Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	dataset	MUTSIG_Significant_Genes	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	context_orig	context65	gene_name	newbase	categ	categ_ignoring_null_categ
MAPKAPK2	9261	broad.mit.edu	37	1	206858676	206858678	+	In_Frame_Del	DEL	GCC	-	-			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206858676_206858678delGCC	uc001hem.1	+	1	388_390	c.102_104delGCC	c.(100-105)CAGCCG>CAG	p.P40del	MAPKAPK2_uc001hel.1_In_Frame_Del_p.P40del	NM_032960	NP_116584	P49137	MAPK2_HUMAN	mitogen-activated protein kinase-activated	40	Pro-rich.|Poly-Pro.				activation of MAPK activity|hormone biosynthetic process|innate immune response|leukotriene biosynthetic process|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|prostanoid metabolic process|Ras protein signal transduction|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	ATP binding|protein binding|protein serine/threonine kinase activity|signal transducer activity				0	Breast(84;0.183)		BRCA - Breast invasive adenocarcinoma(75;0.211)															---	---	---	---	capture_indel		In_Frame_Del	DEL	206858676	206858678	9672	1	GCC	-	-	34	34	MAPKAPK2	-	5	5
PRDM2	7799	broad.mit.edu	37	1	14109273	14109273	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:14109273G>C	uc001avi.2	+	8	5839	c.4983G>C	c.(4981-4983)TTG>TTC	p.L1661F	PRDM2_uc001avg.2_Intron|PRDM2_uc001avh.2_Missense_Mutation_p.L1661F|PRDM2_uc001avj.2_Intron|PRDM2_uc001avk.2_Missense_Mutation_p.L1460F|PRDM2_uc009voe.2_Intron|PRDM2_uc009vof.2_Intron	NM_012231	NP_036363	Q13029	PRDM2_HUMAN	retinoblastoma protein-binding zinc finger	1661						Golgi apparatus|nucleus	DNA binding|histone-lysine N-methyltransferase activity|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1	Ovarian(185;0.249)	all_lung(284;2.56e-05)|Lung NSC(185;4.94e-05)|Renal(390;0.000147)|Breast(348;0.000162)|Colorectal(325;0.00058)|Ovarian(437;0.00965)|Hepatocellular(190;0.0245)|Myeloproliferative disorder(586;0.0255)	GBM - Glioblastoma multiforme(2;0.00182)	UCEC - Uterine corpus endometrioid carcinoma (279;0.00224)|Colorectal(212;3.23e-08)|BRCA - Breast invasive adenocarcinoma(304;2.16e-05)|COAD - Colon adenocarcinoma(227;2.53e-05)|Kidney(185;0.000762)|KIRC - Kidney renal clear cell carcinoma(229;0.00258)|STAD - Stomach adenocarcinoma(313;0.00446)|READ - Rectum adenocarcinoma(331;0.0276)|Lung(427;0.145)														---	---	---	---	capture		Missense_Mutation	SNP	14109273	14109273	12900	1	G	C	C	45	45	PRDM2	C	3	3
DDI2	84301	broad.mit.edu	37	1	15956921	15956921	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:15956921G>C	uc001awx.1	+	3	466	c.370G>C	c.(370-372)GAA>CAA	p.E124Q	DDI2_uc001aww.2_Missense_Mutation_p.E124Q|DDI2_uc009voj.1_5'UTR	NM_032341	NP_115717	Q5TDH0	DDI2_HUMAN	DNA-damage inducible protein 2	124					proteolysis		aspartic-type endopeptidase activity				0		Colorectal(325;0.00108)|Renal(390;0.00145)|Breast(348;0.00327)|Lung NSC(340;0.00566)|all_lung(284;0.00831)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0798)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;9.03e-07)|COAD - Colon adenocarcinoma(227;4.48e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000133)|KIRC - Kidney renal clear cell carcinoma(229;0.00262)|STAD - Stomach adenocarcinoma(313;0.00773)|READ - Rectum adenocarcinoma(331;0.0656)														---	---	---	---	capture		Missense_Mutation	SNP	15956921	15956921	4500	1	G	C	C	33	33	DDI2	C	3	3
CSMD2	114784	broad.mit.edu	37	1	34190220	34190220	+	Silent	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:34190220C>T	uc001bxn.1	-	18	2690	c.2661G>A	c.(2659-2661)GCG>GCA	p.A887A	CSMD2_uc001bxm.1_Silent_p.A927A	NM_052896	NP_443128	Q7Z408	CSMD2_HUMAN	CUB and Sushi multiple domains 2	887	Sushi 5.|Extracellular (Potential).					integral to membrane|plasma membrane	protein binding			ovary(6)|skin(5)|pancreas(1)	12		Myeloproliferative disorder(586;0.0294)|all_neural(195;0.249)																---	---	---	---	capture		Silent	SNP	34190220	34190220	4086	1	C	T	T	27	27	CSMD2	T	1	1
SYT6	148281	broad.mit.edu	37	1	114680442	114680442	+	Missense_Mutation	SNP	C	T	T	rs139165674	byFrequency	TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:114680442C>T	uc001eev.2	-	3	741	c.491G>A	c.(490-492)CGT>CAT	p.R164H		NM_205848	NP_995320	Q5T7P8	SYT6_HUMAN	synaptotagmin VI	249	Cytoplasmic (Potential).|C2 1.				acrosomal vesicle exocytosis	cell junction|cytosol|integral to membrane|perinuclear endoplasmic reticulum|peripheral to membrane of membrane fraction|synaptic vesicle membrane	clathrin binding|metal ion binding|protein homodimerization activity|syntaxin binding|transporter activity			ovary(3)|central_nervous_system(1)|pancreas(1)	5	Lung SC(450;0.184)	all_cancers(81;4.41e-08)|all_epithelial(167;5.18e-08)|all_lung(203;1.58e-05)|Lung NSC(69;2.82e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---	capture		Missense_Mutation	SNP	114680442	114680442	15999	1	C	T	T	19	19	SYT6	T	1	1
OR10X1	128367	broad.mit.edu	37	1	158549354	158549354	+	Silent	SNP	A	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158549354A>T	uc010pin.1	-	1	336	c.336T>A	c.(334-336)GGT>GGA	p.G112G		NM_001004477	NP_001004477	Q8NGY0	O10X1_HUMAN	olfactory receptor, family 10, subfamily X,	112	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_hematologic(112;0.0378)																	---	---	---	---	capture		Silent	SNP	158549354	158549354	11328	1	A	T	T	2	2	OR10X1	T	4	4
F5	2153	broad.mit.edu	37	1	169511232	169511232	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169511232C>G	uc001ggg.1	-	13	3241	c.3096G>C	c.(3094-3096)AAG>AAC	p.K1032N		NM_000130	NP_000121	P12259	FA5_HUMAN	coagulation factor V precursor	1032	B.				cell adhesion|platelet activation|platelet degranulation	plasma membrane|platelet alpha granule lumen	copper ion binding|oxidoreductase activity			ovary(3)|large_intestine(1)|central_nervous_system(1)|skin(1)	6	all_hematologic(923;0.208)				Drotrecogin alfa(DB00055)													---	---	---	---	capture		Missense_Mutation	SNP	169511232	169511232	5542	1	C	G	G	32	32	F5	G	3	3
RASAL2	9462	broad.mit.edu	37	1	178426894	178426894	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:178426894C>G	uc001glr.2	+	12	2169	c.2044C>G	c.(2044-2046)CAG>GAG	p.Q682E	RASAL2_uc001glq.2_Missense_Mutation_p.Q823E|RASAL2_uc009wxc.2_Missense_Mutation_p.Q196E	NM_004841	NP_004832	Q9UJF2	NGAP_HUMAN	RAS protein activator like 2 isoform 1	682					negative regulation of Ras protein signal transduction|signal transduction	cytoplasm|intrinsic to internal side of plasma membrane	Ras GTPase activator activity			ovary(2)|breast(2)|large_intestine(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	178426894	178426894	13525	1	C	G	G	29	29	RASAL2	G	3	3
FCAMR	83953	broad.mit.edu	37	1	207139122	207139122	+	Missense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207139122C>A	uc001hfa.3	-	4	751	c.251G>T	c.(250-252)CGG>CTG	p.R84L	FCAMR_uc001hfb.2_Missense_Mutation_p.R84L|FCAMR_uc009xca.1_Missense_Mutation_p.R84L|FCAMR_uc001hfc.2_Missense_Mutation_p.R59L	NM_001122980	NP_001116452	Q8WWV6	FCAMR_HUMAN	Fc receptor, IgA, IgM, high affinity isoform 2	39	Extracellular (Potential).					integral to membrane|plasma membrane	receptor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	207139122	207139122	6009	1	C	A	A	23	23	FCAMR	A	1	1
CABC1	56997	broad.mit.edu	37	1	227152766	227152766	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:227152766C>G	uc001hqm.1	+	8	3662	c.243C>G	c.(241-243)TTC>TTG	p.F81L	CABC1_uc010pvp.1_Missense_Mutation_p.F44L|CABC1_uc001hqn.1_Missense_Mutation_p.F81L|CABC1_uc009xeq.1_Missense_Mutation_p.F29L|CABC1_uc010pvq.1_Intron|CABC1_uc010pvr.1_5'Flank	NM_020247	NP_064632	Q8NI60	ADCK3_HUMAN	chaperone, ABC1 activity of bc1 complex like	81					cell death	mitochondrion	ATP binding|protein serine/threonine kinase activity				0		Prostate(94;0.0771)																---	---	---	---	capture		Missense_Mutation	SNP	227152766	227152766	2643	1	C	G	G	32	32	CABC1	G	3	3
HNRNPF	3185	broad.mit.edu	37	10	43882166	43882166	+	Silent	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43882166G>A	uc009xmh.1	-	3	1654	c.1167C>T	c.(1165-1167)TAC>TAT	p.Y389Y	HNRNPF_uc001jar.2_Silent_p.Y389Y|HNRNPF_uc001jas.2_Silent_p.Y389Y|HNRNPF_uc001jat.2_Silent_p.Y389Y|HNRNPF_uc001jav.2_Silent_p.Y389Y|HNRNPF_uc001jau.2_Silent_p.Y389Y|uc010qfa.1_5'UTR	NM_001098208	NP_001091678	P52597	HNRPF_HUMAN	heterogeneous nuclear ribonucleoprotein F	389					regulation of RNA splicing	catalytic step 2 spliceosome|cytoplasm|heterogeneous nuclear ribonucleoprotein complex|nucleoplasm	nucleotide binding|protein binding|single-stranded RNA binding				0																		---	---	---	---	capture		Silent	SNP	43882166	43882166	7557	10	G	A	A	48	48	HNRNPF	A	2	2
PTEN	5728	broad.mit.edu	37	10	89685281	89685281	+	Nonsense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:89685281C>G	uc001kfb.2	+	4	1207	c.176C>G	c.(175-177)TCA>TGA	p.S59*		NM_000314	NP_000305	P60484	PTEN_HUMAN	phosphatase and tensin homolog	59	Phosphatase tensin-type.				activation of mitotic anaphase-promoting complex activity|apoptosis|canonical Wnt receptor signaling pathway|cell proliferation|central nervous system development|induction of apoptosis|inositol phosphate dephosphorylation|negative regulation of cell migration|negative regulation of cyclin-dependent protein kinase activity involved in G1/S|negative regulation of focal adhesion assembly|negative regulation of G1/S transition of mitotic cell cycle|negative regulation of protein kinase B signaling cascade|negative regulation of protein phosphorylation|nerve growth factor receptor signaling pathway|phosphatidylinositol dephosphorylation|phosphatidylinositol-mediated signaling|positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process|positive regulation of sequence-specific DNA binding transcription factor activity|protein stabilization|regulation of neuron projection development|T cell receptor signaling pathway	cytosol|internal side of plasma membrane|PML body	anaphase-promoting complex binding|enzyme binding|inositol-1,3,4,5-tetrakisphosphate 3-phosphatase activity|lipid binding|magnesium ion binding|PDZ domain binding|phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity|phosphatidylinositol-3,4-bisphosphate 3-phosphatase activity|phosphatidylinositol-3-phosphatase activity|protein serine/threonine phosphatase activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity	p.?(4)|p.R55fs*1(4)|p.S59*(4)|p.Y27fs*1(2)|p.Y27_N212>Y(2)|p.S59P(1)|p.R55fs*2(1)|p.S59L(1)|p.V54fs*29(1)|p.R55_L70>S(1)|p.F56fs*2(1)		endometrium(831)|central_nervous_system(657)|skin(121)|haematopoietic_and_lymphoid_tissue(101)|large_intestine(99)|prostate(97)|breast(73)|lung(65)|ovary(58)|thyroid(29)|stomach(29)|upper_aerodigestive_tract(25)|cervix(24)|liver(20)|vulva(17)|kidney(15)|NS(14)|soft_tissue(13)|urinary_tract(12)|eye(8)|pancreas(6)|salivary_gland(5)|bone(5)|biliary_tract(4)|autonomic_ganglia(2)|meninges(2)|testis(1)|oesophagus(1)	2334		all_cancers(4;3.61e-31)|all_epithelial(4;3.96e-23)|Prostate(4;8.12e-23)|Breast(4;0.000111)|Melanoma(5;0.00146)|all_hematologic(4;0.00227)|Colorectal(252;0.00494)|all_neural(4;0.00513)|Acute lymphoblastic leukemia(4;0.0116)|Glioma(4;0.0274)|all_lung(38;0.132)	KIRC - Kidney renal clear cell carcinoma(1;0.214)	UCEC - Uterine corpus endometrioid carcinoma (6;0.000228)|all cancers(1;4.16e-84)|GBM - Glioblastoma multiforme(1;7.77e-49)|Epithelial(1;7.67e-41)|OV - Ovarian serous cystadenocarcinoma(1;6.22e-15)|BRCA - Breast invasive adenocarcinoma(1;1.1e-06)|Lung(2;3.18e-06)|Colorectal(12;4.88e-06)|LUSC - Lung squamous cell carcinoma(2;4.97e-06)|COAD - Colon adenocarcinoma(12;1.13e-05)|Kidney(1;0.000288)|KIRC - Kidney renal clear cell carcinoma(1;0.00037)|STAD - Stomach adenocarcinoma(243;0.218)			31	D|Mis|N|F|S		glioma| prostate|endometrial	harmartoma|glioma| prostate|endometrial			Proteus_syndrome|Cowden_syndrome|Juvenile_Polyposis|Hereditary_Mixed_Polyposis_Syndrome_type_1|Bannayan-Riley-Ruvalcaba_syndrome	HNSCC(9;0.0022)|TCGA GBM(2;<1E-08)|TSP Lung(26;0.18)			---	---	---	---	capture		Nonsense_Mutation	SNP	89685281	89685281	13192	10	C	G	G	29	29	PTEN	G	5	3
