Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	dataset	MUTSIG_Significant_Genes	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	context_orig	context65	gene_name	newbase	categ	categ_ignoring_null_categ
KDR	3791	broad.mit.edu	37	4	55981484	55981485	+	Missense_Mutation	DNP	GA	TC	TC			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:55981484_55981485GA>TC	uc003has.2	-	4	754_755	c.452_453TC>GA	c.(451-453)CTC>CGA	p.L151R	KDR_uc003hat.1_Missense_Mutation_p.L151R|KDR_uc011bzx.1_Missense_Mutation_p.L151R	NM_002253	NP_002244	P35968	VGFR2_HUMAN	kinase insert domain receptor precursor	151	Ig-like C2-type 2.|Extracellular (Potential).				angiogenesis|cell differentiation|interspecies interaction between organisms|positive regulation of endothelial cell migration|positive regulation of endothelial cell proliferation|positive regulation of focal adhesion assembly|positive regulation of positive chemotaxis|regulation of cell shape	integral to plasma membrane	ATP binding|growth factor binding|Hsp90 protein binding|integrin binding|receptor signaling protein tyrosine kinase activity|vascular endothelial growth factor receptor activity			lung(16)|soft_tissue(4)|central_nervous_system(4)|large_intestine(2)|stomach(2)|skin(2)|ovary(2)|kidney(1)	33	all_cancers(7;0.0255)|all_lung(4;0.00175)|Lung NSC(11;0.00384)|all_epithelial(27;0.034)|Glioma(25;0.08)|all_neural(26;0.101)		Epithelial(7;0.189)		Sorafenib(DB00398)|Sunitinib(DB01268)			Mis		NSCLC|angiosarcoma				Familial_Infantile_Hemangioma	TSP Lung(20;0.16)			---	---	---	---	capture		Missense_Mutation	DNP	55981484	55981485	8445	4	GA	TC	TC	37	37	KDR	TC	1	1
C6	729	broad.mit.edu	37	5	41181632	41181633	+	Missense_Mutation	DNP	TG	AC	AC			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41181632_41181633TG>AC	uc003jmk.2	-	7	965_966	c.755_756CA>GT	c.(754-756)ACA>AGT	p.T252S	C6_uc003jml.1_Missense_Mutation_p.T252S	NM_000065	NP_000056	P13671	CO6_HUMAN	complement component 6 precursor	252	MACPF.				complement activation, classical pathway|cytolysis|innate immune response	membrane attack complex	protein binding			ovary(3)|central_nervous_system(2)|skin(2)	7		Breast(839;1.07e-05)|Ovarian(839;0.0228)|Lung SC(612;0.0548)|Lung NSC(810;0.128)|all_neural(839;0.157)																---	---	---	---	capture		Missense_Mutation	DNP	41181632	41181633	2416	5	TG	AC	AC	55	55	C6	AC	4	4
CD19	930	broad.mit.edu	37	16	28944602	28944602	+	Frame_Shift_Del	DEL	C	-	-			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28944602delC	uc002drs.2	+	4	669	c.607delC	c.(607-609)CCCfs	p.P203fs	uc010vct.1_Intron|CD19_uc010byo.1_Frame_Shift_Del_p.P203fs	NM_001770	NP_001761	P15391	CD19_HUMAN	CD19 antigen precursor	203	Extracellular (Potential).|Ig-like C2-type 2.				cellular defense response	external side of plasma membrane|integral to plasma membrane	protein binding|receptor signaling protein activity			ovary(2)|central_nervous_system(1)	3																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	28944602	28944602	3100	16	C	-	-	18	18	CD19	-	5	5
RASAL3	64926	broad.mit.edu	37	19	15564239	15564239	+	Frame_Shift_Del	DEL	G	-	-			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15564239delG	uc002nbe.2	-	15	2435	c.2349delC	c.(2347-2349)TCCfs	p.S783fs	RASAL3_uc002nbd.2_Frame_Shift_Del_p.S123fs|RASAL3_uc010eaa.1_Frame_Shift_Del_p.S271fs	NM_022904	NP_075055	Q86YV0	RASL3_HUMAN	RAS protein activator like 3	783					negative regulation of Ras protein signal transduction|signal transduction	cytoplasm|intrinsic to internal side of plasma membrane	Ras GTPase activator activity				0																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	15564239	15564239	13526	19	G	-	-	47	47	RASAL3	-	5	5
NLRP5	126206	broad.mit.edu	37	19	56539152	56539152	+	Frame_Shift_Del	DEL	G	-	-			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56539152delG	uc002qmj.2	+	7	1553	c.1553delG	c.(1552-1554)CGCfs	p.R518fs	NLRP5_uc002qmi.2_Frame_Shift_Del_p.R499fs	NM_153447	NP_703148	P59047	NALP5_HUMAN	NACHT, LRR and PYD containing protein 5	518	NACHT.					mitochondrion|nucleolus	ATP binding			ovary(3)|skin(2)|kidney(1)|central_nervous_system(1)	7		Colorectal(82;3.46e-05)|Ovarian(87;0.0481)|Renal(1328;0.157)		GBM - Glioblastoma multiforme(193;0.0326)														---	---	---	---	capture_indel		Frame_Shift_Del	DEL	56539152	56539152	10883	19	G	-	-	38	38	NLRP5	-	5	5
PACSIN1	29993	broad.mit.edu	37	6	34500248	34500248	+	Frame_Shift_Del	DEL	G	-	-			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34500248delG	uc003ojo.2	+	10	1482	c.1276delG	c.(1276-1278)GGGfs	p.G426fs	PACSIN1_uc003ojp.2_Frame_Shift_Del_p.G426fs	NM_020804	NP_065855	Q9BY11	PACN1_HUMAN	protein kinase C and casein kinase substrate in	426	SH3.				endocytosis		protein kinase activity				0																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	34500248	34500248	11790	6	G	-	-	47	47	PACSIN1	-	5	5
COL22A1	169044	broad.mit.edu	37	8	139603731	139603731	+	Frame_Shift_Del	DEL	G	-	-			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139603731delG	uc003yvd.2	-	64	5076	c.4629delC	c.(4627-4629)GCCfs	p.A1543fs	COL22A1_uc011ljo.1_Frame_Shift_Del_p.A823fs	NM_152888	NP_690848	Q8NFW1	COMA1_HUMAN	collagen, type XXII, alpha 1	1543	Pro-rich.|Gly-rich.|Collagen-like 15.				cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)												HNSCC(7;0.00092)			---	---	---	---	capture_indel		Frame_Shift_Del	DEL	139603731	139603731	3819	8	G	-	-	47	47	COL22A1	-	5	5
MMGT1	93380	broad.mit.edu	37	X	135053241	135053241	+	Frame_Shift_Del	DEL	T	-	-			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135053241delT	uc004ezi.1	-	2	408	c.108delA	c.(106-108)AAAfs	p.K36fs	MMGT1_uc011mvw.1_Frame_Shift_Del_p.K101fs	NM_173470	NP_775741	Q8N4V1	MMGT1_HUMAN	membrane magnesium transporter 1 precursor	36	Lumenal (Potential).					early endosome membrane|endoplasmic reticulum membrane|Golgi membrane|integral to membrane	magnesium ion transmembrane transporter activity				0																		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	135053241	135053241	10037	23	T	-	-	56	56	MMGT1	-	5	5
SPEN	23013	broad.mit.edu	37	1	16256690	16256690	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16256690C>T	uc001axk.1	+	11	4159	c.3955C>T	c.(3955-3957)CAG>TAG	p.Q1319*	SPEN_uc010obp.1_Nonsense_Mutation_p.Q1278*	NM_015001	NP_055816	Q96T58	MINT_HUMAN	spen homolog, transcriptional regulator	1319					interspecies interaction between organisms|negative regulation of transcription, DNA-dependent|Notch signaling pathway	nucleus	nucleotide binding|protein binding|RNA binding			ovary(6)|breast(3)|lung(2)|skin(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	15		Colorectal(325;0.000258)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.000567)|Ovarian(437;0.0129)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0185)|Colorectal(212;5.96e-07)|COAD - Colon adenocarcinoma(227;3.11e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000115)|Kidney(64;0.000212)|KIRC - Kidney renal clear cell carcinoma(64;0.003)|STAD - Stomach adenocarcinoma(313;0.013)|READ - Rectum adenocarcinoma(331;0.0681)														---	---	---	---	capture		Nonsense_Mutation	SNP	16256690	16256690	15550	1	C	T	T	17	17	SPEN	T	5	2
HSPG2	3339	broad.mit.edu	37	1	22166424	22166424	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:22166424C>T	uc001bfj.2	-	72	9640	c.9600G>A	c.(9598-9600)GTG>GTA	p.V3200V	HSPG2_uc009vqd.2_Silent_p.V3201V	NM_005529	NP_005520	P98160	PGBM_HUMAN	heparan sulfate proteoglycan 2 precursor	3200	Ig-like C2-type 17.				angiogenesis|cell adhesion|lipid metabolic process|lipoprotein metabolic process	basement membrane|extracellular space|plasma membrane	protein C-terminus binding			ovary(5)|large_intestine(2)|central_nervous_system(1)|skin(1)	9		Colorectal(325;3.46e-05)|all_lung(284;7.93e-05)|Lung NSC(340;8.71e-05)|Renal(390;0.000219)|Breast(348;0.00222)|Ovarian(437;0.00308)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0498)|OV - Ovarian serous cystadenocarcinoma(117;1.14e-26)|Colorectal(126;4.18e-07)|COAD - Colon adenocarcinoma(152;1.82e-05)|GBM - Glioblastoma multiforme(114;3.13e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000756)|STAD - Stomach adenocarcinoma(196;0.00656)|KIRC - Kidney renal clear cell carcinoma(1967;0.00942)|READ - Rectum adenocarcinoma(331;0.0721)|Lung(427;0.223)	Becaplermin(DB00102)|Palifermin(DB00039)													---	---	---	---	capture		Silent	SNP	22166424	22166424	7730	1	C	T	T	29	29	HSPG2	T	2	2
TCEB3	6924	broad.mit.edu	37	1	24083468	24083468	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24083468G>T	uc001bho.2	+	10	2248	c.2188G>T	c.(2188-2190)GGA>TGA	p.G730*		NM_003198	NP_003189	Q14241	ELOA1_HUMAN	elongin A	730					positive regulation of viral transcription|regulation of transcription from RNA polymerase II promoter|transcription elongation from RNA polymerase II promoter|viral reproduction	integral to membrane	DNA binding			ovary(1)	1		Colorectal(325;3.46e-05)|Lung NSC(340;0.000112)|all_lung(284;0.00016)|Renal(390;0.000219)|Breast(348;0.0044)|Ovarian(437;0.00539)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0227)|OV - Ovarian serous cystadenocarcinoma(117;2.42e-24)|Colorectal(126;5.5e-08)|COAD - Colon adenocarcinoma(152;3.09e-06)|GBM - Glioblastoma multiforme(114;4.74e-06)|BRCA - Breast invasive adenocarcinoma(304;0.000973)|KIRC - Kidney renal clear cell carcinoma(1967;0.00334)|STAD - Stomach adenocarcinoma(196;0.0127)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.0853)|LUSC - Lung squamous cell carcinoma(448;0.187)														---	---	---	---	capture		Nonsense_Mutation	SNP	24083468	24083468	16207	1	G	T	T	43	43	TCEB3	T	5	2
TMEM54	113452	broad.mit.edu	37	1	33363913	33363913	+	Silent	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:33363913C>G	uc001bwi.1	-	2	138	c.24G>C	c.(22-24)CTG>CTC	p.L8L	TMEM54_uc001bwj.1_Silent_p.L8L|TMEM54_uc001bwk.1_Silent_p.L8L	NM_033504	NP_277039	Q969K7	TMM54_HUMAN	transmembrane protein 54	8						integral to membrane					0		Myeloproliferative disorder(586;0.0393)|all_neural(195;0.186)																---	---	---	---	capture		Silent	SNP	33363913	33363913	16719	1	C	G	G	29	29	TMEM54	G	3	3
EPHA10	284656	broad.mit.edu	37	1	38197177	38197177	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:38197177G>A	uc009vvi.2	-	7	1655	c.1569C>T	c.(1567-1569)ACC>ACT	p.T523T	EPHA10_uc009vvh.1_RNA|EPHA10_uc001cbu.2_RNA|EPHA10_uc001cbv.1_RNA	NM_001099439	NP_001092909	Q5JZY3	EPHAA_HUMAN	EPH receptor A10 isofom 3	523	Fibronectin type-III 2.|Extracellular (Potential).					extracellular region|integral to membrane|integral to plasma membrane	ATP binding|ephrin receptor activity|protein binding|transmembrane-ephrin receptor activity			breast(4)|stomach(3)|lung(1)	8	Acute lymphoblastic leukemia(166;0.074)|all_hematologic(146;0.197)	Myeloproliferative disorder(586;0.0255)|all_neural(195;0.164)																---	---	---	---	capture		Silent	SNP	38197177	38197177	5359	1	G	A	A	43	43	EPHA10	A	2	2
DMAP1	55929	broad.mit.edu	37	1	44685139	44685139	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44685139G>T	uc001clq.1	+	8	1048	c.968G>T	c.(967-969)CGG>CTG	p.R323L	DMAP1_uc001clr.1_Missense_Mutation_p.R323L|DMAP1_uc001cls.1_Missense_Mutation_p.R323L|DMAP1_uc010oku.1_Missense_Mutation_p.R313L	NM_001034024	NP_001029196	Q9NPF5	DMAP1_HUMAN	DNA methyltransferase 1 associated protein 1	323					DNA methylation|histone H2A acetylation|histone H4 acetylation|negative regulation of transcription, DNA-dependent|regulation of growth|transcription, DNA-dependent	NuA4 histone acetyltransferase complex	DNA binding|protein binding				0	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---	capture		Missense_Mutation	SNP	44685139	44685139	4756	1	G	T	T	39	39	DMAP1	T	1	1
BEND5	79656	broad.mit.edu	37	1	49224681	49224681	+	Silent	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:49224681T>C	uc001crx.3	-	3	680	c.636A>G	c.(634-636)GTA>GTG	p.V212V	AGBL4_uc001cru.2_Intron|AGBL4_uc010omw.1_Intron|AGBL4_uc010omx.1_Intron|AGBL4_uc001crv.1_Intron|AGBL4_uc010omy.1_Intron|BEND5_uc001crw.3_Silent_p.V43V	NM_024603	NP_078879	Q7L4P6	BEND5_HUMAN	BEN domain containing 5	212	Potential.									skin(1)	1																		---	---	---	---	capture		Silent	SNP	49224681	49224681	1424	1	T	C	C	57	57	BEND5	C	4	4
OMA1	115209	broad.mit.edu	37	1	58999665	58999665	+	Missense_Mutation	SNP	A	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:58999665A>C	uc001cyy.2	-	5	1059	c.971T>G	c.(970-972)CTT>CGT	p.L324R	DAB1_uc001cyt.1_Intron|OMA1_uc001cyx.1_Missense_Mutation_p.L324R|OMA1_uc009vzz.2_Missense_Mutation_p.L324R	NM_145243	NP_660286	Q96E52	OMA1_HUMAN	OMA1 homolog, zinc metallopeptidase precursor	324					proteolysis	integral to membrane|mitochondrial membrane	metal ion binding|metalloendopeptidase activity			large_intestine(1)	1	all_cancers(7;6.54e-05)																	---	---	---	---	capture		Missense_Mutation	SNP	58999665	58999665	11269	1	A	C	C	3	3	OMA1	C	4	4
LRRIQ3	127255	broad.mit.edu	37	1	74648474	74648474	+	Silent	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:74648474A>G	uc001dfy.3	-	3	513	c.321T>C	c.(319-321)AAT>AAC	p.N107N	LRRIQ3_uc001dfz.3_RNA	NM_001105659	NP_001099129	A6PVS8	LRIQ3_HUMAN	leucine-rich repeats and IQ motif containing 3	107	LRR 3.									ovary(2)	2																		---	---	---	---	capture		Silent	SNP	74648474	74648474	9406	1	A	G	G	8	8	LRRIQ3	G	4	4
ABCA4	24	broad.mit.edu	37	1	94577027	94577027	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:94577027G>C	uc001dqh.2	-	3	373	c.269C>G	c.(268-270)TCT>TGT	p.S90C	ABCA4_uc010otn.1_Missense_Mutation_p.S90C	NM_000350	NP_000341	P78363	ABCA4_HUMAN	ATP-binding cassette, sub-family A member 4	90	Extracellular.				phototransduction, visible light|visual perception	integral to plasma membrane|membrane fraction	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(4)|skin(4)|central_nervous_system(2)|upper_aerodigestive_tract(1)|breast(1)	12		all_lung(203;0.000757)|Lung NSC(277;0.00335)		all cancers(265;0.00432)|GBM - Glioblastoma multiforme(16;0.00715)|Epithelial(280;0.171)														---	---	---	---	capture		Missense_Mutation	SNP	94577027	94577027	35	1	G	C	C	33	33	ABCA4	C	3	3
FAM40A	85369	broad.mit.edu	37	1	110586460	110586460	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110586460C>A	uc001dza.1	+	10	1287	c.1268C>A	c.(1267-1269)CCG>CAG	p.P423Q	FAM40A_uc001dyz.1_Missense_Mutation_p.P328Q|FAM40A_uc009wfp.1_Missense_Mutation_p.P247Q	NM_033088	NP_149079	Q5VSL9	FA40A_HUMAN	hypothetical protein LOC85369	423						nucleus	protein binding			ovary(3)|large_intestine(1)	4		all_cancers(81;8.51e-05)|all_epithelial(167;3.58e-05)|all_lung(203;0.000116)|Lung NSC(277;0.000233)		Lung(183;0.0154)|all cancers(265;0.0732)|Epithelial(280;0.0781)|Colorectal(144;0.115)|LUSC - Lung squamous cell carcinoma(189;0.137)														---	---	---	---	capture		Missense_Mutation	SNP	110586460	110586460	5781	1	C	A	A	23	23	FAM40A	A	1	1
KCNA3	3738	broad.mit.edu	37	1	111216341	111216341	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:111216341C>A	uc001dzv.1	-	1	1315	c.1091G>T	c.(1090-1092)AGG>ATG	p.R364M		NM_002232	NP_002223	P22001	KCNA3_HUMAN	potassium voltage-gated channel, shaker-related	364	Helical; Voltage-sensor; Name=Segment S4; (Potential).					voltage-gated potassium channel complex	delayed rectifier potassium channel activity			ovary(4)|pancreas(1)	5		all_cancers(81;3.92e-06)|all_epithelial(167;1.28e-05)|all_lung(203;0.000199)|Lung NSC(277;0.000398)		Lung(183;0.0235)|Colorectal(144;0.0306)|all cancers(265;0.0752)|Epithelial(280;0.0821)|COAD - Colon adenocarcinoma(174;0.132)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---	capture		Missense_Mutation	SNP	111216341	111216341	8309	1	C	A	A	24	24	KCNA3	A	2	2
UBQLN4	56893	broad.mit.edu	37	1	156020106	156020106	+	Silent	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156020106G>C	uc001fna.2	-	4	741	c.717C>G	c.(715-717)CTC>CTG	p.L239L	UBQLN4_uc010pgx.1_Silent_p.L219L	NM_020131	NP_064516	Q9NRR5	UBQL4_HUMAN	ataxin-1 ubiquitin-like interacting protein	239						cytosol|endoplasmic reticulum membrane|nucleus	identical protein binding			pancreas(1)|skin(1)	2	Hepatocellular(266;0.133)|all_neural(408;0.195)																	---	---	---	---	capture		Silent	SNP	156020106	156020106	17457	1	G	C	C	45	45	UBQLN4	C	3	3
MNDA	4332	broad.mit.edu	37	1	158813151	158813151	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158813151C>A	uc001fsz.1	+	3	548	c.348C>A	c.(346-348)CCC>CCA	p.P116P		NM_002432	NP_002423	P41218	MNDA_HUMAN	myeloid cell nuclear differentiation antigen	116					B cell receptor signaling pathway|cellular defense response|negative regulation of B cell proliferation|positive regulation of apoptosis|regulation of transcription, DNA-dependent|response to DNA damage stimulus|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding			ovary(2)|skin(2)	4	all_hematologic(112;0.0378)																	---	---	---	---	capture		Silent	SNP	158813151	158813151	10067	1	C	A	A	21	21	MNDA	A	2	2
SLAMF8	56833	broad.mit.edu	37	1	159799840	159799840	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:159799840C>T	uc001fue.3	+	2	435	c.225C>T	c.(223-225)CGC>CGT	p.R75R		NM_020125	NP_064510	Q9P0V8	SLAF8_HUMAN	SLAM family member 8 precursor	75	Extracellular (Potential).					integral to membrane					0	all_hematologic(112;0.0597)																	---	---	---	---	capture		Silent	SNP	159799840	159799840	14865	1	C	T	T	28	28	SLAMF8	T	2	2
NCSTN	23385	broad.mit.edu	37	1	160325486	160325486	+	Missense_Mutation	SNP	T	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160325486T>G	uc001fvx.2	+	12	1518	c.1394T>G	c.(1393-1395)GTG>GGG	p.V465G	NCSTN_uc001fvy.2_Missense_Mutation_p.V445G|NCSTN_uc010pjf.1_Missense_Mutation_p.V327G|NCSTN_uc001fvz.2_Missense_Mutation_p.V245G|NCSTN_uc010pjg.1_Missense_Mutation_p.V207G	NM_015331	NP_056146	Q92542	NICA_HUMAN	nicastrin precursor	465	Extracellular (Potential).				amyloid precursor protein catabolic process|apoptosis|induction of apoptosis by extracellular signals|membrane protein ectodomain proteolysis|membrane protein intracellular domain proteolysis|nerve growth factor receptor signaling pathway|Notch receptor processing|Notch signaling pathway|positive regulation of catalytic activity|protein processing	endoplasmic reticulum|Golgi apparatus|integral to plasma membrane|melanosome	protein binding			ovary(1)|lung(1)	2	all_cancers(52;8.15e-18)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.111)															---	---	---	---	capture		Missense_Mutation	SNP	160325486	160325486	10640	1	T	G	G	59	59	NCSTN	G	4	4
SERPINC1	462	broad.mit.edu	37	1	173880967	173880967	+	Silent	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173880967A>G	uc001gjt.2	-	3	713	c.594T>C	c.(592-594)TAT>TAC	p.Y198Y		NM_000488	NP_000479	P01008	ANT3_HUMAN	serpin peptidase inhibitor, clade C, member 1	198			Y -> C (in AT3D; type-I and -II; Whitechapel).|Y -> H (in AT3D; type-I).		blood coagulation|regulation of proteolysis	extracellular space|plasma membrane	heparin binding|protease binding|serine-type endopeptidase inhibitor activity			ovary(1)	1					Enoxaparin(DB01225)|Fondaparinux sodium(DB00569)|Heparin(DB01109)													---	---	---	---	capture		Silent	SNP	173880967	173880967	14597	1	A	G	G	8	8	SERPINC1	G	4	4
TNR	7143	broad.mit.edu	37	1	175360549	175360549	+	Missense_Mutation	SNP	T	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:175360549T>G	uc001gkp.1	-	5	1463	c.1382A>C	c.(1381-1383)CAG>CCG	p.Q461P	TNR_uc009wwu.1_Missense_Mutation_p.Q461P	NM_003285	NP_003276	Q92752	TENR_HUMAN	tenascin R precursor	461	Fibronectin type-III 2.				axon guidance|cell adhesion|signal transduction	proteinaceous extracellular matrix				pancreas(5)|ovary(4)|central_nervous_system(1)|skin(1)	11	Renal(580;0.146)																	---	---	---	---	capture		Missense_Mutation	SNP	175360549	175360549	16879	1	T	G	G	55	55	TNR	G	4	4
PAPPA2	60676	broad.mit.edu	37	1	176738877	176738877	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:176738877G>A	uc001gkz.2	+	16	5622	c.4458G>A	c.(4456-4458)CTG>CTA	p.L1486L	PAPPA2_uc009www.2_RNA	NM_020318	NP_064714	Q9BXP8	PAPP2_HUMAN	pappalysin 2 isoform 1	1486	Sushi 2.				cell differentiation|proteolysis|regulation of cell growth	extracellular region|intracellular|membrane	metalloendopeptidase activity|zinc ion binding			ovary(7)|central_nervous_system(5)|skin(2)|lung(1)|breast(1)	16																		---	---	---	---	capture		Silent	SNP	176738877	176738877	11850	1	G	A	A	45	45	PAPPA2	A	2	2
