaminyltransferase-like 6	55	Lumenal (Potential).					Golgi membrane|integral to membrane	metal ion binding|polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			breast(2)|ovary(1)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	173150831	173150831	6489	4	G	T	T	47	47	GALNTL6	T	2	2
ING2	3622	broad.mit.edu	37	4	184431872	184431872	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:184431872G>C	uc003ivs.1	+	2	739	c.610G>C	c.(610-612)GAG>CAG	p.E204Q	ING2_uc011ckk.1_Missense_Mutation_p.E164Q	NM_001564	NP_001555	Q9H160	ING2_HUMAN	inhibitor of growth family, member 2	204					chromatin modification|positive regulation of transcription, DNA-dependent|positive regulation of transforming growth factor beta receptor signaling pathway|regulation of growth|signal transduction|transcription, DNA-dependent	CCAAT-binding factor complex|Sin3 complex	chromatin binding|DNA binding|protein complex binding|zinc ion binding			ovary(1)	1		all_lung(41;5.16e-14)|Lung NSC(41;1.33e-13)|Colorectal(36;0.00139)|Hepatocellular(41;0.00886)|Renal(120;0.00988)|all_hematologic(60;0.0207)|Prostate(90;0.0235)|all_neural(102;0.202)		all cancers(43;1.15e-26)|Epithelial(43;2.98e-22)|OV - Ovarian serous cystadenocarcinoma(60;7.64e-10)|GBM - Glioblastoma multiforme(59;4.22e-06)|Colorectal(24;5.87e-06)|STAD - Stomach adenocarcinoma(60;2.09e-05)|COAD - Colon adenocarcinoma(29;5.15e-05)|LUSC - Lung squamous cell carcinoma(40;0.00902)|READ - Rectum adenocarcinoma(43;0.155)														---	---	---	---	capture		Missense_Mutation	SNP	184431872	184431872	8037	4	G	C	C	45	45	ING2	C	3	3
FAT1	2195	broad.mit.edu	37	4	187549470	187549470	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187549470C>T	uc003izf.2	-	9	4836	c.4648G>A	c.(4648-4650)GTC>ATC	p.V1550I		NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	1550	Extracellular (Potential).|Cadherin 13.				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12															HNSCC(5;0.00058)			---	---	---	---	capture		Missense_Mutation	SNP	187549470	187549470	5925	4	C	T	T	18	18	FAT1	T	2	2
ZFP42	132625	broad.mit.edu	37	4	188924664	188924664	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:188924664C>A	uc003izg.1	+	3	948	c.703C>A	c.(703-705)CAT>AAT	p.H235N	ZFP42_uc003izh.1_Missense_Mutation_p.H235N|ZFP42_uc003izi.1_Missense_Mutation_p.H235N	NM_174900	NP_777560	Q96MM3	ZFP42_HUMAN	zinc finger protein 42	235	C2H2-type 2.				female gonad development|male gonad development|meiosis	cytoplasm|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|skin(1)	2		all_cancers(14;6.2e-52)|all_epithelial(14;7.36e-37)|all_lung(41;2.29e-15)|Lung NSC(41;6.7e-15)|Breast(6;1.53e-05)|Melanoma(20;3.01e-05)|Hepatocellular(41;0.00335)|all_hematologic(60;0.014)|Renal(120;0.0183)|Prostate(90;0.0421)|Colorectal(36;0.227)		OV - Ovarian serous cystadenocarcinoma(60;1.54e-11)|BRCA - Breast invasive adenocarcinoma(30;4.21e-06)|GBM - Glioblastoma multiforme(59;8.93e-05)|STAD - Stomach adenocarcinoma(60;0.000279)|LUSC - Lung squamous cell carcinoma(40;0.00902)|READ - Rectum adenocarcinoma(43;0.157)														---	---	---	---	capture		Missense_Mutation	SNP	188924664	188924664	18238	4	C	A	A	17	17	ZFP42	A	2	2
ADAMTS16	170690	broad.mit.edu	37	5	5182170	5182170	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:5182170G>T	uc003jdl.2	+	4	653	c.515G>T	c.(514-516)CGA>CTA	p.R172L	ADAMTS16_uc003jdk.1_Missense_Mutation_p.R172L|ADAMTS16_uc003jdj.1_Missense_Mutation_p.R172L	NM_139056	NP_620687	Q8TE57	ATS16_HUMAN	ADAM metallopeptidase with thrombospondin type 1	172					proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(3)|lung(2)|large_intestine(1)|breast(1)|pancreas(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	5182170	5182170	262	5	G	T	T	37	37	ADAMTS16	T	1	1
SRD5A1	6715	broad.mit.edu	37	5	6651984	6651984	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:6651984G>C	uc003jdw.2	+	2	513	c.323G>C	c.(322-324)GGA>GCA	p.G108A	SRD5A1_uc011cml.1_RNA|SRD5A1_uc011cmm.1_Intron	NM_001047	NP_001038	P18405	S5A1_HUMAN	steroid-5-alpha-reductase 1	108					androgen biosynthetic process|cell differentiation|sex determination|sex differentiation	endoplasmic reticulum membrane|integral to membrane|microsome	3-oxo-5-alpha-steroid 4-dehydrogenase activity|electron carrier activity				0					Dutasteride(DB01126)|Finasteride(DB01216)													---	---	---	---	capture		Missense_Mutation	SNP	6651984	6651984	15652	5	G	C	C	41	41	SRD5A1	C	3	3
SRD5A1	6715	broad.mit.edu	37	5	6668313	6668313	+	Splice_Site	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:6668313A>T	uc003jdw.2	+	5	904	c.714_splice	c.e5-2	p.E238_splice	SRD5A1_uc011cml.1_Splice_Site|SRD5A1_uc011cmm.1_Splice_Site_p.E191_splice	NM_001047	NP_001038			steroid-5-alpha-reductase 1						androgen biosynthetic process|cell differentiation|sex determination|sex differentiation	endoplasmic reticulum membrane|integral to membrane|microsome	3-oxo-5-alpha-steroid 4-dehydrogenase activity|electron carrier activity				0					Dutasteride(DB01126)|Finasteride(DB01216)													---	---	---	---	capture		Splice_Site	SNP	6668313	6668313	15652	5	A	T	T	15	15	SRD5A1	T	5	4
ADCY2	108	broad.mit.edu	37	5	7709423	7709423	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:7709423T>A	uc003jdz.1	+	10	1568	c.1501T>A	c.(1501-1503)TGG>AGG	p.W501R	ADCY2_uc011cmo.1_Missense_Mutation_p.W321R	NM_020546	NP_065433	Q08462	ADCY2_HUMAN	adenylate cyclase 2	501	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|synaptic transmission|transmembrane transport|water transport	cytoplasm|dendrite|integral to membrane|plasma membrane	ATP binding|metal ion binding			ovary(5)|pancreas(1)|skin(1)	7																		---	---	---	---	capture		Missense_Mutation	SNP	7709423	7709423	295	5	T	A	A	55	55	ADCY2	A	4	4
ADCY2	108	broad.mit.edu	37	5	7826896	7826896	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:7826896T>A	uc003jdz.1	+	25	3255	c.3188T>A	c.(3187-3189)ATC>AAC	p.I1063N	ADCY2_uc011cmo.1_Missense_Mutation_p.I883N|ADCY2_uc010itm.1_Missense_Mutation_p.I259N	NM_020546	NP_065433	Q08462	ADCY2_HUMAN	adenylate cyclase 2	1063	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|synaptic transmission|transmembrane transport|water transport	cytoplasm|dendrite|integral to membrane|plasma membrane	ATP binding|metal ion binding			ovary(5)|pancreas(1)|skin(1)	7																		---	---	---	---	capture		Missense_Mutation	SNP	7826896	7826896	295	5	T	A	A	50	50	ADCY2	A	4	4
TAS2R1	50834	broad.mit.edu	37	5	9629796	9629796	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:9629796A>T	uc003jem.1	-	1	668	c.349T>A	c.(349-351)TGG>AGG	p.W117R		NM_019599	NP_062545	Q9NYW7	TA2R1_HUMAN	taste receptor T2R1	117	Cytoplasmic (Potential).				chemosensory behavior|sensory perception of taste	integral to membrane	taste receptor activity			ovary(3)	3																		---	---	---	---	capture		Missense_Mutation	SNP	9629796	9629796	16087	5	A	T	T	7	7	TAS2R1	T	4	4
MYO10	4651	broad.mit.edu	37	5	16689976	16689976	+	Missense_Mutation	SNP	C	A	A	rs145872653	by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:16689976C>A	uc003jft.3	-	28	4321	c.3853G>T	c.(3853-3855)GAT>TAT	p.D1285Y	MYO10_uc011cnc.1_Missense_Mutation_p.D164Y|MYO10_uc011cnd.1_Missense_Mutation_p.D642Y|MYO10_uc011cne.1_Missense_Mutation_p.D642Y|MYO10_uc010itx.2_Missense_Mutation_p.D908Y	NM_012334	NP_036466	Q9HD67	MYO10_HUMAN	myosin X	1285	PH 1.				axon guidance|signal transduction	myosin complex	actin binding|ATP binding|motor activity			ovary(2)|pancreas(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	16689976	16689976	10457	5	C	A	A	31	31	MYO10	A	1	1
CDH12	1010	broad.mit.edu	37	5	21975227	21975227	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:21975227C>A	uc010iuc.2	-	3	957	c.499G>T	c.(499-501)GCT>TCT	p.A167S	CDH12_uc011cno.1_Missense_Mutation_p.A167S|CDH12_uc003jgk.2_Missense_Mutation_p.A167S	NM_004061	NP_004052	P55289	CAD12_HUMAN	cadherin 12, type 2 preproprotein	167	Extracellular (Potential).|Cadherin 2.				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2															HNSCC(59;0.17)			---	---	---	---	capture		Missense_Mutation	SNP	21975227	21975227	3227	5	C	A	A	25	25	CDH12	A	2	2
IL7R	3575	broad.mit.edu	37	5	35867468	35867468	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35867468C>T	uc003jjs.2	+	3	371	c.282C>T	c.(280-282)ATC>ATT	p.I94I	IL7R_uc011coo.1_Silent_p.I94I|IL7R_uc011cop.1_RNA	NM_002185	NP_002176	P16871	IL7RA_HUMAN	interleukin 7 receptor precursor	94	Extracellular (Potential).				immune response|regulation of DNA recombination	extracellular region|integral to membrane	antigen binding|interleukin-7 receptor activity			ovary(3)|breast(1)|skin(1)	5	all_lung(31;0.00015)		Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Epithelial(62;0.187)|Colorectal(62;0.202)															---	---	---	---	capture		Silent	SNP	35867468	35867468	8006	5	C	T	T	31	31	IL7R	T	1	1
NIPBL	25836	broad.mit.edu	37	5	37000524	37000524	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37000524A>G	uc003jkl.3	+	12	3853	c.3354A>G	c.(3352-3354)GAA>GAG	p.E1118E	NIPBL_uc003jkk.3_Silent_p.E1118E	NM_133433	NP_597677	Q6KC79	NIPBL_HUMAN	delangin isoform A	1118					brain development|cellular protein localization|cellular response to X-ray|cognition|developmental growth|ear morphogenesis|embryonic arm morphogenesis|embryonic digestive tract morphogenesis|external genitalia morphogenesis|eye morphogenesis|face morphogenesis|gall bladder development|maintenance of mitotic sister chromatid cohesion|metanephros development|negative regulation of transcription from RNA polymerase II promoter|outflow tract morphogenesis|positive regulation of histone deacetylation|regulation of developmental growth|regulation of embryonic development|regulation of hair cycle|response to DNA damage stimulus|sensory perception of sound|uterus morphogenesis	SMC loading complex	chromo shadow domain binding|histone deacetylase binding|protein C-terminus binding|protein N-terminus binding			ovary(4)|lung(2)|large_intestine(1)|breast(1)|kidney(1)	9	all_lung(31;0.000447)|Hepatocellular(1;0.108)		Epithelial(62;0.072)|COAD - Colon adenocarcinoma(61;0.14)|all cancers(62;0.191)|Colorectal(62;0.202)															---	---	---	---	capture		Silent	SNP	37000524	37000524	10829	5	A	G	G	3	3	NIPBL	G	4	4
HEATR7B2	133558	broad.mit.edu	37	5	41057273	41057273	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41057273C>T	uc003jmj.3	-	9	1347	c.857G>A	c.(856-858)AGA>AAA	p.R286K	HEATR7B2_uc003jmi.3_Intron	NM_173489	NP_775760	Q7Z745	HTRB2_HUMAN	HEAT repeat family member 7B2	286	HEAT 3.						binding			ovary(6)|central_nervous_system(2)	8																		---	---	---	---	capture		Missense_Mutation	SNP	41057273	41057273	7318	5	C	T	T	32	32	HEATR7B2	T	2	2
HCN1	348980	broad.mit.edu	37	5	45462083	45462083	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:45462083G>A	uc003jok.2	-	3	901	c.876C>T	c.(874-876)GCC>GCT	p.A292A		NM_021072	NP_066550	O60741	HCN1_HUMAN	hyperpolarization activated cyclic	292	Cytoplasmic (Potential).					integral to membrane	cAMP binding|sodium channel activity|voltage-gated potassium channel activity			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	45462083	45462083	7278	5	G	A	A	47	47	HCN1	A	2	2
FST	10468	broad.mit.edu	37	5	52780903	52780903	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:52780903G>T	uc003jpd.2	+	5	825	c.798G>T	c.(796-798)CGG>CGT	p.R266R	FST_uc003jpc.2_Silent_p.R266R	NM_013409	NP_037541	P19883	FST_HUMAN	follistatin isoform FST344 precursor	266	Kazal-like 3.|Follistatin-like 3.				hemopoietic progenitor cell differentiation|negative regulation of activin receptor signaling pathway|negative regulation of follicle-stimulating hormone secretion|negative regulation of transcription from RNA polymerase II promoter|positive regulation of hair follicle development	extracellular region	activin binding|protein binding|signal transducer activity				0		Ovarian(174;1.78e-06)|Lung NSC(810;3.55e-06)|Breast(144;4.08e-05)																---	---	---	---	capture		Silent	SNP	52780903	52780903	6327	5	G	T	T	44	44	FST	T	2	2
BDP1	55814	broad.mit.edu	37	5	70837292	70837292	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:70837292A>T	uc003kbp.1	+	29	6297	c.6034A>T	c.(6034-6036)ATA>TTA	p.I2012L	BDP1_uc003kbo.2_Missense_Mutation_p.I2012L|BDP1_uc003kbq.1_RNA|BDP1_uc003kbr.1_RNA	NM_018429	NP_060899	A6H8Y1	BDP1_HUMAN	transcription factor-like nuclear regulator	2012					regulation of transcription, DNA-dependent|transcription from RNA polymerase III promoter	nucleoplasm	DNA binding			skin(2)	2		Lung NSC(167;0.000422)|Prostate(74;0.00815)|Ovarian(174;0.0176)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;5.28e-56)|Epithelial(20;2.31e-50)														---	---	---	---	capture		Missense_Mutation	SNP	70837292	70837292	1417	5	A	T	T	16	16	BDP1	T	4	4
MAP1B	4131	broad.mit.edu	37	5	71493547	71493547	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:71493547A>T	uc003kbw.3	+	5	4606	c.4365A>T	c.(4363-4365)CAA>CAT	p.Q1455H	MAP1B_uc010iyw.1_Missense_Mutation_p.Q1472H|MAP1B_uc010iyx.1_Missense_Mutation_p.Q1329H|MAP1B_uc010iyy.1_Missense_Mutation_p.Q1329H	NM_005909	NP_005900	P46821	MAP1B_HUMAN	microtubule-associated protein 1B	1455						microtubule|microtubule associated complex	structural molecule activity			large_intestine(2)|ovary(1)|central_nervous_system(1)|pancreas(1)	5		Lung NSC(167;0.00202)|Ovarian(174;0.0175)|Prostate(461;0.142)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;7.99e-54)														---	---	---	---	capture		Missense_Mutation	SNP	71493547	71493547	9611	5	A	T	T	3	3	MAP1B	T	4	4
ZNF366	167465	broad.mit.edu	37	5	71756484	71756484	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:71756484C>T	uc003kce.1	-	2	1026	c.840G>A	c.(838-840)CCG>CCA	p.P280P		NM_152625	NP_689838	Q8N895	ZN366_HUMAN	zinc finger protein 366	280					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			central_nervous_system(1)|skin(1)	2		Lung NSC(167;0.0247)|Ovarian(174;0.0908)|Prostate(461;0.155)		OV - Ovarian serous cystadenocarcinoma(47;2.51e-53)														---	---	---	---	capture		Silent	SNP	71756484	71756484	18462	5	C	T	T	27	27	ZNF366	T	1	1
CMYA5	202333	broad.mit.edu	37	5	79026607	79026607	+	Silent	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79026607A>C	uc003kgc.2	+	2	2091	c.2019A>C	c.(2017-2019)ACA>ACC	p.T673T		NM_153610	NP_705838	Q8N3K9	CMYA5_HUMAN	cardiomyopathy associated 5	673						perinuclear region of cytoplasm				ovary(6)|pancreas(2)|lung(1)	9		Lung NSC(167;0.00296)|all_lung(232;0.00327)|Ovarian(174;0.0262)		OV - Ovarian serous cystadenocarcinoma(54;9.85e-46)|Epithelial(54;3.38e-40)|all cancers(79;3.43e-35)														---	---	---	---	capture		Silent	SNP	79026607	79026607	3728	5	A	C	C	6	6	CMYA5	C	4	4
CKMT2	1160	broad.mit.edu	37	5	80559433	80559433	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:80559433G>T	uc003khc.3	+	10	1380	c.1138G>T	c.(1138-1140)GAG>TAG	p.E380*	RNU5E_uc011cto.1_Intron|CKMT2_uc010jaq.2_Nonsense_Mutation_p.E380*|CKMT2_uc003khd.3_Nonsense_Mutation_p.E380*|uc003khe.1_Intron|uc003khf.1_Intron|uc003khg.1_Intron	NM_001825	NP_001816	P17540	KCRS_HUMAN	sarcomeric mitochondrial creatine kinase	380	Phosphagen kinase C-terminal.				creatine metabolic process|muscle contraction	mitochondrial inner membrane	ATP binding|creatine kinase activity				0		Lung NSC(167;0.00475)|all_lung(232;0.00502)|Ovarian(174;0.0336)		OV - Ovarian serous cystadenocarcinoma(54;2.29e-44)|Epithelial(54;1.05e-38)|all cancers(79;4.15e-34)	Creatine(DB00148)													---	---	---	---	capture		Nonsense_Mutation	SNP	80559433	80559433	3587	5	G	T	T	33	33	CKMT2	T	5	2
GPR98	84059	broad.mit.edu	37	5	89924618	89924618	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:89924618G>A	uc003kju.2	+	8	1574	c.1478G>A	c.(1477-1479)CGA>CAA	p.R493Q	GPR98_uc003kjt.2_5'UTR	NM_032119	NP_115495	Q8WXG9	GPR98_HUMAN	G protein-coupled receptor 98 precursor	493	Extracellular (Potential).				cell communication|cell-cell adhesion|maintenance of organ identity|neuropeptide signaling pathway|photoreceptor cell maintenance	cell surface|cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(11)|central_nervous_system(3)|pancreas(2)	16		all_cancers(142;1.05e-09)|all_epithelial(76;1.81e-12)|all_lung(232;5.41e-06)|Lung NSC(167;1.72e-05)|Ovarian(174;0.00948)|Colorectal(57;0.133)|Breast(839;0.192)		OV - Ovarian serous cystadenocarcinoma(54;7.01e-30)|Epithelial(54;6.79e-25)|all cancers(79;1.88e-20)														---	---	---	---	capture		Missense_Mutation	SNP	89924618	89924618	6997	5	G	A	A	37	37	GPR98	A	1	1
MCTP1	79772	broad.mit.edu	37	5	94050558	94050558	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:94050558A>G	uc003kkx.2	-	20	2644	c.2644T>C	c.(2644-2646)TAT>CAT	p.Y882H	MCTP1_uc003kkv.2_Missense_Mutation_p.Y661H|MCTP1_uc003kkw.2_Missense_Mutation_p.Y575H|MCTP1_uc003kku.2_Missense_Mutation_p.Y398H	NM_024717	NP_078993	Q6DN14	MCTP1_HUMAN	multiple C2 domains, transmembrane 1 isoform L	882					calcium-mediated signaling	integral to membrane|membrane fraction	calcium ion binding			ovary(2)	2		all_cancers(142;1.68e-05)|all_epithelial(76;1.51e-07)|all_lung(232;0.0167)|Lung NSC(167;0.0207)|Ovarian(225;0.0218)|Colorectal(57;0.207)		all cancers(79;9.1e-17)														---	---	---	---	capture		Missense_Mutation	SNP	94050558	94050558	9789	5	A	G	G	15	15	MCTP1	G	4	4
PAM	5066	broad.mit.edu	37	5	102363902	102363902	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:102363902A>T	uc003knw.2	+	24	3076	c.2703A>T	c.(2701-2703)AAA>AAT	p.K901N	PAM_uc003kns.2_Missense_Mutation_p.K794N|PAM_uc003knt.2_Missense_Mutation_p.K902N|PAM_uc003knu.2_Missense_Mutation_p.K833N|PAM_uc003knv.2_Intron|PAM_uc011cuz.1_Missense_Mutation_p.K803N|PAM_uc003knz.2_Intron	NM_000919	NP_000910	P19021	AMD_HUMAN	peptidylglycine alpha-amidating monooxygenase	901	Cytoplasmic (Potential).				peptide metabolic process|protein modification process	extracellular region|integral to membrane|stored secretory granule	L-ascorbic acid binding|peptidylamidoglycolate lyase activity|peptidylglycine monooxygenase activity|protein binding				0		all_cancers(142;3.12e-07)|all_epithelial(76;3.48e-10)|Prostate(80;0.00914)|Lung NSC(167;0.0213)|Ovarian(225;0.024)|Colorectal(57;0.0251)|all_lung(232;0.0284)		Epithelial(69;1.1e-13)|COAD - Colon adenocarcinoma(37;0.0127)	Vitamin C(DB00126)													---	---	---	---	capture		Missense_Mutation	SNP	102363902	102363902	11829	5	A	T	T	2	2	PAM	T	4	4
TNFAIP8	25816	broad.mit.edu	37	5	118728655	118728655	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:118728655G>T	uc003ksh.2	+	3	864	c.176G>T	c.(175-177)AGG>ATG	p.R59M	TNFAIP8_uc003ksf.1_Intron|TNFAIP8_uc003ksg.2_Missense_Mutation_p.R49M|TNFAIP8_uc011cwf.1_Missense_Mutation_p.R53M|TNFAIP8_uc003ksi.2_Missense_Mutation_p.R59M	NM_014350	NP_055165	O95379	TFIP8_HUMAN	tumor necrosis factor, alpha-induced protein 8	59	Potential.				anti-apoptosis|apoptosis|negative regulation of anti-apoptosis	cytoplasm	caspase inhibitor activity|protein binding			ovary(1)	1		all_cancers(142;0.0317)|Prostate(80;0.111)|Breast(839;0.231)		Epithelial(69;4.63e-83)|OV - Ovarian serous cystadenocarcinoma(64;1.39e-82)|all cancers(49;4.88e-75)|GBM - Glioblastoma multiforme(465;0.00338)|BRCA - Breast invasive adenocarcinoma(61;0.0148)|COAD - Colon adenocarcinoma(49;0.0829)														---	---	---	---	capture		Missense_Mutation	SNP	118728655	118728655	16817	5	G	T	T	35	35	TNFAIP8	T	2	2
FBN2	2201	broad.mit.edu	37	5	127681162	127681162	+	Missense_Mutation	SNP	G	T	T	rs145565243		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:127681162G>T	uc003kuu.2	-	24	3543	c.3104C>A	c.(3103-3105)ACC>AAC	p.T1035N	FBN2_uc003kuv.2_Missense_Mutation_p.T1002N	NM_001999	NP_001990	P35556	FBN2_HUMAN	fibrillin 2 precursor	1035	TB 5.				bone trabecula formation|negative regulation of transforming growth factor beta receptor signaling pathway by extracellular sequestering of TGFbeta|positive regulation of bone mineralization|positive regulation of osteoblast differentiation	microfibril	calcium ion binding|extracellular matrix structural constituent			ovary(8)|large_intestine(4)|pancreas(1)|kidney(1)|skin(1)	15		all_cancers(142;0.0216)|Prostate(80;0.0551)	KIRC - Kidney renal clear cell carcinoma(527;0.0268)|Kidney(363;0.0488)	OV - Ovarian serous cystadenocarcinoma(64;0.0821)|Epithelial(69;0.146)														---	---	---	---	capture		Missense_Mutation	SNP	127681162	127681162	5939	5	G	T	T	44	44	FBN2	T	2	2
SHROOM1	134549	broad.mit.edu	37	5	132158542	132158542	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:132158542C>A	uc003kxx.2	-	10	3310	c.2505G>T	c.(2503-2505)CGG>CGT	p.R835R	SHROOM1_uc003kxy.1_Silent_p.R830R	NM_133456	NP_597713	Q2M3G4	SHRM1_HUMAN	shroom family member 1	835					actin filament bundle assembly|cell morphogenesis	cytoplasm|microtubule	actin filament binding			pancreas(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---	capture		Silent	SNP	132158542	132158542	14788	5	C	A	A	26	26	SHROOM1	A	2	2
PCDHA7	56141	broad.mit.edu	37	5	140215673	140215673	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140215673C>T	uc003lhq.2	+	1	1705	c.1705C>T	c.(1705-1707)CGG>TGG	p.R569W	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc011dac.1_Missense_Mutation_p.R569W	NM_018910	NP_061733	Q9UN72	PCDA7_HUMAN	protocadherin alpha 7 isoform 1 precursor	569	Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(2)|skin(2)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---	capture		Missense_Mutation	SNP	140215673	140215673	11949	5	C	T	T	31	31	PCDHA7	T	1	1
PCDHB7	56129	broad.mit.edu	37	5	140552867	140552867	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140552867G>T	uc003lit.2	+	1	625	c.451G>T	c.(451-453)GCA>TCA	p.A151S		NM_018940	NP_061763	Q9Y5E2	PCDB7_HUMAN	protocadherin beta 7 precursor	151	Extracellular (Potential).|Cadherin 2.				calcium-dependent cell-cell adhesion|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|central_nervous_system(1)|skin(1)	6			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---	capture		Missense_Mutation	SNP	140552867	140552867	11967	5	G	T	T	42	42	PCDHB7	T	2	2
PCDHGB1	56104	broad.mit.edu	37	5	140731747	140731747	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140731747C>A	uc003ljo.1	+	1	1920	c.1920C>A	c.(1918-1920)GTC>GTA	p.V640V	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc011daq.1_Silent_p.V640V	NM_018922	NP_061745	Q9Y5G3	PCDGD_HUMAN	protocadherin gamma subfamily B, 1 isoform 1	640	Extracellular (Potential).|Cadherin 6.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---	capture		Silent	SNP	140731747	140731747	11982	5	C	A	A	31	31	PCDHGB1	A	1	1
PCDH1	5097	broad.mit.edu	37	5	141236853	141236853	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:141236853C>G	uc003llp.2	-	4	3400	c.3283G>C	c.(3283-3285)GAT>CAT	p.D1095H		NM_032420	NP_115796	Q08174	PCDH1_HUMAN	protocadherin 1 isoform 2 precursor	Error:Variant_position_missing_in_Q08174_after_alignment					cell-cell signaling|homophilic cell adhesion|nervous system development	cell-cell junction|integral to plasma membrane	calcium ion binding			ovary(5)	5		Lung NSC(810;0.027)|all_lung(500;0.0321)|all_hematologic(541;0.0433)|Prostate(461;0.0453)|Breast(839;0.128)|Lung SC(612;0.238)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)	GBM - Glioblastoma multiforme(465;1.06e-05)														---	---	---	---	capture		Missense_Mutation	SNP	141236853	141236853	11926	5	C	G	G	29	29	PCDH1	G	3	3
ABLIM3	22885	broad.mit.edu	37	5	148627474	148627474	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:148627474G>C	uc003lpy.2	+	18	1932	c.1681G>C	c.(1681-1683)GAG>CAG	p.E561Q	ABLIM3_uc003lpz.1_Missense_Mutation_p.E561Q|ABLIM3_uc003lqa.1_Missense_Mutation_p.E458Q|ABLIM3_uc003lqb.2_Missense_Mutation_p.E450Q|ABLIM3_uc003lqc.1_Missense_Mutation_p.E528Q|ABLIM3_uc003lqd.1_Missense_Mutation_p.E466Q|ABLIM3_uc003lqf.2_Missense_Mutation_p.E450Q|ABLIM3_uc003lqe.1_Missense_Mutation_p.E450Q	NM_014945	NP_055760	O94929	ABLM3_HUMAN	actin binding LIM protein family, member 3	561					axon guidance|cytoskeleton organization	cytoplasm	actin binding|zinc ion binding			ovary(2)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---	capture		Missense_Mutation	SNP	148627474	148627474	97	5	G	C	C	45	45	ABLIM3	C	3	3