CYP2C9	1559	broad.mit.edu	37	10	96745806	96745806	+	Missense_Mutation	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96745806T>C	uc001kka.3	+	8	1191	c.1166T>C	c.(1165-1167)ATT>ACT	p.I389T	CYP2C9_uc009xut.2_Missense_Mutation_p.I387T	NM_000771	NP_000762	P11712	CP2C9_HUMAN	cytochrome P450, family 2, subfamily C,	389					exogenous drug catabolic process|monocarboxylic acid metabolic process|monoterpenoid metabolic process|oxidative demethylation|steroid metabolic process|urea metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	(S)-limonene 6-monooxygenase activity|(S)-limonene 7-monooxygenase activity|4-hydroxyacetophenone monooxygenase activity|caffeine oxidase activity|drug binding|electron carrier activity|heme binding|oxygen binding|steroid hydroxylase activity			skin(4)|ovary(2)	6		Colorectal(252;0.0902)		all cancers(201;6.93e-05)	Acenocoumarol(DB01418)|Alosetron(DB00969)|Amiodarone(DB01118)|Antihemophilic Factor(DB00025)|Aprepitant(DB00673)|Bosentan(DB00559)|Carprofen(DB00821)|Carvedilol(DB01136)|Celecoxib(DB00482)|Clomipramine(DB01242)|Dapsone(DB00250)|Delavirdine(DB00705)|Desloratadine(DB00967)|Desogestrel(DB00304)|Diclofenac(DB00586)|Esomeprazole(DB00736)|Etodolac(DB00749)|Fluconazole(DB00196)|Fluoxetine(DB00472)|Flurbiprofen(DB00712)|Fluvastatin(DB01095)|Fluvoxamine(DB00176)|Formoterol(DB00983)|Gemfibrozil(DB01241)|Ginkgo biloba(DB01381)|Glibenclamide(DB01016)|Glimepiride(DB00222)|Glipizide(DB01067)|Guanfacine(DB01018)|Hydromorphone(DB00327)|Ibuprofen(DB01050)|Imipramine(DB00458)|Irbesartan(DB01029)|Ketoconazole(DB01026)|Lansoprazole(DB00448)|Losartan(DB00678)|Lumiracoxib(DB01283)|Marinol(DB00470)|Mefenamic acid(DB00784)|Meloxicam(DB00814)|Mephenytoin(DB00532)|Metronidazole(DB00916)|Miconazole(DB01110)|Midazolam(DB00683)|Montelukast(DB00471)|Nateglinide(DB00731)|Nelfinavir(DB00220)|Nicardipine(DB00622)|Oxymorphone(DB01192)|Pantoprazole(DB00213)|Paramethadione(DB00617)|Phenprocoumon(DB00946)|Phenytoin(DB00252)|Pravastatin(DB00175)|Quinidine(DB00908)|Ritonavir(DB00503)|Rosiglitazone(DB00412)|Sertraline(DB01104)|Sildenafil(DB00203)|Sulfamethoxazole(DB01015)|Suprofen(DB00870)|Tamoxifen(DB00675)|Tenoxicam(DB00469)|Terfenadine(DB00342)|Tolbutamide(DB01124)|Torasemide(DB00214)|Troleandomycin(DB01361)|Valdecoxib(DB00580)|Valsartan(DB00177)|Voriconazole(DB00582)|Warfarin(DB00682)|Zafirlukast(DB00549)|Zileuton(DB00744)													---	---	---	---	capture		Missense_Mutation	SNP	96745806	96745806	4333	10	T	C	C	52	52	CYP2C9	C	4	4
CYP2C9	1559	broad.mit.edu	37	10	96745813	96745813	+	Silent	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96745813G>C	uc001kka.3	+	8	1198	c.1173G>C	c.(1171-1173)CTG>CTC	p.L391L	CYP2C9_uc009xut.2_Silent_p.L389L	NM_000771	NP_000762	P11712	CP2C9_HUMAN	cytochrome P450, family 2, subfamily C,	391					exogenous drug catabolic process|monocarboxylic acid metabolic process|monoterpenoid metabolic process|oxidative demethylation|steroid metabolic process|urea metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	(S)-limonene 6-monooxygenase activity|(S)-limonene 7-monooxygenase activity|4-hydroxyacetophenone monooxygenase activity|caffeine oxidase activity|drug binding|electron carrier activity|heme binding|oxygen binding|steroid hydroxylase activity			skin(4)|ovary(2)	6		Colorectal(252;0.0902)		all cancers(201;6.93e-05)	Acenocoumarol(DB01418)|Alosetron(DB00969)|Amiodarone(DB01118)|Antihemophilic Factor(DB00025)|Aprepitant(DB00673)|Bosentan(DB00559)|Carprofen(DB00821)|Carvedilol(DB01136)|Celecoxib(DB00482)|Clomipramine(DB01242)|Dapsone(DB00250)|Delavirdine(DB00705)|Desloratadine(DB00967)|Desogestrel(DB00304)|Diclofenac(DB00586)|Esomeprazole(DB00736)|Etodolac(DB00749)|Fluconazole(DB00196)|Fluoxetine(DB00472)|Flurbiprofen(DB00712)|Fluvastatin(DB01095)|Fluvoxamine(DB00176)|Formoterol(DB00983)|Gemfibrozil(DB01241)|Ginkgo biloba(DB01381)|Glibenclamide(DB01016)|Glimepiride(DB00222)|Glipizide(DB01067)|Guanfacine(DB01018)|Hydromorphone(DB00327)|Ibuprofen(DB01050)|Imipramine(DB00458)|Irbesartan(DB01029)|Ketoconazole(DB01026)|Lansoprazole(DB00448)|Losartan(DB00678)|Lumiracoxib(DB01283)|Marinol(DB00470)|Mefenamic acid(DB00784)|Meloxicam(DB00814)|Mephenytoin(DB00532)|Metronidazole(DB00916)|Miconazole(DB01110)|Midazolam(DB00683)|Montelukast(DB00471)|Nateglinide(DB00731)|Nelfinavir(DB00220)|Nicardipine(DB00622)|Oxymorphone(DB01192)|Pantoprazole(DB00213)|Paramethadione(DB00617)|Phenprocoumon(DB00946)|Phenytoin(DB00252)|Pravastatin(DB00175)|Quinidine(DB00908)|Ritonavir(DB00503)|Rosiglitazone(DB00412)|Sertraline(DB01104)|Sildenafil(DB00203)|Sulfamethoxazole(DB01015)|Suprofen(DB00870)|Tamoxifen(DB00675)|Tenoxicam(DB00469)|Terfenadine(DB00342)|Tolbutamide(DB01124)|Torasemide(DB00214)|Troleandomycin(DB01361)|Valdecoxib(DB00580)|Valsartan(DB00177)|Voriconazole(DB00582)|Warfarin(DB00682)|Zafirlukast(DB00549)|Zileuton(DB00744)													---	---	---	---	capture		Silent	SNP	96745813	96745813	4333	10	G	C	C	45	45	CYP2C9	C	3	3
TRPM5	29850	broad.mit.edu	37	11	2435351	2435351	+	Silent	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:2435351G>T	uc001lwm.3	-	12	1839	c.1830C>A	c.(1828-1830)ACC>ACA	p.T610T	TRPM5_uc010qxl.1_Silent_p.T610T|TRPM5_uc009ydn.2_Silent_p.T612T	NM_014555	NP_055370	Q9NZQ8	TRPM5_HUMAN	transient receptor potential cation channel,	610	Cytoplasmic (Potential).					integral to membrane|plasma membrane	receptor activity|voltage-gated ion channel activity			ovary(1)|breast(1)|central_nervous_system(1)|skin(1)	4		Medulloblastoma(188;0.0049)|Breast(177;0.00586)|all_epithelial(84;0.0075)|Ovarian(85;0.0256)|all_neural(188;0.0311)		BRCA - Breast invasive adenocarcinoma(625;0.00147)|LUSC - Lung squamous cell carcinoma(625;0.191)														---	---	---	---	capture		Silent	SNP	2435351	2435351	17140	11	G	T	T	35	35	TRPM5	T	2	2
LDLRAD3	143458	broad.mit.edu	37	11	36248918	36248918	+	Silent	SNP	G	A	A	rs146712517		TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:36248918G>A	uc001mwk.1	+	5	775	c.738G>A	c.(736-738)GCG>GCA	p.A246A	LDLRAD3_uc010rey.1_Silent_p.A197A|LDLRAD3_uc010rez.1_Silent_p.A125A|LDLRAD3_uc010rfa.1_Intron	NM_174902	NP_777562	Q86YD5	LRAD3_HUMAN	low density lipoprotein receptor class A domain	246	Cytoplasmic (Potential).					integral to membrane	receptor activity			central_nervous_system(1)	1	all_lung(20;0.089)|Lung NSC(22;0.175)|all_epithelial(35;0.177)	all_hematologic(20;0.124)																---	---	---	---	capture		Silent	SNP	36248918	36248918	9031	11	G	A	A	39	39	LDLRAD3	A	1	1
OR5D18	219438	broad.mit.edu	37	11	55587196	55587196	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55587196G>T	uc010rin.1	+	1	91	c.91G>T	c.(91-93)GTT>TTT	p.V31F		NM_001001952	NP_001001952	Q8NGL1	OR5DI_HUMAN	olfactory receptor, family 5, subfamily D,	31	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)	3		all_epithelial(135;0.208)																---	---	---	---	capture		Missense_Mutation	SNP	55587196	55587196	11567	11	G	T	T	44	44	OR5D18	T	2	2
OR5I1	10798	broad.mit.edu	37	11	55703274	55703274	+	Silent	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55703274G>T	uc010ris.1	-	1	603	c.603C>A	c.(601-603)CTC>CTA	p.L201L		NM_006637	NP_006628	Q13606	OR5I1_HUMAN	olfactory receptor, family 5, subfamily I,	201	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	55703274	55703274	11574	11	G	T	T	33	33	OR5I1	T	2	2
THRSP	7069	broad.mit.edu	37	11	77775039	77775039	+	Missense_Mutation	SNP	C	T	T	rs147579530		TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:77775039C>T	uc001oyx.2	+	1	133	c.112C>T	c.(112-114)CGG>TGG	p.R38W		NM_003251	NP_003242	Q92748	THRSP_HUMAN	thyroid hormone-responsive protein	38					lipid biosynthetic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|nucleus				breast(1)	1	all_cancers(14;2.23e-19)|all_epithelial(13;7.49e-22)|Breast(9;6.38e-17)|Ovarian(111;0.152)		OV - Ovarian serous cystadenocarcinoma(8;2.15e-25)															---	---	---	---	capture		Missense_Mutation	SNP	77775039	77775039	16404	11	C	T	T	27	27	THRSP	T	1	1
IQSEC3	440073	broad.mit.edu	37	12	274629	274629	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:274629C>G	uc001qhw.1	+	7	1836	c.1830C>G	c.(1828-1830)AGC>AGG	p.S610R	IQSEC3_uc001qhu.1_Missense_Mutation_p.S610R	NM_015232	NP_056047	Q9UPP2	IQEC3_HUMAN	IQ motif and Sec7 domain 3	913	PH.				regulation of ARF protein signal transduction	cytoplasm	ARF guanyl-nucleotide exchange factor activity			central_nervous_system(2)|large_intestine(1)|skin(1)	4	all_cancers(10;0.016)|all_lung(10;0.0222)|all_epithelial(11;0.0262)|Lung NSC(10;0.031)		OV - Ovarian serous cystadenocarcinoma(31;0.00456)	LUAD - Lung adenocarcinoma(1;0.172)|Lung(1;0.179)														---	---	---	---	capture		Missense_Mutation	SNP	274629	274629	8122	12	C	G	G	28	28	IQSEC3	G	3	3
TULP3	7289	broad.mit.edu	37	12	3043692	3043692	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:3043692G>A	uc010seh.1	+	8	970	c.889G>A	c.(889-891)GCC>ACC	p.A297T	TULP3_uc010sef.1_RNA|TULP3_uc009zec.1_Missense_Mutation_p.A24T|TULP3_uc010seg.1_RNA|TULP3_uc001qlj.2_Missense_Mutation_p.A297T|TULP3_uc010sei.1_Missense_Mutation_p.A154T	NM_003324	NP_003315	O75386	TULP3_HUMAN	tubby like protein 3 isoform 1	297					G-protein coupled receptor protein signaling pathway|regulation of transcription, DNA-dependent	cytoplasm|extracellular region|nucleus|plasma membrane	phosphatidylinositol-4,5-bisphosphate binding				0			OV - Ovarian serous cystadenocarcinoma(31;0.000818)															---	---	---	---	capture		Missense_Mutation	SNP	3043692	3043692	17330	12	G	A	A	42	42	TULP3	A	2	2
NOP2	4839	broad.mit.edu	37	12	6669272	6669272	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6669272G>C	uc001qph.1	-	15	1949	c.1769C>G	c.(1768-1770)TCC>TGC	p.S590C	NOP2_uc009zeq.1_Missense_Mutation_p.S306C|NOP2_uc001qpi.1_Missense_Mutation_p.S590C|NOP2_uc001qpj.1_Missense_Mutation_p.S19C	NM_001033714	NP_001028886	P46087	NOP2_HUMAN	nucleolar protein 1, 120kDa	594					positive regulation of cell proliferation|rRNA processing	nucleolus	protein binding|RNA binding|S-adenosylmethionine-dependent methyltransferase activity			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	6669272	6669272	10941	12	G	C	C	41	41	NOP2	C	3	3
C1S	716	broad.mit.edu	37	12	7177174	7177174	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7177174G>A	uc001qsj.2	+	15	2005	c.1286G>A	c.(1285-1287)AGA>AAA	p.R429K	C1S_uc001qsk.2_Missense_Mutation_p.R429K|C1S_uc001qsl.2_Missense_Mutation_p.R429K|C1S_uc009zfr.2_Missense_Mutation_p.R262K|C1S_uc009zfs.2_RNA	NM_201442	NP_958850	P09871	C1S_HUMAN	complement component 1, s subcomponent	429					complement activation, classical pathway|innate immune response|proteolysis	extracellular region	calcium ion binding|serine-type endopeptidase activity			skin(1)	1					Abciximab(DB00054)|Adalimumab(DB00051)|Basiliximab(DB00074)|Cetuximab(DB00002)|Etanercept(DB00005)|Gemtuzumab ozogamicin(DB00056)|Ibritumomab(DB00078)|Immune globulin(DB00028)|Muromonab(DB00075)|Rituximab(DB00073)|Trastuzumab(DB00072)													---	---	---	---	capture		Missense_Mutation	SNP	7177174	7177174	2041	12	G	A	A	33	33	C1S	A	2	2
LRP6	4040	broad.mit.edu	37	12	12311774	12311774	+	Missense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12311774C>A	uc001rah.3	-	12	2922	c.2780G>T	c.(2779-2781)AGG>ATG	p.R927M	BCL2L14_uc001raf.1_Intron|LRP6_uc010shl.1_Missense_Mutation_p.R927M	NM_002336	NP_002327	O75581	LRP6_HUMAN	low density lipoprotein receptor-related protein	927	Extracellular (Potential).|EGF-like 3.				cellular response to cholesterol|negative regulation of protein phosphorylation|negative regulation of protein serine/threonine kinase activity|negative regulation of smooth muscle cell apoptosis|neural crest formation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of cell cycle|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|positive regulation of Wnt receptor signaling pathway involved in dorsal/ventral axis specification|Wnt receptor signaling pathway involved in dorsal/ventral axis specification	cell surface|cytoplasmic vesicle|endoplasmic reticulum|integral to membrane|plasma membrane	coreceptor activity|frizzled binding|kinase inhibitor activity|low-density lipoprotein receptor activity|protein homodimerization activity|toxin transporter activity|Wnt-protein binding			lung(4)|skin(4)|ovary(2)|kidney(1)|central_nervous_system(1)	12		Prostate(47;0.0865)																---	---	---	---	capture		Missense_Mutation	SNP	12311774	12311774	9335	12	C	A	A	24	24	LRP6	A	2	2
ATF7IP	55729	broad.mit.edu	37	12	14613896	14613896	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14613896C>T	uc001rbw.2	+	9	2784	c.2626C>T	c.(2626-2628)CCA>TCA	p.P876S	ATF7IP_uc010shs.1_3'UTR|ATF7IP_uc001rbu.2_Missense_Mutation_p.P876S|ATF7IP_uc001rbv.1_Missense_Mutation_p.P875S|ATF7IP_uc001rbx.2_Missense_Mutation_p.P875S|ATF7IP_uc010sht.1_3'UTR|ATF7IP_uc001rby.3_Missense_Mutation_p.P876S|ATF7IP_uc001rca.2_Missense_Mutation_p.P876S	NM_018179	NP_060649	Q6VMQ6	MCAF1_HUMAN	activating transcription factor 7 interacting	876					DNA methylation|interspecies interaction between organisms|positive regulation of transcription, DNA-dependent|regulation of RNA polymerase II transcriptional preinitiation complex assembly|transcription, DNA-dependent		protein binding			lung(3)|ovary(1)|skin(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	14613896	14613896	1106	12	C	T	T	30	30	ATF7IP	T	2	2