FAM5B	57795	broad.mit.edu	37	1	177250597	177250597	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:177250597C>A	uc001glf.2	+	8	2597	c.2285C>A	c.(2284-2286)TCC>TAC	p.S762Y	FAM5B_uc001glg.2_Missense_Mutation_p.S657Y	NM_021165	NP_066988	Q9C0B6	FAM5B_HUMAN	family with sequence similarity 5, member B	762						extracellular region				skin(3)|ovary(2)|upper_aerodigestive_tract(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	177250597	177250597	5816	1	C	A	A	30	30	FAM5B	A	2	2
NPHS2	7827	broad.mit.edu	37	1	179526328	179526328	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:179526328G>T	uc001gmq.3	-	5	657	c.572C>A	c.(571-573)GCC>GAC	p.A191D	NPHS2_uc009wxi.2_Intron	NM_014625	NP_055440	Q9NP85	PODO_HUMAN	podocin	191	Cytoplasmic (Potential).				excretion	integral to plasma membrane	protein binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	179526328	179526328	10987	1	G	T	T	42	42	NPHS2	T	2	2
QSOX1	5768	broad.mit.edu	37	1	180163472	180163472	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:180163472C>T	uc001gnz.2	+	11	1488	c.1413C>T	c.(1411-1413)AAC>AAT	p.N471N	QSOX1_uc001gny.2_Silent_p.N471N|QSOX1_uc001goa.2_Silent_p.N471N|QSOX1_uc001goc.2_Silent_p.N13N	NM_002826	NP_002817	O00391	QSOX1_HUMAN	quiescin Q6 sulfhydryl oxidase 1 isoform a	471	ERV/ALR sulfhydryl oxidase.				cell redox homeostasis|protein thiol-disulfide exchange	extracellular space|integral to Golgi membrane	flavin-linked sulfhydryl oxidase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	180163472	180163472	13341	1	C	T	T	19	19	QSOX1	T	1	1
RNASEL	6041	broad.mit.edu	37	1	182544528	182544528	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:182544528C>T	uc001gpj.1	-	6	2392	c.2225G>A	c.(2224-2226)TGA>TAA	p.*742*	RNASEL_uc009wxz.1_Silent_p.*742*	NM_021133	NP_066956	Q05823	RN5A_HUMAN	ribonuclease L	742					mRNA processing|response to virus|type I interferon-mediated signaling pathway	mitochondrion	ATP binding|endoribonuclease activity, producing 5'-phosphomonoesters|metal ion binding|protein kinase activity|RNA binding			ovary(4)|stomach(1)	5														Hereditary_Prostate_Cancer				---	---	---	---	capture		Silent	SNP	182544528	182544528	13893	1	C	T	T	29	29	RNASEL	T	2	2
RGS16	6004	broad.mit.edu	37	1	182572472	182572472	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:182572472G>A	uc001gpl.3	-	2	201	c.47C>T	c.(46-48)GCC>GTC	p.A16V	RGS16_uc010pnv.1_Missense_Mutation_p.A16V	NM_002928	NP_002919	O15492	RGS16_HUMAN	regulator of G-protein signalling 16	16					negative regulation of signal transduction|regulation of G-protein coupled receptor protein signaling pathway|visual perception	cytoplasm|plasma membrane	calmodulin binding|GTPase activator activity|signal transducer activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	182572472	182572472	13772	1	G	A	A	42	42	RGS16	A	2	2
RGL1	23179	broad.mit.edu	37	1	183857654	183857654	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183857654C>T	uc001gqo.2	+	8	1155	c.998C>T	c.(997-999)TCG>TTG	p.S333L	RGL1_uc010pof.1_Missense_Mutation_p.S138L|RGL1_uc001gqm.2_Missense_Mutation_p.S368L|RGL1_uc010pog.1_Missense_Mutation_p.S331L|RGL1_uc010poh.1_Missense_Mutation_p.S331L|RGL1_uc010poi.1_Missense_Mutation_p.S333L	NM_015149	NP_055964	Q9NZL6	RGL1_HUMAN	ral guanine nucleotide dissociation	333	Ras-GEF.				cellular lipid metabolic process|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	intracellular	protein binding|Ral guanyl-nucleotide exchange factor activity			breast(5)|ovary(4)|lung(2)	11																		---	---	---	---	capture		Missense_Mutation	SNP	183857654	183857654	13749	1	C	T	T	31	31	RGL1	T	1	1
RGS21	431704	broad.mit.edu	37	1	192335237	192335237	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:192335237T>C	uc001gsh.2	+	5	616	c.442T>C	c.(442-444)TGG>CGG	p.W148R		NM_001039152	NP_001034241	Q2M5E4	RGS21_HUMAN	regulator of G-protein signaling 21	148					negative regulation of signal transduction	cytoplasm|plasma membrane	GTPase activator activity|signal transducer activity			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	192335237	192335237	13778	1	T	C	C	51	51	RGS21	C	4	4
CRB1	23418	broad.mit.edu	37	1	197404369	197404369	+	Missense_Mutation	SNP	C	A	A	rs149390998		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:197404369C>A	uc001gtz.2	+	9	3511	c.3376C>A	c.(3376-3378)CTC>ATC	p.L1126I	CRB1_uc010poz.1_Missense_Mutation_p.L1102I|CRB1_uc010ppa.1_RNA|CRB1_uc009wza.2_Missense_Mutation_p.L1014I|CRB1_uc010ppb.1_Intron|CRB1_uc010ppd.1_Missense_Mutation_p.L607I|CRB1_uc001gub.1_Missense_Mutation_p.L775I	NM_201253	NP_957705	P82279	CRUM1_HUMAN	crumbs homolog 1 precursor	1126	Extracellular (Potential).|Laminin G-like 3.				cell-cell signaling|establishment or maintenance of cell polarity	apical plasma membrane|extracellular region|integral to membrane	calcium ion binding|protein binding	p.L1126F(1)		ovary(5)|skin(3)|large_intestine(1)	9																		---	---	---	---	capture		Missense_Mutation	SNP	197404369	197404369	3987	1	C	A	A	32	32	CRB1	A	2	2
CDK18	5129	broad.mit.edu	37	1	205495521	205495521	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205495521G>T	uc001hcr.2	+	7	907	c.688G>T	c.(688-690)GCC>TCC	p.A230S	CDK18_uc010pri.1_Missense_Mutation_p.R220L|CDK18_uc001hcp.2_Missense_Mutation_p.A200S|CDK18_uc001hcq.2_Missense_Mutation_p.A200S|CDK18_uc010prj.1_Missense_Mutation_p.A111S|CDK18_uc001hcs.2_Missense_Mutation_p.A111S|CDK18_uc009xbm.1_Missense_Mutation_p.A111S|CDK18_uc001hct.2_5'Flank	NM_212503	NP_997668	Q07002	CDK18_HUMAN	PCTAIRE protein kinase 3 isoform a	198	Protein kinase.						ATP binding|cyclin-dependent protein kinase activity|protein binding|signal transducer activity			stomach(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	205495521	205495521	3263	1	G	T	T	38	38	CDK18	T	1	1
SRGAP2	23380	broad.mit.edu	37	1	206603572	206603572	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206603572G>T	uc001hdy.2	+	11	1627	c.1294G>T	c.(1294-1296)GGA>TGA	p.G432*	SRGAP2_uc010prt.1_Nonsense_Mutation_p.G355*|SRGAP2_uc001hdx.2_Nonsense_Mutation_p.G432*|SRGAP2_uc010pru.1_Nonsense_Mutation_p.G355*|SRGAP2_uc010prv.1_Nonsense_Mutation_p.G356*	NM_015326	NP_056141	O75044	FNBP2_HUMAN	SLIT-ROBO Rho GTPase activating protein 2	519	Rho-GAP.				axon guidance|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity|protein binding				0	Breast(84;0.137)																	---	---	---	---	capture		Nonsense_Mutation	SNP	206603572	206603572	15660	1	G	T	T	39	39	SRGAP2	T	5	1
IL10	3586	broad.mit.edu	37	1	206944254	206944254	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206944254A>G	uc001hen.1	-	3	435	c.376T>C	c.(376-378)TGT>CGT	p.C126R		NM_000572	NP_000563	P22301	IL10_HUMAN	interleukin 10 precursor	126					anti-apoptosis|B cell differentiation|B cell proliferation|cytoplasmic sequestering of NF-kappaB|inflammatory response|leukocyte chemotaxis|negative regulation of B cell proliferation|negative regulation of cytokine secretion involved in immune response|negative regulation of interferon-alpha biosynthetic process|negative regulation of interleukin-6 production|negative regulation of membrane protein ectodomain proteolysis|negative regulation of MHC class II biosynthetic process|negative regulation of T cell proliferation|positive regulation of B cell apoptosis|positive regulation of cytokine secretion|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription, DNA-dependent|receptor biosynthetic process|regulation of isotype switching|response to glucocorticoid stimulus|type 2 immune response	extracellular space	cytokine activity|growth factor activity|interleukin-10 receptor binding				0	Breast(84;0.183)		BRCA - Breast invasive adenocarcinoma(75;0.211)															---	---	---	---	capture		Missense_Mutation	SNP	206944254	206944254	7920	1	A	G	G	7	7	IL10	G	4	4
CR2	1380	broad.mit.edu	37	1	207649608	207649608	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207649608A>G	uc001hfw.2	+	14	2663	c.2569A>G	c.(2569-2571)ACC>GCC	p.T857A	CR2_uc001hfv.2_Missense_Mutation_p.T916A|CR2_uc009xch.2_Intron	NM_001877	NP_001868	P20023	CR2_HUMAN	complement component (3d/Epstein Barr virus)	857	Sushi 14.|Extracellular (Potential).				complement activation, classical pathway|innate immune response	integral to membrane|plasma membrane	complement receptor activity|protein homodimerization activity			upper_aerodigestive_tract(3)|skin(3)|urinary_tract(1)|ovary(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	207649608	207649608	3981	1	A	G	G	10	10	CR2	G	4	4
FAM71A	149647	broad.mit.edu	37	1	212799258	212799258	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:212799258G>C	uc001hjk.2	+	1	1443	c.1039G>C	c.(1039-1041)GCT>CCT	p.A347P	uc010pth.1_RNA	NM_153606	NP_705834	Q8IYT1	FA71A_HUMAN	hypothetical protein LOC149647	347	Ala-rich.									skin(3)|ovary(1)|central_nervous_system(1)	5				OV - Ovarian serous cystadenocarcinoma(81;0.00631)|all cancers(67;0.00981)|GBM - Glioblastoma multiforme(131;0.0715)|Epithelial(68;0.094)														---	---	---	---	capture		Missense_Mutation	SNP	212799258	212799258	5830	1	G	C	C	42	42	FAM71A	C	3	3
MIA3	375056	broad.mit.edu	37	1	222833078	222833078	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222833078C>A	uc001hnl.2	+	22	4818	c.4809C>A	c.(4807-4809)CTC>CTA	p.L1603L	MIA3_uc001hnm.2_Silent_p.L481L	NM_198551	NP_940953	Q5JRA6	MIA3_HUMAN	melanoma inhibitory activity family, member 3	1603	Cytoplasmic (Potential).|Potential.				exocytosis|negative regulation of cell adhesion|negative regulation of cell migration|positive regulation of leukocyte migration|protein transport|wound healing	endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(4)|central_nervous_system(1)	5				GBM - Glioblastoma multiforme(131;0.0199)														---	---	---	---	capture		Silent	SNP	222833078	222833078	9955	1	C	A	A	29	29	MIA3	A	2	2
PARP1	142	broad.mit.edu	37	1	226550831	226550831	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:226550831G>A	uc001hqd.3	-	21	2988	c.2817C>T	c.(2815-2817)AGC>AGT	p.S939S		NM_001618	NP_001609	P09874	PARP1_HUMAN	poly (ADP-ribose) polymerase family, member 1	939	PARP catalytic.				cellular response to insulin stimulus|protein ADP-ribosylation|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	nuclear envelope|nucleolus|transcription factor complex	DNA binding|identical protein binding|NAD+ ADP-ribosyltransferase activity|protein N-terminus binding|transcription factor binding|zinc ion binding			lung(3)|ovary(2)|breast(2)|skin(2)|upper_aerodigestive_tract(1)	10	Breast(184;0.133)			GBM - Glioblastoma multiforme(131;0.0531)									Direct_reversal_of_damage|PARP_enzymes_that_bind_to_DNA					---	---	---	---	capture		Silent	SNP	226550831	226550831	11871	1	G	A	A	46	46	PARP1	A	2	2
PARP1	142	broad.mit.edu	37	1	226579972	226579972	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:226579972C>A	uc001hqd.3	-	3	501	c.330G>T	c.(328-330)CTG>CTT	p.L110L		NM_001618	NP_001609	P09874	PARP1_HUMAN	poly (ADP-ribose) polymerase family, member 1	110					cellular response to insulin stimulus|protein ADP-ribosylation|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	nuclear envelope|nucleolus|transcription factor complex	DNA binding|identical protein binding|NAD+ ADP-ribosyltransferase activity|protein N-terminus binding|transcription factor binding|zinc ion binding			lung(3)|ovary(2)|breast(2)|skin(2)|upper_aerodigestive_tract(1)	10	Breast(184;0.133)			GBM - Glioblastoma multiforme(131;0.0531)									Direct_reversal_of_damage|PARP_enzymes_that_bind_to_DNA					---	---	---	---	capture		Silent	SNP	226579972	226579972	11871	1	C	A	A	21	21	PARP1	A	2	2
NUP133	55746	broad.mit.edu	37	1	229577773	229577773	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229577773C>T	uc001htn.2	-	26	3441	c.3349G>A	c.(3349-3351)GAG>AAG	p.E1117K		NM_018230	NP_060700	Q8WUM0	NU133_HUMAN	nucleoporin 133kDa	1117					carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|nuclear pore organization|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			breast(4)|skin(2)|ovary(1)	7	Breast(184;0.104)|Ovarian(103;0.249)	Prostate(94;0.167)																---	---	---	---	capture		Missense_Mutation	SNP	229577773	229577773	11159	1	C	T	T	29	29	NUP133	T	2	2
NUP133	55746	broad.mit.edu	37	1	229599292	229599292	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229599292G>A	uc001htn.2	-	19	2775	c.2683C>T	c.(2683-2685)CAG>TAG	p.Q895*		NM_018230	NP_060700	Q8WUM0	NU133_HUMAN	nucleoporin 133kDa	895					carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|nuclear pore organization|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			breast(4)|skin(2)|ovary(1)	7	Breast(184;0.104)|Ovarian(103;0.249)	Prostate(94;0.167)																---	---	---	---	capture		Nonsense_Mutation	SNP	229599292	229599292	11159	1	G	A	A	45	45	NUP133	A	5	2
PCNXL2	80003	broad.mit.edu	37	1	233161104	233161104	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:233161104C>A	uc001hvl.2	-	26	4628	c.4393G>T	c.(4393-4395)GGC>TGC	p.G1465C	PCNXL2_uc001hvk.1_Missense_Mutation_p.G117C|PCNXL2_uc001hvm.1_Intron	NM_014801	NP_055616	A6NKB5	PCX2_HUMAN	pecanex-like 2	1465						integral to membrane				central_nervous_system(1)|pancreas(1)	2		all_cancers(173;0.0347)|Prostate(94;0.137)														OREG0014326	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	233161104	233161104	12012	1	C	A	A	22	22	PCNXL2	A	2	2
ZNF124	7678	broad.mit.edu	37	1	247320011	247320011	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247320011G>T	uc001ick.2	-	4	1052	c.913C>A	c.(913-915)CTT>ATT	p.L305I	ZNF124_uc001ici.2_Intron|ZNF124_uc001icj.1_Missense_Mutation_p.L243I	NM_003431	NP_003422	Q15973	ZN124_HUMAN	zinc finger protein 124	305	C2H2-type 7.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			breast(1)	1	all_cancers(71;5.07e-05)|all_epithelial(71;8.72e-06)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0488)|Lung NSC(105;0.053)		OV - Ovarian serous cystadenocarcinoma(106;0.00739)															---	---	---	---	capture		Missense_Mutation	SNP	247320011	247320011	18311	1	G	T	T	35	35	ZNF124	T	2	2
VN1R5	317705	broad.mit.edu	37	1	247419658	247419658	+	Silent	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247419658C>G	uc010pyu.1	+	2	285	c.285C>G	c.(283-285)CTC>CTG	p.L95L		NM_173858	NP_776257	Q7Z5H4	VN1R5_HUMAN	vomeronasal 1 receptor 5	95	Helical; Name=3; (Potential).				response to pheromone	integral to membrane|plasma membrane	pheromone receptor activity				0	all_cancers(71;5.7e-05)|all_epithelial(71;1.03e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0607)|Lung NSC(105;0.0661)	all_cancers(173;0.0314)	OV - Ovarian serous cystadenocarcinoma(106;0.00854)															---	---	---	---	capture		Silent	SNP	247419658	247419658	17748	1	C	G	G	32	32	VN1R5	G	3	3
VN1R5	317705	broad.mit.edu	37	1	247420096	247420096	+	Nonsense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247420096T>A	uc010pyu.1	+	2	723	c.723T>A	c.(721-723)TAT>TAA	p.Y241*		NM_173858	NP_776257	Q7Z5H4	VN1R5_HUMAN	vomeronasal 1 receptor 5	241	Cytoplasmic (Potential).				response to pheromone	integral to membrane|plasma membrane	pheromone receptor activity				0	all_cancers(71;5.7e-05)|all_epithelial(71;1.03e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0607)|Lung NSC(105;0.0661)	all_cancers(173;0.0314)	OV - Ovarian serous cystadenocarcinoma(106;0.00854)															---	---	---	---	capture		Nonsense_Mutation	SNP	247420096	247420096	17748	1	T	A	A	52	52	VN1R5	A	5	4
OR2G3	81469	broad.mit.edu	37	1	247769158	247769158	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247769158A>G	uc010pyz.1	+	1	271	c.271A>G	c.(271-273)ACG>GCG	p.T91A		NM_001001914	NP_001001914	Q8NGZ4	OR2G3_HUMAN	olfactory receptor, family 2, subfamily G,	91	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			central_nervous_system(1)	1	all_cancers(71;3.24e-05)|all_epithelial(71;1.3e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)		OV - Ovarian serous cystadenocarcinoma(106;0.017)															---	---	---	---	capture		Missense_Mutation	SNP	247769158	247769158	11405	1	A	G	G	10	10	OR2G3	G	4	4
OR2L8	391190	broad.mit.edu	37	1	248113057	248113057	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248113057C>A	uc001idt.1	+	1	898	c.898C>A	c.(898-900)CTG>ATG	p.L300M	OR2L13_uc001ids.2_Intron	NM_001001963	NP_001001963	Q8NGY9	OR2L8_HUMAN	olfactory receptor, family 2, subfamily L,	300	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2	all_cancers(71;0.000139)|all_epithelial(71;1.58e-05)|Breast(184;0.0117)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0152)															---	---	---	---	capture		Missense_Mutation	SNP	248113057	248113057	11415	1	C	A	A	24	24	OR2L8	A	2	2
OR2M2	391194	broad.mit.edu	37	1	248344097	248344097	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248344097G>A	uc010pzf.1	+	1	810	c.810G>A	c.(808-810)CAG>CAA	p.Q270Q		NM_001004688	NP_001004688	Q96R28	OR2M2_HUMAN	olfactory receptor, family 2, subfamily M,	270	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(3)|skin(1)	4	all_cancers(71;0.000149)|all_epithelial(71;1.27e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0245)															---	---	---	---	capture		Silent	SNP	248344097	248344097	11416	1	G	A	A	35	35	OR2M2	A	2	2
OR2T4	127074	broad.mit.edu	37	1	248525076	248525076	+	Missense_Mutation	SNP	T	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248525076T>G	uc001ieh.1	+	1	194	c.194T>G	c.(193-195)GTG>GGG	p.V65G		NM_001004696	NP_001004696	Q8NH00	OR2T4_HUMAN	olfactory receptor, family 2, subfamily T,	65	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			central_nervous_system(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---	capture		Missense_Mutation	SNP	248525076	248525076	11433	1	T	G	G	59	59	OR2T4	G	4	4
NSUN6	221078	broad.mit.edu	37	10	18834976	18834976	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18834976C>A	uc010qcp.1	-	11	1714	c.1296G>T	c.(1294-1296)CCG>CCT	p.P432P	NSUN6_uc001iqb.2_5'Flank	NM_182543	NP_872349	Q8TEA1	NSUN6_HUMAN	NOL1/NOP2/Sun domain family, member 6	432							methyltransferase activity|RNA binding			ovary(2)	2																		---	---	---	---	capture		Silent	SNP	18834976	18834976	11087	10	C	A	A	23	23	NSUN6	A	1	1
MLLT10	8028	broad.mit.edu	37	10	21959505	21959505	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:21959505C>G	uc001iqs.2	+	10	1271	c.923C>G	c.(922-924)TCA>TGA	p.S308*	MLLT10_uc001iqt.2_Nonsense_Mutation_p.S308*|MLLT10_uc001iqv.2_RNA|MLLT10_uc001iqy.2_Nonsense_Mutation_p.S308*|MLLT10_uc001ira.2_5'UTR|MLLT10_uc001iqz.2_Nonsense_Mutation_p.S63*	NM_004641	NP_004632	P55197	AF10_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	308					positive regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(1)|skin(1)	2								T	MLL|PICALM|CDK6	AL								---	---	---	---	capture		Nonsense_Mutation	SNP	21959505	21959505	10016	10	C	G	G	29	29	MLLT10	G	5	3
C10orf67	256815	broad.mit.edu	37	10	23622020	23622020	+	Missense_Mutation	SNP	A	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:23622020A>T	uc010qcx.1	-	2	367	c.301T>A	c.(301-303)TTG>ATG	p.L101M		NM_153714	NP_714925	Q8IYJ2	CJ067_HUMAN	hypothetical protein LOC256815	101											0																		---	---	---	---	capture		Missense_Mutation	SNP	23622020	23622020	1649	10	A	T	T	4	4	C10orf67	T	4	4
ARID5B	84159	broad.mit.edu	37	10	63852295	63852295	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:63852295G>A	uc001jlt.1	+	10	3099	c.3073G>A	c.(3073-3075)GGG>AGG	p.G1025R		NM_032199	NP_115575	Q14865	ARI5B_HUMAN	AT rich interactive domain 5B (MRF1-like)	1025					liver development|negative regulation of transcription, DNA-dependent|positive regulation of sequence-specific DNA binding transcription factor activity|transcription, DNA-dependent		protein binding|transcription regulatory region DNA binding			ovary(2)|upper_aerodigestive_tract(1)|kidney(1)	4	Prostate(12;0.016)|all_hematologic(501;0.215)																	---	---	---	---	capture		Missense_Mutation	SNP	63852295	63852295	937	10	G	A	A	35	35	ARID5B	A	2	2
CDHR1	92211	broad.mit.edu	37	10	85972907	85972907	+	Missense_Mutation	SNP	G	A	A	rs144856473		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:85972907G>A	uc001kcv.2	+	16	1843	c.1843G>A	c.(1843-1845)GAG>AAG	p.E615K	CDHR1_uc001kcw.2_Missense_Mutation_p.E615K|CDHR1_uc009xst.2_Missense_Mutation_p.E319K|CDHR1_uc001kcx.2_5'UTR	NM_033100	NP_149091	Q96JP9	CDHR1_HUMAN	protocadherin 21 precursor	615	Cadherin 6.|Extracellular (Potential).				homophilic cell adhesion		calcium ion binding|receptor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	85972907	85972907	3247	10	G	A	A	33	33	CDHR1	A	2	2