EBF1	1879	broad.mit.edu	37	5	158204441	158204441	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:158204441G>T	uc010jip.2	-	10	1318	c.1016C>A	c.(1015-1017)CCA>CAA	p.P339Q	EBF1_uc011ddw.1_Missense_Mutation_p.P207Q|EBF1_uc011ddx.1_Missense_Mutation_p.P340Q|EBF1_uc003lxl.3_Missense_Mutation_p.P308Q	NM_024007	NP_076870	Q9UH73	COE1_HUMAN	early B-cell factor	339	IPT/TIG.				multicellular organismal development	nucleus	DNA binding|metal ion binding		HMGA2/EBF1(2)	soft_tissue(2)|ovary(1)|central_nervous_system(1)|pancreas(1)	5	Renal(175;0.00196)	Acute lymphoblastic leukemia(3;2.99e-06)|all_hematologic(3;0.000772)|Medulloblastoma(196;0.037)|all_neural(177;0.143)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)					T	HMGA2	lipoma								---	---	---	---	capture		Missense_Mutation	SNP	158204441	158204441	5066	5	G	T	T	47	47	EBF1	T	2	2
GABRA6	2559	broad.mit.edu	37	5	161116112	161116112	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:161116112A>G	uc003lyu.2	+	4	721	c.383A>G	c.(382-384)AAC>AGC	p.N128S	GABRA6_uc003lyv.2_5'Flank	NM_000811	NP_000802	Q16445	GBRA6_HUMAN	gamma-aminobutyric acid A receptor, alpha 6	128	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	benzodiazepine receptor activity|chloride channel activity			ovary(7)|skin(3)|large_intestine(1)|central_nervous_system(1)	12	Renal(175;0.00259)	Medulloblastoma(196;0.0208)|all_neural(177;0.0672)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)		Alprazolam(DB00404)|Ethchlorvynol(DB00189)|Flunitrazepam(DB01544)|Flurazepam(DB00690)|Lorazepam(DB00186)|Meprobamate(DB00371)|Midazolam(DB00683)										TCGA Ovarian(5;0.080)			---	---	---	---	capture		Missense_Mutation	SNP	161116112	161116112	6416	5	A	G	G	2	2	GABRA6	G	4	4
GABRA1	2554	broad.mit.edu	37	5	161324409	161324409	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:161324409C>T	uc010jiw.2	+	11	1820	c.1352C>T	c.(1351-1353)GCC>GTC	p.A451V	GABRA1_uc010jix.2_Missense_Mutation_p.A451V|GABRA1_uc010jiy.2_Missense_Mutation_p.A451V|GABRA1_uc003lyx.3_Missense_Mutation_p.A451V|GABRA1_uc010jiz.2_Missense_Mutation_p.A451V|GABRA1_uc010jja.2_Missense_Mutation_p.A451V|GABRA1_uc010jjb.2_Missense_Mutation_p.A451V	NM_000806	NP_000797	P14867	GBRA1_HUMAN	gamma-aminobutyric acid (GABA) A receptor, alpha	451					gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)|pancreas(1)	3	Renal(175;0.00259)	Medulloblastoma(196;0.0208)|all_neural(177;0.0672)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.228)	Alprazolam(DB00404)|Butabarbital(DB00237)|Butalbital(DB00241)|Butethal(DB01353)|Chlordiazepoxide(DB00475)|Clobazam(DB00349)|Clonazepam(DB01068)|Clorazepate(DB00628)|Desflurane(DB01189)|Diazepam(DB00829)|Enflurane(DB00228)|Ethanol(DB00898)|Ethchlorvynol(DB00189)|Etomidate(DB00292)|Flumazenil(DB01205)|Flurazepam(DB00690)|Halazepam(DB00801)|Halothane(DB01159)|Hexobarbital(DB01355)|Isoflurane(DB00753)|Lorazepam(DB00186)|Meprobamate(DB00371)|Metharbital(DB00463)|Methohexital(DB00474)|Methoxyflurane(DB01028)|Methylphenobarbital(DB00849)|Methyprylon(DB01107)|Midazolam(DB00683)|Nitrazepam(DB01595)|Oxazepam(DB00842)|Pentobarbital(DB00312)|Phenobarbital(DB01174)|Picrotoxin(DB00466)|Prazepam(DB01588)|Primidone(DB00794)|Progabide(DB00837)|Propofol(DB00818)|Quazepam(DB01589)|Secobarbital(DB00418)|Sevoflurane(DB01236)|Talbutal(DB00306)|Thiamylal(DB01154)|Thiopental(DB00599)|Topiramate(DB00273)|Zaleplon(DB00962)|Zolpidem(DB00425)													---	---	---	---	capture		Missense_Mutation	SNP	161324409	161324409	6411	5	C	T	T	26	26	GABRA1	T	2	2
ODZ2	57451	broad.mit.edu	37	5	167643784	167643784	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:167643784G>A	uc010jjd.2	+	22	4063	c.4063G>A	c.(4063-4065)GAC>AAC	p.D1355N	ODZ2_uc003lzr.3_Missense_Mutation_p.D1125N|ODZ2_uc003lzt.3_Missense_Mutation_p.D728N|ODZ2_uc010jje.2_Missense_Mutation_p.D619N	NM_001122679	NP_001116151			odz, odd Oz/ten-m homolog 2											ovary(6)|central_nervous_system(4)	10	Renal(175;0.00124)|Lung NSC(126;0.136)|all_lung(126;0.242)	Medulloblastoma(196;0.0241)|all_neural(177;0.026)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.0444)|OV - Ovarian serous cystadenocarcinoma(192;0.0694)|Epithelial(171;0.124)														---	---	---	---	capture		Missense_Mutation	SNP	167643784	167643784	11240	5	G	A	A	33	33	ODZ2	A	2	2
SLIT3	6586	broad.mit.edu	37	5	168216618	168216618	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:168216618C>T	uc003mab.2	-	11	1446	c.1026G>A	c.(1024-1026)CAG>CAA	p.Q342Q	SLIT3_uc010jjg.2_Silent_p.Q342Q|SLIT3_uc010jji.2_Silent_p.Q342Q|SLIT3_uc003mac.1_Silent_p.Q139Q	NM_003062	NP_003053	O75094	SLIT3_HUMAN	slit homolog 3 precursor	342	LRR 8.				apoptosis involved in luteolysis|axon extension involved in axon guidance|cellular response to hormone stimulus|negative chemotaxis|negative regulation of cell growth|negative regulation of chemokine-mediated signaling pathway|response to cortisol stimulus|Roundabout signaling pathway	extracellular space|mitochondrion	calcium ion binding|Roundabout binding			ovary(3)|skin(1)	4	Renal(175;0.000159)|Lung NSC(126;0.0174)|all_lung(126;0.0392)	Medulloblastoma(196;0.0399)|all_neural(177;0.0966)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)															---	---	---	---	capture		Silent	SNP	168216618	168216618	15239	5	C	T	T	32	32	SLIT3	T	2	2
DOCK2	1794	broad.mit.edu	37	5	169116285	169116285	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:169116285G>T	uc003maf.2	+	9	871	c.791G>T	c.(790-792)CGG>CTG	p.R264L	DOCK2_uc011der.1_RNA	NM_004946	NP_004937	Q92608	DOCK2_HUMAN	dedicator of cytokinesis 2	264					actin cytoskeleton organization|regulation of defense response to virus by virus|viral reproduction	cytoskeleton|cytosol|endomembrane system|membrane	electron carrier activity|GTP binding|GTPase binding|heme binding|Rac guanyl-nucleotide exchange factor activity|T cell receptor binding			ovary(5)|pancreas(2)	7	Renal(175;0.000159)|Lung NSC(126;0.0221)|all_lung(126;0.0337)	Medulloblastoma(196;0.0399)|all_neural(177;0.0966)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)															---	---	---	---	capture		Missense_Mutation	SNP	169116285	169116285	4871	5	G	T	T	39	39	DOCK2	T	1	1
DOCK2	1794	broad.mit.edu	37	5	169506093	169506093	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:169506093G>C	uc003maf.2	+	49	5189	c.5109G>C	c.(5107-5109)AAG>AAC	p.K1703N	DOCK2_uc011der.1_RNA|DOCK2_uc010jjm.2_Missense_Mutation_p.K1195N|DOCK2_uc003mah.2_Missense_Mutation_p.K259N	NM_004946	NP_004937	Q92608	DOCK2_HUMAN	dedicator of cytokinesis 2	1703					actin cytoskeleton organization|regulation of defense response to virus by virus|viral reproduction	cytoskeleton|cytosol|endomembrane system|membrane	electron carrier activity|GTP binding|GTPase binding|heme binding|Rac guanyl-nucleotide exchange factor activity|T cell receptor binding			ovary(5)|pancreas(2)	7	Renal(175;0.000159)|Lung NSC(126;0.0221)|all_lung(126;0.0337)	Medulloblastoma(196;0.0399)|all_neural(177;0.0966)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)															---	---	---	---	capture		Missense_Mutation	SNP	169506093	169506093	4871	5	G	C	C	33	33	DOCK2	C	3	3
SFXN1	94081	broad.mit.edu	37	5	174948929	174948929	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:174948929C>A	uc003mda.2	+	9	920	c.782C>A	c.(781-783)CCA>CAA	p.P261Q	SFXN1_uc003mdb.1_Missense_Mutation_p.P200Q	NM_022754	NP_073591	Q9H9B4	SFXN1_HUMAN	sideroflexin 1	261					iron ion homeostasis	integral to membrane	cation transmembrane transporter activity|protein binding			ovary(1)	1	all_cancers(89;0.00922)|Renal(175;0.000269)|Lung NSC(126;0.00515)|all_lung(126;0.00873)	Medulloblastoma(196;0.0399)|all_neural(177;0.0663)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000183)															---	---	---	---	capture		Missense_Mutation	SNP	174948929	174948929	14685	5	C	A	A	21	21	SFXN1	A	2	2
BTNL3	10917	broad.mit.edu	37	5	180419834	180419834	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:180419834C>A	uc003mmr.2	+	2	199	c.71C>A	c.(70-72)CCG>CAG	p.P24Q		NM_197975	NP_932079	Q6UXE8	BTNL3_HUMAN	butyrophilin-like 3 precursor	24	Extracellular (Potential).				lipid metabolic process	integral to membrane					0	all_cancers(89;3.37e-05)|all_epithelial(37;3.77e-06)|Renal(175;0.000159)|Lung NSC(126;0.00211)|all_lung(126;0.00371)|Breast(19;0.114)	all_cancers(40;0.00336)|Medulloblastoma(196;0.0133)|all_neural(177;0.0199)|all_hematologic(541;0.163)|Ovarian(839;0.238)|all_lung(500;0.248)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000272)															---	---	---	---	capture		Missense_Mutation	SNP	180419834	180419834	1600	5	C	A	A	23	23	BTNL3	A	1	1
TRIM7	81786	broad.mit.edu	37	5	180622557	180622557	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:180622557G>T	uc003mmz.1	-	7	1212	c.1145C>A	c.(1144-1146)ACC>AAC	p.T382N	TRIM7_uc003mmv.1_Missense_Mutation_p.T200N|TRIM7_uc003mmw.1_Missense_Mutation_p.T174N|TRIM7_uc003mmx.1_Missense_Mutation_p.T174N|TRIM7_uc003mmy.1_Missense_Mutation_p.T174N	NM_203293	NP_976038	Q9C029	TRIM7_HUMAN	tripartite motif-containing 7 isoform 1	382	B30.2/SPRY.					cytoplasm|nucleus	zinc ion binding			ovary(2)|skin(1)	3	all_cancers(89;6.03e-06)|all_epithelial(37;7.1e-07)|Renal(175;0.000159)|Lung NSC(126;0.00354)|all_lung(126;0.00609)|Breast(19;0.0684)	all_cancers(40;0.000172)|Medulloblastoma(196;0.0133)|all_neural(177;0.0199)|all_lung(500;0.0221)|all_hematologic(541;0.0433)|Lung NSC(249;0.132)|Ovarian(839;0.238)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	all cancers(165;2e-06)|Epithelial(171;1.35e-05)|OV - Ovarian serous cystadenocarcinoma(192;0.000128)|Kidney(146;0.0674)|GBM - Glioblastoma multiforme(465;0.0802)														---	---	---	---	capture		Missense_Mutation	SNP	180622557	180622557	17092	5	G	T	T	44	44	TRIM7	T	2	2
F13A1	2162	broad.mit.edu	37	6	6182372	6182372	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:6182372G>T	uc003mwv.2	-	11	1431	c.1308C>A	c.(1306-1308)GTC>GTA	p.V436V	F13A1_uc011dib.1_Silent_p.V373V	NM_000129	NP_000120	P00488	F13A_HUMAN	coagulation factor XIII A1 subunit precursor	436					peptide cross-linking|platelet activation|platelet degranulation	extracellular region|platelet alpha granule lumen	acyltransferase activity|metal ion binding|protein-glutamine gamma-glutamyltransferase activity			ovary(2)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|pancreas(1)|skin(1)	6	Ovarian(93;0.0816)	all_hematologic(90;0.152)			L-Glutamine(DB00130)													---	---	---	---	capture		Silent	SNP	6182372	6182372	5534	6	G	T	T	45	45	F13A1	T	2	2
RREB1	6239	broad.mit.edu	37	6	7232080	7232080	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:7232080C>T	uc003mxc.2	+	10	4138	c.3748C>T	c.(3748-3750)CAC>TAC	p.H1250Y	RREB1_uc003mxb.2_Missense_Mutation_p.H1250Y|RREB1_uc010jnx.2_Missense_Mutation_p.H1250Y	NM_001003698	NP_001003698	Q92766	RREB1_HUMAN	ras responsive element binding protein 1 isoform	1250	C2H2-type 12.				multicellular organismal development|positive regulation of transcription, DNA-dependent|Ras protein signal transduction|transcription from RNA polymerase II promoter	cytoplasm|nuclear speck	DNA binding|zinc ion binding			ovary(4)|large_intestine(2)|pancreas(2)|skin(2)|breast(1)	11	Ovarian(93;0.0398)	all_hematologic(90;0.0384)|Prostate(151;0.191)																---	---	---	---	capture		Missense_Mutation	SNP	7232080	7232080	14159	6	C	T	T	21	21	RREB1	T	2	2
TMEM14C	51522	broad.mit.edu	37	6	10725208	10725208	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:10725208G>A	uc003mzh.2	+	3	216	c.35G>A	c.(34-36)TGG>TAG	p.W12*	TMEM14C_uc010joq.1_Nonsense_Mutation_p.W12*|TMEM14C_uc003mzi.2_Nonsense_Mutation_p.W12*	NM_016462	NP_057546	Q9P0S9	TM14C_HUMAN	transmembrane protein 14C	12	Helical; (Potential).				heme biosynthetic process	integral to membrane|mitochondrial membrane					0	Ovarian(93;0.107)|Breast(50;0.137)	all_hematologic(90;0.135)	Epithelial(50;0.246)															---	---	---	---	capture		Nonsense_Mutation	SNP	10725208	10725208	16597	6	G	A	A	47	47	TMEM14C	A	5	2
HIVEP1	3096	broad.mit.edu	37	6	12161767	12161767	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:12161767G>A	uc003nac.2	+	8	6762	c.6583G>A	c.(6583-6585)GAG>AAG	p.E2195K	HIVEP1_uc011diq.1_RNA	NM_002114	NP_002105	P15822	ZEP1_HUMAN	human immunodeficiency virus type I enhancer	2195					transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|protein binding|zinc ion binding			ovary(3)|large_intestine(1)|central_nervous_system(1)|skin(1)	6	Breast(50;0.0639)|Ovarian(93;0.0816)	all_hematologic(90;0.117)																---	---	---	---	capture		Missense_Mutation	SNP	12161767	12161767	7477	6	G	A	A	45	45	HIVEP1	A	2	2
NUP153	9972	broad.mit.edu	37	6	17637456	17637456	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:17637456C>A	uc003ncd.1	-	16	2592	c.2392G>T	c.(2392-2394)GAG>TAG	p.E798*	NUP153_uc011dje.1_Nonsense_Mutation_p.E829*|NUP153_uc010jpl.1_Nonsense_Mutation_p.E756*	NM_005124	NP_005115	P49790	NU153_HUMAN	nucleoporin 153kDa	798	RanBP2-type 3.				carbohydrate metabolic process|glucose transport|interspecies interaction between organisms|mRNA transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	cytoplasm|nuclear membrane|nuclear pore|nucleolus|nucleoplasm	DNA binding|protein binding|transporter activity|zinc ion binding			lung(4)|ovary(2)|breast(2)|skin(1)	9	Breast(50;0.0259)|Ovarian(93;0.0584)	all_hematologic(90;0.125)	all cancers(50;0.0981)|Epithelial(50;0.112)															---	---	---	---	capture		Nonsense_Mutation	SNP	17637456	17637456	11160	6	C	A	A	30	30	NUP153	A	5	2
CDKAL1	54901	broad.mit.edu	37	6	21201499	21201499	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:21201499G>A	uc003ndc.1	+	15	1716	c.1542G>A	c.(1540-1542)TTG>TTA	p.L514L	CDKAL1_uc003ndd.1_Silent_p.L514L|CDKAL1_uc003nde.1_Silent_p.L423L|CDKAL1_uc003ndf.1_Intron|CDKAL1_uc003ndg.2_RNA	NM_017774	NP_060244	Q5VV42	CDKAL_HUMAN	CDK5 regulatory subunit associated protein	514					RNA modification	integral to membrane	4 iron, 4 sulfur cluster binding|metal ion binding|transferase activity			ovary(2)	2	all_epithelial(95;0.0708)|Breast(50;0.131)|Ovarian(93;0.227)		OV - Ovarian serous cystadenocarcinoma(7;0.0241)|all cancers(50;0.123)|Epithelial(50;0.248)															---	---	---	---	capture		Silent	SNP	21201499	21201499	3281	6	G	A	A	45	45	CDKAL1	A	2	2
LRRC16A	55604	broad.mit.edu	37	6	25554286	25554286	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:25554286G>A	uc011djw.1	+	28	2930	c.2554G>A	c.(2554-2556)GAA>AAA	p.E852K	LRRC16A_uc010jpx.2_Missense_Mutation_p.E852K|LRRC16A_uc010jpy.2_Missense_Mutation_p.E852K|LRRC16A_uc003nfa.1_Missense_Mutation_p.E206K	NM_017640	NP_060110	Q5VZK9	LR16A_HUMAN	leucine rich repeat containing 16A	852					actin filament organization|blood coagulation|cell migration|lamellipodium assembly|ruffle organization|urate metabolic process	cytosol|lamellipodium|nucleus				ovary(1)|breast(1)|central_nervous_system(1)|pancreas(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	25554286	25554286	9345	6	G	A	A	45	45	LRRC16A	A	2	2
SLC17A1	6568	broad.mit.edu	37	6	25811931	25811931	+	Nonsense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:25811931G>C	uc003nfh.3	-	9	1081	c.965C>G	c.(964-966)TCA>TGA	p.S322*	SLC17A1_uc011djy.1_RNA|SLC17A1_uc010jqb.1_Nonsense_Mutation_p.S320*|SLC17A1_uc010jqc.1_Nonsense_Mutation_p.S266*	NM_005074	NP_005065	Q14916	NPT1_HUMAN	solute carrier family 17 (sodium phosphate),	322					sodium ion transport|urate metabolic process	integral to plasma membrane|membrane fraction	sodium-dependent phosphate transmembrane transporter activity|symporter activity			ovary(3)|pancreas(1)	4																		---	---	---	---	capture		Nonsense_Mutation	SNP	25811931	25811931	14912	6	G	C	C	45	45	SLC17A1	C	5	3
HIST1H3D	8351	broad.mit.edu	37	6	26197084	26197084	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26197084C>A	uc003ngv.2	-	2	792	c.395G>T	c.(394-396)CGT>CTT	p.R132L	HIST1H2BF_uc003ngx.2_5'Flank	NM_003530	NP_003521	P68431	H31_HUMAN	histone cluster 1, H3d	132					blood coagulation|nucleosome assembly|regulation of gene silencing|S phase	nucleoplasm|nucleosome	DNA binding|protein binding				0		all_hematologic(11;0.196)																---	---	---	---	capture		Missense_Mutation	SNP	26197084	26197084	7443	6	C	A	A	19	19	HIST1H3D	A	1	1
HIST1H1D	3007	broad.mit.edu	37	6	26234618	26234618	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26234618G>A	uc003nhd.2	-	1	599	c.544C>T	c.(544-546)CAG>TAG	p.Q182*		NM_005320	NP_005311	P16402	H13_HUMAN	histone cluster 1, H1d	182					nucleosome assembly	nucleosome|nucleus	DNA binding			skin(1)	1		all_hematologic(11;0.0945)|Acute lymphoblastic leukemia(11;0.167)																---	---	---	---	capture		Nonsense_Mutation	SNP	26234618	26234618	7410	6	G	A	A	45	45	HIST1H1D	A	5	2
BTN2A2	10385	broad.mit.edu	37	6	26393166	26393166	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26393166C>T	uc003nhq.2	+	8	1629	c.1543C>T	c.(1543-1545)CAC>TAC	p.H515Y	BTN2A2_uc011dkg.1_3'UTR|BTN2A2_uc003nhr.2_Missense_Mutation_p.H399Y|BTN2A2_uc011dkh.1_Missense_Mutation_p.H305Y|BTN2A2_uc003nhs.2_Intron|BTN2A2_uc003nht.2_Missense_Mutation_p.H515Y|BTN2A2_uc011dki.1_3'UTR	NM_006995	NP_008926	Q8WVV5	BT2A2_HUMAN	butyrophilin, subfamily 2, member A2 isoform a	515	Cytoplasmic (Potential).				negative regulation of activated T cell proliferation|negative regulation of cellular metabolic process|negative regulation of cytokine secretion	integral to membrane					0																		---	---	---	---	capture		Missense_Mutation	SNP	26393166	26393166	1595	6	C	T	T	29	29	BTN2A2	T	2	2
BTN3A3	10384	broad.mit.edu	37	6	26444514	26444514	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26444514G>T	uc003nhz.2	+	4	595	c.415G>T	c.(415-417)GTG>TTG	p.V139L	BTN3A3_uc003nia.2_Missense_Mutation_p.V97L|BTN3A3_uc011dkn.1_Missense_Mutation_p.V97L	NM_006994	NP_008925	O00478	BT3A3_HUMAN	butyrophilin, subfamily 3, member A3 isoform a	139	Extracellular (Potential).|Ig-like V-type 1.					integral to membrane					0																		---	---	---	---	capture		Missense_Mutation	SNP	26444514	26444514	1598	6	G	T	T	44	44	BTN3A3	T	2	2
BTN3A3	10384	broad.mit.edu	37	6	26445991	26445991	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26445991G>T	uc003nhz.2	+	5	673	c.493G>T	c.(493-495)GAG>TAG	p.E165*	BTN3A3_uc003nia.2_Nonsense_Mutation_p.E123*|BTN3A3_uc011dkn.1_Nonsense_Mutation_p.E123*	NM_006994	NP_008925	O00478	BT3A3_HUMAN	butyrophilin, subfamily 3, member A3 isoform a	165	Extracellular (Potential).|Ig-like V-type 2.					integral to membrane					0																		---	---	---	---	capture		Nonsense_Mutation	SNP	26445991	26445991	1598	6	G	T	T	41	41	BTN3A3	T	5	2
HIST1H1B	3009	broad.mit.edu	37	6	27834802	27834802	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27834802T>A	uc003njx.2	-	1	558	c.506A>T	c.(505-507)AAG>ATG	p.K169M		NM_005322	NP_005313	P16401	H15_HUMAN	histone cluster 1, H1b	169					nucleosome assembly	nucleosome|nucleus	DNA binding			large_intestine(2)|lung(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	27834802	27834802	7408	6	T	A	A	56	56	HIST1H1B	A	4	4
HIST1H4L	8368	broad.mit.edu	37	6	27841265	27841265	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27841265C>G	uc003njz.2	-	1	25	c.24G>C	c.(22-24)GGG>GGC	p.G8G	HIST1H3I_uc003njy.2_5'Flank	NM_003546	NP_003537	P62805	H4_HUMAN	histone cluster 1, H4l	8					CenH3-containing nucleosome assembly at centromere|negative regulation of megakaryocyte differentiation|phosphatidylinositol-mediated signaling|telomere maintenance	nucleoplasm|nucleosome	DNA binding|protein binding			ovary(1)|breast(1)	2																		---	---	---	---	capture		Silent	SNP	27841265	27841265	7461	6	C	G	G	30	30	HIST1H4L	G	3	3
ZNF165	7718	broad.mit.edu	37	6	28053318	28053318	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28053318G>A	uc003nkg.2	+	3	1144	c.60G>A	c.(58-60)CTG>CTA	p.L20L	ZNF165_uc003nkh.2_Silent_p.L20L|ZNF165_uc003nki.3_Silent_p.L20L	NM_003447	NP_003438	P49910	ZN165_HUMAN	zinc finger protein 165	20					viral reproduction	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0																		---	---	---	---	capture		Silent	SNP	28053318	28053318	18331	6	G	A	A	45	45	ZNF165	A	2	2
OR2B3	442184	broad.mit.edu	37	6	29054912	29054912	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29054912G>C	uc003nlx.2	-	1	179	c.114C>G	c.(112-114)ACC>ACG	p.T38T		NM_001005226	NP_001005226			olfactory receptor, family 2, subfamily B,											skin(1)	1																		---	---	---	---	capture		Silent	SNP	29054912	29054912	11396	6	G	C	C	47	47	OR2B3	C	3	3
OR5V1	81696	broad.mit.edu	37	6	29323495	29323495	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29323495T>C	uc011dlo.1	-	1	560	c.478A>G	c.(478-480)ACA>GCA	p.T160A		NM_030876	NP_110503	Q9UGF6	OR5V1_HUMAN	olfactory receptor, family 5, subfamily V,	160	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(3)|kidney(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	29323495	29323495	11594	6	T	C	C	57	57	OR5V1	C	4	4
OR11A1	26531	broad.mit.edu	37	6	29395013	29395013	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29395013G>T	uc003nmg.2	-	1	497	c.406C>A	c.(406-408)CTG>ATG	p.L136M		NM_013937	NP_039225	Q9GZK7	O11A1_HUMAN	olfactory receptor, family 11, subfamily A,	136	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	29395013	29395013	11330	6	G	T	T	35	35	OR11A1	T	2	2
UBD	10537	broad.mit.edu	37	6	29524035	29524035	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29524035C>G	uc003nmo.2	-	2	344	c.120G>C	c.(118-120)AAG>AAC	p.K40N	GABBR1_uc003nmp.3_3'UTR	NM_006398	NP_006389	O15205	UBD_HUMAN	ubiquitin D	40	Ubiquitin 1.				aggresome assembly|myeloid dendritic cell differentiation|negative regulation of mitotic prometaphase|positive regulation of apoptosis|positive regulation of I-kappaB kinase/NF-kappaB cascade|protein ubiquitination|response to interferon-gamma|response to tumor necrosis factor|ubiquitin-dependent protein catabolic process	aggresome|cytoplasm|nucleus	proteasome binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	29524035	29524035	17400	6	C	G	G	32	32	UBD	G	3	3
GABBR1	2550	broad.mit.edu	37	6	29577154	29577154	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29577154C>A	uc003nmt.3	-	15	2047	c.1711G>T	c.(1711-1713)GGG>TGG	p.G571W	GABBR1_uc003nmp.3_Missense_Mutation_p.G454W|GABBR1_uc003nms.3_Missense_Mutation_p.G454W|GABBR1_uc003nmu.3_Missense_Mutation_p.G509W|GABBR1_uc011dlr.1_Missense_Mutation_p.G394W|GABBR1_uc011dls.1_Intron	NM_001470	NP_001461	Q9UBS5	GABR1_HUMAN	gamma-aminobutyric acid (GABA) B receptor 1	571	Extracellular (Potential).				gamma-aminobutyric acid signaling pathway|negative regulation of adenylate cyclase activity|synaptic transmission	cell junction|extracellular region|integral to plasma membrane|postsynaptic membrane	G-protein coupled receptor activity|GABA-B receptor activity			ovary(5)|liver(1)|skin(1)	7					Baclofen(DB00181)|Progabide(DB00837)													---	---	---	---	capture		Missense_Mutation	SNP	29577154	29577154	6406	6	C	A	A	24	24	GABBR1	A	2	2
MOG	4340	broad.mit.edu	37	6	29627135	29627135	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29627135C>T	uc003nnf.2	+	2	306	c.128C>T	c.(127-129)GCT>GTT	p.A43V	MOG_uc003qzk.1_Missense_Mutation_p.A43V|MOG_uc010kle.1_Intron|MOG_uc010klf.1_Intron|MOG_uc003nmy.1_Missense_Mutation_p.A43V|MOG_uc003nmz.2_Missense_Mutation_p.A43V|MOG_uc011dlt.1_5'UTR|MOG_uc003nna.2_Intron|MOG_uc011dlu.1_Intron|MOG_uc011dlv.1_Intron|MOG_uc003nnd.2_Missense_Mutation_p.A43V|MOG_uc003nne.2_Missense_Mutation_p.A43V|MOG_uc003nng.2_Missense_Mutation_p.A43V|MOG_uc003nnh.2_Missense_Mutation_p.A43V|MOG_uc003nni.2_Missense_Mutation_p.A43V|MOG_uc003nnj.2_Missense_Mutation_p.A43V|MOG_uc003nnk.2_Missense_Mutation_p.A43V	NM_206809	NP_996532	Q16653	MOG_HUMAN	myelin oligodendrocyte glycoprotein isoform	43	Ig-like V-type.|Extracellular (Potential).				cell adhesion|central nervous system development|positive regulation of MyD88-dependent toll-like receptor signaling pathway	integral to membrane|plasma membrane				ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	29627135	29627135	10084	6	C	T	T	28	28	MOG	T	2	2
TNXB	7148	broad.mit.edu	37	6	32017776	32017776	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32017776C>G	uc003nzl.2	-	27	9634	c.9432G>C	c.(9430-9432)ACG>ACC	p.T3144T		NM_019105	NP_061978	P22105	TENX_HUMAN	tenascin XB isoform 1 precursor	3191					actin cytoskeleton organization|cell adhesion|collagen metabolic process|elastic fiber assembly|signal transduction	extracellular space|intracellular|proteinaceous extracellular matrix	heparin binding|integrin binding				0																		---	---	---	---	capture		Silent	SNP	32017776	32017776	16887	6	C	G	G	23	23	TNXB	G	3	3