ABCD2	225	broad.mit.edu	37	12	39947745	39947745	+	Missense_Mutation	SNP	T	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:39947745T>G	uc001rmb.2	-	10	2618	c.2192A>C	c.(2191-2193)AAA>ACA	p.K731T		NM_005164	NP_005155	Q9UBJ2	ABCD2_HUMAN	ATP-binding cassette, sub-family D, member 2	731					fatty acid metabolic process|transport	ATP-binding cassette (ABC) transporter complex|integral to plasma membrane|peroxisomal membrane	ATP binding|ATPase activity|protein binding			ovary(2)|upper_aerodigestive_tract(1)|pancreas(1)|central_nervous_system(1)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	39947745	39947745	62	12	T	G	G	64	64	ABCD2	G	4	4
MLL2	8085	broad.mit.edu	37	12	49437450	49437450	+	Nonsense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49437450G>C	uc001rta.3	-	23	5435	c.5435C>G	c.(5434-5436)TCA>TGA	p.S1812*		NM_003482	NP_003473	O14686	MLL2_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 2	1812					chromatin silencing|histone H3-K4 methylation|oocyte growth|positive regulation of cell proliferation|positive regulation of estrogen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|response to estrogen stimulus|transcription, DNA-dependent	histone methyltransferase complex	histone-lysine N-methyltransferase activity|protein binding|transcription regulatory region DNA binding|zinc ion binding			kidney(16)|central_nervous_system(12)|lung(4)|skin(4)|ovary(3)|pancreas(2)	41								N|F|Mis		medulloblastoma|renal					HNSCC(34;0.089)	OREG0021780	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Nonsense_Mutation	SNP	49437450	49437450	10011	12	G	C	C	45	45	MLL2	C	5	3
CALCOCO1	57658	broad.mit.edu	37	12	54109071	54109071	+	Missense_Mutation	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54109071T>C	uc001sef.2	-	10	1443	c.1299A>G	c.(1297-1299)ATA>ATG	p.I433M	CALCOCO1_uc001see.2_5'Flank|CALCOCO1_uc010som.1_Missense_Mutation_p.I348M|CALCOCO1_uc010son.1_Missense_Mutation_p.I310M|CALCOCO1_uc001seh.2_Missense_Mutation_p.I433M|CALCOCO1_uc009znd.2_Missense_Mutation_p.I433M|CALCOCO1_uc001seg.2_Missense_Mutation_p.I258M|CALCOCO1_uc010soo.1_Missense_Mutation_p.I426M	NM_020898	NP_065949	Q9P1Z2	CACO1_HUMAN	coiled-coil transcriptional coactivator isoform	433	Potential.				steroid hormone receptor signaling pathway|transcription, DNA-dependent|Wnt receptor signaling pathway	cytoplasm	armadillo repeat domain binding|beta-catenin binding|ligand-dependent nuclear receptor transcription coactivator activity|protein C-terminus binding|sequence-specific DNA binding|transcription regulatory region DNA binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	54109071	54109071	2693	12	T	C	C	57	57	CALCOCO1	C	4	4
LRRIQ1	84125	broad.mit.edu	37	12	85547826	85547826	+	Silent	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:85547826G>A	uc001tac.2	+	23	4785	c.4674G>A	c.(4672-4674)TTG>TTA	p.L1558L		NM_001079910	NP_001073379	Q96JM4	LRIQ1_HUMAN	leucine-rich repeats and IQ motif containing 1	1558										ovary(4)|central_nervous_system(1)|skin(1)	6				GBM - Glioblastoma multiforme(134;0.212)														---	---	---	---	capture		Silent	SNP	85547826	85547826	9405	12	G	A	A	45	45	LRRIQ1	A	2	2
ACACB	32	broad.mit.edu	37	12	109654654	109654654	+	Missense_Mutation	SNP	T	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109654654T>A	uc001tob.2	+	24	3612	c.3493T>A	c.(3493-3495)TCC>ACC	p.S1165T	ACACB_uc001toc.2_Missense_Mutation_p.S1165T	NM_001093	NP_001084	O00763	ACACB_HUMAN	acetyl-Coenzyme A carboxylase beta	1165					acetyl-CoA metabolic process|carnitine shuttle|energy reserve metabolic process|fatty acid biosynthetic process|positive regulation of cellular metabolic process|protein homotetramerization|regulation of fatty acid oxidation	cytosol|endomembrane system|Golgi apparatus|membrane	acetyl-CoA carboxylase activity|ATP binding|biotin carboxylase activity|metal ion binding|protein binding			ovary(5)|upper_aerodigestive_tract(1)|pancreas(1)|skin(1)	8					Biotin(DB00121)													---	---	---	---	capture		Missense_Mutation	SNP	109654654	109654654	108	12	T	A	A	58	58	ACACB	A	4	4
HSPB8	26353	broad.mit.edu	37	12	119617441	119617441	+	Silent	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:119617441G>A	uc001txb.2	+	1	847	c.324G>A	c.(322-324)GAG>GAA	p.E108E	HSPB8_uc001txc.2_Silent_p.E108E	NM_014365	NP_055180	Q9UJY1	HSPB8_HUMAN	heat shock 22kDa protein 8	108					cell death|response to heat	cytoplasm|nucleus	identical protein binding|protein serine/threonine kinase activity			central_nervous_system(1)|skin(1)	2	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---	capture		Silent	SNP	119617441	119617441	7723	12	G	A	A	35	35	HSPB8	A	2	2
USPL1	10208	broad.mit.edu	37	13	31231868	31231868	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:31231868G>C	uc001utc.2	+	9	2086	c.1654G>C	c.(1654-1656)GAT>CAT	p.D552H	USPL1_uc001utd.2_Missense_Mutation_p.D223H|USPL1_uc001ute.1_Missense_Mutation_p.D223H	NM_005800	NP_005791	Q5W0Q7	USPL1_HUMAN	ubiquitin specific peptidase like 1	552					ubiquitin-dependent protein catabolic process		ubiquitin thiolesterase activity			pancreas(2)|skin(1)	3		Lung SC(185;0.0257)|Breast(139;0.203)		all cancers(112;0.0306)|Epithelial(112;0.131)|OV - Ovarian serous cystadenocarcinoma(117;0.134)														---	---	---	---	capture		Missense_Mutation	SNP	31231868	31231868	17656	13	G	C	C	33	33	USPL1	C	3	3
TPP2	7174	broad.mit.edu	37	13	103275340	103275340	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:103275340C>T	uc001vpi.3	+	6	837	c.734C>T	c.(733-735)TCC>TTC	p.S245F		NM_003291	NP_003282	P29144	TPP2_HUMAN	tripeptidyl peptidase II	245					proteolysis	cytoplasm|nucleus	aminopeptidase activity|serine-type endopeptidase activity|tripeptidyl-peptidase activity			upper_aerodigestive_tract(1)|ovary(1)	2	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---	capture		Missense_Mutation	SNP	103275340	103275340	16956	13	C	T	T	30	30	TPP2	T	2	2
ACIN1	22985	broad.mit.edu	37	14	23549781	23549781	+	Silent	SNP	T	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23549781T>G	uc001wit.3	-	6	1265	c.937A>C	c.(937-939)AGA>CGA	p.R313R	ACIN1_uc001wis.3_5'UTR|ACIN1_uc010akg.2_Silent_p.R313R|ACIN1_uc010tnj.1_Silent_p.R273R	NM_014977	NP_055792	Q9UKV3	ACINU_HUMAN	apoptotic chromatin condensation inducer 1	313	Glu-rich.				apoptotic chromosome condensation|erythrocyte differentiation|positive regulation of monocyte differentiation	cytosol	ATPase activity|enzyme binding|nucleic acid binding|nucleotide binding			ovary(2)|large_intestine(1)|skin(1)	4	all_cancers(95;1.36e-05)			GBM - Glioblastoma multiforme(265;0.00816)														---	---	---	---	capture		Silent	SNP	23549781	23549781	143	14	T	G	G	53	53	ACIN1	G	4	4
STRN3	29966	broad.mit.edu	37	14	31382827	31382827	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31382827G>A	uc001wqu.2	-	10	1493	c.1277C>T	c.(1276-1278)TCA>TTA	p.S426L	STRN3_uc001wqv.2_Missense_Mutation_p.S342L|STRN3_uc010tpj.1_Intron	NM_001083893	NP_001077362	Q13033	STRN3_HUMAN	nuclear autoantigen isoform 1	426					negative regulation of estrogen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|response to estradiol stimulus	cytoplasm|dendrite|Golgi apparatus|neuronal cell body|nucleoplasm|nucleus|plasma membrane|protein complex	armadillo repeat domain binding|calmodulin binding|protein complex binding|protein phosphatase 2A binding|sequence-specific DNA binding transcription factor activity				0	Hepatocellular(127;0.0877)|Breast(36;0.148)		LUAD - Lung adenocarcinoma(48;0.00192)|Lung(238;0.0119)|BRCA - Breast invasive adenocarcinoma(188;0.0805)	GBM - Glioblastoma multiforme(265;0.0124)														---	---	---	---	capture		Missense_Mutation	SNP	31382827	31382827	15850	14	G	A	A	45	45	STRN3	A	2	2
FUT8	2530	broad.mit.edu	37	14	66136158	66136158	+	Silent	SNP	A	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:66136158A>T	uc001xin.2	+	7	1992	c.795A>T	c.(793-795)ACA>ACT	p.T265T	FUT8_uc001xio.2_Silent_p.T265T|FUT8_uc010tsp.1_Silent_p.T102T|FUT8_uc001xir.3_RNA|FUT8_uc001xip.2_Silent_p.T265T|FUT8_uc001xiq.2_Silent_p.T136T|FUT8_uc001xis.2_Missense_Mutation_p.M1L	NM_178155	NP_835368	Q9BYC5	FUT8_HUMAN	fucosyltransferase 8 isoform a	265	Lumenal (Potential).				in utero embryonic development|L-fucose catabolic process|N-glycan processing|oligosaccharide biosynthetic process|post-translational protein modification|protein glycosylation in Golgi|protein N-linked glycosylation via asparagine	Golgi cisterna membrane|integral to membrane	glycoprotein 6-alpha-L-fucosyltransferase activity|SH3 domain binding			ovary(1)	1				all cancers(60;0.00109)|OV - Ovarian serous cystadenocarcinoma(108;0.00242)|BRCA - Breast invasive adenocarcinoma(234;0.0114)														---	---	---	---	capture		Silent	SNP	66136158	66136158	6361	14	A	T	T	8	8	FUT8	T	4	4
GABRB3	2562	broad.mit.edu	37	15	26825481	26825481	+	Missense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:26825481C>A	uc001zaz.2	-	6	809	c.667G>T	c.(667-669)GTT>TTT	p.V223F	GABRB3_uc010uae.1_Missense_Mutation_p.V138F|GABRB3_uc001zba.2_Missense_Mutation_p.V223F|GABRB3_uc001zbb.2_Missense_Mutation_p.V279F	NM_000814	NP_000805	P28472	GBRB3_HUMAN	gamma-aminobutyric acid (GABA) A receptor, beta	223	Extracellular (Probable).				synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			upper_aerodigestive_tract(1)|ovary(1)|lung(1)|liver(1)|central_nervous_system(1)	5		all_cancers(20;1.89e-22)|all_lung(180;6.35e-15)|Breast(32;0.000279)|Colorectal(260;0.232)		all cancers(64;1.46e-07)|Epithelial(43;2.89e-07)|BRCA - Breast invasive adenocarcinoma(123;0.0251)|COAD - Colon adenocarcinoma(236;0.235)|Lung(196;0.243)	Ethchlorvynol(DB00189)|Flurazepam(DB00690)|Lorazepam(DB00186)|Midazolam(DB00683)													---	---	---	---	capture		Missense_Mutation	SNP	26825481	26825481	6419	15	C	A	A	17	17	GABRB3	A	2	2
ARHGAP11A	9824	broad.mit.edu	37	15	32929036	32929036	+	Missense_Mutation	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:32929036A>G	uc001zgy.1	+	12	2784	c.2062A>G	c.(2062-2064)ATA>GTA	p.I688V	ARHGAP11A_uc010ubw.1_Missense_Mutation_p.I499V|ARHGAP11A_uc010ubx.1_Missense_Mutation_p.I499V	NM_014783	NP_055598	Q6P4F7	RHGBA_HUMAN	Rho GTPase activating protein 11A isoform 1	688					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			skin(3)|breast(2)|urinary_tract(1)	6		all_lung(180;1.3e-11)		all cancers(64;3.34e-21)|Epithelial(43;2.64e-15)|GBM - Glioblastoma multiforme(186;5.17e-06)|BRCA - Breast invasive adenocarcinoma(123;0.00112)|Lung(196;0.227)														---	---	---	---	capture		Missense_Mutation	SNP	32929036	32929036	874	15	A	G	G	16	16	ARHGAP11A	G	4	4
AKAP13	11214	broad.mit.edu	37	15	86122914	86122914	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:86122914G>A	uc002blv.1	+	7	1785	c.1615G>A	c.(1615-1617)GCT>ACT	p.A539T	AKAP13_uc002blt.1_Missense_Mutation_p.A539T|AKAP13_uc002blu.1_Missense_Mutation_p.A539T	NM_007200	NP_009131	Q12802	AKP13_HUMAN	A-kinase anchor protein 13 isoform 2	539					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|membrane|membrane fraction|nucleus	cAMP-dependent protein kinase activity|metal ion binding|protein binding|Rho guanyl-nucleotide exchange factor activity|signal transducer activity			central_nervous_system(3)|kidney(2)|urinary_tract(1)|liver(1)|skin(1)|ovary(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	86122914	86122914	452	15	G	A	A	46	46	AKAP13	A	2	2
RHCG	51458	broad.mit.edu	37	15	90030051	90030051	+	Missense_Mutation	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:90030051T>C	uc002bnz.2	-	2	374	c.350A>G	c.(349-351)TAC>TGC	p.Y117C	RHCG_uc002boa.2_RNA|RHCG_uc010bnq.1_5'UTR	NM_016321	NP_057405	Q9UBD6	RHCG_HUMAN	Rh family, C glycoprotein	117	Extracellular (Potential).				amine transport|cellular ion homeostasis|epithelial cell differentiation|transepithelial ammonium transport	apical plasma membrane|basolateral plasma membrane|cytoplasmic vesicle|integral to plasma membrane	ammonia transmembrane transporter activity|ammonium transmembrane transporter activity|ankyrin binding			kidney(1)	1	Lung NSC(78;0.0237)|all_lung(78;0.0478)																	---	---	---	---	capture		Missense_Mutation	SNP	90030051	90030051	13801	15	T	C	C	57	57	RHCG	C	4	4
RUNDC2A	84127	broad.mit.edu	37	16	12136788	12136788	+	Silent	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:12136788C>G	uc002dbw.1	+	5	344	c.282C>G	c.(280-282)CTC>CTG	p.L94L		NM_032167	NP_115543	Q9HA26	RUN2A_HUMAN	RUN domain containing 2A	94	RUN.									ovary(1)	1								T	CIITA	PMBL|Hodgkin Lymphona|								---	---	---	---	capture		Silent	SNP	12136788	12136788	14223	16	C	G	G	29	29	RUNDC2A	G	3	3
PLA2G15	23659	broad.mit.edu	37	16	68293349	68293349	+	Missense_Mutation	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68293349A>G	uc002evr.2	+	6	1111	c.1028A>G	c.(1027-1029)TAC>TGC	p.Y343C	PLA2G15_uc010vld.1_3'UTR|PLA2G15_uc010vle.1_Missense_Mutation_p.Y249C|PLA2G15_uc010vlf.1_Missense_Mutation_p.Y143C|PLA2G15_uc002evs.2_Missense_Mutation_p.Y164C	NM_012320	NP_036452	Q8NCC3	PAG15_HUMAN	lysophospholipase 3 (lysosomal phospholipase A2)	343					fatty acid catabolic process	extracellular region|lysosome	lysophospholipase activity|phosphatidylcholine-sterol O-acyltransferase activity|phospholipid binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	68293349	68293349	12418	16	A	G	G	14	14	PLA2G15	G	4	4