ANKRD2	26287	broad.mit.edu	37	10	99342433	99342433	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99342433G>T	uc001knw.2	+	8	1116	c.907G>T	c.(907-909)GGG>TGG	p.G303W	DHDPSL_uc001knx.2_5'Flank|DHDPSL_uc001kny.2_5'Flank|DHDPSL_uc001knz.2_5'Flank|PI4K2A_uc010qoy.1_5'Flank|ANKRD2_uc009xvu.2_Missense_Mutation_p.G270W	NM_020349	NP_065082	Q9GZV1	ANKR2_HUMAN	ankyrin repeat domain 2 isoform a	303	ANK 5.				muscle contraction|muscle organ development		structural constituent of muscle				0		all_hematologic(284;1.95e-06)|Colorectal(252;0.0163)		Epithelial(162;1.18e-94)|all cancers(201;9.31e-86)|BRCA - Breast invasive adenocarcinoma(275;0.0233)|STAD - Stomach adenocarcinoma(243;0.181)|KIRC - Kidney renal clear cell carcinoma(50;0.206)|Kidney(138;0.241)														---	---	---	---	capture		Missense_Mutation	SNP	99342433	99342433	651	10	G	T	T	47	47	ANKRD2	T	2	2
DNMBP	23268	broad.mit.edu	37	10	101636941	101636941	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101636941G>A	uc001kqj.2	-	17	4793	c.4701C>T	c.(4699-4701)CCC>CCT	p.P1567P	DNMBP_uc010qpl.1_Silent_p.P503P|DNMBP_uc001kqg.2_Silent_p.P855P|DNMBP_uc001kqh.2_Silent_p.P1199P	NM_015221	NP_056036	Q6XZF7	DNMBP_HUMAN	dynamin binding protein	1567	SH3 6.				intracellular signal transduction|regulation of Rho protein signal transduction	cell junction|cytoskeleton|Golgi stack|synapse	protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(5)|skin(1)	6		Colorectal(252;0.234)		Epithelial(162;2.94e-10)|all cancers(201;3.15e-08)														---	---	---	---	capture		Silent	SNP	101636941	101636941	4857	10	G	A	A	35	35	DNMBP	A	2	2
PPRC1	23082	broad.mit.edu	37	10	103901552	103901552	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:103901552C>T	uc001kum.2	+	5	3326	c.3287C>T	c.(3286-3288)GCA>GTA	p.A1096V	PPRC1_uc001kun.2_Missense_Mutation_p.A976V|PPRC1_uc010qqj.1_Missense_Mutation_p.A1096V|PPRC1_uc009xxa.2_RNA	NM_015062	NP_055877	Q5VV67	PPRC1_HUMAN	peroxisome proliferator-activated receptor	1096	Pro-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	nucleotide binding|RNA binding			ovary(1)|central_nervous_system(1)|skin(1)	3		Colorectal(252;0.122)		Epithelial(162;4.97e-08)|all cancers(201;8.99e-07)														---	---	---	---	capture		Missense_Mutation	SNP	103901552	103901552	12846	10	C	T	T	25	25	PPRC1	T	2	2
SORCS1	114815	broad.mit.edu	37	10	108447979	108447979	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:108447979G>T	uc001kym.2	-	10	1539	c.1531C>A	c.(1531-1533)CTA>ATA	p.L511I	SORCS1_uc001kyl.2_Missense_Mutation_p.L511I|SORCS1_uc009xxs.2_Missense_Mutation_p.L511I|SORCS1_uc001kyn.1_Missense_Mutation_p.L511I|SORCS1_uc001kyo.2_Missense_Mutation_p.L511I	NM_052918	NP_443150	Q8WY21	SORC1_HUMAN	SORCS receptor 1 isoform a	511	Lumenal (Potential).					integral to membrane	neuropeptide receptor activity|protein binding			breast(1)|central_nervous_system(1)	2		Breast(234;0.0256)|Colorectal(252;0.09)|Lung NSC(174;0.168)		Epithelial(162;1.66e-05)|all cancers(201;0.000689)														---	---	---	---	capture		Missense_Mutation	SNP	108447979	108447979	15430	10	G	T	T	33	33	SORCS1	T	2	2
C10orf81	79949	broad.mit.edu	37	10	115534730	115534730	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:115534730C>A	uc001lat.1	+	9	1469	c.907C>A	c.(907-909)CAG>AAG	p.Q303K	C10orf81_uc001lar.1_Missense_Mutation_p.Q309K|C10orf81_uc009xyc.1_Missense_Mutation_p.Q221K|C10orf81_uc001las.1_Missense_Mutation_p.Q221K|C10orf81_uc001lau.1_Missense_Mutation_p.Q123K	NM_024889	NP_079165	Q5SXH7	CJ081_HUMAN	hypothetical protein LOC79949	303										central_nervous_system(1)	1		Colorectal(252;0.175)		Epithelial(162;0.0181)|all cancers(201;0.0204)														---	---	---	---	capture		Missense_Mutation	SNP	115534730	115534730	1656	10	C	A	A	17	17	C10orf81	A	2	2
OAT	4942	broad.mit.edu	37	10	126094046	126094046	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:126094046C>A	uc001lhp.2	-	5	714	c.607G>T	c.(607-609)GGA>TGA	p.G203*	OAT_uc001lhq.2_RNA|OAT_uc001lhr.2_Nonsense_Mutation_p.G65*	NM_000274	NP_000265	P04181	OAT_HUMAN	ornithine aminotransferase precursor	203					cellular amino acid biosynthetic process|visual perception	mitochondrial matrix	ornithine-oxo-acid transaminase activity|protein binding|pyridoxal phosphate binding				0		all_lung(145;0.0271)|Lung NSC(174;0.0436)|Colorectal(57;0.102)|all_neural(114;0.116)			L-Ornithine(DB00129)|Pyridoxal Phosphate(DB00114)													---	---	---	---	capture		Nonsense_Mutation	SNP	126094046	126094046	11208	10	C	A	A	22	22	OAT	A	5	2
STIM1	6786	broad.mit.edu	37	11	4104625	4104625	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4104625C>G	uc001lyv.2	+	10	1939	c.1371C>G	c.(1369-1371)GAC>GAG	p.D457E	STIM1_uc009yef.2_Missense_Mutation_p.D457E|STIM1_uc009yeg.2_Missense_Mutation_p.D284E	NM_003156	NP_003147	Q13586	STIM1_HUMAN	stromal interaction molecule 1 precursor	457	Cytoplasmic (Potential).				activation of store-operated calcium channel activity|calcium ion transport|detection of calcium ion|platelet activation	integral to endoplasmic reticulum membrane|integral to plasma membrane|microtubule	calcium ion binding|microtubule plus-end binding			pancreas(1)	1		Breast(177;0.00159)|Medulloblastoma(188;0.00258)|all_neural(188;0.0233)		BRCA - Breast invasive adenocarcinoma(625;0.114)|LUSC - Lung squamous cell carcinoma(625;0.141)														---	---	---	---	capture		Missense_Mutation	SNP	4104625	4104625	15803	11	C	G	G	18	18	STIM1	G	3	3
TRIM68	55128	broad.mit.edu	37	11	4621770	4621770	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4621770C>T	uc001lzf.1	-	7	1432	c.1194G>A	c.(1192-1194)CTG>CTA	p.L398L	TRIM68_uc001lzg.1_Silent_p.L175L|TRIM68_uc010qyj.1_RNA	NM_018073	NP_060543	Q6AZZ1	TRI68_HUMAN	ring finger protein 137	398	B30.2/SPRY.				protein autoubiquitination|regulation of androgen receptor signaling pathway	Golgi apparatus|nucleolus|perinuclear region of cytoplasm	androgen receptor binding|histone acetyltransferase binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1		Medulloblastoma(188;0.0025)|Breast(177;0.0101)|all_neural(188;0.0227)		Epithelial(150;9.49e-12)|BRCA - Breast invasive adenocarcinoma(625;0.0288)|LUSC - Lung squamous cell carcinoma(625;0.192)														---	---	---	---	capture		Silent	SNP	4621770	4621770	17090	11	C	T	T	29	29	TRIM68	T	2	2
OR51G1	79324	broad.mit.edu	37	11	4945375	4945375	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4945375C>A	uc010qyr.1	-	1	195	c.195G>T	c.(193-195)TTG>TTT	p.L65F		NM_001005237	NP_001005237	Q8NGK1	O51G1_HUMAN	olfactory receptor, family 51, subfamily G,	65	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2		Medulloblastoma(188;0.0075)|all_neural(188;0.0577)|Breast(177;0.086)		Epithelial(150;2.58e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0284)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---	capture		Missense_Mutation	SNP	4945375	4945375	11508	11	C	A	A	21	21	OR51G1	A	2	2
OR51L1	119682	broad.mit.edu	37	11	5021116	5021116	+	Missense_Mutation	SNP	C	T	T	rs139272622	byFrequency	TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5021116C>T	uc010qyu.1	+	1	904	c.904C>T	c.(904-906)CGT>TGT	p.R302C		NM_001004755	NP_001004755	Q8NGJ5	O51L1_HUMAN	olfactory receptor, family 51, subfamily L,	302	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1		Medulloblastoma(188;0.0061)|all_neural(188;0.0479)|Breast(177;0.086)		Epithelial(150;1.75e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0285)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---	capture		Missense_Mutation	SNP	5021116	5021116	11512	11	C	T	T	31	31	OR51L1	T	1	1
CNGA4	1262	broad.mit.edu	37	11	6262983	6262983	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6262983G>T	uc001mco.2	+	5	1347	c.1240G>T	c.(1240-1242)GGG>TGG	p.G414W	CNGA4_uc010raa.1_Missense_Mutation_p.G183W|CNGA4_uc001mcn.2_Missense_Mutation_p.G374W	NM_001037329	NP_001032406	Q8IV77	CNGA4_HUMAN	cyclic nucleotide gated channel alpha 4	414	cNMP.|Cytoplasmic (Potential).				response to stimulus|sensory perception of smell		cAMP binding			skin(1)	1		Medulloblastoma(188;0.00263)|all_neural(188;0.026)|Breast(177;0.029)		Epithelial(150;2.04e-08)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---	capture		Missense_Mutation	SNP	6262983	6262983	3737	11	G	T	T	47	47	CNGA4	T	2	2
HPX	3263	broad.mit.edu	37	11	6453010	6453010	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6453010C>A	uc001mdg.2	-	9	1051	c.990G>T	c.(988-990)CTG>CTT	p.L330L	HPX_uc001mdf.2_Silent_p.L76L|HPX_uc009yfc.2_RNA	NM_000613	NP_000604	P02790	HEMO_HUMAN	hemopexin precursor	330	Hemopexin-like 5.				cellular iron ion homeostasis|interspecies interaction between organisms	extracellular space	heme transporter activity|metal ion binding|protein binding				0		Medulloblastoma(188;0.00776)|all_neural(188;0.0652)|Breast(177;0.114)		Epithelial(150;5.46e-08)|BRCA - Breast invasive adenocarcinoma(625;0.19)														---	---	---	---	capture		Silent	SNP	6453010	6453010	7638	11	C	A	A	29	29	HPX	A	2	2
SCUBE2	57758	broad.mit.edu	37	11	9111341	9111341	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:9111341G>T	uc001mhh.1	-	2	249	c.169C>A	c.(169-171)CAT>AAT	p.H57N	SCUBE2_uc001mhi.1_Missense_Mutation_p.H57N|SCUBE2_uc001mhj.1_Missense_Mutation_p.H57N	NM_020974	NP_066025	Q9NQ36	SCUB2_HUMAN	CEGP1 protein precursor	57	EGF-like 1; calcium-binding (Potential).					extracellular region	calcium ion binding			ovary(1)|skin(1)	2				all cancers(16;8.57e-09)|Epithelial(150;4.42e-08)|BRCA - Breast invasive adenocarcinoma(625;0.0116)														---	---	---	---	capture		Missense_Mutation	SNP	9111341	9111341	14428	11	G	T	T	47	47	SCUBE2	T	2	2
CTR9	9646	broad.mit.edu	37	11	10777236	10777236	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:10777236G>T	uc001mja.2	+	4	545	c.396G>T	c.(394-396)TTG>TTT	p.L132F		NM_014633	NP_055448	Q6PD62	CTR9_HUMAN	SH2 domain binding protein 1	132	TPR 2.				histone H2B ubiquitination|histone monoubiquitination	Cdc73/Paf1 complex|nuclear speck				ovary(2)	2				all cancers(16;1.64e-07)|Epithelial(150;2.47e-07)|BRCA - Breast invasive adenocarcinoma(625;0.111)														---	---	---	---	capture		Missense_Mutation	SNP	10777236	10777236	4183	11	G	T	T	47	47	CTR9	T	2	2
NUCB2	4925	broad.mit.edu	37	11	17332502	17332502	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17332502C>T	uc001mmw.2	+	7	859	c.614C>T	c.(613-615)TCT>TTT	p.S205F	NUCB2_uc001mms.1_Missense_Mutation_p.S206F|NUCB2_uc001mmt.1_Missense_Mutation_p.S205F|NUCB2_uc001mmv.1_Missense_Mutation_p.S205F|NUCB2_uc009ygz.2_Missense_Mutation_p.S205F	NM_005013	NP_005004	P80303	NUCB2_HUMAN	nucleobindin 2 precursor	205	By similarity.					cytosol|ER-Golgi intermediate compartment|extracellular space|Golgi apparatus|plasma membrane	calcium ion binding|DNA binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	17332502	17332502	11124	11	C	T	T	32	32	NUCB2	T	2	2
NUCB2	4925	broad.mit.edu	37	11	17332538	17332538	+	Missense_Mutation	SNP	A	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17332538A>C	uc001mmw.2	+	7	895	c.650A>C	c.(649-651)CAC>CCC	p.H217P	NUCB2_uc001mms.1_Missense_Mutation_p.H218P|NUCB2_uc001mmt.1_Missense_Mutation_p.H217P|NUCB2_uc001mmv.1_Missense_Mutation_p.H217P|NUCB2_uc009ygz.2_Missense_Mutation_p.H217P	NM_005013	NP_005004	P80303	NUCB2_HUMAN	nucleobindin 2 precursor	217	By similarity.|Binds to necdin (By similarity).					cytosol|ER-Golgi intermediate compartment|extracellular space|Golgi apparatus|plasma membrane	calcium ion binding|DNA binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	17332538	17332538	11124	11	A	C	C	6	6	NUCB2	C	4	4
SAAL1	113174	broad.mit.edu	37	11	18110906	18110906	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:18110906G>T	uc001mnq.2	-	7	791	c.741C>A	c.(739-741)CCC>CCA	p.P247P	SAAL1_uc001mnr.2_Silent_p.P247P|SAAL1_uc001mns.2_RNA|SAAL1_uc009yhf.2_Silent_p.P247P	NM_138421	NP_612430	Q96ER3	SAAL1_HUMAN	serum amyloid A-like 1	247					acute-phase response	extracellular region	binding				0																		---	---	---	---	capture		Silent	SNP	18110906	18110906	14281	11	G	T	T	35	35	SAAL1	T	2	2
QSER1	79832	broad.mit.edu	37	11	32975556	32975556	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:32975556C>G	uc001mty.2	+	5	4211	c.3944C>G	c.(3943-3945)TCA>TGA	p.S1315*	QSER1_uc001mtz.1_Nonsense_Mutation_p.S1076*|QSER1_uc001mua.2_Nonsense_Mutation_p.S820*	NM_001076786	NP_001070254	Q2KHR3	QSER1_HUMAN	glutamine and serine rich 1	1315										ovary(3)|central_nervous_system(2)|skin(1)	6	Breast(20;0.158)																	---	---	---	---	capture		Nonsense_Mutation	SNP	32975556	32975556	13340	11	C	G	G	29	29	QSER1	G	5	3
EHF	26298	broad.mit.edu	37	11	34680084	34680084	+	Silent	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:34680084G>C	uc001mvr.1	+	8	723	c.612G>C	c.(610-612)CCG>CCC	p.P204P	EHF_uc009yke.1_Silent_p.P181P|EHF_uc009ykf.1_Silent_p.P207P	NM_012153	NP_036285	Q9NZC4	EHF_HUMAN	ets homologous factor	204					cell proliferation|epithelial cell differentiation|multicellular organismal development|positive regulation of transcription, DNA-dependent		protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0		all_hematologic(20;0.117)	Epithelial(1;0.055)|all cancers(1;0.137)|STAD - Stomach adenocarcinoma(6;0.235)															---	---	---	---	capture		Silent	SNP	34680084	34680084	5170	11	G	C	C	37	37	EHF	C	3	3
OR4A15	81328	broad.mit.edu	37	11	55135797	55135797	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55135797G>T	uc010rif.1	+	1	438	c.438G>T	c.(436-438)ATG>ATT	p.M146I		NM_001005275	NP_001005275	Q8NGL6	O4A15_HUMAN	olfactory receptor, family 4, subfamily A,	146	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	55135797	55135797	11446	11	G	T	T	47	47	OR4A15	T	2	2
OR4S2	219431	broad.mit.edu	37	11	55418439	55418439	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55418439G>T	uc001nhs.1	+	1	60	c.60G>T	c.(58-60)GAG>GAT	p.E20D		NM_001004059	NP_001004059	Q8NH73	OR4S2_HUMAN	olfactory receptor, family 4, subfamily S,	20	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)	3		all_epithelial(135;0.0748)																---	---	---	---	capture		Missense_Mutation	SNP	55418439	55418439	11493	11	G	T	T	33	33	OR4S2	T	2	2
OR5D13	390142	broad.mit.edu	37	11	55541234	55541234	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55541234C>A	uc010ril.1	+	1	321	c.321C>A	c.(319-321)TGC>TGA	p.C107*		NM_001001967	NP_001001967	Q8NGL4	OR5DD_HUMAN	olfactory receptor, family 5, subfamily D,	107	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3		all_epithelial(135;0.196)																---	---	---	---	capture		Nonsense_Mutation	SNP	55541234	55541234	11564	11	C	A	A	25	25	OR5D13	A	5	2
OR5L1	219437	broad.mit.edu	37	11	55579243	55579243	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55579243T>C	uc001nhw.1	+	1	301	c.301T>C	c.(301-303)TTC>CTC	p.F101L		NM_001004738	NP_001004738	Q8NGL2	OR5L1_HUMAN	olfactory receptor, family 5, subfamily L,	101	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(3)|ovary(2)	5		all_epithelial(135;0.208)																---	---	---	---	capture		Missense_Mutation	SNP	55579243	55579243	11580	11	T	C	C	52	52	OR5L1	C	4	4
SERPING1	710	broad.mit.edu	37	11	57367679	57367679	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57367679G>A	uc001nkp.1	+	3	570	c.379G>A	c.(379-381)GTT>ATT	p.V127I	SERPING1_uc001nkq.1_Missense_Mutation_p.V127I|SERPING1_uc010rju.1_Missense_Mutation_p.V75I|SERPING1_uc010rjv.1_Missense_Mutation_p.V132I|SERPING1_uc001nkr.1_Missense_Mutation_p.V127I|SERPING1_uc009ymi.1_Missense_Mutation_p.V127I|SERPING1_uc009ymj.1_Missense_Mutation_p.V127I|SERPING1_uc001nks.1_Intron	NM_000062	NP_000053	P05155	IC1_HUMAN	serpin peptidase inhibitor, clade G, member 1	127			Missing (in HAE; type 2).		blood circulation|blood coagulation, intrinsic pathway|complement activation, classical pathway|innate immune response|negative regulation of complement activation, lectin pathway|platelet activation|platelet degranulation	extracellular space|platelet alpha granule lumen	protein binding|serine-type endopeptidase inhibitor activity			central_nervous_system(1)	1														Hereditary_Angioedema				---	---	---	---	capture		Missense_Mutation	SNP	57367679	57367679	14604	11	G	A	A	48	48	SERPING1	A	2	2
OR10W1	81341	broad.mit.edu	37	11	58034512	58034512	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58034512G>T	uc001nmq.1	-	1	1221	c.819C>A	c.(817-819)ACC>ACA	p.T273T		NM_207374	NP_997257	Q8NGF6	O10W1_HUMAN	olfactory receptor, family 10, subfamily W,	273	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(21;0.0589)																---	---	---	---	capture		Silent	SNP	58034512	58034512	11327	11	G	T	T	43	43	OR10W1	T	2	2
OR10W1	81341	broad.mit.edu	37	11	58034871	58034871	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58034871T>A	uc001nmq.1	-	1	862	c.460A>T	c.(460-462)ATC>TTC	p.I154F		NM_207374	NP_997257	Q8NGF6	O10W1_HUMAN	olfactory receptor, family 10, subfamily W,	154	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(21;0.0589)																---	---	---	---	capture		Missense_Mutation	SNP	58034871	58034871	11327	11	T	A	A	51	51	OR10W1	A	4	4
OR10W1	81341	broad.mit.edu	37	11	58034879	58034879	+	Missense_Mutation	SNP	A	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58034879A>C	uc001nmq.1	-	1	854	c.452T>G	c.(451-453)GTG>GGG	p.V151G		NM_207374	NP_997257	Q8NGF6	O10W1_HUMAN	olfactory receptor, family 10, subfamily W,	151	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(21;0.0589)																---	---	---	---	capture		Missense_Mutation	SNP	58034879	58034879	11327	11	A	C	C	6	6	OR10W1	C	4	4
OR4D9	390199	broad.mit.edu	37	11	59282787	59282787	+	Silent	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:59282787C>G	uc010rkv.1	+	1	402	c.402C>G	c.(400-402)ACC>ACG	p.T134T		NM_001004711	NP_001004711	Q8NGE8	OR4D9_HUMAN	olfactory receptor, family 4, subfamily D,	134	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---	capture		Silent	SNP	59282787	59282787	11466	11	C	G	G	21	21	OR4D9	G	3	3
TCN1	6947	broad.mit.edu	37	11	59623397	59623397	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:59623397C>A	uc001noj.2	-	6	980	c.882G>T	c.(880-882)CTG>CTT	p.L294L		NM_001062	NP_001053	P20061	TCO1_HUMAN	transcobalamin I precursor	294					cobalamin metabolic process|cobalamin transport|cobalt ion transport	extracellular region	cobalamin binding			ovary(2)	2		all_epithelial(135;0.198)			Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)													---	---	---	---	capture		Silent	SNP	59623397	59623397	16232	11	C	A	A	29	29	TCN1	A	2	2
AHNAK	79026	broad.mit.edu	37	11	62292676	62292676	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62292676C>A	uc001ntl.2	-	5	9513	c.9213G>T	c.(9211-9213)GAG>GAT	p.E3071D	AHNAK_uc001ntk.1_Intron	NM_001620	NP_001611	Q09666	AHNK_HUMAN	AHNAK nucleoprotein isoform 1	3071					nervous system development	nucleus	protein binding			ovary(10)|pancreas(4)|skin(4)|upper_aerodigestive_tract(1)	19		Melanoma(852;0.155)																---	---	---	---	capture		Missense_Mutation	SNP	62292676	62292676	417	11	C	A	A	24	24	AHNAK	A	2	2
CHRM1	1128	broad.mit.edu	37	11	62677631	62677631	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62677631G>T	uc001nwi.2	-	2	1343	c.942C>A	c.(940-942)CCC>CCA	p.P314P		NM_000738	NP_000729	P11229	ACM1_HUMAN	cholinergic receptor, muscarinic 1	314	Cytoplasmic (Potential).				activation of phospholipase C activity by muscarinic acetylcholine receptor signaling pathway|activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|cell proliferation|nervous system development|positive regulation of cell proliferation|protein modification process	cell junction|integral to plasma membrane|membrane fraction|postsynaptic membrane	muscarinic acetylcholine receptor activity|phosphatidylinositol phospholipase C activity|protein binding				0					Anisotropine Methylbromide(DB00517)|Atropine(DB00572)|Benzquinamide(DB00767)|Benztropine(DB00245)|Bethanechol(DB01019)|Biperiden(DB00810)|Buclizine(DB00354)|Carbachol(DB00411)|Carbinoxamine(DB00748)|Cevimeline(DB00185)|Clidinium(DB00771)|Cryptenamine(DB00785)|Cyclizine(DB01176)|Cyclopentolate(DB00979)|Cycrimine(DB00942)|Desipramine(DB01151)|Dicyclomine(DB00804)|Diphenidol(DB01231)|Doxylamine(DB00366)|Ethopropazine(DB00392)|Flavoxate(DB01148)|Glycopyrrolate(DB00986)|Homatropine Methylbromide(DB00725)|Hyoscyamine(DB00424)|Ipratropium(DB00332)|Methantheline(DB00940)|Methotrimeprazine(DB01403)|Methylscopolamine(DB00462)|Metixene(DB00340)|Metoclopramide(DB01233)|Olanzapine(DB00334)|Oxybutynin(DB01062)|Oxyphencyclimine(DB00383)|Oxyphenonium(DB00219)|Pilocarpine(DB01085)|Pirenzepine(DB00670)|Procyclidine(DB00387)|Promazine(DB00420)|Promethazine(DB01069)|Propantheline(DB00782)|Propiomazine(DB00777)|Quinacrine(DB01103)|Scopolamine(DB00747)|Solifenacin(DB01591)|Succinylcholine(DB00202)|Thiethylperazine(DB00372)|Tolterodine(DB01036)|Tridihexethyl(DB00505)|Triflupromazine(DB00508)|Trihexyphenidyl(DB00376)|Trospium(DB00209)													---	---	---	---	capture		Silent	SNP	62677631	62677631	3510	11	G	T	T	47	47	CHRM1	T	2	2