HLA-DRB5	3127	broad.mit.edu	37	6	32497990	32497990	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32497990C>G	uc003obj.2	-	1	17	c.12G>C	c.(10-12)CTG>CTC	p.L4L	HLA-DRB1_uc011dqa.1_Intron|HLA-DRB5_uc003obk.3_Intron	NM_002125	NP_002116	Q30154	DRB5_HUMAN	major histocompatibility complex, class II, DR	4					antigen processing and presentation of peptide or polysaccharide antigen via MHC class II|immune response	endoplasmic reticulum membrane|Golgi apparatus|integral to membrane|late endosome membrane|lysosomal membrane|MHC class II protein complex					0																		---	---	---	---	capture		Silent	SNP	32497990	32497990	7500	6	C	G	G	29	29	HLA-DRB5	G	3	3
ZBTB22	9278	broad.mit.edu	37	6	33284035	33284035	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33284035G>T	uc003oeb.2	-	2	811	c.659C>A	c.(658-660)TCC>TAC	p.S220Y	TAPBP_uc003odx.1_5'Flank|TAPBP_uc010jus.1_5'Flank|TAPBP_uc003ody.2_5'Flank|TAPBP_uc003odz.2_5'Flank|TAPBP_uc010jut.1_5'Flank|TAPBP_uc011drc.1_5'Flank|ZBTB22_uc010juu.2_Missense_Mutation_p.S220Y	NM_005453	NP_005444	O15209	ZBT22_HUMAN	zinc finger and BTB domain containing 22	220					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	33284035	33284035	18116	6	G	T	T	41	41	ZBTB22	T	2	2
ITPR3	3710	broad.mit.edu	37	6	33641418	33641418	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33641418C>G	uc011drk.1	+	23	3198	c.2979C>G	c.(2977-2979)GTC>GTG	p.V993V		NM_002224	NP_002215	Q14573	ITPR3_HUMAN	inositol 1,4,5-triphosphate receptor, type 3	993	Cytoplasmic (Potential).				activation of phospholipase C activity|calcium ion transport into cytosol|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|nerve growth factor receptor signaling pathway|platelet activation|protein heterooligomerization|protein homooligomerization|regulation of insulin secretion|response to calcium ion	apical part of cell|brush border|endoplasmic reticulum membrane|integral to plasma membrane|myelin sheath|neuronal cell body|nuclear outer membrane|platelet dense tubular network membrane	inositol 1,3,4,5 tetrakisphosphate binding|inositol 1,4,5 trisphosphate binding|inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity|inositol hexakisphosphate binding|intracellular ligand-gated calcium channel activity|protein binding			ovary(6)|lung(5)|central_nervous_system(5)|breast(2)|kidney(1)	19																		---	---	---	---	capture		Silent	SNP	33641418	33641418	8226	6	C	G	G	32	32	ITPR3	G	3	3
TULP1	7287	broad.mit.edu	37	6	35473528	35473528	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35473528C>A	uc003okv.3	-	11	1114	c.1102G>T	c.(1102-1104)GGG>TGG	p.G368W	TULP1_uc003okw.3_Missense_Mutation_p.G315W	NM_003322	NP_003313	O00294	TULP1_HUMAN	tubby like protein 1	368			G -> W (in LCA15).		dendrite development|eye photoreceptor cell development|phagocytosis|photoreceptor cell maintenance|positive regulation of phagocytosis	cell junction|cytoplasm|extracellular region|photoreceptor inner segment|photoreceptor outer segment|synapse	actin filament binding|phosphatidylinositol-4,5-bisphosphate binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	35473528	35473528	17328	6	C	A	A	23	23	TULP1	A	1	1
LRFN2	57497	broad.mit.edu	37	6	40399677	40399677	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:40399677G>T	uc003oph.1	-	2	1641	c.1176C>A	c.(1174-1176)CCC>CCA	p.P392P		NM_020737	NP_065788	Q9ULH4	LRFN2_HUMAN	leucine rich repeat and fibronectin type III	392	Extracellular (Potential).					cell junction|integral to membrane|postsynaptic membrane				ovary(2)|skin(1)	3	Ovarian(28;0.0418)|Colorectal(47;0.196)																	---	---	---	---	capture		Silent	SNP	40399677	40399677	9311	6	G	T	T	47	47	LRFN2	T	2	2
ABCC10	89845	broad.mit.edu	37	6	43403589	43403589	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43403589G>A	uc003ouy.1	+	5	1924	c.1709G>A	c.(1708-1710)CGG>CAG	p.R570Q	ABCC10_uc003ouz.1_Missense_Mutation_p.R527Q|ABCC10_uc010jyo.1_5'UTR	NM_033450	NP_258261	Q5T3U5	MRP7_HUMAN	ATP-binding cassette, sub-family C, member 10	570						integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(6)|central_nervous_system(1)	7	all_lung(25;0.00536)		Colorectal(64;0.00245)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.0152)|OV - Ovarian serous cystadenocarcinoma(102;0.0804)															---	---	---	---	capture		Missense_Mutation	SNP	43403589	43403589	51	6	G	A	A	39	39	ABCC10	A	1	1
YIPF3	25844	broad.mit.edu	37	6	43480033	43480033	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43480033C>A	uc003ovl.1	-	9	1082	c.925G>T	c.(925-927)GGC>TGC	p.G309C	C6orf154_uc003ovk.1_5'Flank|YIPF3_uc011dvk.1_Missense_Mutation_p.G274C|YIPF3_uc010jyr.1_Missense_Mutation_p.G315C|YIPF3_uc010jys.1_Missense_Mutation_p.G152C|YIPF3_uc003ovm.1_Missense_Mutation_p.G183C|YIPF3_uc010jyt.1_Missense_Mutation_p.G220C	NM_015388	NP_056203	Q9GZM5	YIPF3_HUMAN	natural killer cell-specific antigen KLIP1	309					cell differentiation	integral to membrane|plasma membrane|transport vesicle					0	all_cancers(18;3.79e-05)|Lung NSC(15;0.00217)|all_lung(25;0.00536)		Colorectal(64;0.00245)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.00736)|OV - Ovarian serous cystadenocarcinoma(102;0.0711)															---	---	---	---	capture		Missense_Mutation	SNP	43480033	43480033	18062	6	C	A	A	22	22	YIPF3	A	2	2
TDRD6	221400	broad.mit.edu	37	6	46656656	46656656	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:46656656G>T	uc003oyj.2	+	1	791	c.791G>T	c.(790-792)CGC>CTC	p.R264L	TDRD6_uc010jze.2_Missense_Mutation_p.R258L	NM_001010870	NP_001010870	O60522	TDRD6_HUMAN	tudor domain containing 6	264					cell differentiation|multicellular organismal development|spermatogenesis	chromatoid body	nucleic acid binding			breast(3)|ovary(2)|skin(1)	6			Lung(136;0.192)															---	---	---	---	capture		Missense_Mutation	SNP	46656656	46656656	16261	6	G	T	T	38	38	TDRD6	T	1	1
C6orf138	442213	broad.mit.edu	37	6	47846520	47846520	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47846520C>G	uc011dwm.1	-	3	2094	c.2009G>C	c.(2008-2010)TGG>TCG	p.W670S	C6orf138_uc011dwn.1_Missense_Mutation_p.W434S	NM_001013732	NP_001013754	Q6ZW05	CF138_HUMAN	hypothetical protein LOC442213	687	Helical; (Potential).					integral to membrane	hedgehog receptor activity			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	47846520	47846520	2435	6	C	G	G	21	21	C6orf138	G	3	3
C6orf138	442213	broad.mit.edu	37	6	47847511	47847511	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47847511G>T	uc011dwm.1	-	3	1103	c.1018C>A	c.(1018-1020)CCA>ACA	p.P340T	C6orf138_uc011dwn.1_Missense_Mutation_p.P104T	NM_001013732	NP_001013754	Q6ZW05	CF138_HUMAN	hypothetical protein LOC442213	357	SSD.					integral to membrane	hedgehog receptor activity			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	47847511	47847511	2435	6	G	T	T	43	43	C6orf138	T	2	2
DEFB110	245913	broad.mit.edu	37	6	49986761	49986761	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49986761G>A	uc003pac.2	-	2	179	c.133C>T	c.(133-135)CAG>TAG	p.Q45*	DEFB110_uc011dwr.1_Intron	NM_001037497	NP_001032586	Q30KQ9	DB110_HUMAN	beta-defensin 110 isoform a	45					defense response to bacterium	extracellular region				ovary(1)	1	Lung NSC(77;0.042)																	---	---	---	---	capture		Nonsense_Mutation	SNP	49986761	49986761	4577	6	G	A	A	45	45	DEFB110	A	5	2
PKHD1	5314	broad.mit.edu	37	6	51799118	51799118	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51799118C>T	uc003pah.1	-	37	6187	c.5911G>A	c.(5911-5913)GGC>AGC	p.G1971S	PKHD1_uc010jzn.1_5'UTR|PKHD1_uc003pai.2_Missense_Mutation_p.G1971S	NM_138694	NP_619639	P08F94	PKHD1_HUMAN	fibrocystin isoform 1	1971	Extracellular (Potential).|G8 1.		G -> D (in ARPKD).		cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity			lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)															OREG0017491	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	51799118	51799118	12396	6	C	T	T	22	22	PKHD1	T	2	2
ELOVL5	60481	broad.mit.edu	37	6	53135398	53135398	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:53135398T>A	uc003pbq.1	-	7	1197	c.749A>T	c.(748-750)TAC>TTC	p.Y250F	ELOVL5_uc003pbr.1_Missense_Mutation_p.Y250F|ELOVL5_uc011dwx.1_Missense_Mutation_p.Y277F|ELOVL5_uc003pbs.1_Silent_p.L208L|ELOVL5_uc003pbt.3_RNA	NM_021814	NP_068586	Q9NYP7	ELOV5_HUMAN	elongation of very long chain fatty acids-like	250				YFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQL LQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTN FYIQTYNKKGASRR -> SVCADNHPDQLRGHLAVHIPSWL VVFPDWIHDFPDCSLHKLLHSDLQQERGLPKERPPEGPPEW VHGCCEWTHQQLFTPGKQCEAKEAAEGLKSKN (in Ref. 4; BAD93035).	fatty acid elongation, monounsaturated fatty acid|fatty acid elongation, polyunsaturated fatty acid|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process|very long-chain fatty acid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	fatty acid elongase activity|protein binding				0	Lung NSC(77;0.116)																	---	---	---	---	capture		Missense_Mutation	SNP	53135398	53135398	5269	6	T	A	A	57	57	ELOVL5	A	4	4
ELOVL5	60481	broad.mit.edu	37	6	53160466	53160466	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:53160466T>C	uc003pbq.1	-	2	480	c.32A>G	c.(31-33)TAT>TGT	p.Y11C	ELOVL5_uc003pbr.1_Missense_Mutation_p.Y11C|ELOVL5_uc011dwx.1_Missense_Mutation_p.Y11C|ELOVL5_uc003pbs.1_Missense_Mutation_p.Y11C|ELOVL5_uc003pbu.2_Missense_Mutation_p.Y11C|ELOVL5_uc011dwy.1_RNA	NM_021814	NP_068586	Q9NYP7	ELOV5_HUMAN	elongation of very long chain fatty acids-like	11					fatty acid elongation, monounsaturated fatty acid|fatty acid elongation, polyunsaturated fatty acid|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process|very long-chain fatty acid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	fatty acid elongase activity|protein binding				0	Lung NSC(77;0.116)																	---	---	---	---	capture		Missense_Mutation	SNP	53160466	53160466	5269	6	T	C	C	49	49	ELOVL5	C	4	4
GFRAL	389400	broad.mit.edu	37	6	55196525	55196525	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:55196525G>T	uc003pcm.1	+	2	121	c.35G>T	c.(34-36)AGC>ATC	p.S12I		NM_207410	NP_997293	Q6UXV0	GFRAL_HUMAN	GDNF family receptor alpha like precursor	12						integral to membrane	receptor activity			ovary(1)|breast(1)	2	Lung NSC(77;0.0875)|Renal(3;0.122)		LUSC - Lung squamous cell carcinoma(124;0.23)															---	---	---	---	capture		Missense_Mutation	SNP	55196525	55196525	6619	6	G	T	T	34	34	GFRAL	T	2	2
GFRAL	389400	broad.mit.edu	37	6	55264069	55264069	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:55264069C>T	uc003pcm.1	+	7	1130	c.1044C>T	c.(1042-1044)TTC>TTT	p.F348F		NM_207410	NP_997293	Q6UXV0	GFRAL_HUMAN	GDNF family receptor alpha like precursor	348	Extracellular (Potential).					integral to membrane	receptor activity			ovary(1)|breast(1)	2	Lung NSC(77;0.0875)|Renal(3;0.122)		LUSC - Lung squamous cell carcinoma(124;0.23)															---	---	---	---	capture		Silent	SNP	55264069	55264069	6619	6	C	T	T	29	29	GFRAL	T	2	2
BMP5	653	broad.mit.edu	37	6	55623910	55623910	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:55623910A>G	uc003pcq.2	-	6	1820	c.1108T>C	c.(1108-1110)TGG>CGG	p.W370R	BMP5_uc011dxf.1_Intron	NM_021073	NP_066551	P22003	BMP5_HUMAN	bone morphogenetic protein 5 preproprotein	370					cartilage development|cell differentiation|growth|ossification	extracellular space	BMP receptor binding|cytokine activity|growth factor activity			ovary(2)	2	Lung NSC(77;0.0462)		LUSC - Lung squamous cell carcinoma(124;0.181)															---	---	---	---	capture		Missense_Mutation	SNP	55623910	55623910	1488	6	A	G	G	7	7	BMP5	G	4	4
KIAA1586	57691	broad.mit.edu	37	6	56918885	56918885	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56918885A>G	uc003pdj.2	+	4	1758	c.1588A>G	c.(1588-1590)ATT>GTT	p.I530V	KIAA1586_uc011dxm.1_Missense_Mutation_p.I503V	NM_020931	NP_065982	Q9HCI6	K1586_HUMAN	hypothetical protein LOC57691	530							nucleic acid binding				0	Lung NSC(77;0.0969)		LUSC - Lung squamous cell carcinoma(124;0.0785)|Lung(124;0.13)															---	---	---	---	capture		Missense_Mutation	SNP	56918885	56918885	8554	6	A	G	G	12	12	KIAA1586	G	4	4
EYS	346007	broad.mit.edu	37	6	66112499	66112499	+	Splice_Site	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:66112499C>A	uc011dxu.1	-	7	1595	c.1057_splice	c.e7-1	p.D353_splice	EYS_uc003peq.2_Splice_Site_p.D353_splice|EYS_uc003per.1_Splice_Site_p.D353_splice	NM_001142800	NP_001136272			eyes shut homolog isoform 1						response to stimulus|visual perception	extracellular region	calcium ion binding			lung(4)|ovary(1)|skin(1)	6																		---	---	---	---	capture		Splice_Site	SNP	66112499	66112499	5526	6	C	A	A	24	24	EYS	A	5	2
COL19A1	1310	broad.mit.edu	37	6	70778345	70778345	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70778345C>A	uc003pfc.1	+	15	1318	c.1201C>A	c.(1201-1203)CCA>ACA	p.P401T	COL19A1_uc010kam.1_Missense_Mutation_p.P297T	NM_001858	NP_001849	Q14993	COJA1_HUMAN	alpha 1 type XIX collagen precursor	401	Triple-helical region 2 (COL2).				cell differentiation|cell-cell adhesion|extracellular matrix organization|skeletal system development	collagen	extracellular matrix structural constituent|protein binding, bridging			ovary(2)|breast(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	70778345	70778345	3814	6	C	A	A	30	30	COL19A1	A	2	2
COL12A1	1303	broad.mit.edu	37	6	75857502	75857502	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:75857502C>T	uc003phs.2	-	23	4472	c.4306G>A	c.(4306-4308)GAA>AAA	p.E1436K	COL12A1_uc003pht.2_Missense_Mutation_p.E272K	NM_004370	NP_004361	Q99715	COCA1_HUMAN	collagen, type XII, alpha 1 long isoform	1436	Fibronectin type-III 9.				cell adhesion|collagen fibril organization|skeletal system development	collagen type XII|extracellular space	extracellular matrix structural constituent conferring tensile strength			ovary(6)|large_intestine(1)|breast(1)|skin(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	75857502	75857502	3807	6	C	T	T	30	30	COL12A1	T	2	2
TBX18	9096	broad.mit.edu	37	6	85448296	85448296	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:85448296C>T	uc003pkl.1	-	7	1018	c.1018G>A	c.(1018-1020)GCC>ACC	p.A340T	TBX18_uc010kbq.1_Missense_Mutation_p.A182T	NM_001080508	NP_001073977	O95935	TBX18_HUMAN	T-box 18	340					multicellular organismal development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)|pancreas(2)|lung(1)	5		all_cancers(76;0.000283)|Acute lymphoblastic leukemia(125;3.66e-08)|all_hematologic(105;8.61e-05)|all_epithelial(107;0.0858)		BRCA - Breast invasive adenocarcinoma(108;0.0267)														---	---	---	---	capture		Missense_Mutation	SNP	85448296	85448296	16179	6	C	T	T	28	28	TBX18	T	2	2
C6orf165	154313	broad.mit.edu	37	6	88144698	88144698	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:88144698C>A	uc003plv.2	+	11	1513	c.1421C>A	c.(1420-1422)GCC>GAC	p.A474D	SLC35A1_uc003plx.2_5'Flank|C6orf165_uc003plw.2_Missense_Mutation_p.A286D|C6orf165_uc010kbv.1_RNA|C6orf165_uc003plu.1_Missense_Mutation_p.A474D	NM_001031743	NP_001026913	Q8IYR0	CF165_HUMAN	hypothetical protein LOC154313 isoform 1	474										central_nervous_system(1)	1		all_cancers(76;3.93e-06)|Acute lymphoblastic leukemia(125;3.55e-10)|Prostate(29;3.51e-09)|all_hematologic(105;3.29e-06)|all_epithelial(107;0.00575)		BRCA - Breast invasive adenocarcinoma(108;0.0419)														---	---	---	---	capture		Missense_Mutation	SNP	88144698	88144698	2446	6	C	A	A	26	26	C6orf165	A	2	2
MDN1	23195	broad.mit.edu	37	6	90472117	90472117	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90472117T>C	uc003pnn.1	-	16	2393	c.2277A>G	c.(2275-2277)AAA>AAG	p.K759K	MDN1_uc003pno.1_Silent_p.K177K	NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	759					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---	capture		Silent	SNP	90472117	90472117	9804	6	T	C	C	60	60	MDN1	C	4	4
MDN1	23195	broad.mit.edu	37	6	90482321	90482321	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90482321G>C	uc003pnn.1	-	14	2170	c.2054C>G	c.(2053-2055)TCT>TGT	p.S685C	MDN1_uc003pno.1_Missense_Mutation_p.S103C	NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	685					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---	capture		Missense_Mutation	SNP	90482321	90482321	9804	6	G	C	C	33	33	MDN1	C	3	3
MDN1	23195	broad.mit.edu	37	6	90482391	90482391	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90482391G>A	uc003pnn.1	-	14	2100	c.1984C>T	c.(1984-1986)CAG>TAG	p.Q662*	MDN1_uc003pno.1_Nonsense_Mutation_p.Q80*	NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	662					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---	capture		Nonsense_Mutation	SNP	90482391	90482391	9804	6	G	A	A	46	46	MDN1	A	5	2
GJA10	84694	broad.mit.edu	37	6	90605460	90605460	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90605460C>T	uc011eaa.1	+	1	1273	c.1273C>T	c.(1273-1275)CCA>TCA	p.P425S		NM_032602	NP_115991	Q969M2	CXA10_HUMAN	gap junction protein, alpha 10	425	Cytoplasmic (Potential).				synaptic transmission	connexon complex|integral to membrane	gap junction channel activity				0		all_cancers(76;5.71e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00527)		BRCA - Breast invasive adenocarcinoma(108;0.0915)														---	---	---	---	capture		Missense_Mutation	SNP	90605460	90605460	6669	6	C	T	T	22	22	GJA10	T	2	2
MAP3K7	6885	broad.mit.edu	37	6	91229011	91229011	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:91229011G>T	uc003pnz.1	-	15	1652	c.1490C>A	c.(1489-1491)CCA>CAA	p.P497Q	MAP3K7_uc003pny.1_Missense_Mutation_p.P34Q|MAP3K7_uc003poa.1_Missense_Mutation_p.P497Q|MAP3K7_uc003pob.1_Missense_Mutation_p.P470Q|MAP3K7_uc003poc.1_Missense_Mutation_p.P470Q	NM_145331	NP_663304	O43318	M3K7_HUMAN	mitogen-activated protein kinase kinase kinase 7	497					activation of MAPK activity|activation of NF-kappaB-inducing kinase activity|histone H3 acetylation|I-kappaB phosphorylation|innate immune response|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-2 production|positive regulation of JUN kinase activity|positive regulation of NF-kappaB transcription factor activity|positive regulation of T cell cytokine production|stress-activated MAPK cascade|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway|transforming growth factor beta receptor signaling pathway	Ada2/Gcn5/Ada3 transcription activator complex|cytosol|endosome membrane	ATP binding|magnesium ion binding|MAP kinase kinase kinase activity|protein binding|protein binding			ovary(2)|lung(2)|upper_aerodigestive_tract(1)|stomach(1)	6		all_cancers(76;6.4e-08)|Acute lymphoblastic leukemia(125;1.43e-09)|Prostate(29;9.32e-09)|all_hematologic(105;3.69e-06)|all_epithelial(107;0.000187)|Ovarian(999;0.0164)		OV - Ovarian serous cystadenocarcinoma(136;2.05e-11)|all cancers(137;3.25e-11)|GBM - Glioblastoma multiforme(226;0.0416)|BRCA - Breast invasive adenocarcinoma(108;0.0429)														---	---	---	---	capture		Missense_Mutation	SNP	91229011	91229011	9638	6	G	T	T	47	47	MAP3K7	T	2	2
EPHA7	2045	broad.mit.edu	37	6	93964367	93964367	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:93964367C>G	uc003poe.2	-	14	2771	c.2530G>C	c.(2530-2532)GAT>CAT	p.D844H	EPHA7_uc003pof.2_Missense_Mutation_p.D839H|EPHA7_uc011eac.1_Missense_Mutation_p.D840H	NM_004440	NP_004431	Q15375	EPHA7_HUMAN	ephrin receptor EphA7 precursor	844	Cytoplasmic (Potential).|Protein kinase.					integral to plasma membrane	ATP binding|ephrin receptor activity			lung(8)|ovary(7)|upper_aerodigestive_tract(3)|central_nervous_system(3)|skin(3)|large_intestine(2)|stomach(1)|pancreas(1)	28		all_cancers(76;7.47e-10)|Acute lymphoblastic leukemia(125;1.88e-09)|all_hematologic(75;1.75e-07)|all_epithelial(107;3.6e-05)|Lung NSC(302;0.0368)|all_lung(197;0.0509)|Colorectal(196;0.142)		BRCA - Breast invasive adenocarcinoma(108;0.0847)														---	---	---	---	capture		Missense_Mutation	SNP	93964367	93964367	5365	6	C	G	G	32	32	EPHA7	G	3	3
KLHL32	114792	broad.mit.edu	37	6	97489367	97489367	+	Splice_Site	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:97489367G>T	uc010kcm.1	+	4	677	c.205_splice	c.e4-1	p.A69_splice	KLHL32_uc003poy.2_Splice_Site_p.A69_splice|KLHL32_uc011ead.1_Intron|KLHL32_uc003poz.2_Splice_Site|KLHL32_uc011eae.1_Intron|KLHL32_uc003ppa.2_Splice_Site	NM_052904	NP_443136			kelch-like 32											ovary(3)|skin(1)	4		all_cancers(76;1.19e-06)|Acute lymphoblastic leukemia(125;5.83e-10)|all_hematologic(75;3.67e-07)|all_epithelial(107;0.00778)|Colorectal(196;0.122)		BRCA - Breast invasive adenocarcinoma(108;0.0558)														---	---	---	---	capture		Splice_Site	SNP	97489367	97489367	8699	6	G	T	T	35	35	KLHL32	T	5	2
SIM1	6492	broad.mit.edu	37	6	100838631	100838631	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:100838631C>G	uc003pqj.3	-	11	2114	c.1907G>C	c.(1906-1908)AGA>ACA	p.R636T	SIM1_uc010kcu.2_Missense_Mutation_p.R636T	NM_005068	NP_005059	P81133	SIM1_HUMAN	single-minded homolog 1	636	Single-minded C-terminal.				cell differentiation|nervous system development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|signal transducer activity			ovary(4)	4		all_cancers(76;9.88e-06)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0248)|Colorectal(196;0.13)		BRCA - Breast invasive adenocarcinoma(108;0.0774)														---	---	---	---	capture		Missense_Mutation	SNP	100838631	100838631	14818	6	C	G	G	32	32	SIM1	G	3	3
LIN28B	389421	broad.mit.edu	37	6	105526586	105526586	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:105526586C>A	uc003pqv.1	+	4	884	c.681C>A	c.(679-681)TCC>TCA	p.S227S	LIN28B_uc010kda.1_3'UTR	NM_001004317	NP_001004317	Q6ZN17	LN28B_HUMAN	lin-28 homolog B	227					miRNA catabolic process|pre-miRNA processing|regulation of transcription, DNA-dependent|RNA 3'-end processing	cytoplasm|nucleus	DNA binding|protein binding|RNA binding|zinc ion binding				0		all_cancers(87;0.00346)|Acute lymphoblastic leukemia(125;2.26e-08)|all_hematologic(75;2.79e-06)|all_epithelial(87;0.204)																---	---	---	---	capture		Silent	SNP	105526586	105526586	9133	6	C	A	A	21	21	LIN28B	A	2	2
LAMA4	3910	broad.mit.edu	37	6	112451158	112451158	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112451158C>G	uc003pvu.2	-	30	4362	c.4053G>C	c.(4051-4053)AAG>AAC	p.K1351N	LAMA4_uc003pvv.2_Missense_Mutation_p.K1344N|LAMA4_uc003pvt.2_Missense_Mutation_p.K1344N	NM_001105206	NP_001098676	Q16363	LAMA4_HUMAN	laminin, alpha 4 isoform 1 precursor	1351	Laminin G-like 3.				cell adhesion|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	extracellular matrix structural constituent|receptor binding			ovary(4)|breast(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	9		all_cancers(87;0.000196)|all_hematologic(75;0.000114)|all_epithelial(87;0.00542)|Colorectal(196;0.0209)		all cancers(137;0.0335)|OV - Ovarian serous cystadenocarcinoma(136;0.0578)|Epithelial(106;0.0748)|BRCA - Breast invasive adenocarcinoma(108;0.242)														---	---	---	---	capture		Missense_Mutation	SNP	112451158	112451158	8931	6	C	G	G	32	32	LAMA4	G	3	3
RSPH4A	345895	broad.mit.edu	37	6	116948888	116948888	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:116948888G>A	uc003pxe.2	+	3	1163	c.1018G>A	c.(1018-1020)GCC>ACC	p.A340T	RSPH4A_uc010kee.2_Missense_Mutation_p.A340T	NM_001010892	NP_001010892	Q5TD94	RSH4A_HUMAN	radial spoke head 4 homolog A isoform 1	340					cilium axoneme assembly|cilium movement	cytoplasm|cytoskeleton|radial spoke					0														Kartagener_syndrome				---	---	---	---	capture		Missense_Mutation	SNP	116948888	116948888	14186	6	G	A	A	46	46	RSPH4A	A	2	2
TRDN	10345	broad.mit.edu	37	6	123892185	123892185	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:123892185C>A	uc003pzj.1	-	2	137	c.115G>T	c.(115-117)GAC>TAC	p.D39Y	TRDN_uc003pzk.1_Missense_Mutation_p.D39Y|TRDN_uc003pzl.1_Missense_Mutation_p.D39Y|TRDN_uc010ken.2_Missense_Mutation_p.D39Y|TRDN_uc010keo.1_Missense_Mutation_p.D39Y	NM_006073	NP_006064	Q13061	TRDN_HUMAN	triadin	39	Cytoplasmic.				muscle contraction	integral to membrane|plasma membrane|sarcoplasmic reticulum membrane	receptor binding			ovary(1)	1				GBM - Glioblastoma multiforme(226;0.184)														---	---	---	---	capture		Missense_Mutation	SNP	123892185	123892185	17012	6	C	A	A	32	32	TRDN	A	2	2
LAMA2	3908	broad.mit.edu	37	6	129674308	129674308	+	Splice_Site	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:129674308G>T	uc003qbn.2	+	32	4629	c.4524_splice	c.e32-1	p.R1508_splice	LAMA2_uc003qbo.2_Splice_Site_p.R1508_splice	NM_000426	NP_000417			laminin alpha 2 subunit isoform a precursor						cell adhesion|muscle organ development|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	receptor binding|structural molecule activity			ovary(8)|breast(1)|skin(1)	10				OV - Ovarian serous cystadenocarcinoma(136;0.178)|all cancers(137;0.245)														---	---	---	---	capture		Splice_Site	SNP	129674308	129674308	8929	6	G	T	T	35	35	LAMA2	T	5	2