PMFBP1	83449	broad.mit.edu	37	16	72166725	72166725	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72166725C>G	uc002fcc.3	-	10	1541	c.1369G>C	c.(1369-1371)GAG>CAG	p.E457Q	PMFBP1_uc002fcd.2_Missense_Mutation_p.E457Q|PMFBP1_uc002fce.2_RNA|PMFBP1_uc002fcf.2_Missense_Mutation_p.E312Q	NM_031293	NP_112583	Q8TBY8	PMFBP_HUMAN	polyamine modulated factor 1 binding protein 1	457	Potential.									ovary(2)	2		Ovarian(137;0.179)																---	---	---	---	capture		Missense_Mutation	SNP	72166725	72166725	12560	16	C	G	G	30	30	PMFBP1	G	3	3
DPH1	1801	broad.mit.edu	37	17	1939277	1939277	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1939277G>A	uc002fts.2	+	4	325	c.307G>A	c.(307-309)GAA>AAA	p.E103K	DPH1_uc002ftr.1_RNA|DPH1_uc002ftt.2_Missense_Mutation_p.E98K|DPH1_uc010cjx.2_Intron|DPH1_uc010vqs.1_Missense_Mutation_p.E113K|DPH1_uc002ftu.2_5'Flank|DPH1_uc002ftv.2_5'Flank	NM_001383	NP_001374	Q9BZG8	DPH1_HUMAN	diptheria toxin resistance protein required for	103					peptidyl-diphthamide biosynthetic process from peptidyl-histidine|translation	cytoplasm|nucleus				pancreas(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	1939277	1939277	4903	17	G	A	A	37	37	DPH1	A	1	1
TP53	7157	broad.mit.edu	37	17	7578212	7578212	+	Nonsense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7578212G>A	uc002gim.2	-	6	831	c.637C>T	c.(637-639)CGA>TGA	p.R213*	TP53_uc002gig.1_Nonsense_Mutation_p.R213*|TP53_uc002gih.2_Nonsense_Mutation_p.R213*|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Nonsense_Mutation_p.R81*|TP53_uc010cng.1_Nonsense_Mutation_p.R81*|TP53_uc002gii.1_Nonsense_Mutation_p.R81*|TP53_uc010cnh.1_Nonsense_Mutation_p.R213*|TP53_uc010cni.1_Nonsense_Mutation_p.R213*|TP53_uc002gij.2_Nonsense_Mutation_p.R213*|TP53_uc010cnj.1_Intron|TP53_uc002gin.2_Nonsense_Mutation_p.R120*|TP53_uc002gio.2_Nonsense_Mutation_p.R81*|TP53_uc010vug.1_Nonsense_Mutation_p.R174*	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	213	Required for interaction with FBXO42.||Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).		R -> L (in sporadic cancers; somatic mutation).|R -> W (in sporadic cancers; somatic mutation).|R -> Q (in LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> G (in sporadic cancers; somatic mutation).|R -> P (in LFS; germline mutation and in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.R213*(186)|p.R213L(25)|p.R213Q(22)|p.R213fs*34(10)|p.0?(7)|p.R213P(5)|p.R81*(2)|p.R120*(2)|p.R213G(2)|p.K164_P219del(1)|p.D208_V216delDRNTFRHSV(1)|p.D207_R213delDDRNTFR(1)|p.T211_S215delTFRHS(1)|p.R213*33(1)|p.D208fs*1(1)|p.R213>L(1)|p.R209_R213delRNTFR(1)|p.R213fs*2(1)|p.T211fs*28(1)|p.R213_S215>X(1)|p.D207_V216del10(1)|p.R213R(1)|p.R213fs*32(1)|p.R209fs*6(1)|p.R213W(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)			111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			---	---	---	---	capture		Nonsense_Mutation	SNP	7578212	7578212	16923	17	G	A	A	37	37	TP53	A	5	1
MYH8	4626	broad.mit.edu	37	17	10307790	10307790	+	Nonsense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10307790C>A	uc002gmm.2	-	22	2640	c.2545G>T	c.(2545-2547)GAG>TAG	p.E849*	uc002gml.1_Intron	NM_002472	NP_002463	P13535	MYH8_HUMAN	myosin, heavy chain 8, skeletal muscle,	849	Potential.				muscle filament sliding	cytosol|muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			skin(6)|ovary(3)|breast(2)	11														Trismus-Pseudocamptodactyly_Syndrome_with_Cardiac_Myxoma_and_Freckling				---	---	---	---	capture		Nonsense_Mutation	SNP	10307790	10307790	10436	17	C	A	A	31	31	MYH8	A	5	1
SUPT6H	6830	broad.mit.edu	37	17	27028597	27028597	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27028597C>G	uc002hby.2	+	37	5225	c.5135C>G	c.(5134-5136)TCC>TGC	p.S1712C	SUPT6H_uc010crt.2_Missense_Mutation_p.S1712C	NM_003170	NP_003161	Q7KZ85	SPT6H_HUMAN	suppressor of Ty 6 homolog	1712					chromatin remodeling|regulation of transcription elongation, DNA-dependent|regulation of transcription from RNA polymerase II promoter	nucleus	hydrolase activity, acting on ester bonds|RNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)|skin(1)	3	Lung NSC(42;0.00431)																	---	---	---	---	capture		Missense_Mutation	SNP	27028597	27028597	15920	17	C	G	G	30	30	SUPT6H	G	3	3
CSH2	1443	broad.mit.edu	37	17	61950624	61950624	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61950624G>T	uc002jch.2	-	2	201	c.86C>A	c.(85-87)ACC>AAC	p.T29N	CSH2_uc002jcg.2_Missense_Mutation_p.T29N|CSH2_uc002jci.2_Missense_Mutation_p.T29N|GH2_uc002jcj.2_Intron|CSH2_uc002jck.2_Missense_Mutation_p.T29N	NM_020991	NP_066271	P01243	CSH_HUMAN	chorionic somatomammotropin hormone 2 isoform 1	29					female pregnancy|signal transduction	extracellular region	hormone activity|metal ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	61950624	61950624	4082	17	G	T	T	44	44	CSH2	T	2	2
SNRPD1	6632	broad.mit.edu	37	18	19203843	19203843	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:19203843C>G	uc002ktj.1	+	3	357	c.226C>G	c.(226-228)CTG>GTG	p.L76V		NM_006938	NP_008869	P62314	SMD1_HUMAN	small nuclear ribonucleoprotein D1 polypeptide	76					ncRNA metabolic process|spliceosomal snRNP assembly|spliceosome assembly	catalytic step 2 spliceosome|cytosol|nucleoplasm|small nuclear ribonucleoprotein complex|U12-type spliceosomal complex	protein binding|RNA binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	19203843	19203843	15364	18	C	G	G	32	32	SNRPD1	G	3	3
HRH4	59340	broad.mit.edu	37	18	22057388	22057388	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:22057388G>T	uc002kvi.2	+	3	1135	c.1035G>T	c.(1033-1035)TGG>TGT	p.W345C	HRH4_uc010xbd.1_3'UTR|HRH4_uc010dlx.2_Missense_Mutation_p.W257C	NM_021624	NP_067637	Q9H3N8	HRH4_HUMAN	histamine H4 receptor isoform 1	345	Helical; Name=7; (Potential).					integral to membrane|plasma membrane	histamine receptor activity			ovary(2)	2	all_cancers(21;0.000545)|all_epithelial(16;6.56e-06)|Lung NSC(20;0.0027)|all_lung(20;0.0085)|Colorectal(14;0.0361)|Ovarian(20;0.0991)				Clozapine(DB00363)													---	---	---	---	capture		Missense_Mutation	SNP	22057388	22057388	7650	18	G	T	T	42	42	HRH4	T	2	2
NOL4	8715	broad.mit.edu	37	18	31463290	31463290	+	Silent	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:31463290G>T	uc010dmi.2	-	10	1870	c.1641C>A	c.(1639-1641)ATC>ATA	p.I547I	NOL4_uc010xbs.1_Silent_p.I262I|NOL4_uc002kxr.3_Silent_p.I319I|NOL4_uc010xbt.1_Silent_p.I473I|NOL4_uc010dmh.2_Silent_p.I409I|NOL4_uc010xbu.1_Silent_p.I483I|NOL4_uc002kxt.3_Silent_p.I445I	NM_003787	NP_003778	O94818	NOL4_HUMAN	nucleolar protein 4	547						nucleolus	RNA binding			ovary(3)	3																		---	---	---	---	capture		Silent	SNP	31463290	31463290	10927	18	G	T	T	45	45	NOL4	T	2	2
C3	718	broad.mit.edu	37	19	6684439	6684439	+	Nonsense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6684439G>A	uc002mfm.2	-	33	4194	c.4132C>T	c.(4132-4134)CAG>TAG	p.Q1378*	C3_uc002mfl.2_Nonsense_Mutation_p.Q114*	NM_000064	NP_000055	P01024	CO3_HUMAN	complement component 3 precursor	1378					complement activation, alternative pathway|complement activation, classical pathway|G-protein coupled receptor protein signaling pathway|inflammatory response|positive regulation vascular endothelial growth factor production	extracellular space	endopeptidase inhibitor activity|receptor binding			skin(3)|ovary(1)|pancreas(1)	5				GBM - Glioblastoma multiforme(1328;1.36e-05)|Lung(535;0.00661)														---	---	---	---	capture		Nonsense_Mutation	SNP	6684439	6684439	2296	19	G	A	A	45	45	C3	A	5	2
ZNF20	7568	broad.mit.edu	37	19	12244329	12244329	+	Silent	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12244329C>T	uc002mtf.1	-	4	815	c.672G>A	c.(670-672)GTG>GTA	p.V224V	ZNF20_uc002mte.1_Silent_p.V189V|ZNF20_uc002mtg.1_Silent_p.V224V	NM_021143	NP_066966	P17024	ZNF20_HUMAN	zinc finger protein 20	224					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---	capture		Silent	SNP	12244329	12244329	18352	19	C	T	T	29	29	ZNF20	T	2	2
C19orf62	29086	broad.mit.edu	37	19	17384808	17384808	+	Missense_Mutation	SNP	T	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17384808T>G	uc002nfu.2	+	4	558	c.440T>G	c.(439-441)GTG>GGG	p.V147G	C19orf62_uc010xpl.1_Intron|C19orf62_uc002nfv.2_Missense_Mutation_p.V147G|C19orf62_uc010ean.2_RNA|C19orf62_uc002nfw.2_Missense_Mutation_p.V147G	NM_014173	NP_054892	Q9NWV8	BABA1_HUMAN	mediator of Rap80 interactions and targeting 40	147	VWFA-like.				chromatin modification|double-strand break repair|G2/M transition DNA damage checkpoint|positive regulation of DNA repair|protein K63-linked deubiquitination|response to ionizing radiation	BRCA1-A complex|BRISC complex|cytoplasm	protein binding			ovary(1)|haematopoietic_and_lymphoid_tissue(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	17384808	17384808	2008	19	T	G	G	59	59	C19orf62	G	4	4
ZNF780B	163131	broad.mit.edu	37	19	40540887	40540887	+	Nonsense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40540887G>A	uc002omu.2	-	5	1944	c.1879C>T	c.(1879-1881)CAG>TAG	p.Q627*	ZNF780B_uc002omv.2_Nonsense_Mutation_p.Q479*	NM_001005851	NP_001005851	Q9Y6R6	Z780B_HUMAN	zinc finger protein 780B	627	C2H2-type 17.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|pancreas(1)	2	all_cancers(60;9.55e-06)|all_lung(34;1.17e-07)|Lung NSC(34;1.41e-07)|Ovarian(47;0.0925)																	---	---	---	---	capture		Nonsense_Mutation	SNP	40540887	40540887	18751	19	G	A	A	47	47	ZNF780B	A	5	2
C19orf47	126526	broad.mit.edu	37	19	40827975	40827975	+	Silent	SNP	A	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40827975A>C	uc002oni.3	-	9	1084	c.1083T>G	c.(1081-1083)CTT>CTG	p.L361L	C19orf47_uc002ong.2_Silent_p.L220L|C19orf47_uc002onh.2_Silent_p.L294L	NM_178830	NP_849152	Q8N9M1	CS047_HUMAN	hypothetical protein LOC126526	361										ovary(1)|skin(1)	2			Lung(22;0.000636)															---	---	---	---	capture		Silent	SNP	40827975	40827975	1994	19	A	C	C	5	5	C19orf47	C	4	4
CLPTM1	1209	broad.mit.edu	37	19	45490529	45490529	+	Nonsense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45490529G>T	uc002pai.2	+	8	901	c.886G>T	c.(886-888)GAG>TAG	p.E296*	CLPTM1_uc010ejv.1_Nonsense_Mutation_p.E194*|CLPTM1_uc010xxf.1_Nonsense_Mutation_p.E194*|CLPTM1_uc010xxg.1_Nonsense_Mutation_p.E282*	NM_001294	NP_001285	O96005	CLPT1_HUMAN	cleft lip and palate associated transmembrane	296	Extracellular (Potential).				cell differentiation|multicellular organismal development|regulation of T cell differentiation in thymus	external side of plasma membrane|integral to plasma membrane				ovary(1)	1		all_neural(266;0.224)|Ovarian(192;0.231)		OV - Ovarian serous cystadenocarcinoma(262;0.00354)|Epithelial(262;0.187)														---	---	---	---	capture		Nonsense_Mutation	SNP	45490529	45490529	3692	19	G	T	T	37	37	CLPTM1	T	5	1
NUP62	23636	broad.mit.edu	37	19	50412425	50412425	+	Missense_Mutation	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50412425T>C	uc002pqx.2	-	2	744	c.640A>G	c.(640-642)ATC>GTC	p.I214V	IL4I1_uc002pqv.1_Intron|IL4I1_uc010eno.1_Intron|IL4I1_uc002pqw.1_Intron|IL4I1_uc002pqu.1_Intron|NUP62_uc002pqy.2_Missense_Mutation_p.I214V|NUP62_uc002pqz.2_Missense_Mutation_p.I214V|NUP62_uc002pra.2_Missense_Mutation_p.I214V|NUP62_uc002prb.2_Missense_Mutation_p.I214V|NUP62_uc002prc.2_Missense_Mutation_p.I214V	NM_153719	NP_714941	P37198	NUP62_HUMAN	nucleoporin 62kDa	214	15 X 9 AA approximate repeats.|Ala-rich.|Thr-rich.				carbohydrate metabolic process|cell death|cell surface receptor linked signaling pathway|glucose transport|hormone-mediated signaling pathway|mRNA transport|negative regulation of apoptosis|negative regulation of cell proliferation|nucleocytoplasmic transport|positive regulation of epidermal growth factor receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of transcription, DNA-dependent|protein transport|regulation of glucose transport|transcription, DNA-dependent|transmembrane transport|viral reproduction	cytoplasm|nuclear membrane|nuclear pore|nucleocytoplasmic shuttling complex|ribonucleoprotein complex|spindle pole	chromatin binding|protein serine/threonine kinase activity|receptor signaling complex scaffold activity|SH2 domain binding|structural constituent of nuclear pore|thyroid hormone receptor binding|ubiquitin binding				0		all_lung(116;1.47e-05)|all_neural(266;0.0459)|Ovarian(192;0.0481)		GBM - Glioblastoma multiforme(134;0.00242)|OV - Ovarian serous cystadenocarcinoma(262;0.0177)														---	---	---	---	capture		Missense_Mutation	SNP	50412425	50412425	11173	19	T	C	C	51	51	NUP62	C	4	4