FERMT3	83706	broad.mit.edu	37	11	63978760	63978760	+	Silent	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63978760A>G	uc001nyl.2	+	5	677	c.528A>G	c.(526-528)GCA>GCG	p.A176A	FERMT3_uc001nym.2_Silent_p.A176A	NM_178443	NP_848537	Q86UX7	URP2_HUMAN	fermitin family homolog 3 long form	176					integrin activation|leukocyte cell-cell adhesion|platelet aggregation|regulation of cell-cell adhesion mediated by integrin	cell junction|cell projection|podosome	integrin binding			ovary(1)	1																		---	---	---	---	capture		Silent	SNP	63978760	63978760	6056	11	A	G	G	6	6	FERMT3	G	4	4
FOSL1	8061	broad.mit.edu	37	11	65660459	65660459	+	Silent	SNP	G	T	T	rs148163955		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65660459G>T	uc001ogg.1	-	4	901	c.714C>A	c.(712-714)CCC>CCA	p.P238P	FOSL1_uc010ros.1_Silent_p.P136P	NM_005438	NP_005429	P15407	FOSL1_HUMAN	FOS-like antigen 1	238					cellular defense response|chemotaxis|positive regulation of cell proliferation|response to virus|transcription from RNA polymerase II promoter	nucleus	protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0				READ - Rectum adenocarcinoma(159;0.168)														---	---	---	---	capture		Silent	SNP	65660459	65660459	6229	11	G	T	T	47	47	FOSL1	T	2	2
MRGPRD	116512	broad.mit.edu	37	11	68748108	68748108	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68748108C>T	uc010rqf.1	-	1	348	c.348G>A	c.(346-348)CTG>CTA	p.L116L		NM_198923	NP_944605	Q8TDS7	MRGRD_HUMAN	MAS-related GPR, member D	116	Helical; Name=3; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			pancreas(1)	1			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)															---	---	---	---	capture		Silent	SNP	68748108	68748108	10155	11	C	T	T	29	29	MRGPRD	T	2	2
MRGPRD	116512	broad.mit.edu	37	11	68748447	68748447	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68748447C>G	uc010rqf.1	-	1	9	c.9G>C	c.(7-9)CAG>CAC	p.Q3H		NM_198923	NP_944605	Q8TDS7	MRGRD_HUMAN	MAS-related GPR, member D	3	Extracellular (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			pancreas(1)	1			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)															---	---	---	---	capture		Missense_Mutation	SNP	68748447	68748447	10155	11	C	G	G	32	32	MRGPRD	G	3	3
P2RY2	5029	broad.mit.edu	37	11	72945520	72945520	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72945520T>A	uc001otj.2	+	3	649	c.316T>A	c.(316-318)TGC>AGC	p.C106S	P2RY2_uc001otk.2_Missense_Mutation_p.C106S|P2RY2_uc001otl.2_Missense_Mutation_p.C106S	NM_002564	NP_002555	P41231	P2RY2_HUMAN	purinergic receptor P2Y2	106	Extracellular (Potential).				activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger	integral to plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			ovary(2)|lung(1)|skin(1)	4					Suramin(DB04786)													---	---	---	---	capture		Missense_Mutation	SNP	72945520	72945520	11765	11	T	A	A	55	55	P2RY2	A	4	4
MED17	9440	broad.mit.edu	37	11	93545108	93545108	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:93545108G>T	uc001pem.3	+	12	2109	c.1834G>T	c.(1834-1836)GAT>TAT	p.D612Y		NM_004268	NP_004259	Q9NVC6	MED17_HUMAN	mediator complex subunit 17	612					androgen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex|transcription factor complex	ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			ovary(1)	1		Acute lymphoblastic leukemia(157;2.31e-05)|all_hematologic(158;0.00824)																---	---	---	---	capture		Missense_Mutation	SNP	93545108	93545108	9824	11	G	T	T	33	33	MED17	T	2	2
DLAT	1737	broad.mit.edu	37	11	111908010	111908010	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:111908010G>T	uc001pmo.2	+	6	1460	c.801G>T	c.(799-801)CAG>CAT	p.Q267H	DLAT_uc009yyk.1_Intron|DLAT_uc010rwr.1_Missense_Mutation_p.Q140H	NM_001931	NP_001922	P10515	ODP2_HUMAN	dihydrolipoamide S-acetyltransferase precursor	267	Lipoyl-binding 2.				glycolysis|regulation of acetyl-CoA biosynthetic process from pyruvate	mitochondrial pyruvate dehydrogenase complex	dihydrolipoyllysine-residue acetyltransferase activity|protein binding				0		all_cancers(61;4.53e-11)|all_epithelial(67;2.76e-06)|Melanoma(852;9.42e-06)|all_hematologic(158;0.000885)|Acute lymphoblastic leukemia(157;0.000966)|Breast(348;0.0512)|Medulloblastoma(222;0.0523)|all_neural(223;0.0663)		Epithelial(105;4.87e-07)|BRCA - Breast invasive adenocarcinoma(274;6.83e-07)|all cancers(92;9.63e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.0557)	NADH(DB00157)													---	---	---	---	capture		Missense_Mutation	SNP	111908010	111908010	4729	11	G	T	T	35	35	DLAT	T	2	2
NCAM1	4684	broad.mit.edu	37	11	113102448	113102448	+	Nonsense_Mutation	SNP	G	T	T	rs55757519		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113102448G>T	uc009yyq.1	+	11	1589	c.895G>T	c.(895-897)GGA>TGA	p.G299*		NM_001076682	NP_001070150	P13591	NCAM1_HUMAN	neural cell adhesion molecule 1 isoform 3	391	Ig-like C2-type 4.|Extracellular (Potential).				axon guidance|interferon-gamma-mediated signaling pathway	anchored to membrane|extracellular region|Golgi membrane|integral to membrane				ovary(1)	1		all_cancers(61;5.82e-19)|all_epithelial(67;6.87e-12)|Melanoma(852;1.99e-05)|all_hematologic(158;3.66e-05)|Acute lymphoblastic leukemia(157;0.00119)|Breast(348;0.0109)|all_neural(223;0.0299)|Medulloblastoma(222;0.0458)|Renal(330;0.198)|Prostate(24;0.207)		BRCA - Breast invasive adenocarcinoma(274;1.78e-05)|Epithelial(105;0.000114)|all cancers(92;0.000467)|OV - Ovarian serous cystadenocarcinoma(223;0.212)														---	---	---	---	capture		Nonsense_Mutation	SNP	113102448	113102448	10601	11	G	T	T	39	39	NCAM1	T	5	1
TTC12	54970	broad.mit.edu	37	11	113222836	113222836	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113222836C>T	uc001pnu.2	+	16	1458	c.1353C>T	c.(1351-1353)TGC>TGT	p.C451C	TTC12_uc001pnv.2_Silent_p.C457C|TTC12_uc001pnw.2_RNA|TTC12_uc001pnx.2_Silent_p.C301C	NM_017868	NP_060338	Q9H892	TTC12_HUMAN	tetratricopeptide repeat domain 12	451							binding			pancreas(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	4		all_cancers(61;2.73e-16)|all_epithelial(67;8.64e-10)|Melanoma(852;1.46e-05)|all_hematologic(158;0.00014)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0101)|all_neural(223;0.0281)|Medulloblastoma(222;0.0425)|Prostate(24;0.183)|Renal(330;0.187)		BRCA - Breast invasive adenocarcinoma(274;5.3e-06)|Epithelial(105;8.37e-05)|all cancers(92;0.000694)														---	---	---	---	capture		Silent	SNP	113222836	113222836	17233	11	C	T	T	25	25	TTC12	T	2	2
FOXRED1	55572	broad.mit.edu	37	11	126146370	126146370	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:126146370C>A	uc001qdi.2	+	9	1100	c.1053C>A	c.(1051-1053)CGC>CGA	p.R351R	FOXRED1_uc010sbn.1_Silent_p.R181R|FOXRED1_uc010sbo.1_RNA|FOXRED1_uc010sbp.1_Silent_p.R164R|FOXRED1_uc010sbq.1_Silent_p.R218R|FOXRED1_uc001qdj.2_Silent_p.R140R|FOXRED1_uc010sbr.1_Silent_p.R337R|FOXRED1_uc001qdk.2_Silent_p.R140R	NM_017547	NP_060017	Q96CU9	FXRD1_HUMAN	FAD-dependent oxidoreductase domain containing	351						integral to membrane|mitochondrion	oxidoreductase activity|protein binding				0	all_hematologic(175;0.145)	Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.0739)|all_lung(97;0.0798)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;1.1e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0729)														---	---	---	---	capture		Silent	SNP	126146370	126146370	6279	11	C	A	A	26	26	FOXRED1	A	2	2
NFRKB	4798	broad.mit.edu	37	11	129762615	129762615	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:129762615C>A	uc001qfi.2	-	3	331	c.130G>T	c.(130-132)GAG>TAG	p.E44*	NFRKB_uc001qfg.2_Nonsense_Mutation_p.E57*|NFRKB_uc001qfh.2_Nonsense_Mutation_p.E67*|NFRKB_uc010sbw.1_Nonsense_Mutation_p.E44*	NM_001143835	NP_001137307	Q6P4R8	NFRKB_HUMAN	nuclear factor related to kappaB binding protein	44					DNA recombination|DNA repair|inflammatory response|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	Ino80 complex	DNA binding|protease binding			ovary(3)	3	all_hematologic(175;0.0537)	Breast(109;0.00526)|Lung NSC(97;0.00901)|all_lung(97;0.018)|Medulloblastoma(222;0.0523)|all_neural(223;0.186)		OV - Ovarian serous cystadenocarcinoma(99;0.0167)|Lung(977;0.171)|LUSC - Lung squamous cell carcinoma(976;0.184)														---	---	---	---	capture		Nonsense_Mutation	SNP	129762615	129762615	10784	11	C	A	A	30	30	NFRKB	A	5	2
KCNA1	3736	broad.mit.edu	37	12	5021036	5021036	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:5021036G>T	uc001qnh.2	+	2	1597	c.492G>T	c.(490-492)GGG>GGT	p.G164G		NM_000217	NP_000208	Q09470	KCNA1_HUMAN	potassium voltage-gated channel subfamily A	164					synaptic transmission	juxtaparanode region of axon|voltage-gated potassium channel complex	delayed rectifier potassium channel activity|potassium ion transmembrane transporter activity			ovary(1)|skin(1)	2					Desflurane(DB01189)|Enflurane(DB00228)|Isoflurane(DB00753)|Methoxyflurane(DB01028)|Sevoflurane(DB01236)													---	---	---	---	capture		Silent	SNP	5021036	5021036	8306	12	G	T	T	42	42	KCNA1	T	2	2
KCNA5	3741	broad.mit.edu	37	12	5153731	5153731	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:5153731C>G	uc001qni.2	+	1	647	c.418C>G	c.(418-420)CAG>GAG	p.Q140E		NM_002234	NP_002225	P22460	KCNA5_HUMAN	potassium voltage-gated channel, shaker-related	140						Golgi apparatus|voltage-gated potassium channel complex	delayed rectifier potassium channel activity			ovary(2)|breast(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	5153731	5153731	8311	12	C	G	G	25	25	KCNA5	G	3	3
TAS2R8	50836	broad.mit.edu	37	12	10958656	10958656	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10958656C>T	uc010shh.1	-	1	924	c.924G>A	c.(922-924)ATG>ATA	p.M308I		NM_023918	NP_076407	Q9NYW2	TA2R8_HUMAN	taste receptor, type 2, member 8	308	Cytoplasmic (Potential).				sensory perception of taste	integral to membrane	taste receptor activity			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	10958656	10958656	16109	12	C	T	T	29	29	TAS2R8	T	2	2
TAS2R20	259295	broad.mit.edu	37	12	11150207	11150207	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:11150207C>T	uc001qzm.2	-	1	268	c.268G>A	c.(268-270)GTA>ATA	p.V90I	PRR4_uc009zhp.2_Intron|PRH1_uc001qzb.3_Intron|PRH1_uc001qzc.2_Intron|PRB4_uc001qzf.1_Intron|PRH1_uc001qzj.2_Intron	NM_176889	NP_795370	P59543	T2R20_HUMAN	taste receptor, type 2, member 20	90	Helical; Name=3; (Potential).				sensory perception of taste	integral to membrane	G-protein coupled receptor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	11150207	11150207	16093	12	C	T	T	20	20	TAS2R20	T	2	2
SLCO1C1	53919	broad.mit.edu	37	12	20893149	20893149	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:20893149C>A	uc001rej.3	+	13	1935	c.1580C>A	c.(1579-1581)GCA>GAA	p.A527E	SLCO1C1_uc010sii.1_Missense_Mutation_p.A527E|SLCO1C1_uc010sij.1_Missense_Mutation_p.A478E|SLCO1C1_uc009zip.2_Missense_Mutation_p.A361E|SLCO1C1_uc001rei.2_Missense_Mutation_p.A527E|SLCO1C1_uc010sik.1_Missense_Mutation_p.A409E	NM_017435	NP_059131	Q9NYB5	SO1C1_HUMAN	solute carrier organic anion transporter family,	527	Extracellular (Potential).				sodium-independent organic anion transport	integral to membrane|plasma membrane	thyroid hormone transmembrane transporter activity			ovary(5)|pancreas(1)|skin(1)	7	Esophageal squamous(101;0.149)																	---	---	---	---	capture		Missense_Mutation	SNP	20893149	20893149	15222	12	C	A	A	25	25	SLCO1C1	A	2	2
ST8SIA1	6489	broad.mit.edu	37	12	22354570	22354570	+	Silent	SNP	G	T	T	rs113763889		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:22354570G>T	uc001rfo.3	-	5	1469	c.987C>A	c.(985-987)CTC>CTA	p.L329L	ST8SIA1_uc009zix.2_Silent_p.L186L	NM_003034	NP_003025	Q92185	SIA8A_HUMAN	alpha-2,8-sialyltransferase 1	329	Lumenal (Potential).				glycosphingolipid biosynthetic process|protein glycosylation	integral to Golgi membrane	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity			ovary(3)	3																		---	---	---	---	capture		Silent	SNP	22354570	22354570	15749	12	G	T	T	41	41	ST8SIA1	T	2	2
C12orf35	55196	broad.mit.edu	37	12	32145370	32145370	+	Silent	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32145370A>G	uc001rks.2	+	6	5559	c.5145A>G	c.(5143-5145)CTA>CTG	p.L1715L	C12orf35_uc001rkt.2_RNA	NM_018169	NP_060639	Q9HCM1	CL035_HUMAN	hypothetical protein LOC55196	1715										ovary(1)|skin(1)	2	all_cancers(9;3.36e-11)|all_epithelial(9;2.56e-11)|all_lung(12;5.67e-10)|Acute lymphoblastic leukemia(23;0.0122)|Lung SC(12;0.0336)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.204)		OV - Ovarian serous cystadenocarcinoma(6;0.0114)															---	---	---	---	capture		Silent	SNP	32145370	32145370	1726	12	A	G	G	14	14	C12orf35	G	4	4
NCKAP5L	57701	broad.mit.edu	37	12	50195633	50195633	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50195633G>T	uc009zlk.2	-	6	551	c.349C>A	c.(349-351)CAG>AAG	p.Q117K		NM_001037806	NP_001032895	Q9HCH0	NCK5L_HUMAN	NCK-associated protein 5-like	113	Pro-rich.									central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	50195633	50195633	10623	12	G	T	T	45	45	NCKAP5L	T	2	2
PAN2	9924	broad.mit.edu	37	12	56713650	56713650	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56713650C>T	uc001skx.2	-	21	3329	c.2956G>A	c.(2956-2958)GAG>AAG	p.E986K	PAN2_uc001skw.2_Missense_Mutation_p.E134K|PAN2_uc001skz.2_Missense_Mutation_p.E985K|PAN2_uc001sky.2_Missense_Mutation_p.E982K	NM_001127460	NP_001120932	Q504Q3	PAN2_HUMAN	PAN2 polyA specific ribonuclease subunit homolog	986	Exonuclease.				nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|nuclear-transcribed mRNA poly(A) tail shortening|ubiquitin-dependent protein catabolic process	cytosol|nucleus	nucleic acid binding|poly(A)-specific ribonuclease activity|ubiquitin thiolesterase activity			ovary(2)|skin(2)|large_intestine(1)|breast(1)	6																		---	---	---	---	capture		Missense_Mutation	SNP	56713650	56713650	11831	12	C	T	T	29	29	PAN2	T	2	2
LRP1	4035	broad.mit.edu	37	12	57569263	57569263	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57569263G>T	uc001snd.2	+	23	4034	c.3568G>T	c.(3568-3570)GGT>TGT	p.G1190C		NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	1190	EGF-like 5.|Extracellular (Potential).				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)											OREG0021937	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	57569263	57569263	9324	12	G	T	T	39	39	LRP1	T	1	1
NAV3	89795	broad.mit.edu	37	12	78522538	78522538	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:78522538C>T	uc001syp.2	+	18	4506	c.4333C>T	c.(4333-4335)CGT>TGT	p.R1445C	NAV3_uc001syo.2_Missense_Mutation_p.R1445C|NAV3_uc010sub.1_Missense_Mutation_p.R931C|NAV3_uc009zsf.2_Missense_Mutation_p.R276C	NM_014903	NP_055718	Q8IVL0	NAV3_HUMAN	neuron navigator 3	1445	Ser-rich.					nuclear outer membrane	ATP binding|nucleoside-triphosphatase activity			large_intestine(6)|ovary(5)|lung(2)|breast(1)|skin(1)|kidney(1)|pancreas(1)	17															HNSCC(70;0.22)			---	---	---	---	capture		Missense_Mutation	SNP	78522538	78522538	10581	12	C	T	T	27	27	NAV3	T	1	1
HAL	3034	broad.mit.edu	37	12	96387243	96387243	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:96387243C>A	uc001tem.1	-	8	872	c.575G>T	c.(574-576)CGC>CTC	p.R192L	HAL_uc009zti.1_RNA|HAL_uc010suw.1_5'UTR|HAL_uc010sux.1_Missense_Mutation_p.R192L	NM_002108	NP_002099	P42357	HUTH_HUMAN	histidine ammonia-lyase	192					biosynthetic process|histidine catabolic process	cytosol	histidine ammonia-lyase activity			ovary(2)|skin(1)	3					L-Histidine(DB00117)													---	---	---	---	capture		Missense_Mutation	SNP	96387243	96387243	7229	12	C	A	A	27	27	HAL	A	1	1
ASCL4	121549	broad.mit.edu	37	12	108169032	108169032	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:108169032C>A	uc001tmr.2	+	1	871	c.40C>A	c.(40-42)CCA>ACA	p.P14T		NM_203436	NP_982260	Q6XD76	ASCL4_HUMAN	achaete-scute complex-like 4	13					regulation of transcription from RNA polymerase II promoter|skin development|transcription, DNA-dependent	nucleus	DNA binding			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	108169032	108169032	1055	12	C	A	A	26	26	ASCL4	A	2	2
CORO1C	23603	broad.mit.edu	37	12	109052593	109052593	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109052593C>T	uc001tnj.2	-	5	647	c.551G>A	c.(550-552)CGG>CAG	p.R184Q	CORO1C_uc009zva.2_Missense_Mutation_p.R237Q|CORO1C_uc010sxf.1_Missense_Mutation_p.R147Q	NM_014325	NP_055140	Q9ULV4	COR1C_HUMAN	coronin, actin binding protein, 1C isoform 1	184	WD 3.				actin cytoskeleton organization|phagocytosis|signal transduction	actin cytoskeleton	actin filament binding			skin(3)	3																		---	---	---	---	capture		Missense_Mutation	SNP	109052593	109052593	3893	12	C	T	T	23	23	CORO1C	T	1	1
ACACB	32	broad.mit.edu	37	12	109698427	109698427	+	Silent	SNP	G	T	T	rs61753862		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109698427G>T	uc001tob.2	+	48	6758	c.6639G>T	c.(6637-6639)CCG>CCT	p.P2213P	ACACB_uc001toc.2_Silent_p.P2213P|ACACB_uc010sxl.1_RNA|ACACB_uc001tod.2_RNA|ACACB_uc010sxm.1_Silent_p.P879P	NM_001093	NP_001084	O00763	ACACB_HUMAN	acetyl-Coenzyme A carboxylase beta	2213	Carboxyltransferase.				acetyl-CoA metabolic process|carnitine shuttle|energy reserve metabolic process|fatty acid biosynthetic process|positive regulation of cellular metabolic process|protein homotetramerization|regulation of fatty acid oxidation	cytosol|endomembrane system|Golgi apparatus|membrane	acetyl-CoA carboxylase activity|ATP binding|biotin carboxylase activity|metal ion binding|protein binding			ovary(5)|upper_aerodigestive_tract(1)|pancreas(1)|skin(1)	8					Biotin(DB00121)													---	---	---	---	capture		Silent	SNP	109698427	109698427	108	12	G	T	T	38	38	ACACB	T	1	1
C12orf51	283450	broad.mit.edu	37	12	112694272	112694272	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112694272G>T	uc009zwc.2	-	14	1901	c.1883C>A	c.(1882-1884)CCT>CAT	p.P628H	C12orf51_uc010syk.1_Missense_Mutation_p.P451H|C12orf51_uc001tts.2_Missense_Mutation_p.P451H|C12orf51_uc001ttt.3_Missense_Mutation_p.P449H	NM_001109662	NP_001103132			chromosome 12 open reading frame 51											ovary(1)|lung(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	112694272	112694272	1740	12	G	T	T	35	35	C12orf51	T	2	2
MSI1	4440	broad.mit.edu	37	12	120789151	120789151	+	Silent	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:120789151A>G	uc001tye.1	-	11	850	c.786T>C	c.(784-786)CTT>CTC	p.L262L		NM_002442	NP_002433	O43347	MSI1H_HUMAN	musashi 1	262					nervous system development	cytoplasm|nucleus	nucleotide binding			central_nervous_system(2)|breast(1)	3	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---	capture		Silent	SNP	120789151	120789151	10268	12	A	G	G	13	13	MSI1	G	4	4
SBNO1	55206	broad.mit.edu	37	12	123808232	123808232	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123808232C>A	uc010tap.1	-	15	2120	c.2120G>T	c.(2119-2121)CGG>CTG	p.R707L	SBNO1_uc010tao.1_Missense_Mutation_p.R706L|SBNO1_uc010taq.1_Intron|SBNO1_uc001uet.2_Missense_Mutation_p.R707L|SBNO1_uc001ueu.2_Missense_Mutation_p.R706L|SBNO1_uc001uev.2_Missense_Mutation_p.R705L|SBNO1_uc009zxy.1_Missense_Mutation_p.R672L	NM_018183	NP_060653	A3KN83	SBNO1_HUMAN	sno, strawberry notch homolog 1	707							ATP binding|DNA binding|hydrolase activity			breast(5)|skin(2)|ovary(1)|kidney(1)	9	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000701)|Epithelial(86;0.00197)														---	---	---	---	capture		Missense_Mutation	SNP	123808232	123808232	14343	12	C	A	A	23	23	SBNO1	A	1	1
TCTN2	79867	broad.mit.edu	37	12	124163813	124163813	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124163813G>A	uc001ufp.2	+	5	669	c.541G>A	c.(541-543)GAT>AAT	p.D181N	TCTN2_uc009zya.2_Missense_Mutation_p.D180N	NM_024809	NP_079085	Q96GX1	TECT2_HUMAN	tectonic family member 2 isoform 1	181	Extracellular (Potential).|Cys-rich.				cilium assembly|smoothened signaling pathway	integral to membrane				ovary(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000163)|Epithelial(86;0.000502)|all cancers(50;0.00451)														---	---	---	---	capture		Missense_Mutation	SNP	124163813	124163813	16249	12	G	A	A	45	45	TCTN2	A	2	2