TAAR2	9287	broad.mit.edu	37	6	132938838	132938838	+	Silent	SNP	C	A	A	rs147231065		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132938838C>A	uc003qdl.1	-	2	507	c.507G>T	c.(505-507)TCG>TCT	p.S169S	TAAR2_uc010kfr.1_Silent_p.S124S	NM_001033080	NP_001028252	Q9P1P5	TAAR2_HUMAN	trace amine associated receptor 2 isoform 1	169	Helical; Name=4; (Potential).					plasma membrane	G-protein coupled receptor activity			ovary(1)	1	Breast(56;0.135)			OV - Ovarian serous cystadenocarcinoma(155;0.00608)|GBM - Glioblastoma multiforme(226;0.0151)														---	---	---	---	capture		Silent	SNP	132938838	132938838	16011	6	C	A	A	23	23	TAAR2	A	1	1
SLC2A12	154091	broad.mit.edu	37	6	134350675	134350675	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:134350675G>T	uc003qem.1	-	2	459	c.288C>A	c.(286-288)ACC>ACA	p.T96T		NM_145176	NP_660159	Q8TD20	GTR12_HUMAN	solute carrier family 2 (facilitated glucose	96	Helical; (Potential).					endomembrane system|integral to membrane|perinuclear region of cytoplasm|plasma membrane	D-glucose transmembrane transporter activity			ovary(1)	1	Breast(56;0.214)|Colorectal(23;0.221)			OV - Ovarian serous cystadenocarcinoma(155;0.0101)|GBM - Glioblastoma multiforme(68;0.0123)														---	---	---	---	capture		Silent	SNP	134350675	134350675	15038	6	G	T	T	39	39	SLC2A12	T	1	1
MAP3K5	4217	broad.mit.edu	37	6	136888770	136888770	+	Nonsense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:136888770T>A	uc003qhc.2	-	26	4121	c.3760A>T	c.(3760-3762)AGA>TGA	p.R1254*	MAP3K5_uc011edj.1_Nonsense_Mutation_p.R501*|MAP3K5_uc011edk.1_Nonsense_Mutation_p.R1100*	NM_005923	NP_005914	Q99683	M3K5_HUMAN	mitogen-activated protein kinase kinase kinase	1254					activation of JUN kinase activity|activation of MAPKK activity|cellular response to hydrogen peroxide|induction of apoptosis by extracellular signals|interspecies interaction between organisms		ATP binding|caspase activator activity|magnesium ion binding|MAP kinase kinase kinase activity|protein homodimerization activity|protein phosphatase binding			ovary(2)|skin(2)|lung(1)	5	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00137)|OV - Ovarian serous cystadenocarcinoma(155;0.00569)														---	---	---	---	capture		Nonsense_Mutation	SNP	136888770	136888770	9636	6	T	A	A	53	53	MAP3K5	A	5	4
TNFAIP3	7128	broad.mit.edu	37	6	138198379	138198379	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:138198379C>T	uc003qhr.2	+	6	1038	c.972C>T	c.(970-972)CTC>CTT	p.L324L	TNFAIP3_uc003qhs.2_Silent_p.L324L	NM_006290	NP_006281	P21580	TNAP3_HUMAN	tumor necrosis factor, alpha-induced protein 3	324	2 X approximate repeats.|2.				anti-apoptosis|apoptosis|B-1 B cell homeostasis|negative regulation of B cell activation|negative regulation of bone resorption|negative regulation of CD40 signaling pathway|negative regulation of endothelial cell apoptosis|negative regulation of I-kappaB kinase/NF-kappaB cascade|negative regulation of inflammatory response|negative regulation of interleukin-2 production|negative regulation of interleukin-6 production|negative regulation of NF-kappaB transcription factor activity|negative regulation of osteoclast proliferation|negative regulation of protein ubiquitination|negative regulation of smooth muscle cell proliferation|negative regulation of toll-like receptor 2 signaling pathway|negative regulation of toll-like receptor 3 signaling pathway|negative regulation of tumor necrosis factor production|negative regulation of type I interferon production|positive regulation of protein catabolic process|protein K48-linked ubiquitination|protein K63-linked deubiquitination|protein oligomerization|regulation of defense response to virus by host|regulation of germinal center formation|regulation of vascular wound healing|tolerance induction to lipopolysaccharide	centrosome|cytosol|nucleus	caspase inhibitor activity|DNA binding|protease binding|protein self-association|ubiquitin binding|ubiquitin thiolesterase activity|ubiquitin-protein ligase activity|ubiquitin-specific protease activity|zinc ion binding	p.0?(22)|p.L324fs*7(1)		haematopoietic_and_lymphoid_tissue(133)|lung(3)|ovary(1)	137	Breast(32;0.135)|Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.000849)|OV - Ovarian serous cystadenocarcinoma(155;0.00468)				D|N|F		marginal zone B-cell lymphomas|Hodgkin's lymphoma|primary mediastinal B cell lymphoma								---	---	---	---	capture		Silent	SNP	138198379	138198379	16815	6	C	T	T	29	29	TNFAIP3	T	2	2
UTRN	7402	broad.mit.edu	37	6	144820427	144820427	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144820427C>A	uc003qkt.2	+	33	4720	c.4628C>A	c.(4627-4629)TCA>TAA	p.S1543*		NM_007124	NP_009055	P46939	UTRO_HUMAN	utrophin	1543	Interaction with SYNM.				muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)														---	---	---	---	capture		Nonsense_Mutation	SNP	144820427	144820427	17668	6	C	A	A	29	29	UTRN	A	5	2
GRM1	2911	broad.mit.edu	37	6	146720825	146720825	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:146720825G>C	uc010khw.1	+	8	3120	c.2650G>C	c.(2650-2652)GGG>CGG	p.G884R	GRM1_uc010khv.1_Missense_Mutation_p.G884R|GRM1_uc003qll.2_Missense_Mutation_p.G884R|GRM1_uc011edz.1_Missense_Mutation_p.G884R|GRM1_uc011eea.1_Missense_Mutation_p.G884R	NM_000838	NP_000829	Q13255	GRM1_HUMAN	glutamate receptor, metabotropic 1 isoform alpha	884	Cytoplasmic (Potential).				synaptic transmission	integral to plasma membrane	G-protein coupled receptor activity|glutamate receptor activity			lung(8)|ovary(4)|central_nervous_system(3)|large_intestine(2)|breast(2)	19		Ovarian(120;0.0387)		OV - Ovarian serous cystadenocarcinoma(155;5.35e-08)|GBM - Glioblastoma multiforme(68;0.00762)	Acamprosate(DB00659)|L-Glutamic Acid(DB00142)													---	---	---	---	capture		Missense_Mutation	SNP	146720825	146720825	7075	6	G	C	C	35	35	GRM1	C	3	3
PLEKHG1	57480	broad.mit.edu	37	6	151107545	151107545	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151107545G>T	uc003qny.1	+	5	844	c.532G>T	c.(532-534)GAA>TAA	p.E178*	PLEKHG1_uc011eel.1_Nonsense_Mutation_p.E218*|PLEKHG1_uc011eem.1_Nonsense_Mutation_p.E237*|PLEKHG1_uc003qnz.2_Nonsense_Mutation_p.E178*	NM_001029884	NP_001025055	Q9ULL1	PKHG1_HUMAN	pleckstrin homology domain containing, family G	178	DH.				regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			ovary(2)	2			BRCA - Breast invasive adenocarcinoma(37;0.0923)	OV - Ovarian serous cystadenocarcinoma(155;6.69e-13)														---	---	---	---	capture		Nonsense_Mutation	SNP	151107545	151107545	12494	6	G	T	T	41	41	PLEKHG1	T	5	2
SYNE1	23345	broad.mit.edu	37	6	152782735	152782735	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152782735G>T	uc010kiw.2	-	21	2993	c.2391C>A	c.(2389-2391)ACC>ACA	p.T797T	SYNE1_uc003qot.3_Silent_p.T804T|SYNE1_uc003qou.3_Silent_p.T797T|SYNE1_uc010kjb.1_Silent_p.T780T|SYNE1_uc003qow.2_Silent_p.T92T|SYNE1_uc003qox.1_Silent_p.T313T|SYNE1_uc003qoz.2_Silent_p.T229T|SYNE1_uc003qoy.2_Silent_p.T364T	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	797	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)											HNSCC(10;0.0054)			---	---	---	---	capture		Silent	SNP	152782735	152782735	15966	6	G	T	T	47	47	SYNE1	T	2	2
FNDC1	84624	broad.mit.edu	37	6	159687195	159687195	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:159687195G>T	uc010kjv.2	+	21	5564	c.5364G>T	c.(5362-5364)AAG>AAT	p.K1788N		NM_032532	NP_115921	Q4ZHG4	FNDC1_HUMAN	fibronectin type III domain containing 1	1788						extracellular region				large_intestine(4)|ovary(3)|central_nervous_system(1)	8		Breast(66;0.000781)|Ovarian(120;0.0308)|Prostate(117;0.195)		OV - Ovarian serous cystadenocarcinoma(65;2.6e-16)|BRCA - Breast invasive adenocarcinoma(81;1.06e-05)														---	---	---	---	capture		Missense_Mutation	SNP	159687195	159687195	6210	6	G	T	T	34	34	FNDC1	T	2	2
AGPAT4	56895	broad.mit.edu	37	6	161574454	161574454	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:161574454C>A	uc003qtr.1	-	5	815	c.588G>T	c.(586-588)GGG>GGT	p.G196G	AGPAT4_uc003qts.1_Silent_p.G56G|AGPAT4_uc011egb.1_Intron|AGPAT4_uc003qtt.1_RNA|AGPAT4_uc011egc.1_3'UTR|AGPAT4_uc011egd.1_3'UTR|AGPAT4_uc011ege.1_3'UTR	NM_020133	NP_064518	Q9NRZ5	PLCD_HUMAN	1-acylglycerol-3-phosphate O-acyltransferase 4	196					phospholipid biosynthetic process	integral to membrane	1-acylglycerol-3-phosphate O-acyltransferase activity|protein binding				0		Breast(66;0.000289)|Ovarian(120;0.0266)|Prostate(117;0.0285)		OV - Ovarian serous cystadenocarcinoma(65;2.23e-17)|BRCA - Breast invasive adenocarcinoma(81;3.58e-05)														---	---	---	---	capture		Silent	SNP	161574454	161574454	392	6	C	A	A	26	26	AGPAT4	A	2	2
PACRG	135138	broad.mit.edu	37	6	163483209	163483209	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:163483209C>A	uc003qua.2	+	4	543	c.319C>A	c.(319-321)CAT>AAT	p.H107N	PACRG_uc003qub.2_Missense_Mutation_p.H107N|PACRG_uc003quc.2_Missense_Mutation_p.H107N	NM_152410	NP_689623	Q96M98	PACRG_HUMAN	parkin co-regulated gene protein isoform 1	107											0		Breast(66;2.41e-05)|Ovarian(120;0.0245)|Prostate(117;0.0273)|all_neural(5;0.0416)|Glioma(2;0.203)		OV - Ovarian serous cystadenocarcinoma(33;4.31e-19)|GBM - Glioblastoma multiforme(2;7.42e-11)|BRCA - Breast invasive adenocarcinoma(81;3.19e-05)|KIRC - Kidney renal clear cell carcinoma(3;0.205)|Kidney(3;0.242)														---	---	---	---	capture		Missense_Mutation	SNP	163483209	163483209	11786	6	C	A	A	29	29	PACRG	A	2	2
TTLL2	83887	broad.mit.edu	37	6	167753790	167753790	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:167753790A>G	uc003qvs.1	+	3	490	c.402A>G	c.(400-402)GAA>GAG	p.E134E	TTLL2_uc011egr.1_RNA	NM_031949	NP_114155	Q9BWV7	TTLL2_HUMAN	tubulin tyrosine ligase-like family, member 2	134	TTL.				protein modification process		ATP binding|tubulin-tyrosine ligase activity			ovary(1)|central_nervous_system(1)|skin(1)	3		Breast(66;7.8e-06)|Ovarian(120;0.024)		OV - Ovarian serous cystadenocarcinoma(33;2.22e-20)|BRCA - Breast invasive adenocarcinoma(81;6.17e-07)|GBM - Glioblastoma multiforme(31;0.00492)														---	---	---	---	capture		Silent	SNP	167753790	167753790	17282	6	A	G	G	2	2	TTLL2	G	4	4
THBS2	7058	broad.mit.edu	37	6	169646362	169646362	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:169646362G>A	uc003qwt.2	-	5	872	c.624C>T	c.(622-624)AAC>AAT	p.N208N		NM_003247	NP_003238	P35442	TSP2_HUMAN	thrombospondin 2 precursor	208	TSP N-terminal.|Heparin-binding (Potential).				cell adhesion	extracellular region	calcium ion binding|heparin binding|protein binding|structural molecule activity			ovary(5)	5		Breast(66;1.78e-05)|Ovarian(120;0.0728)|Esophageal squamous(34;0.247)		OV - Ovarian serous cystadenocarcinoma(33;1.85e-21)|BRCA - Breast invasive adenocarcinoma(81;1.43e-06)|GBM - Glioblastoma multiforme(31;0.000379)														---	---	---	---	capture		Silent	SNP	169646362	169646362	16382	6	G	A	A	40	40	THBS2	A	1	1
THBS2	7058	broad.mit.edu	37	6	169649011	169649011	+	Missense_Mutation	SNP	C	T	T	rs150716666		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:169649011C>T	uc003qwt.2	-	4	358	c.110G>A	c.(109-111)CGC>CAC	p.R37H		NM_003247	NP_003238	P35442	TSP2_HUMAN	thrombospondin 2 precursor	37	TSP N-terminal.|Heparin-binding (Potential).				cell adhesion	extracellular region	calcium ion binding|heparin binding|protein binding|structural molecule activity			ovary(5)	5		Breast(66;1.78e-05)|Ovarian(120;0.0728)|Esophageal squamous(34;0.247)		OV - Ovarian serous cystadenocarcinoma(33;1.85e-21)|BRCA - Breast invasive adenocarcinoma(81;1.43e-06)|GBM - Glioblastoma multiforme(31;0.000379)														---	---	---	---	capture		Missense_Mutation	SNP	169649011	169649011	16382	6	C	T	T	27	27	THBS2	T	1	1
TBP	6908	broad.mit.edu	37	6	170871259	170871259	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170871259C>A	uc003qxt.2	+	3	667	c.435C>A	c.(433-435)CCC>CCA	p.P145P	TBP_uc003qxu.2_Silent_p.P145P|TBP_uc011ehf.1_Silent_p.P125P|TBP_uc011ehg.1_Silent_p.P145P	NM_003194	NP_003185	P20226	TBP_HUMAN	TATA box binding protein	145					cell death|interspecies interaction between organisms|transcription elongation from RNA polymerase II promoter|transcription from RNA polymerase III promoter|viral reproduction	transcription factor TFIIA complex|transcription factor TFIID complex	repressing transcription factor binding|transcription regulatory region DNA binding			ovary(1)	1		Breast(66;5.08e-05)|Ovarian(120;0.125)|Esophageal squamous(34;0.246)		OV - Ovarian serous cystadenocarcinoma(33;1.07e-22)|BRCA - Breast invasive adenocarcinoma(81;5.01e-06)|GBM - Glioblastoma multiforme(31;0.00591)														---	---	---	---	capture		Silent	SNP	170871259	170871259	16170	6	C	A	A	21	21	TBP	A	2	2
NUDT1	4521	broad.mit.edu	37	7	2284214	2284214	+	Missense_Mutation	SNP	G	C	C	rs144573336		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2284214G>C	uc003slp.1	+	3	176	c.74G>C	c.(73-75)GGC>GCC	p.G25A	FTSJ2_uc003slk.2_5'Flank|FTSJ2_uc003sll.2_5'Flank|FTSJ2_uc003slm.2_5'Flank|FTSJ2_uc003sln.2_5'Flank|FTSJ2_uc003slo.2_5'Flank|NUDT1_uc003slq.1_Missense_Mutation_p.G2A|NUDT1_uc003slr.1_Missense_Mutation_p.G2A|NUDT1_uc003sls.1_Missense_Mutation_p.G25A|NUDT1_uc003slt.1_Missense_Mutation_p.G2A|NUDT1_uc003slu.1_Missense_Mutation_p.G25A|NUDT1_uc003slv.1_Missense_Mutation_p.G2A	NM_198949	NP_945187	P36639	8ODP_HUMAN	nudix-type motif 1 isoform p22	43					DNA protection|DNA repair|response to oxidative stress	cytoplasm	8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity|8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity|GTPase activity|metal ion binding|protein binding				0		Ovarian(82;0.0253)|Melanoma(862;0.155)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0822)|OV - Ovarian serous cystadenocarcinoma(56;2.8e-14)|BRCA - Breast invasive adenocarcinoma(126;0.15)									Direct_reversal_of_damage|Modulation_of_nucleotide_pools					---	---	---	---	capture		Missense_Mutation	SNP	2284214	2284214	11130	7	G	C	C	42	42	NUDT1	C	3	3
SDK1	221935	broad.mit.edu	37	7	3991404	3991404	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:3991404G>T	uc003smx.2	+	7	1141	c.1002G>T	c.(1000-1002)GTG>GTT	p.V334V		NM_152744	NP_689957	Q7Z5N4	SDK1_HUMAN	sidekick 1 precursor	334	Ig-like C2-type 3.				cell adhesion	integral to membrane				large_intestine(3)|ovary(2)|skin(1)	6		all_cancers(1;0.127)|Ovarian(82;0.0177)|Myeloproliferative disorder(862;0.194)		UCEC - Uterine corpus endometrioid carcinoma (126;0.121)|OV - Ovarian serous cystadenocarcinoma(56;9.65e-15)														---	---	---	---	capture		Silent	SNP	3991404	3991404	14454	7	G	T	T	45	45	SDK1	T	2	2
SDK1	221935	broad.mit.edu	37	7	4218193	4218193	+	Silent	SNP	C	A	A	rs139887943	byFrequency	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4218193C>A	uc003smx.2	+	35	5212	c.5073C>A	c.(5071-5073)CCC>CCA	p.P1691P	SDK1_uc010kso.2_Silent_p.P947P|SDK1_uc003smy.2_Silent_p.P178P	NM_152744	NP_689957	Q7Z5N4	SDK1_HUMAN	sidekick 1 precursor	1691	Fibronectin type-III 10.				cell adhesion	integral to membrane				large_intestine(3)|ovary(2)|skin(1)	6		all_cancers(1;0.127)|Ovarian(82;0.0177)|Myeloproliferative disorder(862;0.194)		UCEC - Uterine corpus endometrioid carcinoma (126;0.121)|OV - Ovarian serous cystadenocarcinoma(56;9.65e-15)														---	---	---	---	capture		Silent	SNP	4218193	4218193	14454	7	C	A	A	23	23	SDK1	A	1	1
PMS2	5395	broad.mit.edu	37	7	6027050	6027050	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6027050T>C	uc003spl.2	-	11	1433	c.1346A>G	c.(1345-1347)CAG>CGG	p.Q449R	PMS2_uc003spj.2_Missense_Mutation_p.Q343R|PMS2_uc003spk.2_Missense_Mutation_p.Q314R|PMS2_uc011jwl.1_Missense_Mutation_p.Q314R|PMS2_uc010ktg.2_Missense_Mutation_p.Q138R|PMS2_uc010kte.2_Intron|PMS2_uc010ktf.1_Missense_Mutation_p.Q449R	NM_000535	NP_000526	P54278	PMS2_HUMAN	PMS2 postmeiotic segregation increased 2 isoform	449					mismatch repair|reciprocal meiotic recombination|somatic hypermutation of immunoglobulin genes	MutLalpha complex	ATP binding|ATPase activity|endonuclease activity|protein binding|single base insertion or deletion binding			lung(1)|central_nervous_system(1)	2		Ovarian(82;0.0694)		UCEC - Uterine corpus endometrioid carcinoma (126;0.101)|OV - Ovarian serous cystadenocarcinoma(56;4.39e-15)				Mis|N|F			colorectal|endometrial|ovarian|medulloblastoma|glioma		Direct_reversal_of_damage|MMR	Lynch_syndrome|Turcot_syndrome|Constitutional_Mismatch_Repair_Deficiency_Syndrome				---	---	---	---	capture		Missense_Mutation	SNP	6027050	6027050	12569	7	T	C	C	55	55	PMS2	C	4	4
PMS2	5395	broad.mit.edu	37	7	6048643	6048643	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6048643C>T	uc003spl.2	-	1	95	c.8G>A	c.(7-9)CGA>CAA	p.R3Q	PMS2_uc003spk.2_5'UTR|PMS2_uc011jwl.1_5'UTR|PMS2_uc010ktg.2_5'UTR|PMS2_uc010kte.2_Missense_Mutation_p.R3Q|PMS2_uc010ktf.1_Missense_Mutation_p.R3Q|AIMP2_uc003spo.2_5'Flank	NM_000535	NP_000526	P54278	PMS2_HUMAN	PMS2 postmeiotic segregation increased 2 isoform	3					mismatch repair|reciprocal meiotic recombination|somatic hypermutation of immunoglobulin genes	MutLalpha complex	ATP binding|ATPase activity|endonuclease activity|protein binding|single base insertion or deletion binding			lung(1)|central_nervous_system(1)	2		Ovarian(82;0.0694)		UCEC - Uterine corpus endometrioid carcinoma (126;0.101)|OV - Ovarian serous cystadenocarcinoma(56;4.39e-15)				Mis|N|F			colorectal|endometrial|ovarian|medulloblastoma|glioma		Direct_reversal_of_damage|MMR	Lynch_syndrome|Turcot_syndrome|Constitutional_Mismatch_Repair_Deficiency_Syndrome				---	---	---	---	capture		Missense_Mutation	SNP	6048643	6048643	12569	7	C	T	T	31	31	PMS2	T	1	1
ZDHHC4	55146	broad.mit.edu	37	7	6621766	6621766	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6621766G>T	uc003sqi.2	+	6	612	c.254G>T	c.(253-255)TGG>TTG	p.W85L	ZDHHC4_uc003sqg.2_Missense_Mutation_p.W85L|ZDHHC4_uc003sql.2_Missense_Mutation_p.W85L|ZDHHC4_uc003sqh.2_Missense_Mutation_p.W85L|ZDHHC4_uc003sqj.2_Missense_Mutation_p.W85L|ZDHHC4_uc003sqk.2_Missense_Mutation_p.W85L|ZDHHC4_uc003sqm.2_Missense_Mutation_p.W85L	NM_001134388	NP_001127860	Q9NPG8	ZDHC4_HUMAN	zinc finger, DHHC-type containing 4	85	Helical; (Potential).					integral to membrane	acyltransferase activity|zinc ion binding			breast(1)|pancreas(1)	2		Ovarian(82;0.232)		UCEC - Uterine corpus endometrioid carcinoma (126;0.1)														---	---	---	---	capture		Missense_Mutation	SNP	6621766	6621766	18205	7	G	T	T	47	47	ZDHHC4	T	2	2
ICA1	3382	broad.mit.edu	37	7	8167699	8167699	+	Missense_Mutation	SNP	C	G	G	rs144420664		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:8167699C>G	uc003srm.2	-	13	1201	c.1134G>C	c.(1132-1134)GAG>GAC	p.E378D	ICA1_uc010ktr.2_Missense_Mutation_p.E407D|ICA1_uc003srl.2_Missense_Mutation_p.E366D|ICA1_uc003srn.3_Missense_Mutation_p.E304D|ICA1_uc003srp.3_Missense_Mutation_p.E377D|ICA1_uc010kts.2_RNA|ICA1_uc003srq.2_Missense_Mutation_p.E378D|ICA1_uc003srr.2_Missense_Mutation_p.E377D|ICA1_uc003sro.3_Missense_Mutation_p.E378D	NM_022307	NP_071682	Q05084	ICA69_HUMAN	islet cell autoantigen 1	378					neurotransmitter transport	cell junction|cytosol|Golgi membrane|nucleus|secretory granule membrane|synaptic vesicle membrane|transport vesicle membrane				central_nervous_system(1)	1		Ovarian(82;0.0612)		UCEC - Uterine corpus endometrioid carcinoma (126;0.246)														---	---	---	---	capture		Missense_Mutation	SNP	8167699	8167699	7777	7	C	G	G	32	32	ICA1	G	3	3
PHF14	9678	broad.mit.edu	37	7	11022091	11022091	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:11022091G>T	uc003sry.1	+	3	640	c.205G>T	c.(205-207)GAA>TAA	p.E69*	PHF14_uc011jxi.1_Intron|PHF14_uc003srz.2_Nonsense_Mutation_p.E69*|PHF14_uc011jxj.1_Intron	NM_014660	NP_055475	O94880	PHF14_HUMAN	PHD finger protein 14 isoform 2	69	Glu/Lys-rich.						zinc ion binding			kidney(2)|skin(1)	3				UCEC - Uterine corpus endometrioid carcinoma (126;0.205)														---	---	---	---	capture		Nonsense_Mutation	SNP	11022091	11022091	12248	7	G	T	T	33	33	PHF14	T	5	2
PHF14	9678	broad.mit.edu	37	7	11078410	11078410	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:11078410A>G	uc003sry.1	+	11	2439	c.2004A>G	c.(2002-2004)CTA>CTG	p.L668L	PHF14_uc011jxi.1_Silent_p.L383L|PHF14_uc003srz.2_Silent_p.L668L|PHF14_uc011jxj.1_Silent_p.L383L	NM_014660	NP_055475	O94880	PHF14_HUMAN	PHD finger protein 14 isoform 2	668							zinc ion binding			kidney(2)|skin(1)	3				UCEC - Uterine corpus endometrioid carcinoma (126;0.205)														---	---	---	---	capture		Silent	SNP	11078410	11078410	12248	7	A	G	G	14	14	PHF14	G	4	4
SNX13	23161	broad.mit.edu	37	7	17930043	17930043	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:17930043G>C	uc003stw.1	-	5	596	c.383C>G	c.(382-384)TCT>TGT	p.S128C	SNX13_uc003stv.2_Missense_Mutation_p.S128C|SNX13_uc010kuc.2_Translation_Start_Site|SNX13_uc003stx.1_Missense_Mutation_p.S48C|SNX13_uc003sty.2_Missense_Mutation_p.S128C			Q9Y5W8	SNX13_HUMAN	SubName: Full=Putative uncharacterized protein SNX13; SubName: Full=Sorting nexin 13, isoform CRA_g;	128	PXA.				cell communication|intracellular protein transport|negative regulation of signal transduction|positive regulation of GTPase activity	early endosome membrane	phosphatidylinositol binding|signal transducer activity			central_nervous_system(2)|kidney(1)	3	Lung NSC(10;0.0261)|all_lung(11;0.0521)																	---	---	---	---	capture		Missense_Mutation	SNP	17930043	17930043	15384	7	G	C	C	33	33	SNX13	C	3	3
PRPS1L1	221823	broad.mit.edu	37	7	18066588	18066588	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:18066588T>A	uc003stz.2	-	1	899	c.818A>T	c.(817-819)AAT>ATT	p.N273I		NM_175886	NP_787082	P21108	PRPS3_HUMAN	phosphoribosyl pyrophosphate synthetase 1-like	273					nucleoside metabolic process|ribonucleoside monophosphate biosynthetic process		ATP binding|kinase activity|magnesium ion binding|protein homodimerization activity|ribose phosphate diphosphokinase activity			ovary(1)	1	Lung NSC(10;0.0385)|all_lung(11;0.0736)																	---	---	---	---	capture		Missense_Mutation	SNP	18066588	18066588	13022	7	T	A	A	52	52	PRPS1L1	A	4	4
HDAC9	9734	broad.mit.edu	37	7	18705919	18705919	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:18705919G>C	uc003suh.2	+	11	1583	c.1542G>C	c.(1540-1542)GCG>GCC	p.A514A	HDAC9_uc003sue.2_Silent_p.A514A|HDAC9_uc011jyd.1_Silent_p.A514A|HDAC9_uc003sui.2_Silent_p.A517A|HDAC9_uc003suj.2_Silent_p.A473A|HDAC9_uc011jya.1_Silent_p.A511A|HDAC9_uc003sua.1_Silent_p.A492A|HDAC9_uc011jyb.1_Silent_p.A470A|HDAC9_uc003sud.1_Silent_p.A514A|HDAC9_uc011jyc.1_Silent_p.A473A|HDAC9_uc003suf.1_Silent_p.A545A|HDAC9_uc010kud.1_Silent_p.A517A|HDAC9_uc011jye.1_Silent_p.A486A|HDAC9_uc011jyf.1_Silent_p.A437A|HDAC9_uc010kue.1_Intron	NM_058176	NP_478056	Q9UKV0	HDAC9_HUMAN	histone deacetylase 9 isoform 1	514					B cell differentiation|cellular response to insulin stimulus|heart development|histone H3 deacetylation|histone H4 deacetylation|inflammatory response|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|peptidyl-lysine deacetylation|positive regulation of cell migration involved in sprouting angiogenesis|regulation of skeletal muscle fiber development|transcription, DNA-dependent	cytoplasm|histone deacetylase complex|histone methyltransferase complex|transcription factor complex	histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|histone deacetylase binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|protein binding|protein kinase C binding|repressing transcription factor binding|transcription corepressor activity			lung(2)|central_nervous_system(2)|kidney(1)	5	all_lung(11;0.187)				Valproic Acid(DB00313)											OREG0017877	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	18705919	18705919	7297	7	G	C	C	37	37	HDAC9	C	3	3
ABCB5	340273	broad.mit.edu	37	7	20691164	20691164	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:20691164G>T	uc003suw.3	+	4	665	c.119G>T	c.(118-120)GGA>GTA	p.G40V	ABCB5_uc010kuh.2_Missense_Mutation_p.G485V|ABCB5_uc003suv.3_Missense_Mutation_p.G40V|ABCB5_uc011jyi.1_Missense_Mutation_p.G40V	NM_178559	NP_848654	Q2M3G0	ABCB5_HUMAN	ATP-binding cassette, sub-family B, member 5	40	ABC transporter 1.|Extracellular (Potential).				regulation of membrane potential	apical plasma membrane|Golgi membrane|integral to plasma membrane|intercellular canaliculus	ATP binding|ATPase activity, coupled to transmembrane movement of substances|efflux transmembrane transporter activity			skin(2)|large_intestine(1)|haematopoietic_and_lymphoid_tissue(1)|ovary(1)|pancreas(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	20691164	20691164	45	7	G	T	T	41	41	ABCB5	T	2	2