LILRB1	10859	broad.mit.edu	37	19	55143939	55143939	+	Nonsense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55143939C>G	uc002qgj.2	+	7	1026	c.686C>G	c.(685-687)TCA>TGA	p.S229*	LILRB1_uc010erp.1_Intron|LILRB1_uc002qgl.2_Nonsense_Mutation_p.S229*|LILRB1_uc002qgk.2_Nonsense_Mutation_p.S229*|LILRB1_uc002qgm.2_Nonsense_Mutation_p.S229*|LILRB1_uc010erq.2_Nonsense_Mutation_p.S229*|LILRB1_uc010err.2_RNA	NM_006669	NP_006660	Q8NHL6	LIRB1_HUMAN	leukocyte immunoglobulin-like receptor,	229	Ig-like C2-type 3.|Extracellular (Potential).				regulation of immune response|response to virus	integral to membrane|plasma membrane	protein phosphatase 1 binding|receptor activity			large_intestine(1)|ovary(1)|skin(1)	3				GBM - Glioblastoma multiforme(193;0.0188)											HNSCC(37;0.09)			---	---	---	---	capture		Nonsense_Mutation	SNP	55143939	55143939	9116	19	C	G	G	29	29	LILRB1	G	5	3
PTPRH	5794	broad.mit.edu	37	19	55708712	55708712	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55708712G>A	uc002qjq.2	-	9	1836	c.1763C>T	c.(1762-1764)CCT>CTT	p.P588L	PTPRH_uc010esv.2_Missense_Mutation_p.P410L|PTPRH_uc002qjs.2_Missense_Mutation_p.P595L	NM_002842	NP_002833	Q9HD43	PTPRH_HUMAN	protein tyrosine phosphatase, receptor type, H	588	Extracellular (Potential).|Fibronectin type-III 7.				apoptosis	cytoplasm|integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(2)|large_intestine(1)|skin(1)	4		Renal(1328;0.245)	BRCA - Breast invasive adenocarcinoma(297;0.209)	GBM - Glioblastoma multiforme(193;0.0479)														---	---	---	---	capture		Missense_Mutation	SNP	55708712	55708712	13260	19	G	A	A	35	35	PTPRH	A	2	2
AGBL5	60509	broad.mit.edu	37	2	27276797	27276797	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27276797C>T	uc002rie.2	+	4	638	c.421C>T	c.(421-423)CAT>TAT	p.H141Y	AGBL5_uc002ric.2_Missense_Mutation_p.H141Y|AGBL5_uc002rid.2_Missense_Mutation_p.H141Y|AGBL5_uc002rif.2_RNA	NM_021831	NP_068603	Q8NDL9	CBPC5_HUMAN	ATP/GTP binding protein-like 5 isoform 1	141					protein branching point deglutamylation|proteolysis	cytosol|nucleus	metallocarboxypeptidase activity|tubulin binding|zinc ion binding			ovary(1)|breast(1)	2	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---	capture		Missense_Mutation	SNP	27276797	27276797	381	2	C	T	T	29	29	AGBL5	T	2	2
MTA3	57504	broad.mit.edu	37	2	42935192	42935192	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:42935192G>C	uc002rso.1	+	14	1799	c.1129G>C	c.(1129-1131)GAG>CAG	p.E377Q	MTA3_uc002rsp.1_Missense_Mutation_p.E377Q|MTA3_uc002rsq.2_Missense_Mutation_p.E434Q|MTA3_uc002rsr.2_Missense_Mutation_p.E433Q	NM_020744	NP_065795	Q9BTC8	MTA3_HUMAN	metastasis associated 1 family, member 3	434						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	42935192	42935192	10303	2	G	C	C	33	33	MTA3	C	3	3
NEB	4703	broad.mit.edu	37	2	152529046	152529046	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152529046G>T	uc010fnx.2	-	37	4327	c.4136C>A	c.(4135-4137)ACC>AAC	p.T1379N		NM_004543	NP_004534	P20929	NEBU_HUMAN	nebulin isoform 3	1379					muscle filament sliding|muscle organ development|regulation of actin filament length|somatic muscle development	actin cytoskeleton|cytosol|Z disc	actin binding|structural constituent of muscle			ovary(8)|large_intestine(5)|breast(3)|central_nervous_system(2)|skin(1)|pancreas(1)	20				BRCA - Breast invasive adenocarcinoma(221;0.219)														---	---	---	---	capture		Missense_Mutation	SNP	152529046	152529046	10701	2	G	T	T	44	44	NEB	T	2	2
PKP4	8502	broad.mit.edu	37	2	159477760	159477760	+	Missense_Mutation	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:159477760A>G	uc002tzv.2	+	6	690	c.430A>G	c.(430-432)AGA>GGA	p.R144G	PKP4_uc002tzt.1_5'UTR|PKP4_uc002tzu.2_Missense_Mutation_p.R144G|PKP4_uc002tzw.2_Missense_Mutation_p.R144G|PKP4_uc002tzx.2_5'UTR|PKP4_uc002tzy.1_5'UTR|PKP4_uc002tzz.1_Missense_Mutation_p.R142G|PKP4_uc002uaa.2_5'UTR	NM_003628	NP_003619	Q99569	PKP4_HUMAN	plakophilin 4 isoform a	144					cell adhesion	desmosome	protein binding			ovary(5)|skin(2)	7															HNSCC(62;0.18)			---	---	---	---	capture		Missense_Mutation	SNP	159477760	159477760	12412	2	A	G	G	3	3	PKP4	G	4	4
RAPGEF4	11069	broad.mit.edu	37	2	173883491	173883491	+	Missense_Mutation	SNP	G	A	A	rs61741755		TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:173883491G>A	uc002uhv.3	+	22	2303	c.2116G>A	c.(2116-2118)GGG>AGG	p.G706R	RAPGEF4_uc002uhw.3_Missense_Mutation_p.G562R	NM_007023	NP_008954	Q8WZA2	RPGF4_HUMAN	Rap guanine nucleotide exchange factor (GEF) 4	706					blood coagulation|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|regulation of insulin secretion|regulation of protein phosphorylation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cAMP-dependent protein kinase complex|membrane fraction|plasma membrane	cAMP binding|cAMP-dependent protein kinase regulator activity|Ras GTPase binding|Ras guanyl-nucleotide exchange factor activity			large_intestine(2)|skin(2)|kidney(1)|central_nervous_system(1)	6			OV - Ovarian serous cystadenocarcinoma(117;0.194)															---	---	---	---	capture		Missense_Mutation	SNP	173883491	173883491	13506	2	G	A	A	39	39	RAPGEF4	A	1	1
NFE2L2	4780	broad.mit.edu	37	2	178098810	178098810	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:178098810C>G	uc002ulh.3	-	2	790	c.235G>C	c.(235-237)GAG>CAG	p.E79Q	NFE2L2_uc002ulg.3_Missense_Mutation_p.E63Q|NFE2L2_uc010zfa.1_Missense_Mutation_p.E63Q|NFE2L2_uc002uli.3_Missense_Mutation_p.E63Q|NFE2L2_uc010fra.2_Missense_Mutation_p.E63Q|NFE2L2_uc010frb.2_Missense_Mutation_p.E63Q	NM_006164	NP_006155	Q16236	NF2L2_HUMAN	nuclear factor erythroid 2-like 2 isoform 1	79					transcription from RNA polymerase II promoter	centrosome|cytosol|nucleus|plasma membrane	protein dimerization activity|protein domain specific binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(1)	1			Epithelial(96;0.00442)|OV - Ovarian serous cystadenocarcinoma(117;0.00739)|all cancers(119;0.0195)|LUSC - Lung squamous cell carcinoma(2;0.036)|Lung(16;0.0935)					Mis		NSCLC|HNSCC					HNSCC(56;0.16)			---	---	---	---	capture		Missense_Mutation	SNP	178098810	178098810	10768	2	C	G	G	32	32	NFE2L2	G	3	3
TTN	7273	broad.mit.edu	37	2	179515558	179515558	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179515558G>T	uc010zfg.1	-	163	32551	c.32327C>A	c.(32326-32328)CCA>CAA	p.P10776Q	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc010fre.1_Intron|TTN_uc002umw.1_RNA|TTN_uc002umx.1_5'UTR	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	11703							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179515558	179515558	17290	2	G	T	T	47	47	TTN	T	2	2
PMS1	5378	broad.mit.edu	37	2	190728905	190728905	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:190728905C>T	uc002urh.3	+	10	2822	c.2293C>T	c.(2293-2295)CAT>TAT	p.H765Y	PMS1_uc010zgb.1_Missense_Mutation_p.H704Y|PMS1_uc002urk.3_Missense_Mutation_p.H726Y|PMS1_uc002uri.3_Intron|PMS1_uc010zgc.1_Missense_Mutation_p.H589Y|PMS1_uc010zgd.1_Missense_Mutation_p.H589Y|PMS1_uc002urj.2_Intron|PMS1_uc010fry.1_Intron|PMS1_uc010frz.2_Intron|PMS1_uc002url.2_Intron|PMS1_uc002urm.2_Intron	NM_000534	NP_000525	P54277	PMS1_HUMAN	postmeiotic segregation 1 isoform a	765					mismatch repair|reciprocal meiotic recombination	MutLalpha complex	ATP binding|ATPase activity|mismatched DNA binding			ovary(2)|kidney(1)|central_nervous_system(1)	4			OV - Ovarian serous cystadenocarcinoma(117;0.0013)|Epithelial(96;0.0263)|all cancers(119;0.0751)					Mis|N			colorectal|endometrial|ovarian		Direct_reversal_of_damage|MMR					---	---	---	---	capture		Missense_Mutation	SNP	190728905	190728905	12568	2	C	T	T	29	29	PMS1	T	2	2
OBFC2A	64859	broad.mit.edu	37	2	192550416	192550416	+	Silent	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:192550416A>G	uc002usx.2	+	6	1017	c.537A>G	c.(535-537)CTA>CTG	p.L179L	OBFC2A_uc002usw.2_Silent_p.L99L|OBFC2A_uc002usy.2_RNA|OBFC2A_uc002usz.2_RNA|OBFC2A_uc002uta.2_Silent_p.L93L	NM_001031716	NP_001026886	Q96AH0	SOSB2_HUMAN	oligonucleotide/oligosaccharide-binding fold	179					double-strand break repair via homologous recombination|G2/M transition checkpoint|response to ionizing radiation	SOSS complex	single-stranded DNA binding				0			OV - Ovarian serous cystadenocarcinoma(117;0.061)|Epithelial(96;0.244)															---	---	---	---	capture		Silent	SNP	192550416	192550416	11213	2	A	G	G	14	14	OBFC2A	G	4	4
CTSA	5476	broad.mit.edu	37	20	44523469	44523469	+	Missense_Mutation	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44523469A>G	uc002xqj.3	+	10	1351	c.877A>G	c.(877-879)AAG>GAG	p.K293E	CTSA_uc002xqh.2_Missense_Mutation_p.K311E|CTSA_uc002xqi.2_RNA|CTSA_uc010zxi.1_Missense_Mutation_p.K294E|CTSA_uc002xqk.3_Missense_Mutation_p.K293E	NM_001127695	NP_001121167	P10619	PPGB_HUMAN	cathepsin A isoform b precursor	293					intracellular protein transport|proteolysis	endoplasmic reticulum|lysosome|nucleus	enzyme activator activity|protein binding|serine-type carboxypeptidase activity			ovary(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---	capture		Missense_Mutation	SNP	44523469	44523469	4188	20	A	G	G	9	9	CTSA	G	4	4
TMPRSS15	5651	broad.mit.edu	37	21	19715877	19715877	+	Silent	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:19715877A>G	uc002ykw.2	-	12	1405	c.1374T>C	c.(1372-1374)TAT>TAC	p.Y458Y		NM_002772	NP_002763	P98073	ENTK_HUMAN	enterokinase precursor	458	Extracellular (Potential).|MAM.				proteolysis	brush border|integral to membrane	scavenger receptor activity|serine-type endopeptidase activity			ovary(5)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	8																		---	---	---	---	capture		Silent	SNP	19715877	19715877	16787	21	A	G	G	8	8	TMPRSS15	G	4	4
PLXNB2	23654	broad.mit.edu	37	22	50717382	50717382	+	Missense_Mutation	SNP	T	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50717382T>A	uc003bkv.3	-	28	4554	c.4448A>T	c.(4447-4449)AAC>ATC	p.N1483I	PLXNB2_uc003bkt.1_Missense_Mutation_p.N275I|PLXNB2_uc003bku.1_Missense_Mutation_p.N468I	NM_012401	NP_036533	O15031	PLXB2_HUMAN	plexin B2 precursor	1483	Cytoplasmic (Potential).				regulation of small GTPase mediated signal transduction	integral to membrane|intracellular	GTPase activator activity|protein binding|receptor activity			ovary(4)|central_nervous_system(1)|skin(1)	6		all_cancers(38;5.78e-13)|all_epithelial(38;1.71e-11)|all_lung(38;3.89e-05)|Breast(42;0.000523)|Lung NSC(38;0.000992)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		BRCA - Breast invasive adenocarcinoma(115;0.205)|LUAD - Lung adenocarcinoma(64;0.247)														---	---	---	---	capture		Missense_Mutation	SNP	50717382	50717382	12550	22	T	A	A	60	60	PLXNB2	A	4	4
CHKB	1120	broad.mit.edu	37	22	51019077	51019077	+	Silent	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:51019077C>T	uc003bms.2	-	5	812	c.594G>A	c.(592-594)CAG>CAA	p.Q198Q	CPT1B_uc003bmk.3_5'Flank|CPT1B_uc003bml.2_5'Flank|CPT1B_uc003bmm.2_5'Flank|CPT1B_uc003bmo.2_5'Flank|CPT1B_uc011asa.1_5'Flank|CPT1B_uc003bmn.2_5'Flank|CPT1B_uc011asb.1_5'Flank|CHKB-CPT1B_uc003bmp.2_5'Flank|CHKB-CPT1B_uc003bmt.1_5'UTR|CHKB-CPT1B_uc003bmu.2_Silent_p.Q77Q|CHKB_uc003bmv.2_Silent_p.Q198Q|LOC100144603_uc003bmw.3_5'Flank	NM_005198	NP_005189	Q9Y259	CHKB_HUMAN	choline kinase beta	198					phosphatidylethanolamine biosynthetic process		ATP binding|choline kinase activity|ethanolamine kinase activity				0		all_cancers(38;8.8e-15)|all_epithelial(38;1.12e-12)|all_lung(38;3.07e-05)|Breast(42;6.27e-05)|Lung NSC(38;0.000813)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		all cancers(3;4.04e-77)|OV - Ovarian serous cystadenocarcinoma(4;5.79e-74)|Epithelial(4;6.17e-70)|GBM - Glioblastoma multiforme(4;5.68e-08)|LUAD - Lung adenocarcinoma(64;0.0016)|Lung(4;0.00942)|BRCA - Breast invasive adenocarcinoma(115;0.205)	Choline(DB00122)													---	---	---	---	capture		Silent	SNP	51019077	51019077	3482	22	C	T	T	32	32	CHKB	T	2	2
SCN10A	6336	broad.mit.edu	37	3	38739099	38739099	+	Missense_Mutation	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38739099A>G	uc003ciq.2	-	27	5612	c.5612T>C	c.(5611-5613)ATG>ACG	p.M1871T		NM_006514	NP_006505	Q9Y5Y9	SCNAA_HUMAN	sodium channel, voltage-gated, type X, alpha	1871	IQ.				sensory perception	voltage-gated sodium channel complex				ovary(5)|skin(3)|large_intestine(1)|kidney(1)	10				KIRC - Kidney renal clear cell carcinoma(284;0.0769)|Kidney(284;0.0945)	Benzocaine(DB01086)|Bupivacaine(DB00297)|Chloroprocaine(DB01161)|Cocaine(DB00907)|Dibucaine(DB00527)|Dyclonine(DB00645)|Hexylcaine(DB00473)|Levobupivacaine(DB01002)|Lidocaine(DB00281)|Mepivacaine(DB00961)|Oxybuprocaine(DB00892)|Procaine(DB00721)|Proparacaine(DB00807)|Ropivacaine(DB00296)													---	---	---	---	capture		Missense_Mutation	SNP	38739099	38739099	14394	3	A	G	G	8	8	SCN10A	G	4	4
BSN	8927	broad.mit.edu	37	3	49688345	49688345	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49688345G>A	uc003cxe.3	+	4	1933	c.1819G>A	c.(1819-1821)GAA>AAA	p.E607K		NM_003458	NP_003449	Q9UPA5	BSN_HUMAN	bassoon protein	607					synaptic transmission	cell junction|cytoplasm|cytoskeleton|nucleus|synaptosome	metal ion binding			ovary(5)|pancreas(1)|central_nervous_system(1)|skin(1)	8				BRCA - Breast invasive adenocarcinoma(193;6.66e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.0032)|Kidney(197;0.00336)														---	---	---	---	capture		Missense_Mutation	SNP	49688345	49688345	1561	3	G	A	A	41	41	BSN	A	2	2