DNAH10	196385	broad.mit.edu	37	12	124257441	124257441	+	Nonsense_Mutation	SNP	G	T	T	rs142898915	by1000genomes	TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124257441G>T	uc001uft.3	+	4	299	c.274G>T	c.(274-276)GAG>TAG	p.E92*		NM_207437	NP_997320	Q8IVF4	DYH10_HUMAN	dynein, axonemal, heavy chain 10	92	Stem (By similarity).				microtubule-based movement	cilium axoneme|cytoplasm|dynein complex|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(3)|skin(2)|central_nervous_system(1)	6	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000207)|Epithelial(86;0.000556)|all cancers(50;0.00346)														---	---	---	---	capture		Nonsense_Mutation	SNP	124257441	124257441	4780	12	G	T	T	37	37	DNAH10	T	5	1
ZDHHC20	253832	broad.mit.edu	37	13	21976986	21976986	+	Silent	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:21976986T>C	uc001uob.2	-	5	503	c.390A>G	c.(388-390)AAA>AAG	p.K130K	ZDHHC20_uc001uod.2_RNA|ZDHHC20_uc001uoc.2_RNA|ZDHHC20_uc001uoe.2_RNA|ZDHHC20_uc010tcs.1_Silent_p.K67K	NM_153251	NP_694983	Q5W0Z9	ZDH20_HUMAN	zinc finger, DHHC-type containing 20	130	DHHC-type.					integral to membrane	acyltransferase activity|zinc ion binding			ovary(1)	1		all_cancers(29;8.1e-16)|all_epithelial(30;3.63e-14)|all_lung(29;2.04e-13)|Lung SC(185;0.0367)		all cancers(112;0.000268)|Epithelial(112;0.000735)|OV - Ovarian serous cystadenocarcinoma(117;0.00517)|Lung(94;0.171)														---	---	---	---	capture		Silent	SNP	21976986	21976986	18199	13	T	C	C	52	52	ZDHHC20	C	4	4
SACS	26278	broad.mit.edu	37	13	23906130	23906130	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:23906130A>G	uc001uon.2	-	10	12474	c.11885T>C	c.(11884-11886)ATA>ACA	p.I3962T	SACS_uc001uoo.2_Missense_Mutation_p.I3815T|SACS_uc001uop.1_Intron|SACS_uc001uoq.1_Intron	NM_014363	NP_055178	Q9NZJ4	SACS_HUMAN	sacsin	3962					cell death|negative regulation of inclusion body assembly|protein folding	axon|cell body fiber|dendrite|mitochondrion|nucleus	ATP binding|chaperone binding|Hsp70 protein binding|proteasome binding			ovary(7)|skin(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	12		all_cancers(29;1.51e-22)|all_epithelial(30;7.82e-19)|all_lung(29;4.71e-18)|Lung SC(185;0.0225)|Breast(139;0.128)		all cancers(112;0.00197)|Epithelial(112;0.00854)|OV - Ovarian serous cystadenocarcinoma(117;0.0298)|Lung(94;0.189)														---	---	---	---	capture		Missense_Mutation	SNP	23906130	23906130	14284	13	A	G	G	16	16	SACS	G	4	4
N4BP2L2	10443	broad.mit.edu	37	13	33110164	33110164	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:33110164T>C	uc001uuk.3	-	2	1179	c.1001A>G	c.(1000-1002)AAC>AGC	p.N334S	N4BP2L2_uc010abe.1_Intron|N4BP2L2_uc010tdz.1_Intron|N4BP2L2_uc001uul.1_Missense_Mutation_p.N334S|N4BP2L2_uc001uum.2_5'Flank	NM_014887	NP_055702	Q92802	N42L2_HUMAN	phosphonoformate immuno-associated protein 5	334											0		Lung SC(185;0.0262)		all cancers(112;9.5e-07)|Epithelial(112;5.07e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.00196)|BRCA - Breast invasive adenocarcinoma(63;0.00438)|GBM - Glioblastoma multiforme(144;0.243)														---	---	---	---	capture		Missense_Mutation	SNP	33110164	33110164	10507	13	T	C	C	60	60	N4BP2L2	C	4	4
CSNK1A1L	122011	broad.mit.edu	37	13	37679333	37679333	+	Missense_Mutation	SNP	G	C	C	rs56158728	by1000genomes	TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:37679333G>C	uc001uwm.1	-	1	469	c.61C>G	c.(61-63)CGG>GGG	p.R21G		NM_145203	NP_660204	Q8N752	KC1AL_HUMAN	casein kinase 1, alpha 1-like	21	Protein kinase.		R -> W.		Wnt receptor signaling pathway	cytoplasm	ATP binding|protein serine/threonine kinase activity	p.R21Q(1)		large_intestine(1)	1		Lung NSC(96;7.97e-05)|Breast(139;0.0615)|Lung SC(185;0.0743)|Prostate(109;0.109)		all cancers(112;3.58e-07)|Epithelial(112;1.29e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.00695)|BRCA - Breast invasive adenocarcinoma(63;0.0117)|GBM - Glioblastoma multiforme(144;0.0407)														---	---	---	---	capture		Missense_Mutation	SNP	37679333	37679333	4092	13	G	C	C	38	38	CSNK1A1L	C	3	3
UFM1	51569	broad.mit.edu	37	13	38934882	38934882	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:38934882G>A	uc001uwu.2	+	6	340	c.225G>A	c.(223-225)CGG>CGA	p.R75R	UFM1_uc010aca.2_3'UTR	NM_016617	NP_057701	P61960	UFM1_HUMAN	ubiquitin-fold modifier 1 precursor	75					protein ufmylation	cytoplasm|nucleus	protein binding				0		Lung NSC(96;3.18e-06)|Prostate(109;0.00314)|Breast(139;0.0199)|Lung SC(185;0.0743)		all cancers(112;1.05e-08)|Epithelial(112;1.44e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.000855)|BRCA - Breast invasive adenocarcinoma(63;0.00342)|GBM - Glioblastoma multiforme(144;0.0132)														---	---	---	---	capture		Silent	SNP	38934882	38934882	17494	13	G	A	A	41	41	UFM1	A	2	2
PCDH20	64881	broad.mit.edu	37	13	61986832	61986832	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:61986832C>A	uc001vid.3	-	2	1764	c.1400G>T	c.(1399-1401)TGC>TTC	p.C467F	PCDH20_uc010thj.1_Missense_Mutation_p.C467F	NM_022843	NP_073754	Q8N6Y1	PCD20_HUMAN	protocadherin 20	440	Cadherin 3.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|breast(1)|central_nervous_system(1)	6		Breast(118;0.195)|Prostate(109;0.229)		GBM - Glioblastoma multiforme(99;0.000118)														---	---	---	---	capture		Missense_Mutation	SNP	61986832	61986832	11935	13	C	A	A	25	25	PCDH20	A	2	2
DACH1	1602	broad.mit.edu	37	13	72014822	72014822	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:72014822C>A	uc010thn.1	-	12	2509	c.2086G>T	c.(2086-2088)GGA>TGA	p.G696*	DACH1_uc010tho.1_Nonsense_Mutation_p.G548*|DACH1_uc010thp.1_Nonsense_Mutation_p.G494*	NM_080759	NP_542937	Q9UI36	DACH1_HUMAN	dachshund homolog 1 isoform a	748					multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus	DNA binding|nucleotide binding|protein binding			breast(1)	1		Acute lymphoblastic leukemia(28;0.0503)|Breast(118;0.198)		GBM - Glioblastoma multiforme(99;0.00032)														---	---	---	---	capture		Nonsense_Mutation	SNP	72014822	72014822	4386	13	C	A	A	21	21	DACH1	A	5	2
EDNRB	1910	broad.mit.edu	37	13	78492262	78492262	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:78492262C>A	uc001vko.2	-	1	705	c.447G>T	c.(445-447)CTG>CTT	p.L149L	uc001vks.2_5'Flank|EDNRB_uc001vkq.1_Silent_p.L149L|EDNRB_uc010aez.1_Silent_p.L149L|EDNRB_uc001vkp.1_Silent_p.L232L|EDNRB_uc010afa.1_Silent_p.L149L	NM_001122659	NP_001116131	P24530	EDNRB_HUMAN	endothelin receptor type B isoform 1 precursor	149	Helical; Name=2; (Potential).				activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|enteric nervous system development|enteric smooth muscle cell differentiation|macrophage chemotaxis|negative regulation of adenylate cyclase activity|negative regulation of cellular protein metabolic process|negative regulation of neuron maturation|negative regulation of transcription from RNA polymerase II promoter|vein smooth muscle contraction	integral to plasma membrane	endothelin-B receptor activity|peptide hormone binding				0		Acute lymphoblastic leukemia(28;0.0279)|Breast(118;0.037)		GBM - Glioblastoma multiforme(99;0.0933)	Bosentan(DB00559)													---	---	---	---	capture		Silent	SNP	78492262	78492262	5107	13	C	A	A	25	25	EDNRB	A	2	2
CLDN10	9071	broad.mit.edu	37	13	96086145	96086145	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:96086145G>A	uc001vmg.2	+	1	293	c.58G>A	c.(58-60)GTT>ATT	p.V20I	CLDN10_uc010tii.1_Missense_Mutation_p.V20I	NM_182848	NP_878268	P78369	CLD10_HUMAN	claudin 10 isoform a	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					calcium-independent cell-cell adhesion	integral to membrane|tight junction	identical protein binding|structural molecule activity			ovary(1)	1	all_neural(89;0.0878)|Breast(111;0.148)|Medulloblastoma(90;0.163)		BRCA - Breast invasive adenocarcinoma(86;0.18)															---	---	---	---	capture		Missense_Mutation	SNP	96086145	96086145	3608	13	G	A	A	40	40	CLDN10	A	1	1
DOCK9	23348	broad.mit.edu	37	13	99452707	99452707	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:99452707C>G	uc001vnt.2	-	52	5851	c.5796G>C	c.(5794-5796)AAG>AAC	p.K1932N	DOCK9_uc001vnw.2_Missense_Mutation_p.K1931N|DOCK9_uc001vnq.2_Missense_Mutation_p.K479N|DOCK9_uc001vnr.2_Missense_Mutation_p.K561N|DOCK9_uc010tin.1_Missense_Mutation_p.K550N|DOCK9_uc001vns.2_Missense_Mutation_p.K467N|DOCK9_uc010tio.1_Missense_Mutation_p.K587N|DOCK9_uc010tip.1_Missense_Mutation_p.K628N	NM_015296	NP_056111	Q9BZ29	DOCK9_HUMAN	dedicator of cytokinesis 9 isoform a	1932	DHR-2.				blood coagulation	cytosol|endomembrane system|membrane	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			central_nervous_system(1)	1	all_neural(89;0.101)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)																	---	---	---	---	capture		Missense_Mutation	SNP	99452707	99452707	4878	13	C	G	G	32	32	DOCK9	G	3	3
NALCN	259232	broad.mit.edu	37	13	101753194	101753194	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101753194C>T	uc001vox.1	-	27	3292	c.3103G>A	c.(3103-3105)GGA>AGA	p.G1035R		NM_052867	NP_443099	Q8IZF0	NALCN_HUMAN	voltage gated channel like 1	1035	Helical; Name=S5 of repeat III; (Potential).					integral to membrane	sodium channel activity|voltage-gated ion channel activity			ovary(8)|breast(4)|skin(2)|pancreas(1)|central_nervous_system(1)	16	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---	capture		Missense_Mutation	SNP	101753194	101753194	10544	13	C	T	T	21	21	NALCN	T	2	2
ITGBL1	9358	broad.mit.edu	37	13	102250523	102250523	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:102250523G>T	uc001vpb.2	+	7	1108	c.889G>T	c.(889-891)GGA>TGA	p.G297*	ITGBL1_uc010agb.2_Nonsense_Mutation_p.G248*|ITGBL1_uc001vpc.3_Nonsense_Mutation_p.G156*	NM_004791	NP_004782	O95965	ITGBL_HUMAN	integrin, beta-like 1 (with EGF-like repeat	297	VI.|Cysteine-rich tandem repeats.				cell-matrix adhesion|integrin-mediated signaling pathway	extracellular region|integrin complex	binding|receptor activity			ovary(1)|skin(1)	2	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---	capture		Nonsense_Mutation	SNP	102250523	102250523	8206	13	G	T	T	39	39	ITGBL1	T	5	1
ERCC5	2073	broad.mit.edu	37	13	103528079	103528079	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:103528079G>T	uc001vpw.2	+	15	3830	c.3387G>T	c.(3385-3387)TCG>TCT	p.S1129S		NM_000123	NP_000114	P28715	ERCC5_HUMAN	XPG-complementing protein	1129					negative regulation of apoptosis|nucleotide-excision repair, DNA damage removal|nucleotide-excision repair, DNA incision, 3'-to lesion|response to UV-C|transcription-coupled nucleotide-excision repair|UV protection	nucleoplasm	bubble DNA binding|double-stranded DNA binding|endodeoxyribonuclease activity|metal ion binding|protein homodimerization activity|protein N-terminus binding|single-stranded DNA binding			ovary(4)|lung(1)|central_nervous_system(1)|skin(1)	7	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.211)							Mis|N|F			skin basal cell|skin squamous cell|melanoma		Direct_reversal_of_damage|NER	Xeroderma_Pigmentosum				---	---	---	---	capture		Silent	SNP	103528079	103528079	5409	13	G	T	T	38	38	ERCC5	T	1	1
FAM155A	728215	broad.mit.edu	37	13	108518186	108518186	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:108518186C>A	uc001vql.2	-	1	1275	c.759G>T	c.(757-759)AAG>AAT	p.K253N		NM_001080396	NP_001073865	B1AL88	F155A_HUMAN	family with sequence similarity 155, member A	253						integral to membrane	binding			skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	108518186	108518186	5663	13	C	A	A	24	24	FAM155A	A	2	2
LIG4	3981	broad.mit.edu	37	13	108861558	108861558	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:108861558C>A	uc001vqn.2	-	2	2332	c.2059G>T	c.(2059-2061)GGT>TGT	p.G687C	LIG4_uc001vqo.2_Missense_Mutation_p.G687C|LIG4_uc010agg.1_Missense_Mutation_p.G620C|LIG4_uc010agf.2_Missense_Mutation_p.G687C|LIG4_uc001vqp.2_Missense_Mutation_p.G687C	NM_002312	NP_002303	P49917	DNLI4_HUMAN	DNA ligase IV	687	BRCT 1.				cell cycle|cell division|cell proliferation|central nervous system development|chromosome organization|DNA ligation involved in DNA recombination|DNA ligation involved in DNA repair|DNA replication|double-strand break repair via nonhomologous end joining|in utero embryonic development|initiation of viral infection|isotype switching|negative regulation of neuron apoptosis|neuron apoptosis|nucleotide-excision repair, DNA gap filling|positive regulation of fibroblast proliferation|positive regulation of neurogenesis|pro-B cell differentiation|provirus integration|response to gamma radiation|response to X-ray|single strand break repair|somatic stem cell maintenance|T cell differentiation in thymus|T cell receptor V(D)J recombination	condensed chromosome|cytoplasm|DNA ligase IV complex|DNA-dependent protein kinase-DNA ligase 4 complex|focal adhesion|nucleoplasm	ATP binding|DNA binding|DNA ligase (ATP) activity|metal ion binding|protein C-terminus binding				0	all_lung(23;0.000238)|all_neural(89;0.00256)|Lung NSC(43;0.0056)|Medulloblastoma(90;0.00596)|Lung SC(71;0.104)												NHEJ					---	---	---	---	capture		Missense_Mutation	SNP	108861558	108861558	9109	13	C	A	A	21	21	LIG4	A	2	2
OR4Q3	441669	broad.mit.edu	37	14	20216032	20216032	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20216032G>C	uc010tkt.1	+	1	446	c.446G>C	c.(445-447)TGC>TCC	p.C149S		NM_172194	NP_751944	Q8NH05	OR4Q3_HUMAN	olfactory receptor, family 4, subfamily Q,	149	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			breast(3)	3	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;2.95e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---	capture		Missense_Mutation	SNP	20216032	20216032	11491	14	G	C	C	46	46	OR4Q3	C	3	3
OR4M1	441670	broad.mit.edu	37	14	20248958	20248958	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20248958G>C	uc010tku.1	+	1	477	c.477G>C	c.(475-477)CAG>CAC	p.Q159H		NM_001005500	NP_001005500	Q8NGD0	OR4M1_HUMAN	olfactory receptor, family 4, subfamily M,	159	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;2.95e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---	capture		Missense_Mutation	SNP	20248958	20248958	11485	14	G	C	C	35	35	OR4M1	C	3	3
OR4K15	81127	broad.mit.edu	37	14	20444613	20444613	+	Silent	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20444613G>C	uc010tkx.1	+	1	936	c.936G>C	c.(934-936)ACG>ACC	p.T312T		NM_001005486	NP_001005486	Q8NH41	OR4KF_HUMAN	olfactory receptor, family 4, subfamily K,	312	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;3.58e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---	capture		Silent	SNP	20444613	20444613	11480	14	G	C	C	38	38	OR4K15	C	3	3
NGDN	25983	broad.mit.edu	37	14	23945346	23945346	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23945346G>T	uc001wjy.2	+	7	556	c.529G>T	c.(529-531)GTT>TTT	p.V177F	NGDN_uc001wjz.2_Missense_Mutation_p.V177F|NGDN_uc001wka.2_5'Flank	NM_001042635	NP_001036100	Q8NEJ9	NGDN_HUMAN	neuroguidin isoform 1	177					regulation of translation	axon|cytoplasm|dendrite|filopodium|nucleus					0	all_cancers(95;0.000251)			GBM - Glioblastoma multiforme(265;0.00654)														---	---	---	---	capture		Missense_Mutation	SNP	23945346	23945346	10793	14	G	T	T	44	44	NGDN	T	2	2
AKAP6	9472	broad.mit.edu	37	14	33291286	33291286	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:33291286C>T	uc001wrq.2	+	13	4437	c.4267C>T	c.(4267-4269)CCA>TCA	p.P1423S		NM_004274	NP_004265	Q13023	AKAP6_HUMAN	A-kinase anchor protein 6	1423					protein targeting	calcium channel complex|nuclear membrane|sarcoplasmic reticulum	protein kinase A binding|receptor binding			breast(6)|ovary(5)|lung(4)|skin(3)|large_intestine(2)|pancreas(1)	21	Breast(36;0.0388)|Prostate(35;0.15)		LUAD - Lung adenocarcinoma(48;0.00107)|Lung(238;0.00677)|STAD - Stomach adenocarcinoma(7;0.116)	GBM - Glioblastoma multiforme(265;0.019)														---	---	---	---	capture		Missense_Mutation	SNP	33291286	33291286	458	14	C	T	T	30	30	AKAP6	T	2	2
RALGAPA1	253959	broad.mit.edu	37	14	36219896	36219896	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:36219896T>A	uc001wti.2	-	9	1194	c.803A>T	c.(802-804)GAC>GTC	p.D268V	RALGAPA1_uc001wtj.2_Missense_Mutation_p.D268V|RALGAPA1_uc010tpv.1_Missense_Mutation_p.D268V|RALGAPA1_uc010tpw.1_Missense_Mutation_p.D268V|RALGAPA1_uc001wtk.1_Missense_Mutation_p.D119V	NM_014990	NP_055805	Q6GYQ0	RGPA1_HUMAN	Ral GTPase activating protein, alpha subunit 1	268					activation of Ral GTPase activity	cytosol|mitochondrion|nucleus	protein heterodimerization activity|Ral GTPase activator activity			ovary(3)|breast(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	36219896	36219896	13473	14	T	A	A	58	58	RALGAPA1	A	4	4
LRFN5	145581	broad.mit.edu	37	14	42356584	42356584	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:42356584G>C	uc001wvm.2	+	3	1954	c.756G>C	c.(754-756)AGG>AGC	p.R252S	LRFN5_uc010ana.2_Missense_Mutation_p.R252S	NM_152447	NP_689660	Q96NI6	LRFN5_HUMAN	leucine rich repeat and fibronectin type III	252	Extracellular (Potential).|LRRCT.					integral to membrane				ovary(5)|pancreas(2)|central_nervous_system(1)	8			LUAD - Lung adenocarcinoma(50;0.0223)|Lung(238;0.0728)	GBM - Glioblastoma multiforme(112;0.00847)											HNSCC(30;0.082)			---	---	---	---	capture		Missense_Mutation	SNP	42356584	42356584	9314	14	G	C	C	42	42	LRFN5	C	3	3
FSCB	84075	broad.mit.edu	37	14	44973864	44973864	+	Missense_Mutation	SNP	A	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:44973864A>T	uc001wvn.2	-	1	2636	c.2327T>A	c.(2326-2328)GTT>GAT	p.V776D		NM_032135	NP_115511	Q5H9T9	FSCB_HUMAN	fibrous sheath CABYR binding protein	776						cilium				lung(3)|breast(3)|ovary(2)|central_nervous_system(1)	9				GBM - Glioblastoma multiforme(112;0.128)														---	---	---	---	capture		Missense_Mutation	SNP	44973864	44973864	6316	14	A	T	T	2	2	FSCB	T	4	4
ERO1L	30001	broad.mit.edu	37	14	53120022	53120022	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:53120022C>G	uc001wzv.2	-	12	1046	c.820G>C	c.(820-822)GAA>CAA	p.E274Q	ERO1L_uc001wzw.2_RNA|ERO1L_uc010aof.2_RNA	NM_014584	NP_055399	Q96HE7	ERO1A_HUMAN	ERO1-like precursor	274					chaperone mediated protein folding requiring cofactor|electron transport chain|protein thiol-disulfide exchange|response to temperature stimulus|transport	endoplasmic reticulum lumen|endoplasmic reticulum membrane|microsome	disulfide oxidoreductase activity|flavin adenine dinucleotide binding|oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor				0	Breast(41;0.226)																	---	---	---	---	capture		Missense_Mutation	SNP	53120022	53120022	5432	14	C	G	G	32	32	ERO1L	G	3	3
SYNE2	23224	broad.mit.edu	37	14	64692225	64692225	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64692225A>G	uc001xgm.2	+	115	20869	c.20639A>G	c.(20638-20640)AAT>AGT	p.N6880S	SYNE2_uc001xgl.2_Missense_Mutation_p.N6902S|SYNE2_uc010apy.2_Missense_Mutation_p.N3265S|SYNE2_uc001xgn.2_Missense_Mutation_p.N1841S|SYNE2_uc001xgo.2_RNA|SYNE2_uc010aqa.2_Missense_Mutation_p.N850S|SYNE2_uc001xgq.2_Missense_Mutation_p.N1259S|SYNE2_uc001xgr.2_Missense_Mutation_p.N663S|SYNE2_uc010tsi.1_Missense_Mutation_p.N537S|SYNE2_uc001xgs.2_Missense_Mutation_p.N551S|SYNE2_uc001xgt.2_Missense_Mutation_p.N424S	NM_015180	NP_055995	Q8WXH0	SYNE2_HUMAN	spectrin repeat containing, nuclear envelope 2	6880	Perinuclear space (Potential).|KASH.				centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)														---	---	---	---	capture		Missense_Mutation	SNP	64692225	64692225	15967	14	A	G	G	4	4	SYNE2	G	4	4
KIAA0247	9766	broad.mit.edu	37	14	70171368	70171368	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:70171368G>A	uc001xlk.2	+	4	683	c.367G>A	c.(367-369)GCT>ACT	p.A123T	KIAA0247_uc010aqz.2_Missense_Mutation_p.A98T	NM_014734	NP_055549	Q92537	K0247_HUMAN	hypothetical protein LOC9766 precursor	123	Helical; (Potential).					integral to membrane				ovary(3)	3				all cancers(60;0.00155)|BRCA - Breast invasive adenocarcinoma(234;0.0164)|OV - Ovarian serous cystadenocarcinoma(108;0.0196)														---	---	---	---	capture		Missense_Mutation	SNP	70171368	70171368	8472	14	G	A	A	42	42	KIAA0247	A	2	2
DPF3	8110	broad.mit.edu	37	14	73238469	73238469	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:73238469G>C	uc001xnc.2	-	2	178	c.165C>G	c.(163-165)ATC>ATG	p.I55M	DPF3_uc001xnf.2_RNA|DPF3_uc010ari.1_Missense_Mutation_p.I55M|DPF3_uc010ttq.1_Missense_Mutation_p.I65M	NM_012074	NP_036206	Q92784	DPF3_HUMAN	D4, zinc and double PHD fingers, family 3	55					chromatin modification|nervous system development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nBAF complex	nucleic acid binding|zinc ion binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(234;0.00649)|OV - Ovarian serous cystadenocarcinoma(108;0.0654)														---	---	---	---	capture		Missense_Mutation	SNP	73238469	73238469	4902	14	G	C	C	33	33	DPF3	C	3	3