ABCB5	340273	broad.mit.edu	37	7	20784959	20784959	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:20784959G>A	uc003suw.3	+	17	2538	c.1992G>A	c.(1990-1992)GAG>GAA	p.E664E	ABCB5_uc010kuh.2_Silent_p.E1109E	NM_178559	NP_848654	Q2M3G0	ABCB5_HUMAN	ATP-binding cassette, sub-family B, member 5	664	Cytoplasmic (Potential).|ABC transporter 2.				regulation of membrane potential	apical plasma membrane|Golgi membrane|integral to plasma membrane|intercellular canaliculus	ATP binding|ATPase activity, coupled to transmembrane movement of substances|efflux transmembrane transporter activity			skin(2)|large_intestine(1)|haematopoietic_and_lymphoid_tissue(1)|ovary(1)|pancreas(1)	6																		---	---	---	---	capture		Silent	SNP	20784959	20784959	45	7	G	A	A	33	33	ABCB5	A	2	2
SP4	6671	broad.mit.edu	37	7	21468913	21468913	+	Nonsense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:21468913C>T	uc003sva.2	+	3	311	c.130C>T	c.(130-132)CAG>TAG	p.Q44*	SP4_uc003svb.2_Intron	NM_003112	NP_003103	Q02446	SP4_HUMAN	Sp4 transcription factor	44					regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|transcription coactivator activity|zinc ion binding			ovary(3)|skin(2)	5																		---	---	---	---	capture		Nonsense_Mutation	SNP	21468913	21468913	15466	7	C	T	T	29	29	SP4	T	5	2
DNAH11	8701	broad.mit.edu	37	7	21639594	21639594	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:21639594C>T	uc003svc.2	+	15	2888	c.2857C>T	c.(2857-2859)CCT>TCT	p.P953S		NM_003777	NP_003768	Q96DT5	DYH11_HUMAN	dynein, axonemal, heavy chain 11	953	Stem (By similarity).				microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(8)|large_intestine(3)|pancreas(3)|central_nervous_system(1)	15														Kartagener_syndrome				---	---	---	---	capture		Missense_Mutation	SNP	21639594	21639594	4781	7	C	T	T	30	30	DNAH11	T	2	2
TRA2A	29896	broad.mit.edu	37	7	23561452	23561452	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:23561452C>T	uc003swi.2	-	2	258	c.44G>A	c.(43-45)CGC>CAC	p.R15H	TRA2A_uc011jzb.1_RNA|TRA2A_uc011jzc.1_5'UTR|TRA2A_uc011jzd.1_5'UTR|TRA2A_uc010kuo.1_RNA	NM_013293	NP_037425	Q13595	TRA2A_HUMAN	transformer-2 alpha	15					nuclear mRNA splicing, via spliceosome	nucleus	nucleotide binding|RNA binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	23561452	23561452	16977	7	C	T	T	27	27	TRA2A	T	1	1
HOXA3	3200	broad.mit.edu	37	7	27148264	27148264	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27148264G>C	uc011jzl.1	-	3	802	c.602C>G	c.(601-603)GCG>GGG	p.A201G	HOXA3_uc011jzk.1_Missense_Mutation_p.A43G|HOXA3_uc003syk.2_Missense_Mutation_p.A201G	NM_030661	NP_109377	O43365	HXA3_HUMAN	homeobox A3 isoform a	201	Homeobox.				angiogenesis	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			breast(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	27148264	27148264	7585	7	G	C	C	38	38	HOXA3	C	3	3
PDE1C	5137	broad.mit.edu	37	7	31864492	31864492	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:31864492C>A	uc003tcm.1	-	13	1864	c.1395G>T	c.(1393-1395)CAG>CAT	p.Q465H	PDE1C_uc003tcn.1_Missense_Mutation_p.Q465H|PDE1C_uc003tco.1_Missense_Mutation_p.Q525H|PDE1C_uc003tcr.2_Missense_Mutation_p.Q465H|PDE1C_uc003tcs.2_Missense_Mutation_p.Q465H	NM_005020	NP_005011	Q14123	PDE1C_HUMAN	phosphodiesterase 1C	465	Catalytic (By similarity).				activation of phospholipase C activity|nerve growth factor receptor signaling pathway	cytosol	calmodulin binding|calmodulin-dependent cyclic-nucleotide phosphodiesterase activity|metal ion binding			skin(3)|central_nervous_system(1)	4			GBM - Glioblastoma multiforme(11;0.216)															---	---	---	---	capture		Missense_Mutation	SNP	31864492	31864492	12056	7	C	A	A	32	32	PDE1C	A	2	2
BMPER	168667	broad.mit.edu	37	7	34097706	34097706	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:34097706C>A	uc011kap.1	+	10	1077	c.963C>A	c.(961-963)ATC>ATA	p.I321I		NM_133468	NP_597725	Q8N8U9	BMPER_HUMAN	BMP-binding endothelial regulator precursor	321	VWFC 5.				blood vessel endothelial cell proliferation involved in sprouting angiogenesis|endothelial cell activation|negative regulation of BMP signaling pathway|positive regulation of ERK1 and ERK2 cascade|regulation of endothelial cell migration|regulation of pathway-restricted SMAD protein phosphorylation	extracellular space				ovary(2)|central_nervous_system(1)	3																		---	---	---	---	capture		Silent	SNP	34097706	34097706	1493	7	C	A	A	32	32	BMPER	A	2	2
BMPER	168667	broad.mit.edu	37	7	34182965	34182965	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:34182965T>C	uc011kap.1	+	14	1983	c.1869T>C	c.(1867-1869)AAT>AAC	p.N623N		NM_133468	NP_597725	Q8N8U9	BMPER_HUMAN	BMP-binding endothelial regulator precursor	623					blood vessel endothelial cell proliferation involved in sprouting angiogenesis|endothelial cell activation|negative regulation of BMP signaling pathway|positive regulation of ERK1 and ERK2 cascade|regulation of endothelial cell migration|regulation of pathway-restricted SMAD protein phosphorylation	extracellular space				ovary(2)|central_nervous_system(1)	3																		---	---	---	---	capture		Silent	SNP	34182965	34182965	1493	7	T	C	C	52	52	BMPER	C	4	4
AMPH	273	broad.mit.edu	37	7	38516551	38516551	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:38516551T>A	uc003tgu.2	-	6	484	c.415A>T	c.(415-417)AGC>TGC	p.S139C	AMPH_uc003tgv.2_Missense_Mutation_p.S139C	NM_001635	NP_001626	P49418	AMPH_HUMAN	amphiphysin isoform 1	139	BAR.				endocytosis|synaptic transmission	actin cytoskeleton|cell junction|synaptic vesicle membrane				ovary(3)|liver(1)|skin(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	38516551	38516551	591	7	T	A	A	55	55	AMPH	A	4	4
POU6F2	11281	broad.mit.edu	37	7	39243867	39243867	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:39243867G>T	uc003thb.1	+	3	266	c.224G>T	c.(223-225)GGC>GTC	p.G75V	POU6F2_uc010kxo.2_Missense_Mutation_p.G67V	NM_007252	NP_009183	P78424	PO6F2_HUMAN	POU class 6 homeobox 2 isoform 1	75					central nervous system development|ganglion mother cell fate determination|transcription from RNA polymerase II promoter|visual perception		sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	39243867	39243867	12715	7	G	T	T	42	42	POU6F2	T	2	2
GLI3	2737	broad.mit.edu	37	7	42004165	42004165	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:42004165T>A	uc011kbh.1	-	15	4597	c.4506A>T	c.(4504-4506)GTA>GTT	p.V1502V	GLI3_uc011kbg.1_Silent_p.V1443V	NM_000168	NP_000159	P10071	GLI3_HUMAN	GLI-Kruppel family member GLI3	1502	Asp/Glu-rich (acidic).				negative regulation of alpha-beta T cell differentiation|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of smoothened signaling pathway|negative regulation of transcription from RNA polymerase II promoter|negative thymic T cell selection|positive regulation of alpha-beta T cell differentiation|positive regulation of transcription from RNA polymerase II promoter|thymocyte apoptosis	cilium|cytosol|nucleolus	beta-catenin binding|histone acetyltransferase binding|histone deacetylase binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(11)|ovary(3)|large_intestine(2)|central_nervous_system(1)|kidney(1)|pancreas(1)	19														Greig_Cephalopolysyndactyly|Pallister-Hall_syndrome				---	---	---	---	capture		Silent	SNP	42004165	42004165	6707	7	T	A	A	57	57	GLI3	A	4	4
GLI3	2737	broad.mit.edu	37	7	42063099	42063099	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:42063099T>A	uc011kbh.1	-	10	1556	c.1465A>T	c.(1465-1467)AGG>TGG	p.R489W	GLI3_uc011kbg.1_Missense_Mutation_p.R430W	NM_000168	NP_000159	P10071	GLI3_HUMAN	GLI-Kruppel family member GLI3	489	C2H2-type 1.				negative regulation of alpha-beta T cell differentiation|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of smoothened signaling pathway|negative regulation of transcription from RNA polymerase II promoter|negative thymic T cell selection|positive regulation of alpha-beta T cell differentiation|positive regulation of transcription from RNA polymerase II promoter|thymocyte apoptosis	cilium|cytosol|nucleolus	beta-catenin binding|histone acetyltransferase binding|histone deacetylase binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(11)|ovary(3)|large_intestine(2)|central_nervous_system(1)|kidney(1)|pancreas(1)	19														Greig_Cephalopolysyndactyly|Pallister-Hall_syndrome				---	---	---	---	capture		Missense_Mutation	SNP	42063099	42063099	6707	7	T	A	A	54	54	GLI3	A	4	4
C7orf25	79020	broad.mit.edu	37	7	42950098	42950098	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:42950098C>A	uc003thw.2	-	2	866	c.402G>T	c.(400-402)AGG>AGT	p.R134S	C7orf25_uc010kxq.2_Missense_Mutation_p.R134S|C7orf25_uc003thx.3_Missense_Mutation_p.R192S|C7orf25_uc010kxr.2_Missense_Mutation_p.R192S	NM_024054	NP_076959	Q9BPX7	CG025_HUMAN	hypothetical protein LOC79020 b	134										skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	42950098	42950098	2487	7	C	A	A	22	22	C7orf25	A	2	2
MRPL32	64983	broad.mit.edu	37	7	42976962	42976962	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:42976962G>T	uc003tia.2	+	3	401	c.354G>T	c.(352-354)CAG>CAT	p.Q118H	MRPL32_uc003tib.2_RNA|MRPL32_uc003tic.2_Missense_Mutation_p.Q65H	NM_031903	NP_114109	Q9BYC8	RM32_HUMAN	mitochondrial ribosomal protein L32 precursor	118					translation	large ribosomal subunit|mitochondrial ribosome	structural constituent of ribosome				0																		---	---	---	---	capture		Missense_Mutation	SNP	42976962	42976962	10188	7	G	T	T	33	33	MRPL32	T	2	2
GCK	2645	broad.mit.edu	37	7	44184789	44184789	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:44184789G>T	uc003tkl.2	-	10	1814	c.1344C>A	c.(1342-1344)GGC>GGA	p.G448G	GCK_uc003tkh.1_Silent_p.G121G|GCK_uc003tki.1_Silent_p.G126G|GCK_uc003tkj.1_Silent_p.G447G|GCK_uc003tkk.1_Silent_p.G449G	NM_000162	NP_000153	P35557	HXK4_HUMAN	glucokinase isoform 1	448					cellular response to insulin stimulus|cellular response to leptin stimulus|detection of glucose|endocrine pancreas development|glucose homeostasis|glucose transport|glycolysis|negative regulation of gluconeogenesis|positive regulation of glycogen biosynthetic process|positive regulation of insulin secretion|regulation of glucose transport|regulation of glycolysis|transmembrane transport	cytosol|nucleoplasm	ATP binding|glucokinase activity|glucose binding|protein binding			skin(3)|lung(1)	4																		---	---	---	---	capture		Silent	SNP	44184789	44184789	6559	7	G	T	T	38	38	GCK	T	1	1
NPC1L1	29881	broad.mit.edu	37	7	44556302	44556302	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:44556302C>A	uc003tlb.2	-	17	3656	c.3600G>T	c.(3598-3600)TCG>TCT	p.S1200S	NPC1L1_uc003tlc.2_Silent_p.S1173S|NPC1L1_uc011kbw.1_Silent_p.S1127S|NPC1L1_uc003tla.2_Intron	NM_013389	NP_037521	Q9UHC9	NPCL1_HUMAN	Niemann-Pick C1-like protein 1 isoform 1	1200	Helical; Name=12; (Potential).				cholesterol biosynthetic process|intestinal cholesterol absorption|lipoprotein metabolic process	apical plasma membrane|cytoplasmic vesicle membrane|integral to membrane	hedgehog receptor activity|protein binding			ovary(3)|central_nervous_system(1)|skin(1)	5					Ezetimibe(DB00973)													---	---	---	---	capture		Silent	SNP	44556302	44556302	10975	7	C	A	A	23	23	NPC1L1	A	1	1
ABCA13	154664	broad.mit.edu	37	7	48314472	48314472	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:48314472A>G	uc003toq.2	+	17	5234	c.5209A>G	c.(5209-5211)AAA>GAA	p.K1737E	ABCA13_uc010kyr.2_Missense_Mutation_p.K1240E	NM_152701	NP_689914	Q86UQ4	ABCAD_HUMAN	ATP binding cassette, sub-family A (ABC1),	1737					transport	integral to membrane	ATP binding|ATPase activity			ovary(5)|central_nervous_system(4)|skin(1)	10																		---	---	---	---	capture		Missense_Mutation	SNP	48314472	48314472	32	7	A	G	G	13	13	ABCA13	G	4	4
EGFR	1956	broad.mit.edu	37	7	55233016	55233016	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:55233016C>T	uc003tqk.2	+	15	2012	c.1766C>T	c.(1765-1767)CCC>CTC	p.P589L	EGFR_uc003tqi.2_Missense_Mutation_p.P589L|EGFR_uc003tqj.2_Missense_Mutation_p.P589L|EGFR_uc010kzg.1_Missense_Mutation_p.P544L|EGFR_uc011kco.1_Missense_Mutation_p.P536L|EGFR_uc011kcp.1_Intron|EGFR_uc011kcq.1_RNA|EGFR_uc003tqn.2_RNA	NM_005228	NP_005219	P00533	EGFR_HUMAN	epidermal growth factor receptor isoform a	589	Approximate.|Extracellular (Potential).			DGPH->AGPA: Decreases intramolecular interactions and facilitates EGF binding.	activation of phospholipase A2 activity by calcium-mediated signaling|activation of phospholipase C activity|axon guidance|cell proliferation|cell-cell adhesion|negative regulation of apoptosis|negative regulation of epidermal growth factor receptor signaling pathway|ossification|positive regulation of catenin import into nucleus|positive regulation of cell migration|positive regulation of cyclin-dependent protein kinase activity involved in G1/S|positive regulation of epithelial cell proliferation|positive regulation of MAP kinase activity|positive regulation of nitric oxide biosynthetic process|positive regulation of phosphorylation|positive regulation of protein kinase B signaling cascade|protein autophosphorylation|protein insertion into membrane|regulation of nitric-oxide synthase activity|regulation of peptidyl-tyrosine phosphorylation|response to stress|response to UV-A	basolateral plasma membrane|endoplasmic reticulum membrane|endosome|extracellular space|Golgi membrane|integral to membrane|nuclear membrane|Shc-EGFR complex	actin filament binding|ATP binding|double-stranded DNA binding|epidermal growth factor receptor activity|identical protein binding|MAP/ERK kinase kinase activity|protein heterodimerization activity|protein phosphatase binding|receptor signaling protein tyrosine kinase activity			lung(9213)|central_nervous_system(103)|stomach(41)|upper_aerodigestive_tract(39)|prostate(32)|ovary(31)|thyroid(24)|breast(11)|peritoneum(9)|oesophagus(9)|salivary_gland(9)|large_intestine(8)|kidney(8)|urinary_tract(6)|skin(5)|adrenal_gland(5)|soft_tissue(4)|bone(3)|NS(2)|pancreas(2)|haematopoietic_and_lymphoid_tissue(2)|thymus(2)|liver(2)|eye(1)	9571	all_cancers(1;1.57e-46)|all_epithelial(1;5.62e-37)|Lung NSC(1;9.29e-25)|all_lung(1;4.39e-23)|Esophageal squamous(2;7.55e-08)|Breast(14;0.0318)		GBM - Glioblastoma multiforme(1;0)|all cancers(1;2.19e-314)|Lung(13;4.65e-05)|LUSC - Lung squamous cell carcinoma(13;0.000168)|STAD - Stomach adenocarcinoma(5;0.00164)|Epithelial(13;0.0607)		Cetuximab(DB00002)|Erlotinib(DB00530)|Gefitinib(DB00317)|Lapatinib(DB01259)|Lidocaine(DB00281)|Panitumumab(DB01269)|Trastuzumab(DB00072)		8	A|O|Mis		glioma|NSCLC	NSCLC			Lung_Cancer_Familial_Clustering_of	TCGA GBM(3;<1E-08)|TSP Lung(4;<1E-08)			---	---	---	---	capture		Missense_Mutation	SNP	55233016	55233016	5156	7	C	T	T	22	22	EGFR	T	2	2
CHCHD2	51142	broad.mit.edu	37	7	56172045	56172045	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:56172045C>T	uc003tsa.2	-	2	255	c.174G>A	c.(172-174)CAG>CAA	p.Q58Q	PSPH_uc003trj.2_Intron	NM_016139	NP_057223	Q9Y6H1	CHCH2_HUMAN	coiled-coil-helix-coiled-coil-helix domain	58						mitochondrion					0	Breast(14;0.214)		Lung(13;0.00024)|LUSC - Lung squamous cell carcinoma(13;0.00099)															---	---	---	---	capture		Silent	SNP	56172045	56172045	3450	7	C	T	T	32	32	CHCHD2	T	2	2
ZNF479	90827	broad.mit.edu	37	7	57188465	57188465	+	Silent	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:57188465G>T	uc010kzo.2	-	5	928	c.657C>A	c.(655-657)GGC>GGA	p.G219G		NM_033273	NP_150376	Q96JC4	ZN479_HUMAN	zinc finger protein 479	219	C2H2-type 2.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)|skin(1)	4			GBM - Glioblastoma multiforme(1;9.18e-12)															---	---	---	---	capture		Silent	SNP	57188465	57188465	18527	7	G	T	T	46	46	ZNF479	T	2	2
WBSCR17	64409	broad.mit.edu	37	7	70800691	70800691	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:70800691C>G	uc003tvy.2	+	2	394	c.394C>G	c.(394-396)CGT>GGT	p.R132G	WBSCR17_uc003tvz.2_5'UTR	NM_022479	NP_071924	Q6IS24	GLTL3_HUMAN	UDP-GalNAc:polypeptide	132	Lumenal (Potential).					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			skin(3)|upper_aerodigestive_tract(1)|ovary(1)|pancreas(1)|central_nervous_system(1)	7		all_cancers(73;0.2)|Lung NSC(55;0.094)|all_lung(88;0.125)																---	---	---	---	capture		Missense_Mutation	SNP	70800691	70800691	17836	7	C	G	G	23	23	WBSCR17	G	3	3
GNAI1	2770	broad.mit.edu	37	7	79846649	79846649	+	Missense_Mutation	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:79846649A>G	uc003uhb.1	+	8	1242	c.905A>G	c.(904-906)TAT>TGT	p.Y302C	GNAI1_uc011kgt.1_Missense_Mutation_p.Y250C	NM_002069	NP_002060	P63096	GNAI1_HUMAN	guanine nucleotide binding protein (G protein),	302					cell cycle|cell division|inhibition of adenylate cyclase activity by G-protein signaling pathway|platelet activation|synaptic transmission	centrosome|heterotrimeric G-protein complex|midbody|nucleus	G-protein beta/gamma-subunit complex binding|GTP binding|metabotropic serotonin receptor binding|signal transducer activity			upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	79846649	79846649	6773	7	A	G	G	16	16	GNAI1	G	4	4
PCLO	27445	broad.mit.edu	37	7	82784244	82784244	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82784244T>A	uc003uhx.2	-	2	2002	c.1713A>T	c.(1711-1713)ACA>ACT	p.T571T	PCLO_uc003uhv.2_Silent_p.T571T	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	517	Pro-rich.				cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7																		---	---	---	---	capture		Silent	SNP	82784244	82784244	12003	7	T	A	A	55	55	PCLO	A	4	4
PCLO	27445	broad.mit.edu	37	7	82784705	82784705	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82784705G>A	uc003uhx.2	-	2	1541	c.1252C>T	c.(1252-1254)CCA>TCA	p.P418S	PCLO_uc003uhv.2_Missense_Mutation_p.P418S	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7																		---	---	---	---	capture		Missense_Mutation	SNP	82784705	82784705	12003	7	G	A	A	44	44	PCLO	A	2	2
ABCB4	5244	broad.mit.edu	37	7	87104757	87104757	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87104757C>G	uc003uiv.1	-	2	101	c.25G>C	c.(25-27)GGA>CGA	p.G9R	ABCB4_uc003uiw.1_Missense_Mutation_p.G9R|ABCB4_uc003uix.1_Missense_Mutation_p.G9R|ABCB4_uc003uiy.2_Missense_Mutation_p.G9R	NM_018849	NP_061337	P21439	MDR3_HUMAN	ATP-binding cassette, subfamily B, member 4	9	Cytoplasmic (By similarity).				cellular lipid metabolic process	apical plasma membrane|Golgi membrane|integral to plasma membrane|intercellular canaliculus|membrane fraction	ATP binding|xenobiotic-transporting ATPase activity			ovary(4)|skin(1)|pancreas(1)	6	Esophageal squamous(14;0.0058)|all_lung(186;0.201)|Lung NSC(181;0.203)																	---	---	---	---	capture		Missense_Mutation	SNP	87104757	87104757	44	7	C	G	G	23	23	ABCB4	G	3	3
PPP1R9A	55607	broad.mit.edu	37	7	94917904	94917904	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:94917904G>T	uc003unp.2	+	15	3240	c.2958G>T	c.(2956-2958)CAG>CAT	p.Q986H	PPP1R9A_uc010lfj.2_Missense_Mutation_p.Q1262H|PPP1R9A_uc011kif.1_Missense_Mutation_p.Q1184H|PPP1R9A_uc003unq.2_Intron|PPP1R9A_uc011kig.1_Missense_Mutation_p.Q978H|PPP1R9A_uc003unr.2_Missense_Mutation_p.Q275H	NM_017650	NP_060120	Q9ULJ8	NEB1_HUMAN	protein phosphatase 1, regulatory (inhibitor)	986	Interacts with TGN38 (By similarity).					cell junction|synapse|synaptosome	actin binding			ovary(2)|haematopoietic_and_lymphoid_tissue(1)|skin(1)	4	all_cancers(62;9.12e-11)|all_epithelial(64;4.34e-09)		STAD - Stomach adenocarcinoma(171;0.0031)												HNSCC(28;0.073)			---	---	---	---	capture		Missense_Mutation	SNP	94917904	94917904	12814	7	G	T	T	35	35	PPP1R9A	T	2	2
ZKSCAN5	23660	broad.mit.edu	37	7	99129345	99129345	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99129345G>T	uc003uqv.2	+	7	2117	c.1993G>T	c.(1993-1995)GAA>TAA	p.E665*	ZKSCAN5_uc010lfx.2_Nonsense_Mutation_p.E665*|ZKSCAN5_uc003uqw.2_Nonsense_Mutation_p.E665*|ZKSCAN5_uc003uqx.2_Nonsense_Mutation_p.E592*|ZKSCAN5_uc003uqy.2_Nonsense_Mutation_p.E401*	NM_145102	NP_659570	Q9Y2L8	ZKSC5_HUMAN	zinc finger with KRAB and SCAN domains 5	665	C2H2-type 9.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1	all_cancers(62;2.54e-08)|all_epithelial(64;2.55e-09)|Lung NSC(181;0.0053)|all_lung(186;0.00895)|Esophageal squamous(72;0.0166)																	---	---	---	---	capture		Nonsense_Mutation	SNP	99129345	99129345	18281	7	G	T	T	45	45	ZKSCAN5	T	5	2
MOSPD3	64598	broad.mit.edu	37	7	100210858	100210858	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100210858G>C	uc003uvq.2	+	3	449	c.247G>C	c.(247-249)GAG>CAG	p.E83Q	MOSPD3_uc003uvr.2_Missense_Mutation_p.E83Q|MOSPD3_uc003uvs.2_Missense_Mutation_p.E83Q|MOSPD3_uc003uvt.2_Missense_Mutation_p.E83Q	NM_001040097	NP_001035186	O75425	MSPD3_HUMAN	motile sperm domain containing 3 isoform a	83	MSP.					integral to membrane	structural molecule activity			ovary(2)	2	Lung NSC(181;0.0261)|all_lung(186;0.0392)|Esophageal squamous(72;0.0439)																	---	---	---	---	capture		Missense_Mutation	SNP	100210858	100210858	10109	7	G	C	C	33	33	MOSPD3	C	3	3
ORC5L	5001	broad.mit.edu	37	7	103808925	103808925	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:103808925C>T	uc003vcb.2	-	9	984	c.873G>A	c.(871-873)CTG>CTA	p.L291L	ORC5L_uc011klp.1_Silent_p.L159L|ORC5L_uc003vcc.2_Silent_p.L291L	NM_002553	NP_002544	O43913	ORC5_HUMAN	origin recognition complex subunit 5 isoform 1	291					cell cycle checkpoint|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|S phase of mitotic cell cycle	cytoplasm|nuclear origin of replication recognition complex|nucleoplasm	ATP binding|DNA replication origin binding|identical protein binding				0																		---	---	---	---	capture		Silent	SNP	103808925	103808925	11676	7	C	T	T	29	29	ORC5L	T	2	2
PIK3CG	5294	broad.mit.edu	37	7	106509912	106509912	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:106509912T>C	uc003vdv.3	+	2	1991	c.1906T>C	c.(1906-1908)TCA>CCA	p.S636P	PIK3CG_uc003vdu.2_Missense_Mutation_p.S636P|PIK3CG_uc003vdw.2_Missense_Mutation_p.S636P	NM_002649	NP_002640	P48736	PK3CG_HUMAN	phosphoinositide-3-kinase, catalytic, gamma	636					G-protein coupled receptor protein signaling pathway|phosphatidylinositol-mediated signaling|platelet activation	phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity|protein binding			lung(16)|central_nervous_system(8)|breast(5)|pancreas(3)|stomach(2)|ovary(2)|upper_aerodigestive_tract(1)|skin(1)	38																		---	---	---	---	capture		Missense_Mutation	SNP	106509912	106509912	12340	7	T	C	C	54	54	PIK3CG	C	4	4
AASS	10157	broad.mit.edu	37	7	121726155	121726155	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:121726155C>A	uc003vka.2	-	18	2191	c.2095G>T	c.(2095-2097)GGC>TGC	p.G699C	AASS_uc011knu.1_RNA|AASS_uc011knv.1_RNA|AASS_uc003vkb.2_Missense_Mutation_p.G699C|AASS_uc011knw.1_Missense_Mutation_p.G187C	NM_005763	NP_005754	Q9UDR5	AASS_HUMAN	aminoadipate-semialdehyde synthase precursor	699	Saccharopine dehydrogenase.				protein tetramerization	mitochondrial matrix	binding|saccharopine dehydrogenase (NAD+, L-glutamate-forming) activity|saccharopine dehydrogenase (NADP+, L-lysine-forming) activity			upper_aerodigestive_tract(1)|ovary(1)	2					L-Glutamic Acid(DB00142)|NADH(DB00157)													---	---	---	---	capture		Missense_Mutation	SNP	121726155	121726155	25	7	C	A	A	24	24	AASS	A	2	2
CADPS2	93664	broad.mit.edu	37	7	122111611	122111611	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:122111611C>A	uc010lkp.2	-	13	2167	c.2004G>T	c.(2002-2004)TGG>TGT	p.W668C	CADPS2_uc011knx.1_Missense_Mutation_p.W39C|CADPS2_uc003vkg.3_Missense_Mutation_p.W365C|CADPS2_uc010lkq.2_Missense_Mutation_p.W665C	NM_017954	NP_060424	Q86UW7	CAPS2_HUMAN	Ca2+-dependent activator protein for secretion 2	668					exocytosis|protein transport	cell junction|cytoplasmic vesicle membrane|synapse	lipid binding|metal ion binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	122111611	122111611	2687	7	C	A	A	18	18	CADPS2	A	2	2