BSN	8927	broad.mit.edu	37	3	49689252	49689252	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49689252G>A	uc003cxe.3	+	5	2377	c.2263G>A	c.(2263-2265)GAG>AAG	p.E755K		NM_003458	NP_003449	Q9UPA5	BSN_HUMAN	bassoon protein	755					synaptic transmission	cell junction|cytoplasm|cytoskeleton|nucleus|synaptosome	metal ion binding			ovary(5)|pancreas(1)|central_nervous_system(1)|skin(1)	8				BRCA - Breast invasive adenocarcinoma(193;6.66e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.0032)|Kidney(197;0.00336)														---	---	---	---	capture		Missense_Mutation	SNP	49689252	49689252	1561	3	G	A	A	37	37	BSN	A	1	1
FILIP1L	11259	broad.mit.edu	37	3	99569313	99569313	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:99569313G>T	uc003dtm.2	-	5	1670	c.1207C>A	c.(1207-1209)CTT>ATT	p.L403I	C3orf26_uc003dtk.1_Intron|C3orf26_uc003dtl.2_Intron|FILIP1L_uc003dto.2_Missense_Mutation_p.L403I|FILIP1L_uc010hpf.2_Intron|FILIP1L_uc010hpg.2_Missense_Mutation_p.L163I|FILIP1L_uc003dtn.2_Missense_Mutation_p.L163I|FILIP1L_uc003dtp.1_Missense_Mutation_p.L163I	NM_182909	NP_878913	Q4L180	FIL1L_HUMAN	filamin A interacting protein 1-like isoform 1	403	Potential.					cytoplasm|membrane|myosin complex|nucleus				ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	99569313	99569313	6133	3	G	T	T	34	34	FILIP1L	T	2	2
MBD4	8930	broad.mit.edu	37	3	129152022	129152022	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:129152022C>T	uc003emh.1	-	6	1656	c.1480G>A	c.(1480-1482)GCA>ACA	p.A494T	MBD4_uc003emi.1_Missense_Mutation_p.A494T|MBD4_uc003emj.1_Missense_Mutation_p.A488T|MBD4_uc003emk.1_Missense_Mutation_p.A176T|MBD4_uc011bkw.1_Missense_Mutation_p.A494T	NM_003925	NP_003916	O95243	MBD4_HUMAN	methyl-CpG binding domain protein 4	494					depyrimidination	nucleoplasm	DNA N-glycosylase activity|endodeoxyribonuclease activity|protein binding|satellite DNA binding			ovary(1)|lung(1)	2													BER_DNA_glycosylases					---	---	---	---	capture		Missense_Mutation	SNP	129152022	129152022	9734	3	C	T	T	27	27	MBD4	T	1	1
ACPP	55	broad.mit.edu	37	3	132056300	132056300	+	Silent	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132056300T>C	uc010htp.2	+	5	547	c.457T>C	c.(457-459)TTG>CTG	p.L153L	ACPP_uc003eon.3_Intron|ACPP_uc003eop.3_Silent_p.L153L	NM_001099	NP_001090	P15309	PPAP_HUMAN	acid phosphatase, prostate short isoform	153						extracellular region|lysosomal membrane	5'-nucleotidase activity|acid phosphatase activity			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	132056300	132056300	168	3	T	C	C	60	60	ACPP	C	4	4
VEPH1	79674	broad.mit.edu	37	3	157099020	157099020	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:157099020C>T	uc003fbj.1	-	7	1369	c.1052G>A	c.(1051-1053)CGC>CAC	p.R351H	VEPH1_uc003fbk.1_Missense_Mutation_p.R351H|VEPH1_uc010hvu.1_Missense_Mutation_p.R351H	NM_024621	NP_078897	Q14D04	MELT_HUMAN	ventricular zone expressed PH domain homolog 1	351						plasma membrane				breast(3)|ovary(1)|lung(1)	5			Lung(72;0.0272)|LUSC - Lung squamous cell carcinoma(72;0.0461)															---	---	---	---	capture		Missense_Mutation	SNP	157099020	157099020	17721	3	C	T	T	27	27	VEPH1	T	1	1
PEX5L	51555	broad.mit.edu	37	3	179593213	179593213	+	Silent	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179593213T>C	uc003fki.1	-	6	688	c.558A>G	c.(556-558)CGA>CGG	p.R186R	PEX5L_uc011bqd.1_Silent_p.R143R|PEX5L_uc011bqe.1_5'UTR|PEX5L_uc011bqf.1_Silent_p.R78R|PEX5L_uc003fkj.1_Silent_p.R151R|PEX5L_uc010hxd.1_Silent_p.R184R|PEX5L_uc011bqg.1_Silent_p.R162R|PEX5L_uc011bqh.1_Silent_p.R127R	NM_016559	NP_057643	Q8IYB4	PEX5R_HUMAN	peroxisomal biogenesis factor 5-like	186					protein import into peroxisome matrix|regulation of cAMP-mediated signaling	cytosol|peroxisomal membrane	peroxisome matrix targeting signal-1 binding			ovary(3)|large_intestine(1)	4	all_cancers(143;3.94e-14)|Ovarian(172;0.0338)|Breast(254;0.183)		OV - Ovarian serous cystadenocarcinoma(80;1.75e-26)|GBM - Glioblastoma multiforme(14;0.000518)															---	---	---	---	capture		Silent	SNP	179593213	179593213	12171	3	T	C	C	62	62	PEX5L	C	4	4
BOD1L	259282	broad.mit.edu	37	4	13605554	13605554	+	Silent	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:13605554A>G	uc003gmz.1	-	10	3087	c.2970T>C	c.(2968-2970)CAT>CAC	p.H990H	BOD1L_uc010idr.1_Silent_p.H327H	NM_148894	NP_683692	Q8NFC6	BOD1L_HUMAN	biorientation of chromosomes in cell division	990	Lys-rich.						DNA binding			ovary(5)|breast(1)	6																		---	---	---	---	capture		Silent	SNP	13605554	13605554	1508	4	A	G	G	16	16	BOD1L	G	4	4
GABRG1	2565	broad.mit.edu	37	4	46067426	46067426	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:46067426C>T	uc003gxb.2	-	4	649	c.497G>A	c.(496-498)CGT>CAT	p.R166H		NM_173536	NP_775807	Q8N1C3	GBRG1_HUMAN	gamma-aminobutyric acid A receptor, gamma 1	166	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway	cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity			ovary(2)	2				Lung(65;0.106)|LUSC - Lung squamous cell carcinoma(721;0.23)														---	---	---	---	capture		Missense_Mutation	SNP	46067426	46067426	6422	4	C	T	T	19	19	GABRG1	T	1	1
ENPEP	2028	broad.mit.edu	37	4	111397798	111397798	+	Silent	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:111397798C>T	uc003iab.3	+	1	570	c.228C>T	c.(226-228)GAC>GAT	p.D76D		NM_001977	NP_001968	Q07075	AMPE_HUMAN	glutamyl aminopeptidase	76	Extracellular (Potential).				cell migration|cell proliferation|cell-cell signaling|proteolysis	integral to plasma membrane	aminopeptidase activity|metalloexopeptidase activity|zinc ion binding			skin(3)|ovary(1)|breast(1)	5		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.0031)	L-Glutamic Acid(DB00142)													---	---	---	---	capture		Silent	SNP	111397798	111397798	5321	4	C	T	T	17	17	ENPEP	T	2	2
ANK2	287	broad.mit.edu	37	4	114209638	114209638	+	Missense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:114209638C>A	uc003ibe.3	+	20	2373	c.2273C>A	c.(2272-2274)ACC>AAC	p.T758N	ANK2_uc003ibd.3_Missense_Mutation_p.T737N|ANK2_uc003ibf.3_Missense_Mutation_p.T758N|ANK2_uc003ibc.2_Missense_Mutation_p.T734N|ANK2_uc011cgb.1_Missense_Mutation_p.T773N	NM_001148	NP_001139	Q01484	ANK2_HUMAN	ankyrin 2 isoform 1	758					axon guidance|signal transduction	apical plasma membrane|basolateral plasma membrane|cytoskeleton|cytosol|sarcomere	protein binding|protein binding			central_nervous_system(7)|ovary(3)|large_intestine(2)|breast(1)|skin(1)	14		Ovarian(17;0.0448)|Hepatocellular(203;0.218)		OV - Ovarian serous cystadenocarcinoma(123;4.92e-05)														---	---	---	---	capture		Missense_Mutation	SNP	114209638	114209638	624	4	C	A	A	18	18	ANK2	A	2	2
FAT4	79633	broad.mit.edu	37	4	126329937	126329937	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:126329937G>A	uc003ifj.3	+	4	5908	c.5908G>A	c.(5908-5910)GAT>AAT	p.D1970N	FAT4_uc011cgp.1_Missense_Mutation_p.D268N	NM_024582	NP_078858	Q6V0I7	FAT4_HUMAN	FAT tumor suppressor homolog 4 precursor	1970	Cadherin 19.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(9)|skin(5)|upper_aerodigestive_tract(2)|pancreas(2)	18																		---	---	---	---	capture		Missense_Mutation	SNP	126329937	126329937	5928	4	G	A	A	45	45	FAT4	A	2	2
TRIML1	339976	broad.mit.edu	37	4	189067976	189067976	+	Missense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:189067976C>A	uc003izm.1	+	6	972	c.857C>A	c.(856-858)ACG>AAG	p.T286K	TRIML1_uc003izn.1_Missense_Mutation_p.T10K	NM_178556	NP_848651	Q8N9V2	TRIML_HUMAN	tripartite motif family-like 1	286	B30.2/SPRY.				multicellular organismal development		ligase activity|zinc ion binding			ovary(1)|pancreas(1)|breast(1)|skin(1)	4		all_cancers(14;1.33e-43)|all_epithelial(14;7.86e-31)|all_lung(41;4.3e-13)|Lung NSC(41;9.69e-13)|Melanoma(20;7.86e-05)|Breast(6;0.000148)|Hepatocellular(41;0.0218)|Renal(120;0.0376)|Prostate(90;0.0513)|all_hematologic(60;0.062)		OV - Ovarian serous cystadenocarcinoma(60;1.52e-11)|BRCA - Breast invasive adenocarcinoma(30;4.19e-06)|GBM - Glioblastoma multiforme(59;0.000232)|STAD - Stomach adenocarcinoma(60;0.000279)|LUSC - Lung squamous cell carcinoma(40;0.00902)|READ - Rectum adenocarcinoma(43;0.156)														---	---	---	---	capture		Missense_Mutation	SNP	189067976	189067976	17100	4	C	A	A	27	27	TRIML1	A	1	1
UGT3A1	133688	broad.mit.edu	37	5	35988612	35988612	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35988612G>C	uc003jjv.1	-	2	293	c.136C>G	c.(136-138)CTT>GTT	p.L46V	UGT3A1_uc003jjw.1_RNA|UGT3A1_uc011coq.1_Missense_Mutation_p.L46V|UGT3A1_uc011cor.1_Intron|UGT3A1_uc003jjy.1_5'UTR	NM_152404	NP_689617	Q6NUS8	UD3A1_HUMAN	UDP glycosyltransferase 3 family, polypeptide A1	46	Extracellular (Potential).					integral to membrane	glucuronosyltransferase activity			ovary(2)|central_nervous_system(1)	3	all_lung(31;0.000197)		Epithelial(62;0.107)|Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---	capture		Missense_Mutation	SNP	35988612	35988612	17521	5	G	C	C	33	33	UGT3A1	C	3	3
UGT3A2	167127	broad.mit.edu	37	5	36049476	36049476	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:36049476G>C	uc003jjz.1	-	4	451	c.358C>G	c.(358-360)CAG>GAG	p.Q120E	UGT3A2_uc011cos.1_Missense_Mutation_p.Q86E|UGT3A2_uc011cot.1_Intron	NM_174914	NP_777574	Q3SY77	UD3A2_HUMAN	UDP glycosyltransferase 3 family, polypeptide A2	120	Extracellular (Potential).					integral to membrane	glucuronosyltransferase activity			ovary(2)|skin(2)|large_intestine(1)|pancreas(1)	6	all_lung(31;0.000179)		Lung(74;0.111)|Epithelial(62;0.113)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---	capture		Missense_Mutation	SNP	36049476	36049476	17522	5	G	C	C	46	46	UGT3A2	C	3	3
MAST4	375449	broad.mit.edu	37	5	66391439	66391439	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:66391439G>A	uc003jut.1	+	6	349	c.281G>A	c.(280-282)CGC>CAC	p.R94H	MAST4_uc003jus.2_Missense_Mutation_p.R94H|MAST4_uc003juu.1_Missense_Mutation_p.R104H|MAST4_uc011cra.1_Missense_Mutation_p.R77H|MAST4_uc010ixa.2_RNA|MAST4_uc003juv.2_Missense_Mutation_p.R89H|MAST4_uc003juw.2_Missense_Mutation_p.R89H	NM_015183	NP_055998	O15021	MAST4_HUMAN	microtubule associated serine/threonine kinase	286						cytoplasm	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			lung(6)|ovary(2)|kidney(2)|breast(2)|central_nervous_system(1)	13		Lung NSC(167;8.56e-06)|Prostate(74;0.00637)|Ovarian(174;0.0563)|Breast(144;0.0586)|Colorectal(97;0.245)		Lung(70;0.011)														---	---	---	---	capture		Missense_Mutation	SNP	66391439	66391439	9711	5	G	A	A	38	38	MAST4	A	1	1
RASGRF2	5924	broad.mit.edu	37	5	80369249	80369249	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:80369249G>T	uc003kha.1	+	5	865	c.865G>T	c.(865-867)GTC>TTC	p.V289F	RASGRF2_uc011ctn.1_RNA|RASGRF2_uc003khb.1_Missense_Mutation_p.V117F	NM_006909	NP_008840	O14827	RGRF2_HUMAN	Ras protein-specific guanine	289	DH.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|synaptic transmission	cytosol|endoplasmic reticulum membrane|plasma membrane	protein binding|Rho guanyl-nucleotide exchange factor activity			breast(5)|ovary(3)|large_intestine(2)|central_nervous_system(1)|skin(1)	12		Lung NSC(167;0.00498)|all_lung(232;0.00531)|Ovarian(174;0.0357)		OV - Ovarian serous cystadenocarcinoma(54;4.22e-42)|Epithelial(54;4.04e-35)|all cancers(79;2.52e-29)														---	---	---	---	capture		Missense_Mutation	SNP	80369249	80369249	13534	5	G	T	T	40	40	RASGRF2	T	1	1
ATG12	9140	broad.mit.edu	37	5	115177356	115177356	+	Missense_Mutation	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:115177356T>C	uc003krh.2	-	1	144	c.35A>G	c.(34-36)AAT>AGT	p.N12S	AP3S1_uc003krl.2_5'Flank|AP3S1_uc003krk.2_5'Flank|AP3S1_uc003krm.2_5'Flank|ATG12_uc003kri.2_Missense_Mutation_p.N12S|ATG12_uc003krj.2_RNA	NM_004707	NP_004698	O94817	ATG12_HUMAN	APG12 autophagy 12-like	Error:Variant_position_missing_in_O94817_after_alignment					autophagic vacuole assembly|negative regulation of type I interferon production	pre-autophagosomal structure membrane	protein binding				0		all_cancers(142;0.00377)|all_epithelial(76;0.000129)|Prostate(80;0.0132)|Ovarian(225;0.0776)|Lung NSC(810;0.245)		OV - Ovarian serous cystadenocarcinoma(64;7.59e-08)|Epithelial(69;7.05e-07)|all cancers(49;3.11e-05)														---	---	---	---	capture		Missense_Mutation	SNP	115177356	115177356	1109	5	T	C	C	52	52	ATG12	C	4	4
HSPA4	3308	broad.mit.edu	37	5	132426993	132426993	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:132426993C>G	uc003kyj.2	+	12	1768	c.1487C>G	c.(1486-1488)TCT>TGT	p.S496C		NM_002154	NP_002145	P34932	HSP74_HUMAN	heat shock 70kDa protein 4	496					cellular chaperone-mediated protein complex assembly|protein import into mitochondrial outer membrane|response to unfolded protein	cytoplasm|nucleus	ATP binding			lung(1)|breast(1)	2			KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---	capture		Missense_Mutation	SNP	132426993	132426993	7711	5	C	G	G	32	32	HSPA4	G	3	3