NEK9	91754	broad.mit.edu	37	14	75590749	75590749	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75590749C>A	uc001xrl.2	-	2	551	c.397G>T	c.(397-399)GGA>TGA	p.G133*		NM_033116	NP_149107	Q8TD19	NEK9_HUMAN	NIMA-related kinase 9	133	Protein kinase.				cell division|mitosis	mitochondrion|nucleus	ATP binding|metal ion binding|protein kinase binding|protein serine/threonine kinase activity			lung(2)|stomach(2)|ovary(1)	5				BRCA - Breast invasive adenocarcinoma(234;0.00718)														---	---	---	---	capture		Nonsense_Mutation	SNP	75590749	75590749	10730	14	C	A	A	21	21	NEK9	A	5	2
VIPAR	63894	broad.mit.edu	37	14	77919646	77919646	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77919646C>A	uc001xtt.1	-	4	530	c.192G>T	c.(190-192)GTG>GTT	p.V64V	VIPAR_uc001xtu.1_Silent_p.V64V|VIPAR_uc010tvj.1_Silent_p.V64V|VIPAR_uc001xtv.1_Silent_p.V64V	NM_022067	NP_071350	Q9H9C1	VIPAR_HUMAN	hypothetical protein LOC63894	64					endosome to lysosome transport|intracellular protein transport|regulation of transcription, DNA-dependent|transcription, DNA-dependent	early endosome|late endosome|recycling endosome	protein binding			central_nervous_system(1)	1																		---	---	---	---	capture		Silent	SNP	77919646	77919646	17735	14	C	A	A	21	21	VIPAR	A	2	2
SPTLC2	9517	broad.mit.edu	37	14	77987879	77987879	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77987879C>T	uc001xub.2	-	10	1537	c.1349G>A	c.(1348-1350)AGG>AAG	p.R450K		NM_004863	NP_004854	O15270	SPTC2_HUMAN	serine palmitoyltransferase, long chain base	450				KECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVV -> NGI TIHEVVQTRNTYHRFSPLSPVFSHQCLWIML (in Ref. 5).		integral to membrane|serine C-palmitoyltransferase complex	pyridoxal phosphate binding|serine C-palmitoyltransferase activity|transferase activity, transferring nitrogenous groups	p.R450R(1)		upper_aerodigestive_tract(1)|ovary(1)	2			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0346)	L-Serine(DB00133)|Pyridoxal Phosphate(DB00114)													---	---	---	---	capture		Missense_Mutation	SNP	77987879	77987879	15638	14	C	T	T	24	24	SPTLC2	T	2	2
SPATA7	55812	broad.mit.edu	37	14	88857754	88857754	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:88857754G>T	uc001xwq.2	+	2	200	c.49G>T	c.(49-51)GGT>TGT	p.G17C	SPATA7_uc001xwr.2_Missense_Mutation_p.G17C	NM_018418	NP_060888	Q9P0W8	SPAT7_HUMAN	spermatogenesis-associated protein 7 isoform a	17					response to stimulus|visual perception					ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	88857754	88857754	15524	14	G	T	T	47	47	SPATA7	T	2	2
ASB2	51676	broad.mit.edu	37	14	94420769	94420769	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94420769C>A	uc001ycc.1	-	2	717	c.228G>T	c.(226-228)ATG>ATT	p.M76I	ASB2_uc001ycd.2_Missense_Mutation_p.M124I|ASB2_uc001yce.1_Missense_Mutation_p.M22I	NM_016150	NP_057234	Q96Q27	ASB2_HUMAN	ankyrin repeat and SOCS box-containing protein	76	ANK 1.				intracellular signal transduction					ovary(1)|pancreas(1)	2		all_cancers(154;0.13)		COAD - Colon adenocarcinoma(157;0.217)|Epithelial(152;0.232)														---	---	---	---	capture		Missense_Mutation	SNP	94420769	94420769	1041	14	C	A	A	29	29	ASB2	A	2	2
TNFAIP2	7127	broad.mit.edu	37	14	103598002	103598002	+	Missense_Mutation	SNP	T	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103598002T>G	uc001ymm.1	+	7	1456	c.1325T>G	c.(1324-1326)GTA>GGA	p.V442G	TNFAIP2_uc010awo.1_Missense_Mutation_p.V154G|TNFAIP2_uc010txz.1_Missense_Mutation_p.V111G|TNFAIP2_uc010tya.1_5'Flank	NM_006291	NP_006282	Q03169	TNAP2_HUMAN	tumor necrosis factor, alpha-induced protein 2	442					angiogenesis|cell differentiation	extracellular space				central_nervous_system(1)	1		Melanoma(154;0.155)	Epithelial(46;0.191)															---	---	---	---	capture		Missense_Mutation	SNP	103598002	103598002	16814	14	T	G	G	57	57	TNFAIP2	G	4	4
ZFYVE21	79038	broad.mit.edu	37	14	104198969	104198969	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:104198969G>T	uc001yoc.2	+	6	573	c.539G>T	c.(538-540)CGG>CTG	p.R180L	ZFYVE21_uc001yod.2_Missense_Mutation_p.R198L|ZFYVE21_uc001yoe.2_RNA	NM_024071	NP_076976	Q9BQ24	ZFY21_HUMAN	zinc finger, FYVE domain containing 21	180						cytoplasmic membrane-bounded vesicle|focal adhesion	metal ion binding				0		Melanoma(154;0.226)		Epithelial(152;0.245)														---	---	---	---	capture		Missense_Mutation	SNP	104198969	104198969	18257	14	G	T	T	39	39	ZFYVE21	T	1	1
OR4M2	390538	broad.mit.edu	37	15	22368733	22368733	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22368733C>A	uc010tzu.1	+	1	158	c.158C>A	c.(157-159)CCT>CAT	p.P53H	LOC727924_uc001yua.2_Intron|LOC727924_uc001yub.1_Intron|OR4N4_uc001yuc.1_Intron	NM_001004719	NP_001004719	Q8NGB6	OR4M2_HUMAN	olfactory receptor, family 4, subfamily M,	53	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		all_cancers(20;1.94e-20)|all_epithelial(15;3.94e-18)|Lung NSC(15;8.53e-15)|all_lung(15;2.87e-14)|Breast(32;0.00519)|Colorectal(260;0.101)	GBM - Glioblastoma multiforme(6;0.124)	all cancers(64;1.64e-11)|Epithelial(43;5.81e-10)|BRCA - Breast invasive adenocarcinoma(123;0.000255)|Kidney(6;0.00736)|KIRC - Kidney renal clear cell carcinoma(6;0.0135)|GBM - Glioblastoma multiforme(186;0.0963)														---	---	---	---	capture		Missense_Mutation	SNP	22368733	22368733	11486	15	C	A	A	24	24	OR4M2	A	2	2
OR4M2	390538	broad.mit.edu	37	15	22369360	22369360	+	Missense_Mutation	SNP	G	T	T	rs138137222	byFrequency	TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22369360G>T	uc010tzu.1	+	1	785	c.785G>T	c.(784-786)CGC>CTC	p.R262L	LOC727924_uc001yua.2_Intron|LOC727924_uc001yub.1_Intron|OR4N4_uc001yuc.1_Intron	NM_001004719	NP_001004719	Q8NGB6	OR4M2_HUMAN	olfactory receptor, family 4, subfamily M,	262	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		all_cancers(20;1.94e-20)|all_epithelial(15;3.94e-18)|Lung NSC(15;8.53e-15)|all_lung(15;2.87e-14)|Breast(32;0.00519)|Colorectal(260;0.101)	GBM - Glioblastoma multiforme(6;0.124)	all cancers(64;1.64e-11)|Epithelial(43;5.81e-10)|BRCA - Breast invasive adenocarcinoma(123;0.000255)|Kidney(6;0.00736)|KIRC - Kidney renal clear cell carcinoma(6;0.0135)|GBM - Glioblastoma multiforme(186;0.0963)														---	---	---	---	capture		Missense_Mutation	SNP	22369360	22369360	11486	15	G	T	T	38	38	OR4M2	T	1	1
OR4N4	283694	broad.mit.edu	37	15	22382912	22382912	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22382912C>A	uc001yuc.1	+	7	1421	c.440C>A	c.(439-441)GCT>GAT	p.A147D	LOC727924_uc001yub.1_Intron|OR4N4_uc010tzv.1_Missense_Mutation_p.A147D	NM_001005241	NP_001005241	Q8N0Y3	OR4N4_HUMAN	olfactory receptor, family 4, subfamily N,	147	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(4)|skin(1)	5		all_cancers(20;1.94e-20)|all_epithelial(15;3.94e-18)|Lung NSC(15;8.53e-15)|all_lung(15;2.87e-14)|Breast(32;0.00519)|Colorectal(260;0.101)	GBM - Glioblastoma multiforme(6;0.124)	all cancers(64;1.64e-11)|Epithelial(43;5.81e-10)|BRCA - Breast invasive adenocarcinoma(123;0.000255)|Kidney(6;0.00736)|KIRC - Kidney renal clear cell carcinoma(6;0.0135)|GBM - Glioblastoma multiforme(186;0.0963)														---	---	---	---	capture		Missense_Mutation	SNP	22382912	22382912	11488	15	C	A	A	28	28	OR4N4	A	2	2
C15orf2	23742	broad.mit.edu	37	15	24924184	24924184	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:24924184C>G	uc001ywo.2	+	1	3644	c.3170C>G	c.(3169-3171)GCA>GGA	p.A1057G		NM_018958	NP_061831	Q9NZP6	CO002_HUMAN	hypothetical protein LOC23742	1057					cell differentiation|multicellular organismal development|spermatogenesis					ovary(2)|large_intestine(2)|skin(2)|kidney(1)|central_nervous_system(1)	8		all_cancers(20;2.14e-21)|all_epithelial(15;4.77e-19)|Lung NSC(15;1.43e-14)|all_lung(15;9.57e-14)|Breast(32;0.00086)		all cancers(64;3.19e-24)|Epithelial(43;2.67e-17)|GBM - Glioblastoma multiforme(186;7.36e-07)|BRCA - Breast invasive adenocarcinoma(123;0.000273)|Lung(196;0.229)														---	---	---	---	capture		Missense_Mutation	SNP	24924184	24924184	1834	15	C	G	G	25	25	C15orf2	G	3	3
ATP10A	57194	broad.mit.edu	37	15	25924909	25924909	+	Missense_Mutation	SNP	G	T	T	rs113319791	byFrequency;by1000genomes	TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25924909G>T	uc010ayu.2	-	21	4185	c.4079C>A	c.(4078-4080)CCG>CAG	p.P1360Q		NM_024490	NP_077816	O60312	AT10A_HUMAN	ATPase, class V, type 10A	1360	Cytoplasmic (Potential).				ATP biosynthetic process|regulation of cell shape	integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			pancreas(2)|ovary(1)|breast(1)|liver(1)	5		all_cancers(20;5.16e-25)|all_lung(180;1.51e-14)|Acute lymphoblastic leukemia(1;2.53e-05)|all_hematologic(1;0.000267)|Breast(32;0.00125)		all cancers(64;9.48e-07)|Epithelial(43;1.69e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0252)|Lung(196;0.244)														---	---	---	---	capture		Missense_Mutation	SNP	25924909	25924909	1135	15	G	T	T	39	39	ATP10A	T	1	1
SPINT1	6692	broad.mit.edu	37	15	41149072	41149072	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41149072G>T	uc001zna.2	+	11	1693	c.1489G>T	c.(1489-1491)GGA>TGA	p.G497*	SPINT1_uc001znb.2_Nonsense_Mutation_p.G481*|SPINT1_uc001znc.2_Nonsense_Mutation_p.G481*|SPINT1_uc010ucs.1_Nonsense_Mutation_p.G488*	NM_181642	NP_857593	O43278	SPIT1_HUMAN	serine peptidase inhibitor, Kunitz type 1	497						extracellular region|membrane fraction	protein binding|serine-type endopeptidase inhibitor activity			ovary(1)	1		all_cancers(109;1.35e-17)|all_epithelial(112;3.78e-15)|Lung NSC(122;9.68e-11)|all_lung(180;2.25e-09)|Melanoma(134;0.0574)|Ovarian(310;0.0822)|Colorectal(260;0.0946)		GBM - Glioblastoma multiforme(113;2.91e-05)|COAD - Colon adenocarcinoma(120;0.153)|BRCA - Breast invasive adenocarcinoma(123;0.166)														---	---	---	---	capture		Nonsense_Mutation	SNP	41149072	41149072	15580	15	G	T	T	39	39	SPINT1	T	5	1
PPIP5K1	9677	broad.mit.edu	37	15	43827208	43827208	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43827208C>A	uc001zrw.2	-	31	4149	c.3966G>T	c.(3964-3966)GAG>GAT	p.E1322D	PPIP5K1_uc001zrx.1_Missense_Mutation_p.E1295D|PPIP5K1_uc001zru.2_Missense_Mutation_p.E1297D|PPIP5K1_uc001zry.3_Missense_Mutation_p.E1297D|PPIP5K1_uc001zrv.2_Missense_Mutation_p.E1083D	NM_001130858	NP_001124330	Q6PFW1	VIP1_HUMAN	histidine acid phosphatase domain containing 2A	1322					inositol metabolic process	cytosol	acid phosphatase activity|ATP binding|diphosphoinositol-pentakisphosphate kinase activity|inositol 1,3,4,5,6-pentakisphosphate kinase activity|inositol hexakisphosphate 5-kinase activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	43827208	43827208	12767	15	C	A	A	24	24	PPIP5K1	A	2	2
STRC	161497	broad.mit.edu	37	15	43903132	43903132	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43903132C>T	uc001zsf.2	-	14	3435	c.3357G>A	c.(3355-3357)GTG>GTA	p.V1119V	STRC_uc010bdl.2_Intron|STRC_uc001zse.2_Translation_Start_Site	NM_153700	NP_714544	Q7RTU9	STRC_HUMAN	stereocilin precursor	1119					sensory perception of sound	cell surface					0		all_cancers(109;3.26e-15)|all_epithelial(112;1.48e-12)|Lung NSC(122;2.76e-08)|all_lung(180;3.1e-07)|Melanoma(134;0.027)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;3.56e-07)														---	---	---	---	capture		Silent	SNP	43903132	43903132	15848	15	C	T	T	17	17	STRC	T	2	2
MPI	4351	broad.mit.edu	37	15	75189482	75189482	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75189482C>A	uc002azc.1	+	7	980	c.975C>A	c.(973-975)CTC>CTA	p.L325L	MPI_uc002azd.1_Intron|MPI_uc010ulx.1_Silent_p.L275L|MPI_uc002aze.1_Silent_p.L264L	NM_002435	NP_002426	P34949	MPI_HUMAN	mannose-6- phosphate isomerase	325					dolichol-linked oligosaccharide biosynthetic process|GDP-mannose biosynthetic process|post-translational protein modification|protein N-linked glycosylation via asparagine	cytosol	mannose-6-phosphate isomerase activity|zinc ion binding			ovary(2)	2																		---	---	---	---	capture		Silent	SNP	75189482	75189482	10121	15	C	A	A	30	30	MPI	A	2	2
C15orf17	57184	broad.mit.edu	37	15	75195106	75195106	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75195106G>T	uc002azh.3	-	5	772	c.451C>A	c.(451-453)CGG>AGG	p.R151R	C15orf17_uc010bkh.2_Silent_p.R65R|C15orf17_uc002azg.2_Silent_p.R150R|C15orf17_uc002azf.2_Silent_p.R151R	NM_020447	NP_065180	Q5XKK7	CO017_HUMAN	hypothetical protein LOC57184	151							cytochrome-c oxidase activity				0																		---	---	---	---	capture		Silent	SNP	75195106	75195106	1833	15	G	T	T	39	39	C15orf17	T	1	1
ACAN	176	broad.mit.edu	37	15	89400029	89400029	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:89400029C>A	uc010upo.1	+	12	4587	c.4213C>A	c.(4213-4215)CCT>ACT	p.P1405T	ACAN_uc010upp.1_Missense_Mutation_p.P1405T|ACAN_uc002bna.2_RNA	NM_013227	NP_037359	E7EX88	E7EX88_HUMAN	aggrecan isoform 2 precursor	1405					cell adhesion		hyaluronic acid binding|sugar binding			ovary(2)|central_nervous_system(1)	3	Lung NSC(78;0.0392)|all_lung(78;0.077)		BRCA - Breast invasive adenocarcinoma(143;0.146)															---	---	---	---	capture		Missense_Mutation	SNP	89400029	89400029	118	15	C	A	A	22	22	ACAN	A	2	2
CRTC3	64784	broad.mit.edu	37	15	91172762	91172762	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91172762C>A	uc002bpp.2	+	11	1370	c.1264C>A	c.(1264-1266)CAG>AAG	p.Q422K	CRTC3_uc002bpo.2_Missense_Mutation_p.Q422K	NM_022769	NP_073606	Q6UUV7	CRTC3_HUMAN	transducer of regulated CREB protein 3 isoform	422					interspecies interaction between organisms|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus			CRTC3/MAML2(26)	salivary_gland(26)|ovary(1)	27	Melanoma(11;0.00551)|Lung NSC(78;0.0931)|all_lung(78;0.163)		BRCA - Breast invasive adenocarcinoma(143;0.0745)					T	MAML2	salivary gland mucoepidermoid								---	---	---	---	capture		Missense_Mutation	SNP	91172762	91172762	4040	15	C	A	A	21	21	CRTC3	A	2	2
BLM	641	broad.mit.edu	37	15	91347526	91347526	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91347526G>T	uc002bpr.2	+	19	3785	c.3688G>T	c.(3688-3690)GGG>TGG	p.G1230W	BLM_uc010uqh.1_Missense_Mutation_p.G1230W|BLM_uc010uqi.1_Missense_Mutation_p.G855W|BLM_uc010bnx.2_Intron|BLM_uc002bpt.2_Missense_Mutation_p.G205W	NM_000057	NP_000048	P54132	BLM_HUMAN	Bloom syndrome protein	1230	HRDC.				double-strand break repair via homologous recombination|G2 phase of mitotic cell cycle|G2/M transition DNA damage checkpoint|negative regulation of cell division|positive regulation of transcription, DNA-dependent|protein oligomerization|regulation of cyclin-dependent protein kinase activity|replication fork processing|replication fork protection|response to X-ray	cytoplasm|lateral element|nuclear matrix|nucleolus|PML body	ATP binding|bubble DNA binding|DNA strand annealing activity|four-way junction helicase activity|G-quadruplex DNA binding|p53 binding			ovary(3)|skin(2)|breast(1)	6	Lung NSC(78;0.0875)|all_lung(78;0.109)		Lung(145;0.189)					Mis|N|F			leukemia|lymphoma|skin squamous cell |other cancers		Genes_defective_in_diseases_associated_with_sensitivity_to_DNA_damaging_agents	Bloom_syndrome				---	---	---	---	capture		Missense_Mutation	SNP	91347526	91347526	1470	15	G	T	T	43	43	BLM	T	2	2
FES	2242	broad.mit.edu	37	15	91438664	91438664	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91438664C>A	uc002bpv.2	+	19	2441	c.2345C>A	c.(2344-2346)CCA>CAA	p.P782Q	FES_uc010uqj.1_Missense_Mutation_p.P654Q|FES_uc010uqk.1_Missense_Mutation_p.P764Q|FES_uc002bpw.2_RNA|FES_uc010bny.2_Missense_Mutation_p.P641Q|FES_uc002bpx.2_Missense_Mutation_p.P712Q|FES_uc002bpy.2_Missense_Mutation_p.P724Q	NM_002005	NP_001996	P07332	FES_HUMAN	feline sarcoma oncogene isoform 1	782	Protein kinase.				axon guidance|cell proliferation|peptidyl-tyrosine phosphorylation	cytosol	ATP binding|non-membrane spanning protein tyrosine kinase activity|protein binding			lung(2)	2	Lung NSC(78;0.0771)|all_lung(78;0.137)		Lung(145;0.229)															---	---	---	---	capture		Missense_Mutation	SNP	91438664	91438664	6057	15	C	A	A	21	21	FES	A	2	2
MAPK8IP3	23162	broad.mit.edu	37	16	1814128	1814128	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1814128G>T	uc002cmk.2	+	18	2155	c.2035G>T	c.(2035-2037)GGG>TGG	p.G679W	MAPK8IP3_uc002cml.2_Missense_Mutation_p.G673W|MAPK8IP3_uc010uvl.1_Missense_Mutation_p.G680W	NM_015133	NP_055948	Q9UPT6	JIP3_HUMAN	mitogen-activated protein kinase 8 interacting	679					vesicle-mediated transport	Golgi membrane	kinesin binding|MAP-kinase scaffold activity|protein kinase binding			breast(2)|central_nervous_system(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	1814128	1814128	9669	16	G	T	T	39	39	MAPK8IP3	T	1	1
ZNF598	90850	broad.mit.edu	37	16	2049972	2049972	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2049972G>T	uc002cof.1	-	11	1593	c.1578C>A	c.(1576-1578)ACC>ACA	p.T526T	ZNF598_uc002coe.1_5'UTR	NM_178167	NP_835461	Q86UK7	ZN598_HUMAN	zinc finger protein 598	526						intracellular	zinc ion binding			lung(1)|breast(1)	2																		---	---	---	---	capture		Silent	SNP	2049972	2049972	18623	16	G	T	T	39	39	ZNF598	T	1	1
C16orf90	646174	broad.mit.edu	37	16	3544563	3544563	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3544563G>A	uc002cvi.2	-	2	361	c.361C>T	c.(361-363)CTG>TTG	p.L121L		NM_001080524	NP_001073993	A8MZG2	CP090_HUMAN	hypothetical protein LOC646174	111											0																		---	---	---	---	capture		Silent	SNP	3544563	3544563	1896	16	G	A	A	33	33	C16orf90	A	2	2
XYLT1	64131	broad.mit.edu	37	16	17211579	17211579	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:17211579G>T	uc002dfa.2	-	11	2566	c.2481C>A	c.(2479-2481)CAC>CAA	p.H827Q		NM_022166	NP_071449	Q86Y38	XYLT1_HUMAN	xylosyltransferase I	827	Lumenal (Potential).				glycosaminoglycan biosynthetic process	endoplasmic reticulum membrane|extracellular region|Golgi membrane|integral to membrane	acetylglucosaminyltransferase activity|protein xylosyltransferase activity			ovary(4)	4																		---	---	---	---	capture		Missense_Mutation	SNP	17211579	17211579	18046	16	G	T	T	44	44	XYLT1	T	2	2
TMC7	79905	broad.mit.edu	37	16	19058500	19058500	+	Nonsense_Mutation	SNP	G	T	T	rs146407341		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19058500G>T	uc002dfq.2	+	12	1799	c.1669G>T	c.(1669-1671)GGA>TGA	p.G557*	TMC7_uc002dfp.2_Nonsense_Mutation_p.G557*|TMC7_uc010vap.1_Nonsense_Mutation_p.G447*	NM_024847	NP_079123	Q7Z402	TMC7_HUMAN	transmembrane channel-like 7 isoform a	557	Helical; (Potential).					integral to membrane				skin(2)|ovary(1)	3																		---	---	---	---	capture		Nonsense_Mutation	SNP	19058500	19058500	16520	16	G	T	T	39	39	TMC7	T	5	1
ACSM1	116285	broad.mit.edu	37	16	20651905	20651905	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20651905T>C	uc002dhm.1	-	7	1062	c.994A>G	c.(994-996)ATC>GTC	p.I332V	ACSM1_uc002dhn.1_Intron|ACSM1_uc010bwg.1_Missense_Mutation_p.I332V	NM_052956	NP_443188	Q08AH1	ACSM1_HUMAN	acyl-CoA synthetase medium-chain family member	332					benzoate metabolic process|butyrate metabolic process|energy derivation by oxidation of organic compounds|fatty acid oxidation|xenobiotic metabolic process	mitochondrial matrix	acyl-CoA ligase activity|ATP binding|butyrate-CoA ligase activity|GTP binding|metal ion binding			central_nervous_system(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	20651905	20651905	183	16	T	C	C	51	51	ACSM1	C	4	4
PRKCB	5579	broad.mit.edu	37	16	24135245	24135245	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24135245G>A	uc002dmd.2	+	9	1205	c.1008G>A	c.(1006-1008)CGG>CGA	p.R336R	PRKCB_uc002dme.2_Silent_p.R336R	NM_212535	NP_997700	P05771	KPCB_HUMAN	protein kinase C, beta isoform 1	336					apoptosis|B cell activation|B cell receptor signaling pathway|intracellular signal transduction|lipoprotein transport|platelet activation|positive regulation of I-kappaB kinase/NF-kappaB cascade|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|synaptic transmission|transcription, DNA-dependent	cytosol|nucleus|plasma membrane	androgen receptor binding|ATP binding|chromatin binding|histone binding|histone kinase activity (H3-T6 specific)|ligand-dependent nuclear receptor transcription coactivator activity|protein kinase C activity|protein kinase C binding|zinc ion binding			ovary(3)|central_nervous_system(3)|lung(2)|large_intestine(1)	9					Vitamin E(DB00163)													---	---	---	---	capture		Silent	SNP	24135245	24135245	12951	16	G	A	A	41	41	PRKCB	A	2	2