SPAM1	6677	broad.mit.edu	37	7	123594272	123594272	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:123594272G>T	uc003vld.2	+	4	1050	c.648G>T	c.(646-648)TGG>TGT	p.W216C	SPAM1_uc003vle.2_Missense_Mutation_p.W216C|SPAM1_uc011koa.1_5'Flank|SPAM1_uc003vlf.3_Missense_Mutation_p.W216C|SPAM1_uc010lku.2_Missense_Mutation_p.W216C	NM_153189	NP_694859	P38567	HYALP_HUMAN	sperm adhesion molecule 1 isoform 2	216					binding of sperm to zona pellucida|carbohydrate metabolic process|cell adhesion|fusion of sperm to egg plasma membrane	anchored to membrane|plasma membrane	hyalurononglucosaminidase activity			ovary(3)|kidney(1)	4					Hyaluronidase(DB00070)													---	---	---	---	capture		Missense_Mutation	SNP	123594272	123594272	15489	7	G	T	T	43	43	SPAM1	T	2	2
IMPDH1	3614	broad.mit.edu	37	7	128038584	128038584	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128038584G>A	uc011kol.1	-	7	809	c.703C>T	c.(703-705)CTG>TTG	p.L235L	IMPDH1_uc011kom.1_Silent_p.L230L|IMPDH1_uc003vmt.2_Silent_p.L210L|IMPDH1_uc003vmu.2_Silent_p.L320L|IMPDH1_uc003vmw.2_Silent_p.L310L|IMPDH1_uc011kon.1_Silent_p.L287L|IMPDH1_uc003vmv.2_Silent_p.L284L|IMPDH1_uc003vmx.2_Silent_p.L243L|IMPDH1_uc003vmy.2_Silent_p.L251L	NM_001142573	NP_001136045	P20839	IMDH1_HUMAN	inosine monophosphate dehydrogenase 1 isoform e	235	CBS 2.				GMP biosynthetic process|purine base metabolic process	cytosol|nucleus	DNA binding|IMP dehydrogenase activity|metal ion binding			skin(2)|lung(1)|central_nervous_system(1)	4					Mycophenolate mofetil(DB00688)|Mycophenolic acid(DB01024)|NADH(DB00157)|Ribavirin(DB00811)|Thioguanine(DB00352)											OREG0018292	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	128038584	128038584	8027	7	G	A	A	33	33	IMPDH1	A	2	2
IMPDH1	3614	broad.mit.edu	37	7	128041089	128041089	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128041089C>A	uc011kol.1	-	3	335	c.229G>T	c.(229-231)GAC>TAC	p.D77Y	IMPDH1_uc011kom.1_Missense_Mutation_p.D77Y|IMPDH1_uc003vmt.2_Missense_Mutation_p.D77Y|IMPDH1_uc003vmu.2_Missense_Mutation_p.D162Y|IMPDH1_uc003vmw.2_Missense_Mutation_p.D152Y|IMPDH1_uc011kon.1_Missense_Mutation_p.D129Y|IMPDH1_uc003vmv.2_Missense_Mutation_p.D126Y|IMPDH1_uc003vmx.2_Missense_Mutation_p.D85Y|IMPDH1_uc003vmy.2_Missense_Mutation_p.D93Y	NM_001142573	NP_001136045	P20839	IMDH1_HUMAN	inosine monophosphate dehydrogenase 1 isoform e	77					GMP biosynthetic process|purine base metabolic process	cytosol|nucleus	DNA binding|IMP dehydrogenase activity|metal ion binding			skin(2)|lung(1)|central_nervous_system(1)	4					Mycophenolate mofetil(DB00688)|Mycophenolic acid(DB01024)|NADH(DB00157)|Ribavirin(DB00811)|Thioguanine(DB00352)													---	---	---	---	capture		Missense_Mutation	SNP	128041089	128041089	8027	7	C	A	A	29	29	IMPDH1	A	2	2
PLXNA4	91584	broad.mit.edu	37	7	131872353	131872353	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:131872353G>A	uc003vra.3	-	15	3099	c.2870C>T	c.(2869-2871)TCA>TTA	p.S957L		NM_020911	NP_065962	Q9HCM2	PLXA4_HUMAN	plexin A4 isoform 1	957	IPT/TIG 2.|Extracellular (Potential).					integral to membrane|intracellular|plasma membrane				ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	131872353	131872353	12548	7	G	A	A	45	45	PLXNA4	A	2	2
CNOT4	4850	broad.mit.edu	37	7	135048770	135048770	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:135048770C>A	uc011kpy.1	-	10	1768	c.1676G>T	c.(1675-1677)GGG>GTG	p.G559V	CNOT4_uc003vss.2_Intron|CNOT4_uc011kpz.1_Missense_Mutation_p.G556V|CNOT4_uc003vst.2_Intron	NM_001008225	NP_001008226	O95628	CNOT4_HUMAN	CCR4-NOT transcription complex, subunit 4	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					nuclear-transcribed mRNA poly(A) tail shortening|protein autoubiquitination|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|nucleus	nucleotide binding|protein binding|RNA binding|ubiquitin-protein ligase activity|zinc ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	135048770	135048770	3759	7	C	A	A	22	22	CNOT4	A	2	2
WEE2	494551	broad.mit.edu	37	7	141429329	141429329	+	Splice_Site	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141429329A>C	uc003vwn.2	+	11	1942	c.1536_splice	c.e11-2	p.R512_splice	FLJ40852_uc011krh.1_Intron|FLJ40852_uc010lnm.2_Intron|FLJ40852_uc010lnn.2_Intron|FLJ40852_uc003vwm.3_Intron|FLJ40852_uc010lno.2_Intron	NM_001105558	NP_001099028			WEE1 homolog 2						egg activation|female meiosis|female pronucleus assembly|meiotic metaphase II|meiotic prophase I|mitosis|negative regulation of oocyte development|regulation of meiosis I	centrosome|nucleus	ATP binding|magnesium ion binding|non-membrane spanning protein tyrosine kinase activity|protein serine/threonine kinase activity			ovary(1)|stomach(1)	2	Melanoma(164;0.0171)																	---	---	---	---	capture		Splice_Site	SNP	141429329	141429329	17919	7	A	C	C	7	7	WEE2	C	5	4
OR6V1	346517	broad.mit.edu	37	7	142750136	142750136	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142750136G>T	uc011ksv.1	+	1	699	c.699G>T	c.(697-699)CAG>CAT	p.Q233H		NM_001001667	NP_001001667	Q8N148	OR6V1_HUMAN	olfactory receptor, family 6, subfamily V,	233	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	Melanoma(164;0.059)																	---	---	---	---	capture		Missense_Mutation	SNP	142750136	142750136	11622	7	G	T	T	33	33	OR6V1	T	2	2
TAS2R41	259287	broad.mit.edu	37	7	143175872	143175872	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143175872G>T	uc003wdc.1	+	1	907	c.907G>T	c.(907-909)GGC>TGC	p.G303C	uc003wda.2_Intron	NM_176883	NP_795364	P59536	T2R41_HUMAN	taste receptor, type 2, member 41	303	Cytoplasmic (Potential).				sensory perception of taste	integral to membrane	G-protein coupled receptor activity			pancreas(1)|skin(1)	2	Melanoma(164;0.15)																	---	---	---	---	capture		Missense_Mutation	SNP	143175872	143175872	16101	7	G	T	T	43	43	TAS2R41	T	2	2
GIMAP1	170575	broad.mit.edu	37	7	150417175	150417175	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150417175G>A	uc003whq.2	+	3	170	c.83G>A	c.(82-84)CGG>CAG	p.R28Q	GIMAP1_uc003whp.2_Missense_Mutation_p.R36Q	NM_130759	NP_570115	Q8WWP7	GIMA1_HUMAN	GTPase, IMAP family member 1	28	Cytoplasmic (Potential).					endoplasmic reticulum membrane|integral to membrane	GTP binding			ovary(1)|breast(1)|central_nervous_system(1)	3			OV - Ovarian serous cystadenocarcinoma(82;0.0145)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---	capture		Missense_Mutation	SNP	150417175	150417175	6647	7	G	A	A	39	39	GIMAP1	A	1	1
ABCF2	10061	broad.mit.edu	37	7	150921165	150921165	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150921165C>T	uc003wjp.2	-	4	514	c.403G>A	c.(403-405)GAA>AAA	p.E135K	ABCF2_uc003wjo.1_Missense_Mutation_p.E135K	NM_007189	NP_009120	Q9UG63	ABCF2_HUMAN	ATP-binding cassette, sub-family F, member 2	135	ABC transporter 1.					ATP-binding cassette (ABC) transporter complex|mitochondrial envelope	ATP binding|ATPase activity|transporter activity			central_nervous_system(1)	1			OV - Ovarian serous cystadenocarcinoma(82;0.00448)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---	capture		Missense_Mutation	SNP	150921165	150921165	67	7	C	T	T	29	29	ABCF2	T	2	2
SHH	6469	broad.mit.edu	37	7	155598997	155598997	+	Silent	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:155598997C>T	uc003wmk.1	-	2	706	c.555G>A	c.(553-555)GTG>GTA	p.V185V	SHH_uc003wmh.1_RNA|SHH_uc003wmi.1_Silent_p.V98V|SHH_uc003wmj.1_Silent_p.V98V	NM_000193	NP_000184	Q15465	SHH_HUMAN	sonic hedgehog preproprotein	185					androgen metabolic process|axon guidance|branching involved in ureteric bud morphogenesis|CD4-positive or CD8-positive, alpha-beta T cell lineage commitment|embryonic digit morphogenesis|hindbrain development|intein-mediated protein splicing|lymphoid progenitor cell differentiation|metanephric mesenchymal cell proliferation involved in metanephros development|midbrain development|negative regulation of cell migration|negative regulation of kidney smooth muscle cell differentiation|negative regulation of ureter smooth muscle cell differentiation|negative thymic T cell selection|neural crest cell migration|neuroblast proliferation|patterning of blood vessels|positive regulation of alpha-beta T cell differentiation|positive regulation of immature T cell proliferation in thymus|positive regulation of kidney smooth muscle cell differentiation|positive regulation of mesenchymal cell proliferation involved in ureter development|positive regulation of T cell differentiation in thymus|positive regulation of ureter smooth muscle cell differentiation|positive thymic T cell selection|proteolysis|sclerotome development|stem cell development|thymus development|vasculogenesis|ventral midline development	cell surface|extracellular space|membrane raft|plasma membrane	calcium ion binding|laminin-1 binding|peptidase activity|signal transducer activity|zinc ion binding			central_nervous_system(3)|lung(1)	4	all_neural(206;0.101)	all_hematologic(28;0.0592)	OV - Ovarian serous cystadenocarcinoma(82;0.00882)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---	capture		Silent	SNP	155598997	155598997	14771	7	C	T	T	29	29	SHH	T	2	2
PTPRN2	5799	broad.mit.edu	37	7	157396693	157396693	+	Splice_Site	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:157396693C>T	uc003wno.2	-	16	2539	c.2418_splice	c.e16+1	p.I806_splice	PTPRN2_uc003wnp.2_Splice_Site_p.I789_splice|PTPRN2_uc003wnq.2_Splice_Site_p.I777_splice|PTPRN2_uc003wnr.2_Splice_Site_p.I768_splice|PTPRN2_uc011kwa.1_Splice_Site_p.I829_splice	NM_002847	NP_002838			protein tyrosine phosphatase, receptor type, N							integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(4)|large_intestine(1)|pleura(1)|skin(1)	7	all_neural(206;0.181)	all_cancers(7;8.99e-13)|all_epithelial(9;2.4e-06)|all_hematologic(28;0.0155)|Breast(660;0.132)	OV - Ovarian serous cystadenocarcinoma(82;0.00463)	STAD - Stomach adenocarcinoma(7;0.0875)														---	---	---	---	capture		Splice_Site	SNP	157396693	157396693	13265	7	C	T	T	19	19	PTPRN2	T	5	1
DEFA5	1670	broad.mit.edu	37	8	6914138	6914138	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:6914138C>A	uc003wra.1	-	1	122	c.82G>T	c.(82-84)GAG>TAG	p.E28*		NM_021010	NP_066290	Q01523	DEF5_HUMAN	defensin, alpha 5 preproprotein	28					defense response to bacterium|defense response to fungus|killing of cells of other organism	extracellular space					0				COAD - Colon adenocarcinoma(149;0.0572)|READ - Rectum adenocarcinoma(644;0.121)														---	---	---	---	capture		Nonsense_Mutation	SNP	6914138	6914138	4563	8	C	A	A	29	29	DEFA5	A	5	2
SORBS3	10174	broad.mit.edu	37	8	22421834	22421834	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22421834G>C	uc003xbv.2	+	9	1054	c.714G>C	c.(712-714)ACG>ACC	p.T238T	SORBS3_uc011kzk.1_RNA|SORBS3_uc003xbw.3_5'Flank	NM_005775	NP_005766	O60504	VINEX_HUMAN	sorbin and SH3 domain containing 3 isoform 1	238					muscle contraction|positive regulation of stress fiber assembly	cytoskeleton|cytosol|nucleus	protein binding|structural constituent of cytoskeleton|vinculin binding				0		Prostate(55;0.0421)|Breast(100;0.102)		BRCA - Breast invasive adenocarcinoma(99;0.00566)|Colorectal(74;0.0146)|COAD - Colon adenocarcinoma(73;0.061)														---	---	---	---	capture		Silent	SNP	22421834	22421834	15429	8	G	C	C	39	39	SORBS3	C	3	3
FZD3	7976	broad.mit.edu	37	8	28384825	28384825	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:28384825G>T	uc003xgx.2	+	5	1026	c.548G>T	c.(547-549)CGT>CTT	p.R183L	FZD3_uc010lvb.2_Missense_Mutation_p.R183L	NM_017412	NP_059108	Q9NPG1	FZD3_HUMAN	frizzled 3 precursor	183	Extracellular (Potential).				canonical Wnt receptor signaling pathway|cell proliferation in midbrain|commissural neuron axon guidance|establishment of planar polarity|facial nucleus development|G-protein signaling, coupled to cGMP nucleotide second messenger|gonad development|inner ear morphogenesis|neural tube closure|vasculature development	apical part of cell|axon|cytoplasm|dendrite|integral to membrane|neuron projection membrane|neuronal cell body|presynaptic active zone	G-protein coupled receptor activity|PDZ domain binding|Wnt-protein binding			ovary(1)|central_nervous_system(1)	2		Ovarian(32;2.06e-05)		KIRC - Kidney renal clear cell carcinoma(542;0.109)|Kidney(114;0.13)|Colorectal(74;0.23)														---	---	---	---	capture		Missense_Mutation	SNP	28384825	28384825	6382	8	G	T	T	40	40	FZD3	T	1	1
FZD3	7976	broad.mit.edu	37	8	28385267	28385267	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:28385267G>A	uc003xgx.2	+	5	1468	c.990G>A	c.(988-990)CTG>CTA	p.L330L	FZD3_uc010lvb.2_Silent_p.L330L	NM_017412	NP_059108	Q9NPG1	FZD3_HUMAN	frizzled 3 precursor	330	Helical; Name=4; (Potential).				canonical Wnt receptor signaling pathway|cell proliferation in midbrain|commissural neuron axon guidance|establishment of planar polarity|facial nucleus development|G-protein signaling, coupled to cGMP nucleotide second messenger|gonad development|inner ear morphogenesis|neural tube closure|vasculature development	apical part of cell|axon|cytoplasm|dendrite|integral to membrane|neuron projection membrane|neuronal cell body|presynaptic active zone	G-protein coupled receptor activity|PDZ domain binding|Wnt-protein binding			ovary(1)|central_nervous_system(1)	2		Ovarian(32;2.06e-05)		KIRC - Kidney renal clear cell carcinoma(542;0.109)|Kidney(114;0.13)|Colorectal(74;0.23)														---	---	---	---	capture		Silent	SNP	28385267	28385267	6382	8	G	A	A	48	48	FZD3	A	2	2
XKR4	114786	broad.mit.edu	37	8	56436703	56436703	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:56436703G>C	uc003xsf.2	+	3	1902	c.1870G>C	c.(1870-1872)GAA>CAA	p.E624Q		NM_052898	NP_443130	Q5GH76	XKR4_HUMAN	XK, Kell blood group complex subunit-related	624						integral to membrane				pancreas(2)	2			Epithelial(17;0.000117)|all cancers(17;0.000836)															---	---	---	---	capture		Missense_Mutation	SNP	56436703	56436703	18014	8	G	C	C	45	45	XKR4	C	3	3
TGS1	96764	broad.mit.edu	37	8	56699597	56699597	+	Silent	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:56699597A>C	uc003xsj.3	+	4	1527	c.1140A>C	c.(1138-1140)ACA>ACC	p.T380T	TGS1_uc010lyh.2_Silent_p.T284T	NM_024831	NP_079107	Q96RS0	TGS1_HUMAN	trimethylguanosine synthase homolog	380					cellular lipid metabolic process|ncRNA metabolic process|regulation of transcription, DNA-dependent|RNA capping|spliceosomal snRNP assembly|transcription, DNA-dependent	Cajal body|cytosol	RNA trimethylguanosine synthase activity			ovary(1)|lung(1)|breast(1)	3		all_lung(136;0.119)|all_epithelial(80;0.125)|Lung NSC(129;0.147)	Epithelial(17;0.00027)|all cancers(17;0.00251)															---	---	---	---	capture		Silent	SNP	56699597	56699597	16365	8	A	C	C	5	5	TGS1	C	4	4
CYP7A1	1581	broad.mit.edu	37	8	59409573	59409573	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:59409573C>A	uc003xtm.3	-	3	561	c.498G>T	c.(496-498)TGG>TGT	p.W166C		NM_000780	NP_000771	P22680	CP7A1_HUMAN	cytochrome P450, family 7, subfamily A,	166					bile acid biosynthetic process|cellular lipid metabolic process|cellular response to cholesterol|cellular response to glucose stimulus|cholesterol catabolic process|cholesterol homeostasis|regulation of bile acid biosynthetic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	cholesterol 7-alpha-monooxygenase activity|electron carrier activity|heme binding			ovary(1)	1		all_lung(136;0.0271)|Lung NSC(129;0.0351)|all_epithelial(80;0.0554)												Neonatal_Giant_Cell_Hepatitis				---	---	---	---	capture		Missense_Mutation	SNP	59409573	59409573	4361	8	C	A	A	22	22	CYP7A1	A	2	2
SGK3	23678	broad.mit.edu	37	8	67726104	67726104	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:67726104A>G	uc003xwr.2	+	5	569	c.270A>G	c.(268-270)AGA>AGG	p.R90R	SGK3_uc003xwp.2_Silent_p.R84R|SGK3_uc003xwt.2_Silent_p.R90R|SGK3_uc003xwu.2_Silent_p.R90R	NM_001033578	NP_001028750	Q96BR1	SGK3_HUMAN	serum/glucocorticoid regulated kinase 3 isoform	90	PX.			R->A: Partially localized to the membrane.	cell communication|response to stress	cytoplasmic membrane-bounded vesicle|early endosome	ATP binding|phosphatidylinositol binding|protein serine/threonine kinase activity			ovary(1)|large_intestine(1)|lung(1)|breast(1)	4	Breast(64;0.186)	Lung NSC(129;0.0908)|all_lung(136;0.152)	Epithelial(68;0.0046)|OV - Ovarian serous cystadenocarcinoma(28;0.0112)|all cancers(69;0.0141)|BRCA - Breast invasive adenocarcinoma(89;0.206)															---	---	---	---	capture		Silent	SNP	67726104	67726104	14703	8	A	G	G	10	10	SGK3	G	4	4
CPA6	57094	broad.mit.edu	37	8	68423882	68423882	+	Missense_Mutation	SNP	A	G	G	rs151119622		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:68423882A>G	uc003xxq.3	-	4	582	c.326T>C	c.(325-327)ATA>ACA	p.I109T	CPA6_uc003xxr.3_5'UTR|CPA6_uc003xxs.2_Missense_Mutation_p.I109T	NM_020361	NP_065094	Q8N4T0	CBPA6_HUMAN	carboxypeptidase A6 isoform 1 precursor	109					proteolysis	proteinaceous extracellular matrix	metallocarboxypeptidase activity|zinc ion binding			ovary(2)	2			Epithelial(68;0.04)|OV - Ovarian serous cystadenocarcinoma(28;0.0593)|all cancers(69;0.136)															---	---	---	---	capture		Missense_Mutation	SNP	68423882	68423882	3932	8	A	G	G	16	16	CPA6	G	4	4
SULF1	23213	broad.mit.edu	37	8	70501234	70501234	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:70501234G>A	uc010lza.1	+	8	1309	c.592G>A	c.(592-594)GAG>AAG	p.E198K	SULF1_uc003xyd.2_Missense_Mutation_p.E198K|SULF1_uc003xye.2_Missense_Mutation_p.E198K|SULF1_uc003xyf.2_Missense_Mutation_p.E198K|SULF1_uc003xyg.2_Missense_Mutation_p.E198K	NM_015170	NP_055985	Q8IWU6	SULF1_HUMAN	sulfatase 1 precursor	198					apoptosis|bone development|heparan sulfate proteoglycan metabolic process|kidney development|negative regulation of fibroblast growth factor receptor signaling pathway	cell surface|endoplasmic reticulum|extracellular space|Golgi stack	arylsulfatase activity|calcium ion binding			central_nervous_system(3)|ovary(2)|pancreas(1)|skin(1)	7	Breast(64;0.0654)		Epithelial(68;0.0124)|OV - Ovarian serous cystadenocarcinoma(28;0.0265)|all cancers(69;0.0534)															---	---	---	---	capture		Missense_Mutation	SNP	70501234	70501234	15890	8	G	A	A	37	37	SULF1	A	1	1
SULF1	23213	broad.mit.edu	37	8	70541837	70541837	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:70541837G>A	uc010lza.1	+	19	2924	c.2207G>A	c.(2206-2208)GGG>GAG	p.G736E	SULF1_uc003xyd.2_Missense_Mutation_p.G736E|SULF1_uc003xye.2_Missense_Mutation_p.G736E|SULF1_uc003xyf.2_Missense_Mutation_p.G736E|SULF1_uc003xyg.2_Missense_Mutation_p.G736E|SULF1_uc003xyh.1_RNA|SULF1_uc003xyi.1_5'UTR	NM_015170	NP_055985	Q8IWU6	SULF1_HUMAN	sulfatase 1 precursor	736					apoptosis|bone development|heparan sulfate proteoglycan metabolic process|kidney development|negative regulation of fibroblast growth factor receptor signaling pathway	cell surface|endoplasmic reticulum|extracellular space|Golgi stack	arylsulfatase activity|calcium ion binding			central_nervous_system(3)|ovary(2)|pancreas(1)|skin(1)	7	Breast(64;0.0654)		Epithelial(68;0.0124)|OV - Ovarian serous cystadenocarcinoma(28;0.0265)|all cancers(69;0.0534)															---	---	---	---	capture		Missense_Mutation	SNP	70541837	70541837	15890	8	G	A	A	43	43	SULF1	A	2	2
ZFHX4	79776	broad.mit.edu	37	8	77616923	77616923	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77616923C>G	uc003yav.2	+	2	987	c.600C>G	c.(598-600)TCC>TCG	p.S200S	ZFHX4_uc003yat.1_Silent_p.S200S|ZFHX4_uc003yau.1_Silent_p.S200S|ZFHX4_uc003yaw.1_Silent_p.S200S	NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	200						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)												HNSCC(33;0.089)			---	---	---	---	capture		Silent	SNP	77616923	77616923	18223	8	C	G	G	22	22	ZFHX4	G	3	3
ZFHX4	79776	broad.mit.edu	37	8	77766955	77766955	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77766955G>A	uc003yav.2	+	10	8050	c.7663G>A	c.(7663-7665)GAA>AAA	p.E2555K	ZFHX4_uc003yau.1_Missense_Mutation_p.E2600K|ZFHX4_uc003yaw.1_Missense_Mutation_p.E2555K	NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	2555						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)												HNSCC(33;0.089)			---	---	---	---	capture		Missense_Mutation	SNP	77766955	77766955	18223	8	G	A	A	45	45	ZFHX4	A	2	2
CALB1	793	broad.mit.edu	37	8	91072419	91072419	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:91072419G>C	uc003yel.1	-	11	950	c.768C>G	c.(766-768)CTC>CTG	p.L256L	CALB1_uc011lge.1_Silent_p.L199L	NM_004929	NP_004920	P05937	CALB1_HUMAN	calbindin 1	256						nucleus	calcium ion binding|vitamin D binding			pancreas(1)	1			BRCA - Breast invasive adenocarcinoma(11;0.00953)															---	---	---	---	capture		Silent	SNP	91072419	91072419	2689	8	G	C	C	33	33	CALB1	C	3	3
KIAA1429	25962	broad.mit.edu	37	8	95538842	95538842	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95538842C>G	uc003ygo.1	-	8	1643	c.1630G>C	c.(1630-1632)GTG>CTG	p.V544L	KIAA1429_uc003ygp.2_Missense_Mutation_p.V544L|KIAA1429_uc010maz.1_RNA	NM_015496	NP_056311	Q69YN4	VIR_HUMAN	hypothetical protein LOC25962 isoform 1	544					mRNA processing|RNA splicing	nucleus				ovary(1)|skin(1)	2	Breast(36;3.29e-05)		BRCA - Breast invasive adenocarcinoma(8;0.00185)															---	---	---	---	capture		Missense_Mutation	SNP	95538842	95538842	8540	8	C	G	G	17	17	KIAA1429	G	3	3
INTS8	55656	broad.mit.edu	37	8	95848775	95848775	+	Silent	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95848775A>T	uc003yhb.2	+	7	903	c.777A>T	c.(775-777)GCA>GCT	p.A259A	INTS8_uc003yha.1_Silent_p.A259A|INTS8_uc011lgq.1_RNA|INTS8_uc011lgr.1_RNA|INTS8_uc010mba.2_Silent_p.A86A	NM_017864	NP_060334	Q75QN2	INT8_HUMAN	integrator complex subunit 8	259	TPR 1.				snRNA processing	integrator complex	protein binding				0	Breast(36;1.05e-06)																	---	---	---	---	capture		Silent	SNP	95848775	95848775	8085	8	A	T	T	8	8	INTS8	T	4	4
KCNS2	3788	broad.mit.edu	37	8	99440426	99440426	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:99440426C>A	uc003yin.2	+	2	569	c.219C>A	c.(217-219)CGC>CGA	p.R73R		NM_020697	NP_065748	Q9ULS6	KCNS2_HUMAN	potassium voltage-gated channel,	73	Cytoplasmic (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(1)	1	Breast(36;2.4e-06)		OV - Ovarian serous cystadenocarcinoma(57;0.0448)															---	---	---	---	capture		Silent	SNP	99440426	99440426	8394	8	C	A	A	25	25	KCNS2	A	2	2
VPS13B	157680	broad.mit.edu	37	8	100133616	100133616	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:100133616G>C	uc003yiv.2	+	8	1260	c.1149G>C	c.(1147-1149)TTG>TTC	p.L383F	VPS13B_uc003yiw.2_Missense_Mutation_p.L383F|VPS13B_uc003yit.2_Missense_Mutation_p.L383F|VPS13B_uc003yiu.1_Missense_Mutation_p.L383F|VPS13B_uc003yis.2_Missense_Mutation_p.L383F|VPS13B_uc011lgy.1_Missense_Mutation_p.L259F	NM_017890	NP_060360	Q7Z7G8	VP13B_HUMAN	vacuolar protein sorting 13B isoform 5	383					protein transport					ovary(7)|skin(4)|lung(3)|central_nervous_system(2)|pancreas(2)|breast(1)|kidney(1)	20	Breast(36;3.73e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.00636)															---	---	---	---	capture		Missense_Mutation	SNP	100133616	100133616	17757	8	G	C	C	45	45	VPS13B	C	3	3
PKHD1L1	93035	broad.mit.edu	37	8	110523031	110523031	+	Silent	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110523031T>A	uc003yne.2	+	71	11525	c.11421T>A	c.(11419-11421)GCT>GCA	p.A3807A		NM_177531	NP_803875	Q86WI1	PKHL1_HUMAN	fibrocystin L precursor	3807	Extracellular (Potential).				immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)												HNSCC(38;0.096)			---	---	---	---	capture		Silent	SNP	110523031	110523031	12397	8	T	A	A	55	55	PKHD1L1	A	4	4
CSMD3	114788	broad.mit.edu	37	8	113317125	113317125	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113317125G>A	uc003ynu.2	-	52	8250	c.8091C>T	c.(8089-8091)ATC>ATT	p.I2697I	CSMD3_uc003yns.2_Silent_p.I1899I|CSMD3_uc003ynt.2_Silent_p.I2657I|CSMD3_uc011lhx.1_Intron	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	2697	Extracellular (Potential).|Sushi 16.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---	capture		Silent	SNP	113317125	113317125	4087	8	G	A	A	45	45	CSMD3	A	2	2
CSMD3	114788	broad.mit.edu	37	8	113599332	113599332	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113599332G>C	uc003ynu.2	-	23	4007	c.3848C>G	c.(3847-3849)GCC>GGC	p.A1283G	CSMD3_uc003yns.2_Missense_Mutation_p.A555G|CSMD3_uc003ynt.2_Missense_Mutation_p.A1243G|CSMD3_uc011lhx.1_Missense_Mutation_p.A1179G	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	1283	Extracellular (Potential).|CUB 7.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---	capture		Missense_Mutation	SNP	113599332	113599332	4087	8	G	C	C	42	42	CSMD3	C	3	3