PCDHGA1	56114	broad.mit.edu	37	5	140710510	140710510	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140710510G>T	uc003lji.1	+	1	259	c.259G>T	c.(259-261)GCG>TCG	p.A87S	PCDHGA1_uc011dan.1_Missense_Mutation_p.A87S	NM_018912	NP_061735	Q9Y5H4	PCDG1_HUMAN	protocadherin gamma subfamily A, 1 isoform 1	87	Cadherin 1.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(1)|breast(1)|pancreas(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---	capture		Missense_Mutation	SNP	140710510	140710510	11970	5	G	T	T	38	38	PCDHGA1	T	1	1
CYP21A2	1589	broad.mit.edu	37	6	32007980	32007980	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32007980G>C	uc003nze.1	+	7	1055	c.937G>C	c.(937-939)GAG>CAG	p.E313Q	CYP21A2_uc003nzf.1_Missense_Mutation_p.E283Q	NM_000500	NP_000491	P08686	CP21A_HUMAN	cytochrome P450, family 21, subfamily A,	312					glucocorticoid biosynthetic process|mineralocorticoid biosynthetic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	electron carrier activity|heme binding|steroid 21-monooxygenase activity|steroid binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	32007980	32007980	4318	6	G	C	C	45	45	CYP21A2	C	3	3
AGPAT1	10554	broad.mit.edu	37	6	32137188	32137188	+	Silent	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32137188C>A	uc003oae.2	-	7	1035	c.717G>T	c.(715-717)ACG>ACT	p.T239T	PPT2_uc003nzy.1_RNA|AGPAT1_uc011dpj.1_RNA|AGPAT1_uc011dpk.1_Silent_p.T203T|AGPAT1_uc003oaf.2_Silent_p.T239T|AGPAT1_uc003oag.2_Silent_p.T129T|AGPAT1_uc003oah.2_Silent_p.T239T|AGPAT1_uc003oai.1_Silent_p.T239T|AGPAT1_uc011dpl.1_Silent_p.T127T	NM_006411	NP_006402	Q99943	PLCA_HUMAN	1-acylglycerol-3-phosphate O-acyltransferase 1	239					energy reserve metabolic process|phosphatidic acid biosynthetic process|positive regulation of cellular metabolic process|positive regulation of cytokine production|triglyceride biosynthetic process	endoplasmic reticulum membrane|integral to membrane	1-acylglycerol-3-phosphate O-acyltransferase activity			central_nervous_system(1)	1																		---	---	---	---	capture		Silent	SNP	32137188	32137188	389	6	C	A	A	23	23	AGPAT1	A	1	1
DST	667	broad.mit.edu	37	6	56494056	56494056	+	Silent	SNP	A	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56494056A>T	uc003pdf.2	-	31	4396	c.4368T>A	c.(4366-4368)ATT>ATA	p.I1456I	DST_uc003pcz.3_Silent_p.I1278I|DST_uc011dxj.1_Silent_p.I1307I|DST_uc011dxk.1_Silent_p.I1318I|DST_uc003pcy.3_Silent_p.I952I|DST_uc003pdb.2_Silent_p.I952I|DST_uc003pdc.3_Silent_p.I952I|DST_uc003pdd.3_Silent_p.I952I	NM_001144769	NP_001138241	Q03001	DYST_HUMAN	dystonin isoform 2	1278					cell adhesion|cell cycle arrest|cell motility|hemidesmosome assembly|integrin-mediated signaling pathway|intermediate filament cytoskeleton organization|maintenance of cell polarity|microtubule cytoskeleton organization|response to wounding	actin cytoskeleton|axon|axon part|basement membrane|cell cortex|cell leading edge|cytoplasmic membrane-bounded vesicle|endoplasmic reticulum membrane|hemidesmosome|hemidesmosome|integral to membrane|intermediate filament|intermediate filament cytoskeleton|microtubule cytoskeleton|microtubule plus end|nuclear envelope|sarcomere|Z disc	actin binding|calcium ion binding|integrin binding|microtubule plus-end binding|protein binding|protein C-terminus binding|protein homodimerization activity			ovary(7)|central_nervous_system(6)|upper_aerodigestive_tract(1)	14	Lung NSC(77;0.103)		LUSC - Lung squamous cell carcinoma(124;0.0485)|Lung(124;0.0956)															---	---	---	---	capture		Silent	SNP	56494056	56494056	4967	6	A	T	T	5	5	DST	T	4	4
RIMS1	22999	broad.mit.edu	37	6	72806810	72806810	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:72806810G>T	uc003pga.2	+	3	481	c.404G>T	c.(403-405)TGT>TTT	p.C135F		NM_014989	NP_055804	Q86UR5	RIMS1_HUMAN	regulating synaptic membrane exocytosis 1	135	RabBD.|FYVE-type.				calcium ion-dependent exocytosis|cellular membrane fusion|glutamate secretion|intracellular protein transport|protein complex assembly|regulated secretory pathway|response to stimulus|synaptic vesicle exocytosis|visual perception	cell junction|presynaptic membrane	metal ion binding|Rab GTPase binding			ovary(7)|pancreas(2)|breast(1)	10		all_epithelial(107;0.179)|all_hematologic(105;0.212)																---	---	---	---	capture		Missense_Mutation	SNP	72806810	72806810	13844	6	G	T	T	48	48	RIMS1	T	2	2
SLC17A5	26503	broad.mit.edu	37	6	74304842	74304842	+	Silent	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:74304842T>C	uc003phn.3	-	11	1574	c.1446A>G	c.(1444-1446)GTA>GTG	p.V482V	SLC17A5_uc010kax.2_Silent_p.V141V|SLC17A5_uc010kay.2_RNA	NM_012434	NP_036566	Q9NRA2	S17A5_HUMAN	sialin	482					anion transport	integral to plasma membrane|lysosomal membrane|membrane fraction	sialic acid:hydrogen symporter activity			skin(5)|central_nervous_system(1)	6																		---	---	---	---	capture		Silent	SNP	74304842	74304842	14916	6	T	C	C	57	57	SLC17A5	C	4	4
FIG4	9896	broad.mit.edu	37	6	110107533	110107533	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:110107533G>C	uc003ptt.2	+	18	2192	c.1977G>C	c.(1975-1977)TTG>TTC	p.L659F	FIG4_uc011eau.1_Missense_Mutation_p.L382F	NM_014845	NP_055660	Q92562	FIG4_HUMAN	Sac domain-containing inositol phosphatase 3	659					cell death	endosome membrane	protein binding			ovary(1)	1		all_cancers(87;8.63e-07)|Acute lymphoblastic leukemia(125;2.66e-08)|all_hematologic(75;1.13e-06)|all_epithelial(87;0.000124)|all_lung(197;0.0187)|Colorectal(196;0.0492)|Lung SC(18;0.0548)		OV - Ovarian serous cystadenocarcinoma(136;0.0355)|Epithelial(106;0.038)|all cancers(137;0.0425)|BRCA - Breast invasive adenocarcinoma(108;0.079)														---	---	---	---	capture		Missense_Mutation	SNP	110107533	110107533	6126	6	G	C	C	45	45	FIG4	C	3	3
ROS1	6098	broad.mit.edu	37	6	117715339	117715339	+	Missense_Mutation	SNP	T	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:117715339T>A	uc003pxp.1	-	10	1349	c.1150A>T	c.(1150-1152)ATC>TTC	p.I384F	ROS1_uc011ebi.1_RNA|GOPC_uc003pxq.1_Intron	NM_002944	NP_002935	P08922	ROS_HUMAN	proto-oncogene c-ros-1 protein precursor	384	Extracellular (Potential).				transmembrane receptor protein tyrosine kinase signaling pathway	membrane fraction|sodium:potassium-exchanging ATPase complex	ATP binding|transmembrane receptor protein tyrosine kinase activity			lung(8)|ovary(6)|central_nervous_system(3)|skin(3)|stomach(2)|breast(2)|large_intestine(1)	25		all_cancers(87;0.00846)|all_epithelial(87;0.0242)		GBM - Glioblastoma multiforme(226;0.0387)|OV - Ovarian serous cystadenocarcinoma(136;0.0954)|all cancers(137;0.137)				T	GOPC|ROS1	glioblastoma|NSCLC								---	---	---	---	capture		Missense_Mutation	SNP	117715339	117715339	14010	6	T	A	A	51	51	ROS1	A	4	4
NKAIN2	154215	broad.mit.edu	37	6	124604183	124604183	+	Missense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:124604183C>A	uc003pzo.2	+	2	364	c.87C>A	c.(85-87)TTC>TTA	p.F29L	NKAIN2_uc003pzn.1_Missense_Mutation_p.F29L|NKAIN2_uc003pzp.2_Missense_Mutation_p.F28L|NKAIN2_uc010keq.2_Missense_Mutation_p.F29L|NKAIN2_uc010ker.2_5'UTR|NKAIN2_uc010kep.1_RNA	NM_001040214	NP_001035304	Q5VXU1	NKAI2_HUMAN	T-cell lymphoma breakpoint-associated target 1	29						integral to membrane|plasma membrane					0				GBM - Glioblastoma multiforme(226;0.104)														---	---	---	---	capture		Missense_Mutation	SNP	124604183	124604183	10837	6	C	A	A	30	30	NKAIN2	A	2	2
TAAR8	83551	broad.mit.edu	37	6	132874559	132874559	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132874559G>T	uc011ecj.1	+	1	728	c.728G>T	c.(727-729)AGT>ATT	p.S243I		NM_053278	NP_444508	Q969N4	TAAR8_HUMAN	trace amine associated receptor 8	243	Cytoplasmic (Potential).					plasma membrane	G-protein coupled receptor activity			ovary(1)	1	Breast(56;0.112)			OV - Ovarian serous cystadenocarcinoma(155;0.00412)|GBM - Glioblastoma multiforme(226;0.00792)														---	---	---	---	capture		Missense_Mutation	SNP	132874559	132874559	16014	6	G	T	T	36	36	TAAR8	T	2	2
TAAR6	319100	broad.mit.edu	37	6	132892023	132892023	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132892023G>C	uc011eck.1	+	1	563	c.563G>C	c.(562-564)GGA>GCA	p.G188A		NM_175067	NP_778237	Q96RI8	TAAR6_HUMAN	trace amine associated receptor 6	188	Extracellular (Potential).					plasma membrane	G-protein coupled receptor activity			ovary(2)|skin(1)	3	Breast(56;0.112)			OV - Ovarian serous cystadenocarcinoma(155;0.006)|GBM - Glioblastoma multiforme(226;0.00792)														---	---	---	---	capture		Missense_Mutation	SNP	132892023	132892023	16013	6	G	C	C	41	41	TAAR6	C	3	3
SLC22A1	6580	broad.mit.edu	37	6	160560878	160560878	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:160560878G>T	uc003qtc.2	+	7	1360	c.1255G>T	c.(1255-1257)GTC>TTC	p.V419F	SLC22A1_uc003qtd.2_Missense_Mutation_p.V419F	NM_003057	NP_003048	O15245	S22A1_HUMAN	solute carrier family 22 member 1 isoform a	419	Helical; (Potential).					basolateral plasma membrane|integral to plasma membrane|membrane fraction	organic cation transmembrane transporter activity|protein binding				0		Breast(66;0.000776)|Ovarian(120;0.00556)		OV - Ovarian serous cystadenocarcinoma(65;2.73e-17)|BRCA - Breast invasive adenocarcinoma(81;1.1e-06)														---	---	---	---	capture		Missense_Mutation	SNP	160560878	160560878	14936	6	G	T	T	40	40	SLC22A1	T	1	1
RSPH10B2	728194	broad.mit.edu	37	7	5967999	5967999	+	Silent	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:5967999G>T	uc003sph.1	-	20	2531	c.2260C>A	c.(2260-2262)CGA>AGA	p.R754R	RSPH10B2_uc003spg.1_Silent_p.R601R|RSPH10B2_uc010ktd.1_Silent_p.R754R|RSPH10B2_uc011jwk.1_Silent_p.I375I	NM_173565	NP_775836	B2RC85	R10B2_HUMAN	radial spoke head 10 homolog B	754										ovary(1)|pancreas(1)|skin(1)	3																		---	---	---	---	capture		Silent	SNP	5967999	5967999	14184	7	G	T	T	37	37	RSPH10B2	T	1	1
HOXA4	3201	broad.mit.edu	37	7	27169030	27169030	+	Silent	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27169030G>C	uc003sym.3	-	2	824	c.777C>G	c.(775-777)GTC>GTG	p.V259V	HOXA3_uc003syk.2_5'Flank	NM_002141	NP_002132	Q00056	HXA4_HUMAN	homeobox A4	259	Homeobox.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			breast(1)	1																		---	---	---	---	capture		Silent	SNP	27169030	27169030	7586	7	G	C	C	45	45	HOXA4	C	3	3
HOXA4	3201	broad.mit.edu	37	7	27169744	27169744	+	Silent	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27169744G>A	uc003sym.3	-	1	656	c.609C>T	c.(607-609)GTC>GTT	p.V203V		NM_002141	NP_002132	Q00056	HXA4_HUMAN	homeobox A4	203						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			breast(1)	1																		---	---	---	---	capture		Silent	SNP	27169744	27169744	7586	7	G	A	A	45	45	HOXA4	A	2	2
HGF	3082	broad.mit.edu	37	7	81386571	81386571	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:81386571G>T	uc003uhl.2	-	4	581	c.416C>A	c.(415-417)ACA>AAA	p.T139K	HGF_uc003uhm.2_Missense_Mutation_p.T139K|HGF_uc003uhn.1_Missense_Mutation_p.T139K|HGF_uc003uho.1_Missense_Mutation_p.T139K|HGF_uc003uhp.2_Missense_Mutation_p.T139K	NM_000601	NP_000592	P14210	HGF_HUMAN	hepatocyte growth factor isoform 1	139	Kringle 1.				epithelial to mesenchymal transition|mitosis|platelet activation|platelet degranulation|proteolysis|regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	platelet alpha granule lumen	growth factor activity|serine-type endopeptidase activity			ovary(2)|central_nervous_system(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	81386571	81386571	7369	7	G	T	T	48	48	HGF	T	2	2
PCLO	27445	broad.mit.edu	37	7	82474630	82474630	+	Missense_Mutation	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82474630G>A	uc003uhx.2	-	13	14292	c.14003C>T	c.(14002-14004)CCA>CTA	p.P4668L	PCLO_uc003uhv.2_Missense_Mutation_p.P4668L|PCLO_uc003uht.1_Missense_Mutation_p.P119L|PCLO_uc003uhu.1_Missense_Mutation_p.P98L	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	4556					cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7																		---	---	---	---	capture		Missense_Mutation	SNP	82474630	82474630	12003	7	G	A	A	47	47	PCLO	A	2	2
ZNF804B	219578	broad.mit.edu	37	7	88963284	88963284	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:88963284C>T	uc011khi.1	+	4	1526	c.988C>T	c.(988-990)CAT>TAT	p.H330Y		NM_181646	NP_857597	A4D1E1	Z804B_HUMAN	zinc finger protein 804B	330						intracellular	zinc ion binding			ovary(5)|skin(3)|pancreas(2)|upper_aerodigestive_tract(1)	11	all_hematologic(106;0.125)|Lung NSC(181;0.15)|all_lung(186;0.151)		STAD - Stomach adenocarcinoma(171;0.0513)												HNSCC(36;0.09)			---	---	---	---	capture		Missense_Mutation	SNP	88963284	88963284	18769	7	C	T	T	29	29	ZNF804B	T	2	2