ATXN2L	11273	broad.mit.edu	37	16	28842045	28842045	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28842045C>T	uc002drc.2	+	9	1312	c.1144C>T	c.(1144-1146)CGT>TGT	p.R382C	uc010vct.1_Intron|ATXN2L_uc010byl.1_Missense_Mutation_p.R382C|ATXN2L_uc002drb.2_Missense_Mutation_p.R382C|ATXN2L_uc002dqy.2_Missense_Mutation_p.R382C|ATXN2L_uc002dra.2_Missense_Mutation_p.R382C|ATXN2L_uc002dqz.2_Missense_Mutation_p.R382C|ATXN2L_uc010vdb.1_Missense_Mutation_p.R382C|ATXN2L_uc002dre.2_Missense_Mutation_p.R382C|ATXN2L_uc002drf.2_5'UTR	NM_007245	NP_009176	Q8WWM7	ATX2L_HUMAN	ataxin 2 related protein isoform A	382						membrane				upper_aerodigestive_tract(1)|ovary(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	28842045	28842045	1232	16	C	T	T	31	31	ATXN2L	T	1	1
SPNS1	83985	broad.mit.edu	37	16	28994515	28994515	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28994515C>T	uc010vdi.1	+	11	1364	c.1224C>T	c.(1222-1224)TAC>TAT	p.Y408Y	uc010vct.1_Intron|SPNS1_uc002drx.2_Silent_p.Y335Y|SPNS1_uc002dsa.2_Silent_p.Y408Y|SPNS1_uc002drz.2_Silent_p.Y356Y|SPNS1_uc010byp.2_Silent_p.Y334Y|SPNS1_uc010byq.1_Silent_p.Y340Y|LAT_uc010vdj.1_5'Flank|LAT_uc002dsb.2_5'Flank|LAT_uc002dsd.2_5'Flank|LAT_uc002dsc.2_5'Flank|LAT_uc010vdk.1_5'Flank|LAT_uc010vdl.1_5'Flank	NM_001142448	NP_001135920	Q9H2V7	SPNS1_HUMAN	spinster homolog 1 isoform 1	408					lipid transport|transmembrane transport	integral to membrane|mitochondrial inner membrane	protein binding				0																		---	---	---	---	capture		Silent	SNP	28994515	28994515	15587	16	C	T	T	19	19	SPNS1	T	1	1
ITFG1	81533	broad.mit.edu	37	16	47196508	47196508	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:47196508C>T	uc002eet.2	-	15	1583	c.1521G>A	c.(1519-1521)CGG>CGA	p.R507R	ITFG1_uc010vgg.1_Silent_p.R252R|ITFG1_uc010vgh.1_Silent_p.R394R	NM_030790	NP_110417	Q8TB96	TIP_HUMAN	integrin alpha FG-GAP repeat containing 1	507						extracellular region|integral to membrane				ovary(1)|central_nervous_system(1)	2		all_cancers(37;0.0613)|all_lung(18;0.0543)|Lung NSC(13;0.227)																---	---	---	---	capture		Silent	SNP	47196508	47196508	8173	16	C	T	T	30	30	ITFG1	T	2	2
GPR97	222487	broad.mit.edu	37	16	57712152	57712152	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57712152G>A	uc002emh.2	+	4	519	c.416G>A	c.(415-417)CGA>CAA	p.R139Q	GPR97_uc010cdc.2_Missense_Mutation_p.R139Q|GPR97_uc010vhv.1_Missense_Mutation_p.R19Q|GPR97_uc010cdd.2_RNA|GPR97_uc010cde.2_5'Flank	NM_170776	NP_740746	Q86Y34	GPR97_HUMAN	G protein-coupled receptor 97 precursor	139	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	57712152	57712152	6996	16	G	A	A	37	37	GPR97	A	1	1
CDH8	1006	broad.mit.edu	37	16	61851395	61851395	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:61851395G>T	uc002eog.1	-	7	1517	c.1265C>A	c.(1264-1266)TCC>TAC	p.S422Y	CDH8_uc002eoh.2_Missense_Mutation_p.S191Y	NM_001796	NP_001787	P55286	CADH8_HUMAN	cadherin 8, type 2 preproprotein	422	Extracellular (Potential).|Cadherin 4.				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|skin(2)|breast(1)	9		Ovarian(137;0.0799)|Melanoma(118;0.16)		UCEC - Uterine corpus endometrioid carcinoma (183;0.196)|Epithelial(162;0.0155)|all cancers(182;0.0305)|OV - Ovarian serous cystadenocarcinoma(108;0.0499)|BRCA - Breast invasive adenocarcinoma(181;0.249)														---	---	---	---	capture		Missense_Mutation	SNP	61851395	61851395	3245	16	G	T	T	41	41	CDH8	T	2	2
C16orf86	388284	broad.mit.edu	37	16	67701881	67701881	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67701881G>A	uc002ety.2	+	3	590	c.433G>A	c.(433-435)GAG>AAG	p.E145K	C16orf48_uc002etw.1_5'Flank|C16orf48_uc010cem.1_5'Flank|C16orf86_uc002etx.1_Missense_Mutation_p.E160K|C16orf86_uc002etz.2_RNA	NM_001012984	NP_001013002	Q6ZW13	CP086_HUMAN	hypothetical protein LOC388284	145											0		Acute lymphoblastic leukemia(13;3.76e-06)|all_hematologic(13;0.000303)|Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0143)|Epithelial(162;0.047)|all cancers(182;0.228)												OREG0023886	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	67701881	67701881	1892	16	G	A	A	45	45	C16orf86	A	2	2
ZNF19	7567	broad.mit.edu	37	16	71510125	71510125	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71510125C>G	uc010cgc.1	-	6	831	c.325G>C	c.(325-327)GAA>CAA	p.E109Q	ZNF23_uc002fai.2_Intron|ZNF19_uc002fak.1_Missense_Mutation_p.E97Q|ZNF19_uc002fal.1_Missense_Mutation_p.E97Q|ZNF19_uc002fam.1_Missense_Mutation_p.E109Q	NM_006961	NP_008892	P17023	ZNF19_HUMAN	zinc finger protein 19	109						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Ovarian(137;0.00965)		BRCA - Breast invasive adenocarcinoma(221;0.0161)|Kidney(780;0.0598)														---	---	---	---	capture		Missense_Mutation	SNP	71510125	71510125	18346	16	C	G	G	29	29	ZNF19	G	3	3
PMFBP1	83449	broad.mit.edu	37	16	72166752	72166752	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72166752C>G	uc002fcc.3	-	10	1514	c.1342G>C	c.(1342-1344)GCT>CCT	p.A448P	PMFBP1_uc002fcd.2_Missense_Mutation_p.A448P|PMFBP1_uc002fce.2_RNA|PMFBP1_uc002fcf.2_Missense_Mutation_p.A303P	NM_031293	NP_112583	Q8TBY8	PMFBP_HUMAN	polyamine modulated factor 1 binding protein 1	448	Potential.									ovary(2)	2		Ovarian(137;0.179)																---	---	---	---	capture		Missense_Mutation	SNP	72166752	72166752	12560	16	C	G	G	26	26	PMFBP1	G	3	3
CHST5	23563	broad.mit.edu	37	16	75563809	75563809	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:75563809G>T	uc002fei.2	-	3	1869	c.474C>A	c.(472-474)AGC>AGA	p.S158R	CHST5_uc002fej.1_Missense_Mutation_p.S164R	NM_024533	NP_078809	Q9GZS9	CHST5_HUMAN	carbohydrate (N-acetylglucosamine 6-O)	158	Lumenal (Potential).				N-acetylglucosamine metabolic process|protein sulfation	integral to membrane|intrinsic to Golgi membrane	N-acetylglucosamine 6-O-sulfotransferase activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	75563809	75563809	3541	16	G	T	T	38	38	CHST5	T	1	1
C16orf7	9605	broad.mit.edu	37	16	89777102	89777102	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89777102C>G	uc002fom.1	-	10	1275	c.1150G>C	c.(1150-1152)GAG>CAG	p.E384Q	C16orf7_uc002fol.1_Missense_Mutation_p.E314Q|uc002fon.1_5'Flank	NM_004913	NP_004904	Q9Y2B5	CP007_HUMAN	chromosome 16 open reading frame 7	384					ATP synthesis coupled proton transport		GTPase activator activity|transporter activity				0		Lung NSC(15;2.19e-05)|all_lung(18;3.07e-05)|all_hematologic(23;0.0256)		BRCA - Breast invasive adenocarcinoma(80;0.0273)														---	---	---	---	capture		Missense_Mutation	SNP	89777102	89777102	1881	16	C	G	G	30	30	C16orf7	G	3	3
OR1D2	4991	broad.mit.edu	37	17	2996205	2996205	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:2996205C>A	uc010vrb.1	-	1	86	c.86G>T	c.(85-87)TGG>TTG	p.W29L		NM_002548	NP_002539	P34982	OR1D2_HUMAN	olfactory receptor, family 1, subfamily D,	29	Helical; Name=1; (Potential).				cellular component movement|chemotaxis|protein import into nucleus, translocation|sensory perception of smell|single fertilization	integral to plasma membrane	olfactory receptor activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	2996205	2996205	11359	17	C	A	A	21	21	OR1D2	A	2	2
TP53	7157	broad.mit.edu	37	17	7577547	7577547	+	Missense_Mutation	SNP	C	A	A	rs121912656		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7577547C>A	uc002gim.2	-	7	928	c.734G>T	c.(733-735)GGC>GTC	p.G245V	TP53_uc002gig.1_Missense_Mutation_p.G245V|TP53_uc002gih.2_Missense_Mutation_p.G245V|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Missense_Mutation_p.G113V|TP53_uc010cng.1_Missense_Mutation_p.G113V|TP53_uc002gii.1_Missense_Mutation_p.G113V|TP53_uc010cnh.1_Missense_Mutation_p.G245V|TP53_uc010cni.1_Missense_Mutation_p.G245V|TP53_uc002gij.2_Missense_Mutation_p.G245V|TP53_uc010cnj.1_RNA|TP53_uc002gin.2_Missense_Mutation_p.G152V|TP53_uc002gio.2_Missense_Mutation_p.G113V	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	245	|Interaction with HIPK1 (By similarity).|Interacts with the 53BP2 SH3 domain.|Interaction with AXIN1 (By similarity).		G -> N (in sporadic cancers; somatic mutation; requires 2 nucleotide substitutions).|G -> A (in sporadic cancers; somatic mutation).|G -> V (in LFS; germline mutation and in sporadic cancers; somatic mutation).|G -> F (in sporadic cancers; somatic mutation; requires 2 nucleotide substitutions).|G -> R (in sporadic cancers; somatic mutation).|G -> E (in a sporadic cancer; somatic mutation).|G -> D (in LFS; germline mutation and in sporadic cancers; somatic mutation).|G -> H (in a sporadic cancer; somatic mutation; requires 2 nucleotide substitutions).|G -> L (in sporadic cancers; somatic mutation; requires 2 nucleotide substitutions).|G -> C (in LFS; germline mutation and in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.G245S(274)|p.G245D(93)|p.G245V(50)|p.G245C(47)|p.G245R(10)|p.G245A(8)|p.0?(7)|p.G245G(3)|p.G245fs*2(3)|p.G245N(2)|p.G245H(1)|p.G245L(1)|p.G244fs*17(1)|p.G245F(1)|p.G245E(1)|p.C242_M246>L(1)|p.C238_M246delCNSSCMGGM(1)|p.G245del(1)|p.C242fs*98(1)|p.G245fs*22(1)|p.M243fs*18(1)|p.S241_G245delSCMGG(1)|p.G245fs*14(1)|p.G245fs*17(1)|p.G245fs*16(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)			111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			---	---	---	---	capture		Missense_Mutation	SNP	7577547	7577547	16923	17	C	A	A	26	26	TP53	A	2	2
PER1	5187	broad.mit.edu	37	17	8051027	8051027	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8051027C>T	uc002gkd.2	-	11	1591	c.1353G>A	c.(1351-1353)AAG>AAA	p.K451K	PER1_uc010vuq.1_RNA|PER1_uc010vur.1_Silent_p.K435K	NM_002616	NP_002607	O15534	PER1_HUMAN	period 1	451	PAC.				circadian rhythm|entrainment of circadian clock|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	signal transducer activity			lung(2)|breast(2)|skin(2)|large_intestine(1)|ovary(1)|kidney(1)	9								T	ETV6	AML|CMML			Other_conserved_DNA_damage_response_genes					---	---	---	---	capture		Silent	SNP	8051027	8051027	12150	17	C	T	T	24	24	PER1	T	2	2
KRBA2	124751	broad.mit.edu	37	17	8272809	8272809	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8272809G>T	uc002glf.1	-	2	1128	c.1122C>A	c.(1120-1122)ACC>ACA	p.T374T	KRBA2_uc002glg.1_Silent_p.T291T	NM_213597	NP_998762	Q6ZNG9	KRBA2_HUMAN	KRAB-A domain containing 2	374	Integrase catalytic.				DNA integration|regulation of transcription, DNA-dependent	intracellular	DNA binding				0																		---	---	---	---	capture		Silent	SNP	8272809	8272809	8755	17	G	T	T	35	35	KRBA2	T	2	2
MYH2	4620	broad.mit.edu	37	17	10427107	10427107	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10427107G>A	uc010coi.2	-	36	5398	c.5270C>T	c.(5269-5271)GCA>GTA	p.A1757V	uc002gml.1_Intron|MYH2_uc002gmp.3_Missense_Mutation_p.A1757V|MYH2_uc010coj.2_Intron	NM_001100112	NP_001093582	Q9UKX2	MYH2_HUMAN	myosin heavy chain IIa	1757	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(5)|pancreas(4)|skin(3)|lung(1)|kidney(1)	14																		---	---	---	---	capture		Missense_Mutation	SNP	10427107	10427107	10430	17	G	A	A	46	46	MYH2	A	2	2
ZNF287	57336	broad.mit.edu	37	17	16456336	16456336	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:16456336C>A	uc002gqi.2	-	6	1573	c.1120G>T	c.(1120-1122)GGG>TGG	p.G374W		NM_020653	NP_065704	Q9HBT7	ZN287_HUMAN	zinc finger protein 287	367	C2H2-type 1.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0				UCEC - Uterine corpus endometrioid carcinoma (92;0.083)														---	---	---	---	capture		Missense_Mutation	SNP	16456336	16456336	18417	17	C	A	A	21	21	ZNF287	A	2	2
MYO15A	51168	broad.mit.edu	37	17	18022930	18022930	+	Silent	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18022930A>G	uc010vxh.1	+	2	1154	c.816A>G	c.(814-816)CCA>CCG	p.P272P		NM_016239	NP_057323	Q9UKN7	MYO15_HUMAN	myosin XV	272	Myosin head-like.				sensory perception of sound	cytoplasm|myosin complex|stereocilium	actin binding|ATP binding|calmodulin binding|motor activity			skin(4)|ovary(2)|pancreas(1)|breast(1)|central_nervous_system(1)	9	all_neural(463;0.228)																	---	---	---	---	capture		Silent	SNP	18022930	18022930	10458	17	A	G	G	6	6	MYO15A	G	4	4
C17orf102	400591	broad.mit.edu	37	17	32906050	32906050	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:32906050C>A	uc002hie.1	-	1	339	c.250G>T	c.(250-252)GGG>TGG	p.G84W	TMEM132E_uc002hif.2_5'Flank	NM_207454	NP_997337	A2RUQ5	CQ102_HUMAN	hypothetical protein LOC400591	84										ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	32906050	32906050	1902	17	C	A	A	21	21	C17orf102	A	2	2
AP2B1	163	broad.mit.edu	37	17	33953725	33953725	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:33953725G>C	uc002hjr.2	+	7	991	c.802G>C	c.(802-804)GAA>CAA	p.E268Q	AP2B1_uc002hjq.2_Missense_Mutation_p.E268Q|AP2B1_uc010wci.1_Missense_Mutation_p.E230Q|AP2B1_uc002hjs.2_Missense_Mutation_p.E211Q|AP2B1_uc002hjt.2_Missense_Mutation_p.E268Q|AP2B1_uc010ctv.2_Missense_Mutation_p.E268Q|AP2B1_uc010wcj.1_Missense_Mutation_p.E5Q	NM_001282	NP_001273	P63010	AP2B1_HUMAN	adaptor-related protein complex 2, beta 1	268					axon guidance|epidermal growth factor receptor signaling pathway|intracellular protein transport|negative regulation of epidermal growth factor receptor signaling pathway|nerve growth factor receptor signaling pathway|regulation of defense response to virus by virus|synaptic transmission|vesicle-mediated transport|viral reproduction	clathrin adaptor complex|coated pit|cytosol|endocytic vesicle membrane|plasma membrane	clathrin binding|protein transporter activity			ovary(1)	1		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0227)														---	---	---	---	capture		Missense_Mutation	SNP	33953725	33953725	751	17	G	C	C	33	33	AP2B1	C	3	3
ACACA	31	broad.mit.edu	37	17	35609009	35609009	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:35609009C>A	uc002hnm.2	-	16	2083	c.1892G>T	c.(1891-1893)GGG>GTG	p.G631V	ACACA_uc002hnk.2_Missense_Mutation_p.G553V|ACACA_uc002hnl.2_Missense_Mutation_p.G573V|ACACA_uc002hnn.2_Missense_Mutation_p.G631V|ACACA_uc002hno.2_Missense_Mutation_p.G668V|ACACA_uc010cuz.2_Missense_Mutation_p.G631V	NM_198836	NP_942133	Q13085	ACACA_HUMAN	acetyl-Coenzyme A carboxylase alpha isoform 2	631					acetyl-CoA metabolic process|energy reserve metabolic process|fatty acid biosynthetic process|long-chain fatty-acyl-CoA biosynthetic process|positive regulation of cellular metabolic process|protein homotetramerization|triglyceride biosynthetic process	cytosol	acetyl-CoA carboxylase activity|ATP binding|biotin carboxylase activity|metal ion binding|protein binding			large_intestine(1)|ovary(1)	2		Breast(25;0.00157)|Ovarian(249;0.15)			Biotin(DB00121)													---	---	---	---	capture		Missense_Mutation	SNP	35609009	35609009	107	17	C	A	A	22	22	ACACA	A	2	2
MED24	9862	broad.mit.edu	37	17	38183201	38183201	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38183201G>A	uc002htt.2	-	17	1930	c.1617C>T	c.(1615-1617)ATC>ATT	p.I539I	MED24_uc010wes.1_Silent_p.I399I|MED24_uc010wet.1_Intron|MED24_uc002hts.2_Silent_p.I564I|MED24_uc002htu.2_Silent_p.I526I|MED24_uc010cwn.2_Silent_p.I526I|MED24_uc010weu.1_Silent_p.I449I|MED24_uc010wev.1_Silent_p.I489I|MED24_uc010wew.1_Silent_p.I480I|MED24_uc010wex.1_Silent_p.I244I|SNORD124_uc010wey.1_5'Flank	NM_014815	NP_055630	O75448	MED24_HUMAN	mediator complex subunit 24 isoform 1	539					androgen receptor signaling pathway|positive regulation of transcription, DNA-dependent|transcription initiation from RNA polymerase II promoter	mediator complex	ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			ovary(1)	1	Colorectal(19;0.000442)															OREG0024386	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	38183201	38183201	9831	17	G	A	A	41	41	MED24	A	2	2
UBTF	7343	broad.mit.edu	37	17	42289033	42289033	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42289033G>A	uc002igb.2	-	9	1055	c.988C>T	c.(988-990)CAG>TAG	p.Q330*	UBTF_uc002igc.2_Nonsense_Mutation_p.Q293*|UBTF_uc010czs.2_Nonsense_Mutation_p.Q330*|UBTF_uc002igd.2_Nonsense_Mutation_p.Q293*|UBTF_uc010czt.2_Nonsense_Mutation_p.Q330*|UBTF_uc002ige.2_Nonsense_Mutation_p.Q293*	NM_014233	NP_055048	P17480	UBF1_HUMAN	upstream binding transcription factor, RNA	330	HMG box 3.				positive regulation of transcription from RNA polymerase I promoter|termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription initiation from RNA polymerase I promoter	nucleolus|nucleoplasm	DNA binding|protein binding				0		Breast(137;0.00765)|Prostate(33;0.0181)		BRCA - Breast invasive adenocarcinoma(366;0.114)														---	---	---	---	capture		Nonsense_Mutation	SNP	42289033	42289033	17467	17	G	A	A	47	47	UBTF	A	5	2
UBTF	7343	broad.mit.edu	37	17	42293285	42293285	+	Missense_Mutation	SNP	T	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42293285T>G	uc002igb.2	-	3	374	c.307A>C	c.(307-309)AAA>CAA	p.K103Q	UBTF_uc002igc.2_Missense_Mutation_p.K103Q|UBTF_uc010czs.2_Missense_Mutation_p.K103Q|UBTF_uc002igd.2_Missense_Mutation_p.K103Q|UBTF_uc010czt.2_Missense_Mutation_p.K103Q|UBTF_uc002ige.2_Missense_Mutation_p.K103Q	NM_014233	NP_055048	P17480	UBF1_HUMAN	upstream binding transcription factor, RNA	103					positive regulation of transcription from RNA polymerase I promoter|termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription initiation from RNA polymerase I promoter	nucleolus|nucleoplasm	DNA binding|protein binding				0		Breast(137;0.00765)|Prostate(33;0.0181)		BRCA - Breast invasive adenocarcinoma(366;0.114)														---	---	---	---	capture		Missense_Mutation	SNP	42293285	42293285	17467	17	T	G	G	63	63	UBTF	G	4	4
SGCA	6442	broad.mit.edu	37	17	48244818	48244818	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48244818G>A	uc002iqi.2	+	2	163	c.127G>A	c.(127-129)GAG>AAG	p.E43K	SGCA_uc010wmh.1_5'UTR|SGCA_uc002iqj.2_Missense_Mutation_p.E43K|SGCA_uc010wmi.1_RNA	NM_000023	NP_000014	Q16586	SGCA_HUMAN	sarcoglycan, alpha isoform 1 precursor	43	Extracellular (Potential).				muscle contraction|muscle organ development	cytoplasm|cytoskeleton|integral to membrane|sarcoglycan complex|sarcolemma	calcium ion binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	48244818	48244818	14690	17	G	A	A	45	45	SGCA	A	2	2
USP32	84669	broad.mit.edu	37	17	58260692	58260692	+	Silent	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:58260692G>C	uc002iyo.1	-	31	4243	c.3957C>G	c.(3955-3957)CTC>CTG	p.L1319L	USP32_uc002iyn.1_Silent_p.L989L	NM_032582	NP_115971	Q8NFA0	UBP32_HUMAN	ubiquitin specific protease 32	1319					protein deubiquitination|ubiquitin-dependent protein catabolic process	Golgi apparatus|membrane	calcium ion binding|cysteine-type peptidase activity|ubiquitin thiolesterase activity			lung(2)|breast(2)|large_intestine(1)	5	all_neural(34;0.0878)|Medulloblastoma(34;0.0922)		Epithelial(12;2.02e-11)|all cancers(12;5.23e-10)|Colorectal(3;0.198)															---	---	---	---	capture		Silent	SNP	58260692	58260692	17627	17	G	C	C	33	33	USP32	C	3	3
STRADA	92335	broad.mit.edu	37	17	61787865	61787865	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61787865C>A	uc002jbm.2	-	8	726	c.567G>T	c.(565-567)ATG>ATT	p.M189I	STRADA_uc002jbn.2_Missense_Mutation_p.M131I|STRADA_uc002jbo.2_Missense_Mutation_p.M152I|STRADA_uc002jbp.2_Missense_Mutation_p.M152I|STRADA_uc002jbq.2_Missense_Mutation_p.M131I|STRADA_uc010wpq.1_Missense_Mutation_p.M145I|STRADA_uc010wpr.1_Missense_Mutation_p.M160I|STRADA_uc010ddw.2_Missense_Mutation_p.M160I|STRADA_uc002jbr.2_Missense_Mutation_p.M131I	NM_001003787	NP_001003787	Q7RTN6	STRAA_HUMAN	STE20-related kinase adaptor alpha isoform 1	189	Protein kinase.				activation of protein kinase activity|cell cycle arrest|insulin receptor signaling pathway|protein export from nucleus|regulation of fatty acid oxidation	cytosol|nucleus	ATP binding|kinase binding|protein kinase activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	61787865	61787865	15844	17	C	A	A	21	21	STRADA	A	2	2
FTSJ3	117246	broad.mit.edu	37	17	61902623	61902623	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61902623C>G	uc002jbz.2	-	6	652	c.574G>C	c.(574-576)GAG>CAG	p.E192Q	FTSJ3_uc002jca.2_Missense_Mutation_p.E192Q|PSMC5_uc002jcb.2_5'Flank|PSMC5_uc010ddy.2_5'Flank|PSMC5_uc010ddz.2_5'Flank|PSMC5_uc002jcc.2_5'Flank|PSMC5_uc002jcd.2_5'Flank	NM_017647	NP_060117	Q8IY81	RRMJ3_HUMAN	FtsJ homolog 3	192					RNA methylation|rRNA processing	nucleolus	methyltransferase activity|nucleic acid binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	61902623	61902623	6340	17	C	G	G	32	32	FTSJ3	G	3	3