HAS2	3037	broad.mit.edu	37	8	122641427	122641427	+	Missense_Mutation	SNP	A	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:122641427A>T	uc003yph.2	-	2	692	c.154T>A	c.(154-156)TTT>ATT	p.F52I		NM_005328	NP_005319	Q92819	HAS2_HUMAN	hyaluronan synthase 2	52	Helical; Name=2; (Potential).					integral to plasma membrane	hyaluronan synthase activity		HAS2/PLAG1(10)	soft_tissue(10)|ovary(5)	15	Lung NSC(37;3.12e-08)|Ovarian(258;0.0254)|Hepatocellular(40;0.0997)|all_neural(195;0.142)		STAD - Stomach adenocarcinoma(47;0.00503)															---	---	---	---	capture		Missense_Mutation	SNP	122641427	122641427	7244	8	A	T	T	3	3	HAS2	T	4	4
FER1L6	654463	broad.mit.edu	37	8	125058105	125058105	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:125058105C>A	uc003yqw.2	+	21	2893	c.2687C>A	c.(2686-2688)CCC>CAC	p.P896H		NM_001039112	NP_001034201	Q2WGJ9	FR1L6_HUMAN	fer-1-like 6	896	Cytoplasmic (Potential).|C2 3.					integral to membrane				ovary(5)|skin(5)|central_nervous_system(1)	11	Lung NSC(37;4.1e-12)|Ovarian(258;0.00438)|all_neural(195;0.0741)		STAD - Stomach adenocarcinoma(47;0.00186)															---	---	---	---	capture		Missense_Mutation	SNP	125058105	125058105	6052	8	C	A	A	22	22	FER1L6	A	2	2
TMEM71	137835	broad.mit.edu	37	8	133740110	133740110	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:133740110T>A	uc003ytp.2	-	6	836	c.607A>T	c.(607-609)AGC>TGC	p.S203C	TMEM71_uc003ytm.1_Missense_Mutation_p.S25C|TMEM71_uc003ytn.2_Missense_Mutation_p.S185C|TMEM71_uc003yto.2_Intron	NM_144649	NP_653250	Q6P5X7	TMM71_HUMAN	transmembrane protein 71 isoform 1	204						integral to membrane				ovary(2)	2	all_neural(3;2.72e-06)|Medulloblastoma(3;7.08e-05)|Ovarian(258;0.00438)|Esophageal squamous(12;0.00507)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;4.46e-05)															---	---	---	---	capture		Missense_Mutation	SNP	133740110	133740110	16739	8	T	A	A	53	53	TMEM71	A	4	4
TG	7038	broad.mit.edu	37	8	133900481	133900481	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:133900481G>C	uc003ytw.2	+	10	2470	c.2429G>C	c.(2428-2430)AGA>ACA	p.R810T		NM_003235	NP_003226	P01266	THYG_HUMAN	thyroglobulin precursor	810	Thyroglobulin type-1 7.				hormone biosynthetic process|signal transduction|thyroid gland development|thyroid hormone generation	extracellular space	hormone activity			ovary(8)|breast(4)|pancreas(1)|central_nervous_system(1)|skin(1)	15	Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)	Myeloproliferative disorder(644;0.00878)|Acute lymphoblastic leukemia(644;0.0559)|Breast(495;0.0735)	BRCA - Breast invasive adenocarcinoma(115;0.000701)	KIRC - Kidney renal clear cell carcinoma(542;0.0546)														---	---	---	---	capture		Missense_Mutation	SNP	133900481	133900481	16341	8	G	C	C	33	33	TG	C	3	3
TG	7038	broad.mit.edu	37	8	133905937	133905937	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:133905937C>A	uc003ytw.2	+	11	2805	c.2764C>A	c.(2764-2766)CCT>ACT	p.P922T		NM_003235	NP_003226	P01266	THYG_HUMAN	thyroglobulin precursor	922	Thyroglobulin type-1 8.				hormone biosynthetic process|signal transduction|thyroid gland development|thyroid hormone generation	extracellular space	hormone activity			ovary(8)|breast(4)|pancreas(1)|central_nervous_system(1)|skin(1)	15	Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)	Myeloproliferative disorder(644;0.00878)|Acute lymphoblastic leukemia(644;0.0559)|Breast(495;0.0735)	BRCA - Breast invasive adenocarcinoma(115;0.000701)	KIRC - Kidney renal clear cell carcinoma(542;0.0546)														---	---	---	---	capture		Missense_Mutation	SNP	133905937	133905937	16341	8	C	A	A	30	30	TG	A	2	2
TG	7038	broad.mit.edu	37	8	134125847	134125847	+	Missense_Mutation	SNP	G	T	T	rs146323019		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:134125847G>T	uc003ytw.2	+	44	7795	c.7754G>T	c.(7753-7755)CGG>CTG	p.R2585L	TG_uc010mdw.2_Missense_Mutation_p.R1344L|TG_uc011ljb.1_Missense_Mutation_p.R954L|TG_uc011ljc.1_Missense_Mutation_p.R718L	NM_003235	NP_003226	P01266	THYG_HUMAN	thyroglobulin precursor	2585					hormone biosynthetic process|signal transduction|thyroid gland development|thyroid hormone generation	extracellular space	hormone activity			ovary(8)|breast(4)|pancreas(1)|central_nervous_system(1)|skin(1)	15	Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)	Myeloproliferative disorder(644;0.00878)|Acute lymphoblastic leukemia(644;0.0559)|Breast(495;0.0735)	BRCA - Breast invasive adenocarcinoma(115;0.000701)	KIRC - Kidney renal clear cell carcinoma(542;0.0546)														---	---	---	---	capture		Missense_Mutation	SNP	134125847	134125847	16341	8	G	T	T	39	39	TG	T	1	1
KHDRBS3	10656	broad.mit.edu	37	8	136561104	136561104	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:136561104G>T	uc003yuv.2	+	4	826	c.432G>T	c.(430-432)ATG>ATT	p.M144I	KHDRBS3_uc003yuw.2_Missense_Mutation_p.M144I	NM_006558	NP_006549	O75525	KHDR3_HUMAN	KH domain containing, RNA binding, signal	144					regulation of transcription, DNA-dependent|spermatogenesis|transcription, DNA-dependent	nucleus	SH3 domain binding			ovary(2)	2	all_epithelial(106;2.85e-16)|all_neural(2;2.72e-06)|Lung NSC(106;3.95e-06)|all_lung(105;1.11e-05)|Ovarian(258;0.00579)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.247)															---	---	---	---	capture		Missense_Mutation	SNP	136561104	136561104	8454	8	G	T	T	47	47	KHDRBS3	T	2	2
COL22A1	169044	broad.mit.edu	37	8	139696707	139696707	+	Silent	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139696707G>C	uc003yvd.2	-	39	3420	c.2973C>G	c.(2971-2973)CTC>CTG	p.L991L	COL22A1_uc011ljo.1_Silent_p.L291L	NM_152888	NP_690848	Q8NFW1	COMA1_HUMAN	collagen, type XXII, alpha 1	991	Pro-rich.|Gly-rich.				cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)												HNSCC(7;0.00092)			---	---	---	---	capture		Silent	SNP	139696707	139696707	3819	8	G	C	C	41	41	COL22A1	C	3	3
DENND3	22898	broad.mit.edu	37	8	142146830	142146830	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142146830G>C	uc003yvy.2	+	2	363	c.85G>C	c.(85-87)GAG>CAG	p.E29Q	DENND3_uc003yvw.1_Missense_Mutation_p.E42Q|DENND3_uc003yvx.2_Missense_Mutation_p.E109Q|DENND3_uc010mep.2_Missense_Mutation_p.E42Q	NM_014957	NP_055772	A2RUS2	DEND3_HUMAN	DENN/MADD domain containing 3	29	UDENN.									ovary(1)	1	all_cancers(97;7.36e-15)|all_epithelial(106;2.33e-13)|Lung NSC(106;1.23e-05)|all_lung(105;1.75e-05)|Ovarian(258;0.01)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.105)															---	---	---	---	capture		Missense_Mutation	SNP	142146830	142146830	4611	8	G	C	C	45	45	DENND3	C	3	3
BAI1	575	broad.mit.edu	37	8	143570401	143570401	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:143570401G>A	uc003ywm.2	+	14	2641	c.2458G>A	c.(2458-2460)GAT>AAT	p.D820N		NM_001702	NP_001693	O14514	BAI1_HUMAN	brain-specific angiogenesis inhibitor 1	820	Extracellular (Potential).				axonogenesis|cell adhesion|negative regulation of angiogenesis|negative regulation of cell proliferation|neuropeptide signaling pathway|peripheral nervous system development	cell-cell junction|integral to plasma membrane	G-protein coupled receptor activity|protein binding			lung(3)|ovary(2)|breast(1)|central_nervous_system(1)|pancreas(1)	8	all_cancers(97;2.84e-12)|all_epithelial(106;5.91e-09)|Lung NSC(106;0.000322)|all_lung(105;0.000616)|Medulloblastoma(13;0.00276)|all_neural(13;0.00559)|Ovarian(258;0.0315)|Acute lymphoblastic leukemia(118;0.155)																	---	---	---	---	capture		Missense_Mutation	SNP	143570401	143570401	1319	8	G	A	A	37	37	BAI1	A	1	1
GLI4	2738	broad.mit.edu	37	8	144358654	144358654	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144358654G>A	uc003yxx.2	+	4	896	c.811G>A	c.(811-813)GAG>AAG	p.E271K	ZFP41_uc003yxv.2_RNA	NM_138465	NP_612474	P10075	GLI4_HUMAN	GLI-Kruppel family member GLI4	271	C2H2-type 4.					nucleus	DNA binding|zinc ion binding				0	all_cancers(97;1.01e-10)|all_epithelial(106;4.86e-09)|Lung NSC(106;0.000167)|all_lung(105;0.000459)|Ovarian(258;0.0212)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.156)|Colorectal(110;0.173)															---	---	---	---	capture		Missense_Mutation	SNP	144358654	144358654	6708	8	G	A	A	37	37	GLI4	A	1	1
SCRIB	23513	broad.mit.edu	37	8	144892670	144892670	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144892670C>G	uc003yzp.1	-	13	1516	c.1509G>C	c.(1507-1509)GGG>GGC	p.G503G	SCRIB_uc003yzo.1_Silent_p.G503G	NM_015356	NP_056171	Q14160	SCRIB_HUMAN	scribble isoform b	503	Sufficient for targeting to adherens junction and to inhibit cell proliferation.				activation of Rac GTPase activity|apoptosis involved in morphogenesis|cell migration|cell proliferation|cell-cell adhesion|establishment of apical/basal cell polarity|interspecies interaction between organisms|mammary gland duct morphogenesis|negative regulation of mitotic cell cycle|positive chemotaxis|positive regulation of apoptosis|positive regulation of receptor recycling|protein localization to adherens junction	cell-cell adherens junction|Scrib-APC-beta-catenin complex	protein binding			urinary_tract(1)|ovary(1)|kidney(1)|central_nervous_system(1)|pancreas(1)	5	all_cancers(97;2.31e-11)|all_epithelial(106;1.58e-09)|Lung NSC(106;0.00013)|all_lung(105;0.000374)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;2.46e-41)|Epithelial(56;1.23e-39)|all cancers(56;1.12e-34)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.18)															---	---	---	---	capture		Silent	SNP	144892670	144892670	14419	8	C	G	G	18	18	SCRIB	G	3	3
PPAPDC2	403313	broad.mit.edu	37	9	4663258	4663258	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:4663258C>G	uc003zin.2	+	1	961	c.883C>G	c.(883-885)CGA>GGA	p.R295G	C9orf68_uc003zik.2_Intron|C9orf68_uc003zil.2_Intron|C9orf68_uc010mhj.2_Intron|C9orf68_uc011lly.1_Intron|C9orf68_uc011llz.1_Intron|C9orf68_uc003zim.2_Intron	NM_203453	NP_982278	Q8IY26	PPAC2_HUMAN	phosphatidic acid phosphatase type 2 domain	295						integral to membrane	hydrolase activity				0	all_hematologic(13;0.137)	Breast(48;0.238)		GBM - Glioblastoma multiforme(50;0.026)														---	---	---	---	capture		Missense_Mutation	SNP	4663258	4663258	12725	9	C	G	G	19	19	PPAPDC2	G	3	3
FREM1	158326	broad.mit.edu	37	9	14842506	14842506	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:14842506G>A	uc003zlm.2	-	9	2136	c.1546C>T	c.(1546-1548)CCC>TCC	p.P516S	FREM1_uc010mic.2_RNA	NM_144966	NP_659403	Q5H8C1	FREM1_HUMAN	FRAS1 related extracellular matrix 1 precursor	516	CSPG 3.				cell communication|multicellular organismal development	basement membrane|integral to membrane	metal ion binding|sugar binding			ovary(2)|breast(2)|pancreas(1)	5				GBM - Glioblastoma multiforme(50;3.53e-06)														---	---	---	---	capture		Missense_Mutation	SNP	14842506	14842506	6291	9	G	A	A	42	42	FREM1	A	2	2
FAM154A	158297	broad.mit.edu	37	9	18928832	18928832	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:18928832G>C	uc003zni.1	-	4	921	c.643C>G	c.(643-645)CCC>GCC	p.P215A	FAM154A_uc010mip.1_Missense_Mutation_p.P23A	NM_153707	NP_714918	Q8IYX7	F154A_HUMAN	hypothetical protein LOC158297	215										pancreas(1)	1				GBM - Glioblastoma multiforme(50;6.53e-16)														---	---	---	---	capture		Missense_Mutation	SNP	18928832	18928832	5661	9	G	C	C	43	43	FAM154A	C	3	3
IFNA1	3439	broad.mit.edu	37	9	21440586	21440586	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:21440586C>A	uc003zpd.1	+	1	147	c.80C>A	c.(79-81)CCT>CAT	p.P27H		NM_024013	NP_076918	P01562	IFNA1_HUMAN	interferon, alpha 1 precursor	27					blood coagulation|regulation of type I interferon-mediated signaling pathway|response to virus|type I interferon-mediated signaling pathway	extracellular space	cytokine activity|interferon-alpha/beta receptor binding			ovary(2)	2				Lung(24;7.66e-27)|LUSC - Lung squamous cell carcinoma(38;1.4e-13)|OV - Ovarian serous cystadenocarcinoma(39;0.0173)														---	---	---	---	capture		Missense_Mutation	SNP	21440586	21440586	7832	9	C	A	A	24	24	IFNA1	A	2	2
DNAJB5	25822	broad.mit.edu	37	9	34996700	34996700	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:34996700G>A	uc003zvt.2	+	3	788	c.650G>A	c.(649-651)CGT>CAT	p.R217H	DNAJB5_uc003zvs.2_Missense_Mutation_p.R251H|DNAJB5_uc011los.1_Missense_Mutation_p.R289H	NM_012266	NP_036398	O75953	DNJB5_HUMAN	DnaJ (Hsp40) homolog, subfamily B, member 5	217					protein folding|response to unfolded protein		heat shock protein binding|unfolded protein binding				0			LUSC - Lung squamous cell carcinoma(32;0.00575)															---	---	---	---	capture		Missense_Mutation	SNP	34996700	34996700	4806	9	G	A	A	40	40	DNAJB5	A	1	1
KIAA1539	80256	broad.mit.edu	37	9	35108045	35108045	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35108045G>A	uc003zwl.2	-	3	552	c.227C>T	c.(226-228)CCC>CTC	p.P76L	KIAA1539_uc003zwm.2_Missense_Mutation_p.P76L|KIAA1539_uc003zwn.2_Intron|KIAA1539_uc003zwo.2_Missense_Mutation_p.P76L|KIAA1539_uc003zwp.1_Missense_Mutation_p.P76L|KIAA1539_uc010mkk.1_Intron	NM_025182	NP_079458	Q7L5A3	K1539_HUMAN	hypothetical protein LOC80256	76						nucleus				ovary(2)	2	all_epithelial(49;0.217)		LUSC - Lung squamous cell carcinoma(32;0.00343)|Lung(28;0.00778)															---	---	---	---	capture		Missense_Mutation	SNP	35108045	35108045	8551	9	G	A	A	43	43	KIAA1539	A	2	2
TRPM6	140803	broad.mit.edu	37	9	77455096	77455096	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:77455096C>T	uc004ajl.1	-	5	626	c.388G>A	c.(388-390)GAG>AAG	p.E130K	TRPM6_uc004ajk.1_Missense_Mutation_p.E125K|TRPM6_uc010mpb.1_RNA|TRPM6_uc010mpc.1_Missense_Mutation_p.E130K|TRPM6_uc010mpd.1_Missense_Mutation_p.E130K|TRPM6_uc010mpe.1_Missense_Mutation_p.E130K|TRPM6_uc004ajn.1_Missense_Mutation_p.E130K	NM_017662	NP_060132	Q9BX84	TRPM6_HUMAN	transient receptor potential cation channel,	130	Cytoplasmic (Potential).				response to toxin	integral to membrane	ATP binding|calcium channel activity|metal ion binding|protein binding|protein serine/threonine kinase activity			lung(3)|stomach(2)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|skin(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	77455096	77455096	17141	9	C	T	T	32	32	TRPM6	T	2	2
PCSK5	5125	broad.mit.edu	37	9	78686749	78686749	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:78686749G>T	uc004ajz.2	+	7	1367	c.829G>T	c.(829-831)GAT>TAT	p.D277Y	PCSK5_uc004ajy.2_Missense_Mutation_p.D277Y|PCSK5_uc004aka.2_RNA	NM_006200	NP_006191	Q92824	PCSK5_HUMAN	proprotein convertase subtilisin/kexin type 5	277	Catalytic.				anterior/posterior pattern formation|cell-cell signaling|cytokine biosynthetic process|embryo implantation|embryonic digestive tract development|embryonic skeletal system development|heart development|kidney development|limb morphogenesis|nerve growth factor processing|nerve growth factor receptor signaling pathway|peptide biosynthetic process|renin secretion into blood stream|respiratory tube development|signal peptide processing|viral assembly, maturation, egress, and release	extracellular space|Golgi lumen|stored secretory granule	peptide binding|serine-type endopeptidase activity			ovary(2)|skin(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	78686749	78686749	12024	9	G	T	T	45	45	PCSK5	T	2	2
PRUNE2	158471	broad.mit.edu	37	9	79322998	79322998	+	Nonsense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:79322998C>A	uc010mpk.2	-	8	4316	c.4192G>T	c.(4192-4194)GAG>TAG	p.E1398*		NM_015225	NP_056040	Q8WUY3	PRUN2_HUMAN	prune homolog 2	1398					apoptosis|G1 phase|induction of apoptosis	cytoplasm	metal ion binding|pyrophosphatase activity				0																		---	---	---	---	capture		Nonsense_Mutation	SNP	79322998	79322998	13092	9	C	A	A	32	32	PRUNE2	A	5	2
CEP78	84131	broad.mit.edu	37	9	80856685	80856685	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:80856685G>A	uc004akx.2	+	4	849	c.573G>A	c.(571-573)CAG>CAA	p.Q191Q	CEP78_uc004aky.3_Silent_p.Q191Q|CEP78_uc010mpp.2_Silent_p.Q191Q|CEP78_uc011lsp.1_Silent_p.Q104Q	NM_032171	NP_115547	Q5JTW2	CEP78_HUMAN	centrosomal protein 78kDa isoform b	191					G2/M transition of mitotic cell cycle	centrosome|cytosol				ovary(1)	1																		---	---	---	---	capture		Silent	SNP	80856685	80856685	3395	9	G	A	A	35	35	CEP78	A	2	2
FLJ46321	389763	broad.mit.edu	37	9	84607342	84607342	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:84607342C>G	uc004amn.2	+	4	2004	c.1957C>G	c.(1957-1959)CCA>GCA	p.P653A		NM_001001670	NP_001001670	Q6ZQQ2	F75D1_HUMAN	hypothetical protein LOC389763	653						integral to membrane					0																		---	---	---	---	capture		Missense_Mutation	SNP	84607342	84607342	6174	9	C	G	G	30	30	FLJ46321	G	3	3
AGTPBP1	23287	broad.mit.edu	37	9	88203362	88203362	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88203362C>A	uc011ltd.1	-	20	2787	c.2754G>T	c.(2752-2754)CGG>CGT	p.R918R	AGTPBP1_uc004aod.3_Silent_p.R544R|AGTPBP1_uc011ltc.1_Intron|AGTPBP1_uc010mqc.2_Silent_p.R878R|AGTPBP1_uc011lte.1_Silent_p.R930R	NM_015239	NP_056054	Q9UPW5	CBPC1_HUMAN	ATP/GTP binding protein 1	918					C-terminal protein deglutamylation|cerebellar Purkinje cell differentiation|eye photoreceptor cell differentiation|mitochondrion organization|neuromuscular process|olfactory bulb development|protein side chain deglutamylation|proteolysis	cytosol|mitochondrion|nucleus	metallocarboxypeptidase activity|tubulin binding|zinc ion binding			ovary(4)|large_intestine(2)|skin(1)	7																		---	---	---	---	capture		Silent	SNP	88203362	88203362	403	9	C	A	A	22	22	AGTPBP1	A	2	2
ASPN	54829	broad.mit.edu	37	9	95219630	95219630	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95219630A>G	uc004ase.1	-	8	1327	c.1083T>C	c.(1081-1083)CCT>CCC	p.P361P	CENPP_uc004arz.2_Intron|CENPP_uc010mqx.2_Intron|ASPN_uc010mqy.1_3'UTR	NM_017680	NP_060150	Q9BXN1	ASPN_HUMAN	asporin precursor	361	LRR 11.				bone mineralization|negative regulation of tooth mineralization|negative regulation of transforming growth factor beta receptor signaling pathway	proteinaceous extracellular matrix	calcium ion binding				0																		---	---	---	---	capture		Silent	SNP	95219630	95219630	1076	9	A	G	G	7	7	ASPN	G	4	4
FAM120AOS	158293	broad.mit.edu	37	9	96212824	96212824	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96212824G>A	uc004atu.3	-	2	1504	c.621C>T	c.(619-621)CCC>CCT	p.P207P	FAM120AOS_uc004atm.2_RNA|FAM120AOS_uc004atn.3_RNA|FAM120AOS_uc004ato.3_RNA|FAM120AOS_uc004atp.3_RNA|FAM120AOS_uc004atq.3_RNA|FAM120AOS_uc004atr.3_RNA|FAM120AOS_uc004ats.3_RNA|FAM120AOS_uc004att.3_RNA|FAM120A_uc004atv.2_5'Flank|FAM120A_uc004atw.2_5'Flank	NM_198841	NP_942138	Q5T036	F120S_HUMAN	hypothetical protein LOC158293	207											0																		---	---	---	---	capture		Silent	SNP	96212824	96212824	5613	9	G	A	A	47	47	FAM120AOS	A	2	2
HABP4	22927	broad.mit.edu	37	9	99228025	99228025	+	Silent	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:99228025T>C	uc010msg.2	+	4	856	c.708T>C	c.(706-708)TGT>TGC	p.C236C	HABP4_uc010msh.2_Intron	NM_014282	NP_055097	Q5JVS0	HABP4_HUMAN	hyaluronan binding protein 4	236					platelet activation|platelet degranulation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|extracellular region|nucleus	protein binding			ovary(1)	1		Acute lymphoblastic leukemia(62;0.0169)|all_hematologic(171;0.214)																---	---	---	---	capture		Silent	SNP	99228025	99228025	7221	9	T	C	C	59	59	HABP4	C	4	4
PPP3R2	5535	broad.mit.edu	37	9	104356946	104356946	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:104356946G>A	uc004bbr.2	-	1	338	c.267C>T	c.(265-267)GGC>GGT	p.G89G	GRIN3A_uc004bbp.1_Intron|GRIN3A_uc004bbq.1_Intron|PPP3R2_uc010mtf.1_Intron	NM_147180	NP_671709	Q96LZ3	CANB2_HUMAN	protein phosphatase 3 regulatory subunit B, beta	86							calcium ion binding	p.G89C(1)		ovary(1)|skin(1)	2		Acute lymphoblastic leukemia(62;0.0527)			Cyclosporine(DB00091)													---	---	---	---	capture		Silent	SNP	104356946	104356946	12837	9	G	A	A	38	38	PPP3R2	A	1	1
CYLC2	1539	broad.mit.edu	37	9	105767520	105767520	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:105767520G>T	uc004bbs.2	+	5	677	c.607G>T	c.(607-609)GCA>TCA	p.A203S		NM_001340	NP_001331	Q14093	CYLC2_HUMAN	cylicin 2	203	3 X approximate tandem repeats.|31 X 3 AA repeats of K-K-X.|2.				cell differentiation|multicellular organismal development|spermatogenesis	cytoskeletal calyx	structural constituent of cytoskeleton			skin(1)	1		all_hematologic(171;0.125)																---	---	---	---	capture		Missense_Mutation	SNP	105767520	105767520	4307	9	G	T	T	42	42	CYLC2	T	2	2
OR13D1	286365	broad.mit.edu	37	9	107457200	107457200	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:107457200C>A	uc011lvs.1	+	1	498	c.498C>A	c.(496-498)ATC>ATA	p.I166I		NM_001004484	NP_001004484	Q8NGV5	O13D1_HUMAN	olfactory receptor, family 13, subfamily D,	166	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2																		---	---	---	---	capture		Silent	SNP	107457200	107457200	11346	9	C	A	A	29	29	OR13D1	A	2	2
ABCA1	19	broad.mit.edu	37	9	107576733	107576733	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:107576733C>G	uc004bcl.2	-	26	4075	c.3762G>C	c.(3760-3762)GAG>GAC	p.E1254D		NM_005502	NP_005493	O95477	ABCA1_HUMAN	ATP-binding cassette, sub-family A member 1	1254					Cdc42 protein signal transduction|cellular lipid metabolic process|cholesterol efflux|cholesterol homeostasis|cholesterol metabolic process|endosome transport|G-protein coupled receptor protein signaling pathway|high-density lipoprotein particle assembly|interleukin-1 beta secretion|intracellular cholesterol transport|lysosome organization|negative regulation of cholesterol storage|negative regulation of macrophage derived foam cell differentiation|phospholipid efflux|phospholipid homeostasis|platelet dense granule organization|positive regulation of cAMP biosynthetic process|reverse cholesterol transport	integral to plasma membrane|membrane fraction|membrane raft|phagocytic vesicle	anion transmembrane transporter activity|apolipoprotein A-I receptor activity|ATP binding|ATPase activity|cholesterol transporter activity|phospholipid transporter activity|small GTPase binding|syntaxin-13 binding			large_intestine(4)|lung(4)|ovary(4)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	17				OV - Ovarian serous cystadenocarcinoma(323;0.023)	Adenosine triphosphate(DB00171)|Glibenclamide(DB01016)													---	---	---	---	capture		Missense_Mutation	SNP	107576733	107576733	29	9	C	G	G	32	32	ABCA1	G	3	3
ACTL7A	10881	broad.mit.edu	37	9	111625099	111625099	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:111625099C>T	uc004bdj.1	+	1	497	c.497C>T	c.(496-498)GCG>GTG	p.A166V		NM_006687	NP_006678	Q9Y615	ACL7A_HUMAN	actin-like 7A	166						cytoplasm|cytoskeleton|protein complex	structural constituent of cytoskeleton				0																		---	---	---	---	capture		Missense_Mutation	SNP	111625099	111625099	201	9	C	T	T	27	27	ACTL7A	T	1	1
CTNNAL1	8727	broad.mit.edu	37	9	111741743	111741743	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:111741743G>A	uc004bdo.1	-	7	961	c.919C>T	c.(919-921)CGG>TGG	p.R307W	CTNNAL1_uc010mts.1_Missense_Mutation_p.R43W|CTNNAL1_uc010mtt.1_Missense_Mutation_p.R307W|CTNNAL1_uc004bdp.1_Missense_Mutation_p.R307W	NM_003798	NP_003789	Q9UBT7	CTNL1_HUMAN	catenin, alpha-like 1	307					cell adhesion|Rho protein signal transduction	actin cytoskeleton|cytosol|plasma membrane	cadherin binding|structural molecule activity			ovary(1)	1				STAD - Stomach adenocarcinoma(157;0.0768)														---	---	---	---	capture		Missense_Mutation	SNP	111741743	111741743	4174	9	G	A	A	37	37	CTNNAL1	A	1	1
ASTN2	23245	broad.mit.edu	37	9	119582947	119582947	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:119582947G>T	uc004bjs.1	-	12	2257	c.2156C>A	c.(2155-2157)ACG>AAG	p.T719K	ASTN2_uc004bjr.1_Missense_Mutation_p.T715K|ASTN2_uc004bjt.1_Missense_Mutation_p.T668K	NM_198187	NP_937830	O75129	ASTN2_HUMAN	astrotactin 2 isoform c	719	Extracellular (Potential).|EGF-like 3.					integral to membrane				skin(4)|ovary(3)|breast(1)|kidney(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	119582947	119582947	1084	9	G	T	T	40	40	ASTN2	T	1	1
FAM129B	64855	broad.mit.edu	37	9	130279211	130279211	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130279211C>A	uc004brh.2	-	8	1100	c.898G>T	c.(898-900)GCC>TCC	p.A300S	FAM129B_uc004bri.2_Missense_Mutation_p.A287S|FAM129B_uc004brj.3_Missense_Mutation_p.A300S	NM_022833	NP_073744	Q96TA1	NIBL1_HUMAN	hypothetical protein LOC64855 isoform 1	300							protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	130279211	130279211	5634	9	C	A	A	26	26	FAM129B	A	2	2