ZNF3	7551	broad.mit.edu	37	7	99669079	99669079	+	Missense_Mutation	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99669079T>C	uc003usq.2	-	6	1335	c.1028A>G	c.(1027-1029)AAT>AGT	p.N343S	ZNF3_uc003usp.2_Intron|ZNF3_uc003usr.2_Missense_Mutation_p.N343S|ZNF3_uc010lgj.2_Missense_Mutation_p.N307S|ZNF3_uc003uss.2_Missense_Mutation_p.N350S|ZNF3_uc003ust.3_Missense_Mutation_p.N343S	NM_032924	NP_116313	P17036	ZNF3_HUMAN	zinc finger protein 3 isoform 2	343	C2H2-type 6.			GEKPYECNECGKAFSQSSHLYQHQRIHTGEKPYECMECGGK FTYSSGLIQHQ -> EALPTFVTLIRLLPSVDPIVTNEAAF PAESLATIFALIWRLFCVHSLMFKKV (in Ref. 2; BAA91019).	cell differentiation|leukocyte activation|multicellular organismal development	nucleus	DNA binding|identical protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)	Ovarian(593;2.06e-05)|Myeloproliferative disorder(862;0.0122)|Breast(660;0.029)	STAD - Stomach adenocarcinoma(171;0.129)															---	---	---	---	capture		Missense_Mutation	SNP	99669079	99669079	18421	7	T	C	C	52	52	ZNF3	C	4	4
TRIP6	7205	broad.mit.edu	37	7	100469219	100469219	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100469219C>T	uc003uww.2	+	7	1224	c.1054C>T	c.(1054-1056)CGG>TGG	p.R352W		NM_003302	NP_003293	Q15654	TRIP6_HUMAN	thyroid receptor-interacting protein 6	352	LIM zinc-binding 2.				focal adhesion assembly|positive regulation of cell migration|regulation of transcription, DNA-dependent|release of cytoplasmic sequestered NF-kappaB|transcription, DNA-dependent	cytoplasm|cytoskeleton|focal adhesion|nucleus	identical protein binding|interleukin-1 receptor binding|kinase binding|thyroid hormone receptor binding|zinc ion binding			central_nervous_system(2)	2	Lung NSC(181;0.041)|all_lung(186;0.0581)																	---	---	---	---	capture		Missense_Mutation	SNP	100469219	100469219	17109	7	C	T	T	27	27	TRIP6	T	1	1
COG5	10466	broad.mit.edu	37	7	107198509	107198509	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:107198509G>C	uc003ved.2	-	2	764	c.239C>G	c.(238-240)TCT>TGT	p.S80C	COG5_uc003vec.2_Missense_Mutation_p.S80C|COG5_uc003vee.2_Missense_Mutation_p.S80C	NM_181733	NP_859422	Q9UP83	COG5_HUMAN	component of oligomeric golgi complex 5 isoform	80					intra-Golgi vesicle-mediated transport|protein transport	cytosol|Golgi membrane|Golgi transport complex|nucleus	protein binding			central_nervous_system(2)|skin(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	107198509	107198509	3799	7	G	C	C	33	33	COG5	C	3	3
ZNF398	57541	broad.mit.edu	37	7	148863259	148863259	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:148863259G>T	uc003wfl.2	+	3	705	c.430G>T	c.(430-432)GCA>TCA	p.A144S	ZNF398_uc011kul.1_5'UTR|ZNF398_uc011kum.1_Missense_Mutation_p.A149S	NM_170686	NP_733787	Q8TD17	ZN398_HUMAN	zinc finger 398 isoform a	144	KRAB.				positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1	Melanoma(164;0.15)		OV - Ovarian serous cystadenocarcinoma(82;0.00143)															---	---	---	---	capture		Missense_Mutation	SNP	148863259	148863259	18478	7	G	T	T	42	42	ZNF398	T	2	2
NOM1	64434	broad.mit.edu	37	7	156743221	156743221	+	Nonsense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:156743221G>T	uc003wmy.2	+	1	805	c.790G>T	c.(790-792)GAG>TAG	p.E264*		NM_138400	NP_612409	Q5C9Z4	NOM1_HUMAN	nucleolar protein with MIF4G domain 1	264	Glu-rich.|Necessary for nucleolar localization and for targeting PPP1CA to the nucleolus.				RNA metabolic process	nucleolus	protein binding				0	Ovarian(565;0.218)	all_hematologic(28;0.0749)	OV - Ovarian serous cystadenocarcinoma(82;0.00301)	UCEC - Uterine corpus endometrioid carcinoma (81;0.169)														---	---	---	---	capture		Nonsense_Mutation	SNP	156743221	156743221	10933	7	G	T	T	41	41	NOM1	T	5	2
UNC5D	137970	broad.mit.edu	37	8	35544208	35544208	+	Silent	SNP	A	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:35544208A>G	uc003xjr.1	+	7	1393	c.1065A>G	c.(1063-1065)ACA>ACG	p.T355T	UNC5D_uc003xjs.1_Silent_p.T350T|UNC5D_uc003xjt.1_Silent_p.T124T	NM_080872	NP_543148	Q6UXZ4	UNC5D_HUMAN	unc-5 homolog D precursor	355	Extracellular (Potential).|TSP type-1 2.				apoptosis|axon guidance	integral to membrane	receptor activity			upper_aerodigestive_tract(2)|ovary(2)|pancreas(1)|skin(1)	6				READ - Rectum adenocarcinoma(1;1.31e-05)|Colorectal(1;0.000723)														---	---	---	---	capture		Silent	SNP	35544208	35544208	17553	8	A	G	G	7	7	UNC5D	G	4	4
OPRK1	4986	broad.mit.edu	37	8	54147415	54147415	+	Missense_Mutation	SNP	G	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:54147415G>T	uc003xrh.1	-	2	889	c.514C>A	c.(514-516)CCC>ACC	p.P172T	OPRK1_uc003xri.1_Missense_Mutation_p.P172T|OPRK1_uc010lyc.1_Missense_Mutation_p.P83T	NM_000912	NP_000903	P41145	OPRK_HUMAN	opioid receptor, kappa 1	172	Cytoplasmic (Potential).				behavior|immune response|inhibition of adenylate cyclase activity by G-protein signaling pathway|sensory perception|synaptic transmission|viral genome replication	integral to plasma membrane	kappa-opioid receptor activity|protein binding			ovary(1)|skin(1)	2		all_epithelial(80;0.066)|Lung NSC(129;0.0804)|all_lung(136;0.136)			Buprenorphine(DB00921)|Butorphanol(DB00611)|Cocaine(DB00907)|Codeine(DB00318)|Dezocine(DB01209)|Hydrocodone(DB00956)|Hydromorphone(DB00327)|Meperidine(DB00454)|Mirtazapine(DB00370)|Morphine(DB00295)|Nalbuphine(DB00844)|Naltrexone(DB00704)|Oxycodone(DB00497)|Pentazocine(DB00652)|Propoxyphene(DB00647)|Tramadol(DB00193)													---	---	---	---	capture		Missense_Mutation	SNP	54147415	54147415	11291	8	G	T	T	44	44	OPRK1	T	2	2
ZFHX4	79776	broad.mit.edu	37	8	77767225	77767225	+	Silent	SNP	T	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77767225T>C	uc003yav.2	+	10	8320	c.7933T>C	c.(7933-7935)TTA>CTA	p.L2645L	ZFHX4_uc003yau.1_Silent_p.L2690L|ZFHX4_uc003yaw.1_Silent_p.L2645L	NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	2645	C2H2-type 17.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)												HNSCC(33;0.089)			---	---	---	---	capture		Silent	SNP	77767225	77767225	18223	8	T	C	C	56	56	ZFHX4	C	4	4
PTPRD	5789	broad.mit.edu	37	9	8504320	8504320	+	Missense_Mutation	SNP	C	A	A	rs150553394		TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:8504320C>A	uc003zkk.2	-	22	2474	c.1763G>T	c.(1762-1764)CGC>CTC	p.R588L	PTPRD_uc003zkp.2_Missense_Mutation_p.R588L|PTPRD_uc003zkq.2_Missense_Mutation_p.R588L|PTPRD_uc003zkr.2_Missense_Mutation_p.R582L|PTPRD_uc003zks.2_Missense_Mutation_p.R578L|PTPRD_uc003zkl.2_Missense_Mutation_p.R588L|PTPRD_uc003zkm.2_Missense_Mutation_p.R575L|PTPRD_uc003zkn.2_Missense_Mutation_p.R588L|PTPRD_uc003zko.2_Missense_Mutation_p.R585L	NM_002839	NP_002830	P23468	PTPRD_HUMAN	protein tyrosine phosphatase, receptor type, D	588	Fibronectin type-III 3.|Extracellular (Potential).				transmembrane receptor protein tyrosine phosphatase signaling pathway	integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			lung(14)|large_intestine(3)|ovary(2)|breast(2)|urinary_tract(1)	22		all_cancers(3;3.38e-95)|all_epithelial(3;2.84e-91)|all_lung(3;7.3e-56)|Lung NSC(3;1.82e-52)|Renal(3;3.42e-19)|all_hematologic(3;0.000134)|all_neural(3;0.00409)|Acute lymphoblastic leukemia(23;0.0069)|Melanoma(3;0.0121)|Myeloproliferative disorder(4;0.0122)|Medulloblastoma(3;0.0144)|Lung SC(3;0.0301)|Ovarian(56;0.0694)|Hepatocellular(3;0.0824)		all cancers(1;3.38e-12)|Epithelial(1;2.12e-09)|STAD - Stomach adenocarcinoma(1;1.29e-07)|KIRC - Kidney renal clear cell carcinoma(3;5.49e-07)|Kidney(3;6.36e-07)|GBM - Glioblastoma multiforme(50;9.05e-05)|Lung(1;0.000189)|BRCA - Breast invasive adenocarcinoma(1;0.00178)|LUSC - Lung squamous cell carcinoma(1;0.0115)|LUAD - Lung adenocarcinoma(58;0.119)											TSP Lung(15;0.13)			---	---	---	---	capture		Missense_Mutation	SNP	8504320	8504320	13256	9	C	A	A	27	27	PTPRD	A	1	1
TAF1L	138474	broad.mit.edu	37	9	32635551	32635551	+	Silent	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:32635551C>T	uc003zrg.1	-	1	117	c.27G>A	c.(25-27)CTG>CTA	p.L9L	uc003zrh.1_Intron	NM_153809	NP_722516	Q8IZX4	TAF1L_HUMAN	TBP-associated factor RNA polymerase 1-like	9					male meiosis|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription initiation, DNA-dependent	transcription factor TFIID complex	DNA binding|histone acetyltransferase activity|protein serine/threonine kinase activity|TBP-class protein binding			lung(8)|skin(6)|central_nervous_system(4)|large_intestine(3)|ovary(2)|stomach(1)|breast(1)|pancreas(1)	26			LUSC - Lung squamous cell carcinoma(29;0.0181)	GBM - Glioblastoma multiforme(74;0.00301)														---	---	---	---	capture		Silent	SNP	32635551	32635551	16044	9	C	T	T	29	29	TAF1L	T	2	2
ASTN2	23245	broad.mit.edu	37	9	119976953	119976953	+	Missense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:119976953C>A	uc004bjs.1	-	3	800	c.699G>T	c.(697-699)TGG>TGT	p.W233C	ASTN2_uc004bjr.1_Missense_Mutation_p.W233C|ASTN2_uc004bjt.1_Missense_Mutation_p.W233C	NM_198187	NP_937830	O75129	ASTN2_HUMAN	astrotactin 2 isoform c	233	Cytoplasmic (Potential).					integral to membrane				skin(4)|ovary(3)|breast(1)|kidney(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	119976953	119976953	1084	9	C	A	A	26	26	ASTN2	A	2	2
C9orf78	51759	broad.mit.edu	37	9	132597006	132597006	+	Missense_Mutation	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:132597006C>A	uc004byp.2	-	2	195	c.123G>T	c.(121-123)AGG>AGT	p.R41S	C9orf78_uc004byo.2_5'Flank|C9orf78_uc004byq.1_5'Flank|USP20_uc004bys.2_5'Flank|USP20_uc004byr.2_5'Flank|USP20_uc004byt.1_5'Flank	NM_016520	NP_057604	Q9NZ63	CI078_HUMAN	chromosome 9 open reading frame 78	41											0		Ovarian(14;0.00556)																---	---	---	---	capture		Missense_Mutation	SNP	132597006	132597006	2612	9	C	A	A	30	30	C9orf78	A	2	2
FAM47C	442444	broad.mit.edu	37	X	37028784	37028784	+	Silent	SNP	T	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:37028784T>A	uc004ddl.1	+	1	2315	c.2301T>A	c.(2299-2301)CCT>CCA	p.P767P		NM_001013736	NP_001013758	Q5HY64	FA47C_HUMAN	hypothetical protein LOC442444	767										ovary(3)	3																		---	---	---	---	capture		Silent	SNP	37028784	37028784	5792	23	T	A	A	55	55	FAM47C	A	4	4
MAGEE1	57692	broad.mit.edu	37	X	75649243	75649243	+	Missense_Mutation	SNP	C	T	T			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:75649243C>T	uc004ecm.1	+	1	1127	c.920C>T	c.(919-921)TCC>TTC	p.S307F		NM_020932	NP_065983	Q9HCI5	MAGE1_HUMAN	melanoma antigen family E, 1	307	Pro-rich.					dendrite|nucleus|perinuclear region of cytoplasm|postsynaptic membrane				breast(3)|ovary(1)|pancreas(1)|skin(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	75649243	75649243	9568	23	C	T	T	30	30	MAGEE1	T	2	2
P2RY10	27334	broad.mit.edu	37	X	78216453	78216453	+	Missense_Mutation	SNP	C	G	G			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:78216453C>G	uc004ede.2	+	4	805	c.436C>G	c.(436-438)CGT>GGT	p.R146G	P2RY10_uc004edf.2_Missense_Mutation_p.R146G	NM_014499	NP_055314	O00398	P2Y10_HUMAN	G-protein coupled purinergic receptor P2Y10	146	Cytoplasmic (Potential).					integral to membrane|plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			ovary(2)|lung(2)|breast(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	78216453	78216453	11760	23	C	G	G	27	27	P2RY10	G	3	3
DOCK11	139818	broad.mit.edu	37	X	117788715	117788715	+	Missense_Mutation	SNP	G	C	C			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:117788715G>C	uc004eqp.2	+	43	4909	c.4846G>C	c.(4846-4848)GAG>CAG	p.E1616Q	DOCK11_uc004eqq.2_Missense_Mutation_p.E1395Q	NM_144658	NP_653259	Q5JSL3	DOC11_HUMAN	dedicator of cytokinesis 11	1616	DHR-2.				blood coagulation	cytosol	GTP binding			ovary(3)	3																		---	---	---	---	capture		Missense_Mutation	SNP	117788715	117788715	4870	23	G	C	C	33	33	DOCK11	C	3	3
GRIA3	2892	broad.mit.edu	37	X	122528848	122528848	+	Silent	SNP	C	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:122528848C>A	uc004etq.3	+	7	1073	c.780C>A	c.(778-780)GTC>GTA	p.V260V	GRIA3_uc004etr.3_Silent_p.V260V|GRIA3_uc004ets.3_RNA|GRIA3_uc011muf.1_Silent_p.V244V	NM_007325	NP_015564	P42263	GRIA3_HUMAN	glutamate receptor, ionotrophic, AMPA 3 isoform	260	Extracellular (Potential).				glutamate signaling pathway|synaptic transmission	alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex|cell junction|endocytic vesicle membrane|postsynaptic membrane	alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|extracellular-glutamate-gated ion channel activity			ovary(3)|central_nervous_system(1)|pancreas(1)	5					L-Glutamic Acid(DB00142)													---	---	---	---	capture		Silent	SNP	122528848	122528848	7047	23	C	A	A	29	29	GRIA3	A	2	2
BCORL1	63035	broad.mit.edu	37	X	129159314	129159314	+	Silent	SNP	G	A	A			TCGA-56-5897-01	TCGA-56-5897-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:129159314G>A	uc004evb.1	+	7	4152	c.4038G>A	c.(4036-4038)CTG>CTA	p.L1346L	BCORL1_uc010nrd.1_Intron|BCORL1_uc004evc.1_Silent_p.L108L	NM_021946	NP_068765	Q5H9F3	BCORL_HUMAN	BCL6 co-repressor-like 1	1346					chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus				ovary(4)|breast(2)|lung(1)	7																		---	---	---	---	capture		Silent	SNP	129159314	129159314	1408	23	G	A	A	45	45	BCORL1	A	2	2