FAM129B	64855	broad.mit.edu	37	9	130279214	130279214	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130279214G>C	uc004brh.2	-	8	1097	c.895C>G	c.(895-897)CCG>GCG	p.P299A	FAM129B_uc004bri.2_Missense_Mutation_p.P286A|FAM129B_uc004brj.3_Missense_Mutation_p.P299A	NM_022833	NP_073744	Q96TA1	NIBL1_HUMAN	hypothetical protein LOC64855 isoform 1	299							protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	130279214	130279214	5634	9	G	C	C	42	42	FAM129B	C	3	3
C9orf117	286207	broad.mit.edu	37	9	130473730	130473730	+	Silent	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130473730G>A	uc004brn.1	+	4	850	c.810G>A	c.(808-810)GAG>GAA	p.E270E	PTRH1_uc004brm.2_Intron|C9orf117_uc010mxl.1_RNA	NM_001012502	NP_001012520	Q5JU67	CI117_HUMAN	hypothetical protein LOC286207	270	Potential.										0																		---	---	---	---	capture		Silent	SNP	130473730	130473730	2564	9	G	A	A	33	33	C9orf117	A	2	2
USP20	10868	broad.mit.edu	37	9	132623876	132623876	+	Missense_Mutation	SNP	A	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:132623876A>C	uc004bys.2	+	8	693	c.482A>C	c.(481-483)CAG>CCG	p.Q161P	USP20_uc004byr.2_Missense_Mutation_p.Q161P|USP20_uc004byt.1_Missense_Mutation_p.Q161P	NM_001110303	NP_001103773	Q9Y2K6	UBP20_HUMAN	ubiquitin specific protease 20	161					endocytosis|protein K48-linked deubiquitination|protein K63-linked deubiquitination|regulation of G-protein coupled receptor protein signaling pathway|ubiquitin-dependent protein catabolic process	perinuclear region of cytoplasm	cysteine-type endopeptidase activity|G-protein-coupled receptor binding|ubiquitin thiolesterase activity|zinc ion binding			lung(1)|breast(1)	2		Ovarian(14;0.00556)																---	---	---	---	capture		Missense_Mutation	SNP	132623876	132623876	17615	9	A	C	C	7	7	USP20	C	4	4
NUP214	8021	broad.mit.edu	37	9	134049561	134049561	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134049561G>C	uc004cag.2	+	22	3124	c.3013G>C	c.(3013-3015)GAT>CAT	p.D1005H	NUP214_uc004cah.2_Missense_Mutation_p.D995H|NUP214_uc004cai.2_Missense_Mutation_p.D435H|NUP214_uc004caf.1_Missense_Mutation_p.D994H|NUP214_uc010mzf.2_Missense_Mutation_p.D303H	NM_005085	NP_005076	P35658	NU214_HUMAN	nucleoporin 214kDa	1005	11 X 5 AA approximate repeats.				carbohydrate metabolic process|glucose transport|mRNA metabolic process|protein export from nucleus|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|nuclear pore|nucleoplasm	protein binding			breast(7)|lung(3)|skin(3)|ovary(2)|central_nervous_system(1)	16	all_hematologic(7;0.0028)	Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;3.42e-05)|Epithelial(140;0.000256)				T	DEK|SET|ABL1	AML|T-ALL								---	---	---	---	capture		Missense_Mutation	SNP	134049561	134049561	11167	9	G	C	C	33	33	NUP214	C	3	3
RPL7A	6130	broad.mit.edu	37	9	136216887	136216887	+	Missense_Mutation	SNP	G	C	C	rs11549063		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136216887G>C	uc004cde.1	+	4	425	c.395G>C	c.(394-396)AGA>ACA	p.R132T	MED22_uc004cdc.2_5'Flank|MED22_uc004cdd.2_5'Flank|RPL7A_uc004cdf.1_5'UTR|SNORD36B_uc010nai.1_5'Flank|SNORD36A_uc010naj.2_5'Flank|SNORD36C_uc010nak.2_5'Flank	NM_000972	NP_000963	P62424	RL7A_HUMAN	ribosomal protein L7a	132					endocrine pancreas development|ribosome biogenesis|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit|membrane fraction|polysomal ribosome	RNA binding|structural constituent of ribosome				0				OV - Ovarian serous cystadenocarcinoma(145;4.93e-07)|Epithelial(140;4.09e-06)|all cancers(34;3.78e-05)														---	---	---	---	capture		Missense_Mutation	SNP	136216887	136216887	14079	9	G	C	C	33	33	RPL7A	C	3	3
SNAPC4	6621	broad.mit.edu	37	9	139288772	139288772	+	Nonsense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139288772C>T	uc004chh.2	-	6	570	c.561G>A	c.(559-561)TGG>TGA	p.W187*		NM_003086	NP_003077	Q5SXM2	SNPC4_HUMAN	small nuclear RNA activating complex,	187					snRNA transcription from RNA polymerase II promoter|snRNA transcription from RNA polymerase III promoter	snRNA-activating protein complex	DNA binding|sequence-specific DNA binding transcription factor activity				0		Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;5.31e-06)|Epithelial(140;7.13e-06)														---	---	---	---	capture		Nonsense_Mutation	SNP	139288772	139288772	15337	9	C	T	T	22	22	SNAPC4	T	5	2
FAM166A	401565	broad.mit.edu	37	9	140139971	140139971	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140139971G>A	uc004cmi.1	-	3	365	c.310C>T	c.(310-312)CTC>TTC	p.L104F		NM_001001710	NP_001001710	Q6J272	F166A_HUMAN	hypothetical protein LOC401565	104										ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	140139971	140139971	5685	9	G	A	A	34	34	FAM166A	A	2	2
C9orf173	441476	broad.mit.edu	37	9	140146505	140146505	+	Silent	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140146505C>G	uc004cmk.1	+	3	330	c.318C>G	c.(316-318)ACC>ACG	p.T106T	C9orf173_uc004cmj.1_Silent_p.T107T|C9orf173_uc011meu.1_RNA|C9orf173_uc010ncd.1_Intron|C9orf173_uc011mev.1_Silent_p.T106T|C9orf173_uc004cml.1_Silent_p.T106T			Q8N7X2	CI173_HUMAN	SubName: Full=LOC441476 protein;	107										pancreas(1)	1																		---	---	---	---	capture		Silent	SNP	140146505	140146505	2587	9	C	G	G	21	21	C9orf173	G	3	3
SHOX	6473	broad.mit.edu	37	X	591648	591648	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:591648G>C	uc004cph.1	+	2	707	c.16G>C	c.(16-18)GCT>CCT	p.A6P	SHOX_uc004cpi.2_Missense_Mutation_p.A6P	NM_000451	NP_000442	O15266	SHOX_HUMAN	short stature homeobox isoform SHOXa	6					skeletal system development|transcription from RNA polymerase II promoter	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)																---	---	---	---	capture		Missense_Mutation	SNP	591648	591648	14783	23	G	C	C	42	42	SHOX	C	3	3
MXRA5	25878	broad.mit.edu	37	X	3241309	3241309	+	Missense_Mutation	SNP	T	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:3241309T>G	uc004crg.3	-	5	2574	c.2417A>C	c.(2416-2418)AAA>ACA	p.K806T		NM_015419	NP_056234	Q9NR99	MXRA5_HUMAN	adlican precursor	806						extracellular region				ovary(5)|lung(1)|central_nervous_system(1)|skin(1)	8		all_lung(23;0.00031)|Lung NSC(23;0.000946)																---	---	---	---	capture		Missense_Mutation	SNP	3241309	3241309	10397	23	T	G	G	64	64	MXRA5	G	4	4
SCML2	10389	broad.mit.edu	37	X	18259479	18259479	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:18259479C>A	uc004cyl.2	-	15	2152	c.1995G>T	c.(1993-1995)CTG>CTT	p.L665L	SCML2_uc004cyk.3_RNA|SCML2_uc010nfd.1_3'UTR|SCML2_uc011miz.1_3'UTR|SCML2_uc010nfc.2_3'UTR	NM_006089	NP_006080	Q9UQR0	SCML2_HUMAN	sex comb on midleg-like 2	665	SAM.				anatomical structure morphogenesis	PcG protein complex	DNA binding|sequence-specific DNA binding transcription factor activity				0	Hepatocellular(33;0.183)																	---	---	---	---	capture		Silent	SNP	18259479	18259479	14392	23	C	A	A	17	17	SCML2	A	2	2
GPR64	10149	broad.mit.edu	37	X	19024151	19024151	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:19024151C>G	uc004cyx.2	-	22	1972	c.1808G>C	c.(1807-1809)TGT>TCT	p.C603S	GPR64_uc004cyy.2_Missense_Mutation_p.C600S|GPR64_uc004cyz.2_Missense_Mutation_p.C589S|GPR64_uc004czb.2_Missense_Mutation_p.C603S|GPR64_uc004czc.2_Missense_Mutation_p.C587S|GPR64_uc004czd.2_Missense_Mutation_p.C579S|GPR64_uc004cze.2_Missense_Mutation_p.C573S|GPR64_uc004czf.2_Missense_Mutation_p.C565S|GPR64_uc004cza.2_Missense_Mutation_p.C581S|GPR64_uc004cyw.2_Missense_Mutation_p.C587S|GPR64_uc010nfj.2_Missense_Mutation_p.C484S	NM_001079858	NP_001073327	Q8IZP9	GPR64_HUMAN	G protein-coupled receptor 64 isoform 1	603	GPS.|Extracellular (Potential).				neuropeptide signaling pathway|spermatogenesis	cytoplasm|integral to plasma membrane	G-protein coupled receptor activity				0	Hepatocellular(33;0.183)																	---	---	---	---	capture		Missense_Mutation	SNP	19024151	19024151	6980	23	C	G	G	17	17	GPR64	G	3	3
IL1RAPL1	11141	broad.mit.edu	37	X	29938136	29938136	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:29938136G>A	uc004dby.2	+	8	1490	c.982G>A	c.(982-984)GAC>AAC	p.D328N		NM_014271	NP_055086	Q9NZN1	IRPL1_HUMAN	interleukin 1 receptor accessory protein-like 1	328	Extracellular (Potential).|Ig-like C2-type 3.				innate immune response|negative regulation of calcium ion transport via voltage-gated calcium channel activity|negative regulation of exocytosis|regulation of neuron projection development	cytoplasm|integral to membrane|plasma membrane	protein binding|transmembrane receptor activity			ovary(3)|lung(1)|pancreas(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	29938136	29938136	7962	23	G	A	A	45	45	IL1RAPL1	A	2	2
MAGEB2	4113	broad.mit.edu	37	X	30236723	30236723	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:30236723T>A	uc004dbz.2	+	2	129	c.26T>A	c.(25-27)CTC>CAC	p.L9H		NM_002364	NP_002355	O15479	MAGB2_HUMAN	melanoma antigen family B, 2	9							protein binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	30236723	30236723	9557	23	T	A	A	54	54	MAGEB2	A	4	4
CXorf59	286464	broad.mit.edu	37	X	36117869	36117869	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:36117869C>G	uc004ddk.1	+	7	911	c.725C>G	c.(724-726)TCT>TGT	p.S242C		NM_173695	NP_775966	Q8N9S7	CX059_HUMAN	hypothetical protein LOC286464	242						integral to membrane				central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	36117869	36117869	4279	23	C	G	G	32	32	CXorf59	G	3	3
CASK	8573	broad.mit.edu	37	X	41437649	41437649	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:41437649C>T	uc004dfl.3	-	15	1493	c.1447G>A	c.(1447-1449)GAG>AAG	p.E483K	CASK_uc004dfj.3_Missense_Mutation_p.E46K|CASK_uc004dfk.3_Missense_Mutation_p.E298K|CASK_uc004dfm.3_Missense_Mutation_p.E483K|CASK_uc004dfn.3_Missense_Mutation_p.E477K	NM_003688	NP_003679	O14936	CSKP_HUMAN	calcium/calmodulin-dependent serine protein	483					cell adhesion	actin cytoskeleton|cytoplasm|nucleus|plasma membrane	ATP binding|calmodulin binding|guanylate kinase activity|protein serine/threonine kinase activity			ovary(3)|lung(2)|stomach(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	41437649	41437649	2784	23	C	T	T	30	30	CASK	T	2	2
ZNF41	7592	broad.mit.edu	37	X	47307673	47307673	+	Missense_Mutation	SNP	T	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:47307673T>G	uc004dhs.3	-	4	1689	c.1622A>C	c.(1621-1623)GAA>GCA	p.E541A	ZNF41_uc004dhu.3_Missense_Mutation_p.E533A|ZNF41_uc004dht.3_Missense_Mutation_p.E413A|ZNF41_uc004dhv.3_Missense_Mutation_p.E509A|ZNF41_uc004dhw.3_Missense_Mutation_p.E501A|ZNF41_uc004dhy.3_Missense_Mutation_p.E499A|ZNF41_uc004dhx.3_Missense_Mutation_p.E499A|ZNF41_uc011mlm.1_Missense_Mutation_p.E413A	NM_153380	NP_700359	P51814	ZNF41_HUMAN	zinc finger protein 41	541	C2H2-type 9.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(3)	3		all_lung(315;0.000129)																---	---	---	---	capture		Missense_Mutation	SNP	47307673	47307673	18482	23	T	G	G	62	62	ZNF41	G	4	4
ITIH5L	347365	broad.mit.edu	37	X	54823400	54823400	+	Missense_Mutation	SNP	G	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54823400G>C	uc004dtj.2	-	2	262	c.232C>G	c.(232-234)CTT>GTT	p.L78V		NM_198510	NP_940912	Q6UXX5	ITH5L_HUMAN	inter-alpha (globulin) inhibitor H5-like	78	VIT.				hyaluronan metabolic process	extracellular region	serine-type endopeptidase inhibitor activity			lung(2)|skin(2)|ovary(1)|breast(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	54823400	54823400	8212	23	G	C	C	33	33	ITIH5L	C	3	3
ZC4H2	55906	broad.mit.edu	37	X	64141826	64141826	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:64141826C>A	uc004dvu.2	-	2	184	c.96G>T	c.(94-96)AAG>AAT	p.K32N	ZC4H2_uc004dvv.2_Missense_Mutation_p.K9N|ZC4H2_uc011mov.1_Missense_Mutation_p.K9N|ZC4H2_uc011mow.1_Missense_Mutation_p.K32N|ZC4H2_uc004dvw.1_Missense_Mutation_p.K32N	NM_018684	NP_061154	Q9NQZ6	ZC4H2_HUMAN	zinc finger, C4H2 domain containing	32	Potential.						metal ion binding|protein binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	64141826	64141826	18166	23	C	A	A	24	24	ZC4H2	A	2	2
EFNB1	1947	broad.mit.edu	37	X	68059886	68059886	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:68059886G>T	uc004dxd.3	+	4	1363	c.583G>T	c.(583-585)GCC>TCC	p.A195S	EFNB1_uc004dxe.2_Missense_Mutation_p.A195S	NM_004429	NP_004420	P98172	EFNB1_HUMAN	ephrin-B1 precursor	195	Extracellular (Potential).				cell adhesion|cell-cell signaling	integral to plasma membrane|soluble fraction|synapse	ephrin receptor binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	68059886	68059886	5143	23	G	T	T	42	42	EFNB1	T	2	2
OTUD6A	139562	broad.mit.edu	37	X	69282924	69282924	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:69282924G>T	uc004dxu.1	+	1	584	c.550G>T	c.(550-552)GAG>TAG	p.E184*		NM_207320	NP_997203	Q7L8S5	OTU6A_HUMAN	OTU domain containing 6A	184	OTU.									lung(1)|skin(1)	2																		---	---	---	---	capture		Nonsense_Mutation	SNP	69282924	69282924	11729	23	G	T	T	37	37	OTUD6A	T	5	1
DGAT2L6	347516	broad.mit.edu	37	X	69424174	69424174	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:69424174T>A	uc004dxx.1	+	6	764	c.667T>A	c.(667-669)TAT>AAT	p.Y223N		NM_198512	NP_940914	Q6ZPD8	DG2L6_HUMAN	diacylglycerol O-acyltransferase 2-like 6	223					lipid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	acyltransferase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	69424174	69424174	4638	23	T	A	A	49	49	DGAT2L6	A	4	4
FOXO4	4303	broad.mit.edu	37	X	70321014	70321014	+	Missense_Mutation	SNP	C	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70321014C>G	uc004dys.1	+	2	1287	c.934C>G	c.(934-936)CTC>GTC	p.L312V	FOXO4_uc010nkz.2_Intron|FOXO4_uc004dyt.1_Missense_Mutation_p.L257V	NM_005938	NP_005929	P98177	FOXO4_HUMAN	forkhead box O4	312					cell cycle arrest|cell differentiation|embryo development|G1 phase of mitotic cell cycle|insulin receptor signaling pathway|mitotic cell cycle G2/M transition DNA damage checkpoint|muscle organ development|negative regulation of angiogenesis|negative regulation of cell proliferation|negative regulation of smooth muscle cell differentiation|nerve growth factor receptor signaling pathway|pattern specification process|phosphatidylinositol-mediated signaling|positive regulation of transcription from RNA polymerase II promoter|regulation of sequence-specific DNA binding transcription factor activity|tissue development	cytosol|transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|protein kinase binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding			central_nervous_system(2)|prostate(1)	3	Renal(35;0.156)															OREG0019856	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	70321014	70321014	6271	23	C	G	G	32	32	FOXO4	G	3	3
ATRX	546	broad.mit.edu	37	X	76938926	76938926	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:76938926C>A	uc004ecp.3	-	9	2054	c.1822G>T	c.(1822-1824)GTT>TTT	p.V608F	ATRX_uc004ecq.3_Missense_Mutation_p.V570F|ATRX_uc004eco.3_Missense_Mutation_p.V393F|ATRX_uc004ecr.2_Missense_Mutation_p.V540F|ATRX_uc010nlx.1_Missense_Mutation_p.V579F|ATRX_uc010nly.1_Missense_Mutation_p.V553F	NM_000489	NP_000480	P46100	ATRX_HUMAN	transcriptional regulator ATRX isoform 1	608					DNA methylation|DNA recombination|DNA repair|regulation of transcription, DNA-dependent	nuclear heterochromatin	ATP binding|chromo shadow domain binding|DNA binding|DNA helicase activity|zinc ion binding			haematopoietic_and_lymphoid_tissue(14)|pancreas(12)|lung(1)|breast(1)|skin(1)|kidney(1)	30					Phosphatidylserine(DB00144)			Mis|F|N		Pancreatic neuroendocrine tumors		ATR-X (alpha thalassemia/mental retardation) syndrome						---	---	---	---	capture		Missense_Mutation	SNP	76938926	76938926	1227	23	C	A	A	20	20	ATRX	A	2	2
IL1RAPL2	26280	broad.mit.edu	37	X	104440226	104440226	+	Missense_Mutation	SNP	T	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:104440226T>A	uc004elz.1	+	3	908	c.152T>A	c.(151-153)GTG>GAG	p.V51E		NM_017416	NP_059112	Q9NP60	IRPL2_HUMAN	interleukin 1 receptor accessory protein-like 2	51	Ig-like C2-type 1.|Extracellular (Potential).				central nervous system development|innate immune response	integral to membrane	interleukin-1, Type II, blocking receptor activity			breast(2)|ovary(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	104440226	104440226	7963	23	T	A	A	59	59	IL1RAPL2	A	4	4
GUCY2F	2986	broad.mit.edu	37	X	108636213	108636213	+	Silent	SNP	A	G	G			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:108636213A>G	uc004eod.3	-	13	2772	c.2496T>C	c.(2494-2496)TCT>TCC	p.S832S	GUCY2F_uc011msq.1_RNA	NM_001522	NP_001513	P51841	GUC2F_HUMAN	guanylate cyclase 2F precursor	832	Cytoplasmic (Potential).				intracellular signal transduction|receptor guanylyl cyclase signaling pathway|visual perception	integral to plasma membrane|nuclear outer membrane	ATP binding|GTP binding|guanylate cyclase activity|protein kinase activity|receptor activity			lung(4)|breast(3)|central_nervous_system(1)	8																		---	---	---	---	capture		Silent	SNP	108636213	108636213	7178	23	A	G	G	15	15	GUCY2F	G	4	4
GPC3	2719	broad.mit.edu	37	X	132887889	132887889	+	Nonsense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:132887889G>A	uc004exe.1	-	3	842	c.652C>T	c.(652-654)CAG>TAG	p.Q218*	GPC3_uc004exd.1_Nonsense_Mutation_p.Q90*|GPC3_uc010nrn.1_Nonsense_Mutation_p.Q218*|GPC3_uc011mvh.1_Nonsense_Mutation_p.Q202*|GPC3_uc010nro.1_Nonsense_Mutation_p.Q164*|GPC3_uc010nrp.1_Nonsense_Mutation_p.Q90*	NM_004484	NP_004475	P51654	GPC3_HUMAN	glypican 3 isoform 2 precursor	218						extracellular space|integral to plasma membrane|proteinaceous extracellular matrix	heparan sulfate proteoglycan binding|peptidyl-dipeptidase inhibitor activity			lung(2)|prostate(1)|breast(1)|skin(1)	5	Acute lymphoblastic leukemia(192;0.000127)							T|D|Mis|N|F|S			Wilms tumour			Simpson-Golabi-Behmel_syndrome				---	---	---	---	capture		Nonsense_Mutation	SNP	132887889	132887889	6873	23	G	A	A	47	47	GPC3	A	5	2
MAGEC3	139081	broad.mit.edu	37	X	140983082	140983082	+	Missense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:140983082G>T	uc011mwp.1	+	5	937	c.937G>T	c.(937-939)GAT>TAT	p.D313Y	MAGEC3_uc004fbs.2_5'UTR|MAGEC3_uc010nsj.2_5'Flank	NM_138702	NP_619647	Q8TD91	MAGC3_HUMAN	melanoma antigen family C, 3 isoform 1	313	MAGE 1.									skin(2)|central_nervous_system(1)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---	capture		Missense_Mutation	SNP	140983082	140983082	9563	23	G	T	T	41	41	MAGEC3	T	2	2
MAGEC1	9947	broad.mit.edu	37	X	140995433	140995433	+	Missense_Mutation	SNP	C	T	T	rs149394425		TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:140995433C>T	uc004fbt.2	+	4	2529	c.2243C>T	c.(2242-2244)TCC>TTC	p.S748F	MAGEC1_uc010nsl.1_Intron	NM_005462	NP_005453	O60732	MAGC1_HUMAN	melanoma antigen family C, 1	748							protein binding			ovary(1)|kidney(1)|central_nervous_system(1)|skin(1)	4	Acute lymphoblastic leukemia(192;6.56e-05)														HNSCC(15;0.026)			---	---	---	---	capture		Missense_Mutation	SNP	140995433	140995433	9561	23	C	T	T	30	30	MAGEC1	T	2	2
SPANXN2	494119	broad.mit.edu	37	X	142795489	142795489	+	Missense_Mutation	SNP	T	C	C			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:142795489T>C	uc004fbz.2	-	2	943	c.189A>G	c.(187-189)ATA>ATG	p.I63M		NM_001009615	NP_001009615	Q5MJ10	SPXN2_HUMAN	SPANX-N2 protein	63										ovary(1)	1	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---	capture		Missense_Mutation	SNP	142795489	142795489	15499	23	T	C	C	61	61	SPANXN2	C	4	4
GPR50	9248	broad.mit.edu	37	X	150349889	150349889	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:150349889C>T	uc010ntg.1	+	2	1969	c.1834C>T	c.(1834-1836)CCT>TCT	p.P612S		NM_004224	NP_004215	Q13585	MTR1L_HUMAN	G protein-coupled receptor 50	612	Cytoplasmic (Potential).|Pro-rich.				cell-cell signaling	integral to plasma membrane	melatonin receptor activity			large_intestine(1)|lung(1)|ovary(1)|pancreas(1)	4	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---	capture		Missense_Mutation	SNP	150349889	150349889	6972	23	C	T	T	30	30	GPR50	T	2	2
PASD1	139135	broad.mit.edu	37	X	150842410	150842410	+	Missense_Mutation	SNP	G	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:150842410G>A	uc004fev.3	+	15	2259	c.1927G>A	c.(1927-1929)GAG>AAG	p.E643K		NM_173493	NP_775764	Q8IV76	PASD1_HUMAN	PAS domain containing 1	643						nucleus	signal transducer activity			ovary(3)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---	capture		Missense_Mutation	SNP	150842410	150842410	11888	23	G	A	A	45	45	PASD1	A	2	2
CNGA2	1260	broad.mit.edu	37	X	150908073	150908073	+	Missense_Mutation	SNP	C	A	A	rs144004735	by1000genomes	TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:150908073C>A	uc004fey.1	+	4	467	c.243C>A	c.(241-243)AAC>AAA	p.N81K		NM_005140	NP_005131	Q16280	CNGA2_HUMAN	cyclic nucleotide gated channel alpha 2	81	Cytoplasmic (Potential).				response to stimulus|sensory perception of smell	intracellular cyclic nucleotide activated cation channel complex	cAMP binding|intracellular cAMP activated cation channel activity			breast(3)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---	capture		Missense_Mutation	SNP	150908073	150908073	3735	23	C	A	A	17	17	CNGA2	A	2	2
GABRQ	55879	broad.mit.edu	37	X	151821602	151821602	+	Missense_Mutation	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:151821602C>A	uc004ffp.1	+	9	1777	c.1757C>A	c.(1756-1758)CCT>CAT	p.P586H		NM_018558	NP_061028	Q9UN88	GBRT_HUMAN	gamma-aminobutyric acid (GABA) receptor, theta	586						cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity|neurotransmitter transporter activity			ovary(2)|pancreas(1)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---	capture		Missense_Mutation	SNP	151821602	151821602	6426	23	C	A	A	24	24	GABRQ	A	2	2
PNMA3	29944	broad.mit.edu	37	X	152225749	152225749	+	Nonsense_Mutation	SNP	G	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:152225749G>T	uc004fhc.2	+	2	673	c.337G>T	c.(337-339)GAG>TAG	p.E113*	PNMA5_uc004fha.3_5'Flank|PNMA3_uc004fhd.2_5'Flank	NM_013364	NP_037496	Q9UL41	PNMA3_HUMAN	paraneoplastic cancer-testis-brain antigen	113					apoptosis	nucleolus	nucleic acid binding|zinc ion binding			skin(2)|large_intestine(1)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---	capture		Nonsense_Mutation	SNP	152225749	152225749	12581	23	G	T	T	41	41	PNMA3	T	5	2
FLNA	2316	broad.mit.edu	37	X	153581667	153581667	+	Missense_Mutation	SNP	C	T	T			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153581667C>T	uc004fkk.2	-	37	6268	c.6019G>A	c.(6019-6021)GTG>ATG	p.V2007M	FLNA_uc004fki.2_Missense_Mutation_p.V50M|FLNA_uc011mzn.1_Missense_Mutation_p.V140M|FLNA_uc010nuu.1_Missense_Mutation_p.V1999M	NM_001110556	NP_001104026	P21333	FLNA_HUMAN	filamin A, alpha isoform 2	2007	Filamin 18.				actin crosslink formation|actin cytoskeleton reorganization|cell junction assembly|cytoplasmic sequestering of protein|establishment of protein localization|inhibition of adenylate cyclase activity by dopamine receptor signaling pathway|negative regulation of protein catabolic process|negative regulation of sequence-specific DNA binding transcription factor activity|platelet activation|platelet degranulation|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of transcription factor import into nucleus|protein localization at cell surface|protein stabilization|receptor clustering	cell cortex|cytosol|extracellular region|nucleus|plasma membrane	actin filament binding|Fc-gamma receptor I complex binding|glycoprotein binding|GTP-Ral binding|protein homodimerization activity|Rac GTPase binding|signal transducer activity|transcription factor binding			breast(6)	6	all_cancers(53;3.7e-16)|all_epithelial(53;2.97e-10)|all_lung(58;1.84e-07)|Lung NSC(58;5.84e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)																	---	---	---	---	capture		Missense_Mutation	SNP	153581667	153581667	6175	23	C	T	T	19	19	FLNA	T	1	1
TSPY1	7258	broad.mit.edu	37	Y	9305960	9305960	+	Silent	SNP	C	A	A			TCGA-46-3769-01	TCGA-46-3769-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrY:9305960C>A	uc004frw.3	+	3	662	c.616C>A	c.(616-618)CGG>AGG	p.R206R	TSPY1_uc004frx.3_Silent_p.R206R|TSPY1_uc010nwp.1_Intron	NM_003308	NP_003299	Q01534	TSPY1_HUMAN	testis specific protein, Y-linked 1	206					cell differentiation|cell proliferation|gonadal mesoderm development|nucleosome assembly|spermatogenesis	cytoplasm|nucleus	identical protein binding				0																		---	---	---	---	capture		Silent	SNP	9305960	9305960	17208	24	C	A	A	31	31	TSPY1	A	1	1