PSMC5	5705	broad.mit.edu	37	17	61908527	61908527	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61908527C>G	uc002jcb.2	+	8	852	c.811C>G	c.(811-813)CGC>GGC	p.R271G	PSMC5_uc010ddy.2_Missense_Mutation_p.R248G|PSMC5_uc010ddz.2_Missense_Mutation_p.R192G|PSMC5_uc002jcc.2_Missense_Mutation_p.R263G|PSMC5_uc002jcd.2_Missense_Mutation_p.R263G	NM_002805	NP_002796	P62195	PRS8_HUMAN	proteasome 26S ATPase subunit 5	271					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of programmed cell death|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of transcription, DNA-dependent|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|transcription from RNA polymerase II promoter|viral reproduction	cytoplasm|nucleus|proteasome complex	ATP binding|ATPase activity|thyrotropin-releasing hormone receptor binding|transcription cofactor activity|transcription factor binding			large_intestine(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	61908527	61908527	13143	17	C	G	G	27	27	PSMC5	G	3	3
BPTF	2186	broad.mit.edu	37	17	65822267	65822267	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:65822267G>T	uc002jgf.2	+	1	488	c.427G>T	c.(427-429)GAG>TAG	p.E143*	BPTF_uc002jge.2_Nonsense_Mutation_p.E143*|BPTF_uc010wqm.1_Nonsense_Mutation_p.E143*	NM_182641	NP_872579	Q12830	BPTF_HUMAN	bromodomain PHD finger transcription factor	143	Glu-rich.				brain development|chromatin remodeling|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|NURF complex	sequence-specific DNA binding|transcription factor binding|zinc ion binding			ovary(2)|skin(2)	4	all_cancers(12;6e-11)		BRCA - Breast invasive adenocarcinoma(8;7.48e-08)|Colorectal(3;0.0984)|LUSC - Lung squamous cell carcinoma(166;0.24)															---	---	---	---	capture		Nonsense_Mutation	SNP	65822267	65822267	1523	17	G	T	T	37	37	BPTF	T	5	1
WIPI1	55062	broad.mit.edu	37	17	66425064	66425064	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66425064G>A	uc010dey.2	-	10	1070	c.979C>T	c.(979-981)CCA>TCA	p.P327S	WIPI1_uc002jhd.3_RNA|WIPI1_uc010wqo.1_Missense_Mutation_p.P245S|WIPI1_uc002jhe.3_RNA	NM_017983	NP_060453	Q5MNZ9	WIPI1_HUMAN	WD repeat domain, phosphoinositide interacting	327	WD 3.				macroautophagy|vesicle targeting, trans-Golgi to endosome	autophagic vacuole membrane|clathrin-coated vesicle|cytosol|endosome membrane|PAS complex|pre-autophagosomal structure membrane|trans-Golgi network	androgen receptor binding|estrogen receptor binding|phosphatidylinositol-3,5-bisphosphate binding|phosphatidylinositol-3-phosphate binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	66425064	66425064	17944	17	G	A	A	42	42	WIPI1	A	2	2
ABCA8	10351	broad.mit.edu	37	17	66881394	66881394	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66881394G>T	uc002jhp.2	-	25	3551	c.3372C>A	c.(3370-3372)ATC>ATA	p.I1124I	ABCA8_uc002jhq.2_Silent_p.I1164I|ABCA8_uc010wqq.1_Silent_p.I1164I	NM_007168	NP_009099	O94911	ABCA8_HUMAN	ATP-binding cassette, sub-family A member 8	1124	Helical; (Potential).					integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(2)|skin(1)	3	Breast(10;4.56e-13)																	---	---	---	---	capture		Silent	SNP	66881394	66881394	39	17	G	T	T	33	33	ABCA8	T	2	2
SLC16A5	9121	broad.mit.edu	37	17	73096607	73096607	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73096607C>T	uc002jmr.2	+	5	1221	c.849C>T	c.(847-849)AGC>AGT	p.S283S	SLC16A5_uc002jms.1_Silent_p.S283S|SLC16A5_uc002jmt.2_Silent_p.S283S|SLC16A5_uc002jmu.2_Silent_p.S283S|SLC16A5_uc010wrt.1_Silent_p.S323S	NM_004695	NP_004686	O15375	MOT6_HUMAN	solute carrier family 16, member 5	283	Helical; (Potential).				organic anion transport	integral to plasma membrane|membrane fraction	secondary active monocarboxylate transmembrane transporter activity|symporter activity			central_nervous_system(1)	1	all_lung(278;0.226)		LUSC - Lung squamous cell carcinoma(166;0.162)|Lung(188;0.235)		Pyruvic acid(DB00119)													---	---	---	---	capture		Silent	SNP	73096607	73096607	14907	17	C	T	T	25	25	SLC16A5	T	2	2
RPTOR	57521	broad.mit.edu	37	17	78921039	78921039	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78921039G>A	uc002jyt.1	+	27	3958	c.3153G>A	c.(3151-3153)TGG>TGA	p.W1051*	RPTOR_uc010wug.1_Nonsense_Mutation_p.W893*|RPTOR_uc002jyu.1_5'Flank	NM_020761	NP_065812	Q8N122	RPTOR_HUMAN	raptor isoform 1	1051	WD 1.				cell cycle arrest|cell growth|cellular response to amino acid stimulus|cellular response to nutrient levels|insulin receptor signaling pathway|positive regulation of protein serine/threonine kinase activity|positive regulation of TOR signaling cascade|TOR signaling cascade	cytosol|lysosome|TORC1 complex	protein complex binding			lung(4)|urinary_tract(1)|ovary(1)	6																		---	---	---	---	capture		Nonsense_Mutation	SNP	78921039	78921039	14145	17	G	A	A	43	43	RPTOR	A	5	2
AATK	9625	broad.mit.edu	37	17	79093228	79093228	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79093228G>T	uc010dia.2	-	13	4116	c.4036C>A	c.(4036-4038)CGC>AGC	p.R1346S	AATK_uc010dhz.2_RNA	NM_001080395	NP_001073864	Q6ZMQ8	LMTK1_HUMAN	apoptosis-associated tyrosine kinase	1346						integral to membrane|mitochondrion|perinuclear region of cytoplasm	ATP binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			stomach(4)|ovary(2)|lung(2)|upper_aerodigestive_tract(1)	9	all_neural(118;0.101)		BRCA - Breast invasive adenocarcinoma(99;0.0228)|OV - Ovarian serous cystadenocarcinoma(97;0.0524)															---	---	---	---	capture		Missense_Mutation	SNP	79093228	79093228	27	17	G	T	T	39	39	AATK	T	1	1
FAM38B	63895	broad.mit.edu	37	18	10696076	10696076	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:10696076C>T	uc002kor.3	-	5	858	c.718G>A	c.(718-720)GAG>AAG	p.E240K	FAM38B_uc002koq.2_Missense_Mutation_p.E138K	NM_022068	NP_071351	Q9H5I5	PIEZ2_HUMAN	family with sequence similarity 38, member B	2283						integral to membrane	ion channel activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	10696076	10696076	5776	18	C	T	T	29	29	FAM38B	T	2	2
KHSRP	8570	broad.mit.edu	37	19	6422370	6422370	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6422370C>A	uc002mer.3	-	2	437	c.327G>T	c.(325-327)AAG>AAT	p.K109N		NM_003685	NP_003676	Q92945	FUBP2_HUMAN	KH-type splicing regulatory protein	109	Gly-rich.				mRNA processing|mRNA transport|regulation of transcription, DNA-dependent|RNA splicing, via transesterification reactions|transcription, DNA-dependent	cytosol|nucleus	DNA binding|protein binding|RNA binding			skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	6422370	6422370	8457	19	C	A	A	32	32	KHSRP	A	2	2
MUC16	94025	broad.mit.edu	37	19	9068085	9068085	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9068085G>T	uc002mkp.2	-	3	19565	c.19361C>A	c.(19360-19362)GCG>GAG	p.A6454E		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	6456	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---	capture		Missense_Mutation	SNP	9068085	9068085	10367	19	G	T	T	38	38	MUC16	T	1	1
ZNF560	147741	broad.mit.edu	37	19	9578918	9578918	+	Silent	SNP	A	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9578918A>T	uc002mlp.1	-	10	915	c.705T>A	c.(703-705)ACT>ACA	p.T235T	ZNF560_uc010dwr.1_Silent_p.T129T	NM_152476	NP_689689	Q96MR9	ZN560_HUMAN	zinc finger protein 560	235					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(2)|ovary(1)|large_intestine(1)|pancreas(1)|liver(1)	6																		---	---	---	---	capture		Silent	SNP	9578918	9578918	18586	19	A	T	T	11	11	ZNF560	T	4	4
CCDC151	115948	broad.mit.edu	37	19	11545644	11545644	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11545644G>T	uc002mrs.2	-	1	337	c.194C>A	c.(193-195)CCC>CAC	p.P65H	CCDC151_uc010dxz.2_Missense_Mutation_p.P65H|PRKCSH_uc002mrt.2_5'Flank|PRKCSH_uc002mru.2_5'Flank|PRKCSH_uc010xlz.1_5'Flank|PRKCSH_uc010dya.2_5'Flank|PRKCSH_uc002mrv.1_5'Flank|PRKCSH_uc010dyb.2_5'Flank	NM_145045	NP_659482	A5D8V7	CC151_HUMAN	coiled-coil domain containing 151	65										ovary(1)	1																OREG0025257	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	11545644	11545644	2906	19	G	T	T	43	43	CCDC151	T	2	2
HOOK2	29911	broad.mit.edu	37	19	12876760	12876760	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12876760T>A	uc002muy.2	-	16	1751	c.1580A>T	c.(1579-1581)CAG>CTG	p.Q527L	HOOK2_uc010xmq.1_5'UTR|HOOK2_uc002muz.2_Missense_Mutation_p.Q527L	NM_013312	NP_037444	Q96ED9	HOOK2_HUMAN	hook homolog 2 isoform 1	527	Sufficient for interaction with microtubules.|Potential.				early endosome to late endosome transport|endocytosis|endosome organization|endosome to lysosome transport|lysosome organization|microtubule cytoskeleton organization|protein transport	centrosome|FHF complex|microtubule	identical protein binding|microtubule binding			ovary(1)|breast(1)|skin(1)	3																OREG0025273	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Missense_Mutation	SNP	12876760	12876760	7575	19	T	A	A	55	55	HOOK2	A	4	4
CACNA1A	773	broad.mit.edu	37	19	13476130	13476130	+	Splice_Site	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:13476130C>T	uc010dze.2	-	5	1020	c.784_splice	c.e5+1	p.D262_splice	CACNA1A_uc002mwy.3_Splice_Site_p.D262_splice	NM_001127221	NP_001120693			calcium channel, alpha 1A subunit isoform 3						cell death|elevation of cytosolic calcium ion concentration|energy reserve metabolic process|membrane depolarization|regulation of insulin secretion	cytoplasm|nucleus	syntaxin binding			large_intestine(2)	2			OV - Ovarian serous cystadenocarcinoma(19;5.07e-21)		Bepridil(DB01244)|Cinnarizine(DB00568)|Loperamide(DB00836)|Nisoldipine(DB00401)|Pregabalin(DB00230)													---	---	---	---	capture		Splice_Site	SNP	13476130	13476130	2654	19	C	T	T	18	18	CACNA1A	T	5	2
DNAJB1	3337	broad.mit.edu	37	19	14627582	14627582	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:14627582G>T	uc002myz.1	-	2	528	c.488C>A	c.(487-489)CCA>CAA	p.P163Q	DNAJB1_uc010xnr.1_Missense_Mutation_p.P63Q	NM_006145	NP_006136	P25685	DNJB1_HUMAN	DnaJ (Hsp40) homolog, subfamily B, member 1	163					chaperone cofactor-dependent protein refolding|response to unfolded protein	cytoplasm|nucleolus	heat shock protein binding|unfolded protein binding				0				GBM - Glioblastoma multiforme(1328;0.0476)														---	---	---	---	capture		Missense_Mutation	SNP	14627582	14627582	4798	19	G	T	T	47	47	DNAJB1	T	2	2
ZNF14	7561	broad.mit.edu	37	19	19823724	19823724	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19823724C>G	uc002nnk.1	-	4	520	c.366G>C	c.(364-366)ATG>ATC	p.M122I		NM_021030	NP_066358	P17017	ZNF14_HUMAN	zinc finger protein 14	122	C2H2-type 1.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)	3		Renal(1328;0.0474)																---	---	---	---	capture		Missense_Mutation	SNP	19823724	19823724	18319	19	C	G	G	29	29	ZNF14	G	3	3
ZNF208	7757	broad.mit.edu	37	19	22157371	22157371	+	Missense_Mutation	SNP	A	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22157371A>T	uc002nqp.2	-	4	614	c.465T>A	c.(463-465)CAT>CAA	p.H155Q	ZNF208_uc002nqo.1_Intron|ZNF208_uc010ecw.1_5'Flank	NM_007153	NP_009084			zinc finger protein 208											ovary(5)|skin(2)	7		all_lung(12;0.0961)|Lung NSC(12;0.103)																---	---	---	---	capture		Missense_Mutation	SNP	22157371	22157371	18357	19	A	T	T	16	16	ZNF208	T	4	4
ZNF681	148213	broad.mit.edu	37	19	23927115	23927115	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:23927115T>C	uc002nrk.3	-	4	1379	c.1237A>G	c.(1237-1239)AAG>GAG	p.K413E	ZNF681_uc002nrl.3_Missense_Mutation_p.K344E|ZNF681_uc002nrj.3_Missense_Mutation_p.K344E	NM_138286	NP_612143	Q96N22	ZN681_HUMAN	zinc finger protein 681	413	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_lung(12;0.11)|Lung NSC(12;0.163)|all_epithelial(12;0.206)																---	---	---	---	capture		Missense_Mutation	SNP	23927115	23927115	18683	19	T	C	C	61	61	ZNF681	C	4	4
ZNF536	9745	broad.mit.edu	37	19	31039116	31039116	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:31039116C>A	uc002nsu.1	+	4	2728	c.2590C>A	c.(2590-2592)CTC>ATC	p.L864I	ZNF536_uc010edd.1_Missense_Mutation_p.L864I	NM_014717	NP_055532	O15090	ZN536_HUMAN	zinc finger protein 536	864					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(7)|large_intestine(2)|skin(2)	11	Esophageal squamous(110;0.0834)																	---	---	---	---	capture		Missense_Mutation	SNP	31039116	31039116	18568	19	C	A	A	32	32	ZNF536	A	2	2
ZNF790	388536	broad.mit.edu	37	19	37310031	37310031	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37310031C>G	uc002oew.2	-	5	1334	c.1215G>C	c.(1213-1215)TGG>TGC	p.W405C	uc002oev.1_Intron	NM_206894	NP_996777	Q6PG37	ZN790_HUMAN	zinc finger protein 790	405	C2H2-type 8.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			upper_aerodigestive_tract(1)|skin(1)	2	Esophageal squamous(110;0.183)		COAD - Colon adenocarcinoma(19;0.0454)|Colorectal(19;0.065)															---	---	---	---	capture		Missense_Mutation	SNP	37310031	37310031	18760	19	C	G	G	30	30	ZNF790	G	3	3
PLEKHG2	64857	broad.mit.edu	37	19	39913755	39913755	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39913755C>A	uc010xuz.1	+	18	2386	c.2061C>A	c.(2059-2061)CCC>CCA	p.P687P	PLEKHG2_uc010xuy.1_Silent_p.P628P|PLEKHG2_uc002olj.2_Intron|PLEKHG2_uc010xva.1_Silent_p.P465P	NM_022835	NP_073746	Q9H7P9	PKHG2_HUMAN	common-site lymphoma/leukemia guanine nucleotide	687					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	Rho guanyl-nucleotide exchange factor activity			skin(2)|pancreas(1)|breast(1)	4	all_cancers(60;3.08e-07)|all_lung(34;2.66e-08)|Lung NSC(34;3e-08)|all_epithelial(25;6.57e-07)|Ovarian(47;0.0569)		Epithelial(26;2.92e-26)|all cancers(26;2.01e-23)|Lung(45;0.000499)|LUSC - Lung squamous cell carcinoma(53;0.000657)															---	---	---	---	capture		Silent	SNP	39913755	39913755	12495	19	C	A	A	21	21	PLEKHG2	A	2	2
TMEM145	284339	broad.mit.edu	37	19	42818838	42818838	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42818838G>T	uc002otk.1	+	4	399	c.347G>T	c.(346-348)TGG>TTG	p.W116L		NM_173633	NP_775904	Q8NBT3	TM145_HUMAN	transmembrane protein 145	116						integral to membrane					0		Prostate(69;0.00682)																---	---	---	---	capture		Missense_Mutation	SNP	42818838	42818838	16591	19	G	T	T	47	47	TMEM145	T	2	2
PSG3	5671	broad.mit.edu	37	19	43243164	43243164	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43243164C>A	uc002oue.2	-	2	274	c.142G>T	c.(142-144)GGG>TGG	p.G48W	PSG3_uc002ouf.2_RNA|PSG1_uc002oug.1_Intron|PSG3_uc010eil.2_Missense_Mutation_p.G70W	NM_021016	NP_066296	Q16557	PSG3_HUMAN	pregnancy specific beta-1-glycoprotein 3	48	Ig-like V-type.				defense response|female pregnancy	extracellular region				ovary(1)|skin(1)	2		Prostate(69;0.00682)																---	---	---	---	capture		Missense_Mutation	SNP	43243164	43243164	13109	19	C	A	A	22	22	PSG3	A	2	2
PSG1	5669	broad.mit.edu	37	19	43382240	43382240	+	Missense_Mutation	SNP	G	T	T	rs1058959		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43382240G>T	uc002ovb.2	-	2	393	c.255C>A	c.(253-255)GAC>GAA	p.D85E	PSG3_uc002ouf.2_Intron|PSG1_uc002oug.1_Missense_Mutation_p.D85E|PSG11_uc002ouw.2_Intron|PSG7_uc002ous.1_Intron|PSG7_uc002out.1_Intron|PSG10_uc002ouv.1_Intron|PSG1_uc002oun.2_RNA|PSG1_uc002our.1_Missense_Mutation_p.D85E|PSG1_uc010eio.1_Missense_Mutation_p.D85E|PSG1_uc002oux.1_Missense_Mutation_p.D14E|PSG1_uc002ouy.1_Missense_Mutation_p.D85E|PSG1_uc002ouz.1_Missense_Mutation_p.D85E|PSG1_uc002ova.1_Missense_Mutation_p.D85E|PSG1_uc002ovc.2_Missense_Mutation_p.D85E|PSG1_uc002ovd.1_Missense_Mutation_p.D85E	NM_006905	NP_008836	P11464	PSG1_HUMAN	pregnancy specific beta-1-glycoprotein 1	85	Ig-like V-type.				female pregnancy	extracellular region				ovary(2)	2		Prostate(69;0.00682)																---	---	---	---	capture		Missense_Mutation	SNP	43382240	43382240	13106	19	G	T	T	40	40	PSG1	T	1	1
PSG6	5675	broad.mit.edu	37	19	43414888	43414888	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43414888G>C	uc002ovj.1	-	3	602	c.550C>G	c.(550-552)CAG>GAG	p.Q184E	PSG3_uc002ouf.2_Intron|PSG11_uc002ouw.2_Intron|PSG7_uc002ous.1_Intron|PSG7_uc002out.1_Intron|PSG10_uc002ouv.1_Intron|PSG6_uc002ovh.1_Missense_Mutation_p.Q191E|PSG6_uc002ovi.2_Missense_Mutation_p.Q185E|PSG6_uc010xwk.1_Intron|PSG11_uc002ovk.1_Intron|PSG6_uc002ove.1_5'UTR|PSG6_uc002ovf.1_Missense_Mutation_p.Q184E|PSG6_uc002ovg.1_Missense_Mutation_p.Q184E	NM_002782	NP_002773	Q00889	PSG6_HUMAN	pregnancy specific beta-1-glycoprotein 6 isoform	184	Ig-like C2-type 1.				female pregnancy	extracellular region				ovary(1)|skin(1)	2		Prostate(69;0.00899)																---	---	---	---	capture		Missense_Mutation	SNP	43414888	43414888	13112	19	G	C	C	45	45	PSG6	C	3	3
PSG4	5672	broad.mit.edu	37	19	43699169	43699169	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43699169G>A	uc002ovy.2	-	4	1068	c.966C>T	c.(964-966)GAC>GAT	p.D322D	PSG6_uc010xwk.1_Intron|PSG4_uc002owa.2_RNA|PSG4_uc002owb.2_Silent_p.D229D|PSG4_uc002ovz.2_Intron	NM_002780	NP_002771	Q00888	PSG4_HUMAN	pregnancy specific beta-1-glycoprotein 4 isoform	322	Ig-like C2-type 2.				defense response|female pregnancy	extracellular region				ovary(1)	1		Prostate(69;0.00682)																---	---	---	---	capture		Silent	SNP	43699169	43699169	13110	19	G	A	A	44	44	PSG4	A	2	2
TEX101	83639	broad.mit.edu	37	19	43922108	43922108	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43922108G>T	uc010xwo.1	+	5	665	c.470G>T	c.(469-471)TGT>TTT	p.C157F	TEX101_uc002owk.2_Missense_Mutation_p.C175F	NM_001130011	NP_001123483	Q9BY14	TX101_HUMAN	testis expressed 101 isoform 2	157				C -> Y (in Ref. 1; AAK28327).		anchored to membrane|plasma membrane				ovary(1)	1		Prostate(69;0.0199)																---	---	---	---	capture		Missense_Mutation	SNP	43922108	43922108	16300	19	G	T	T	48	48	TEX101	T	2	2
ZNF222	7673	broad.mit.edu	37	19	44537098	44537098	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44537098C>A	uc002oyc.2	+	4	1454	c.1271C>A	c.(1270-1272)CCA>CAA	p.P424Q	ZNF284_uc010ejd.2_Intron|ZNF222_uc002oye.2_Missense_Mutation_p.P464Q|ZNF222_uc002oyd.2_Missense_Mutation_p.P370Q	NM_013360	NP_037492	Q9UK12	ZN222_HUMAN	zinc finger protein 222 isoform 2	424					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)	3		Prostate(69;0.0435)																---	---	---	---	capture		Missense_Mutation	SNP	44537098	44537098	18367	19	C	A	A	21	21	ZNF222	A	2	2
MARK4	57787	broad.mit.edu	37	19	45781203	45781203	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45781203G>C	uc002pbb.1	+	9	814	c.809G>C	c.(808-810)AGA>ACA	p.R270T	MARK4_uc002paz.1_Intron|MARK4_uc002pba.1_Missense_Mutation_p.R270T|MARK4_uc002pbc.1_Missense_Mutation_p.R136T			Q96L34	MARK4_HUMAN	RecName: Full=MAP/microtubule affinity-regulating kinase 4;          EC=2.7.11.1; AltName: Full=MAP/microtubule affinity-regulating kinase-like 1;	270	Protein kinase.				microtubule bundle formation|nervous system development|positive regulation of programmed cell death	centrosome|neuron projection	ATP binding|gamma-tubulin binding|microtubule binding|protein serine/threonine kinase activity|tau-protein kinase activity|ubiquitin binding			central_nervous_system(2)|large_intestine(1)	3		all_neural(266;0.224)|Ovarian(192;0.231)		OV - Ovarian serous cystadenocarcinoma(262;0.0102)														---	---	---	---	capture		Missense_Mutation	SNP	45781203	45781203	9698	19	G	C	C	33	33	MARK4	C	3	3
IGFL3	388555	broad.mit.edu	37	19	46627176	46627176	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46627176C>T	uc002pea.1	-	3	342	c.317G>A	c.(316-318)TGT>TAT	p.C106Y		NM_207393	NP_997276	Q6UXB1	IGFL3_HUMAN	IGF-like family member 3 precursor	106						extracellular region	protein binding				0		Ovarian(192;0.0175)|all_neural(266;0.0476)		OV - Ovarian serous cystadenocarcinoma(262;0.00473)|GBM - Glioblastoma multiforme(486;0.0149)|Epithelial(262;0.239)														---	---	---	---	capture		Missense_Mutation	SNP	46627176	46627176	7889	19	C	T	T	17	17	IGFL3	T	2	2
HIF3A	64344	broad.mit.edu	37	19	46811522	46811522	+	Nonsense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46811522T>A	uc002peh.2	+	4	437	c.408T>A	c.(406-408)TGT>TGA	p.C136*	HIF3A_uc002pef.1_Nonsense_Mutation_p.C136*|HIF3A_uc002peg.3_Nonsense_Mutation_p.C136*|HIF3A_uc010xxx.1_RNA|HIF3A_uc002pei.3_Nonsense_Mutation_p.C80*|HIF3A_uc002pej.1_Nonsense_Mutation_p.C67*|HIF3A_uc002pek.2_Nonsense_Mutation_p.C80*|HIF3A_uc010xxy.1_Nonsense_Mutation_p.C67*|HIF3A_uc002pel.2_Nonsense_Mutation_p.C134*|HIF3A_uc010xxz.1_Nonsense_Mutation_p.C85*	NM_152795	NP_690008	Q9Y2N7	HIF3A_HUMAN	hypoxia inducible factor 3, alpha subunit	136	PAS 1.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|signal transducer activity			upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	3		Ovarian(192;0.00965)|all_neural(266;0.0887)		OV - Ovarian serous cystadenocarcinoma(262;0.00204)|all cancers(93;0.0107)|GBM - Glioblastoma multiforme(486;0.0489)|Epithelial(262;0.136)														---	---	---	---	capture		Nonsense_Mutation	SNP	46811522	46811522	7390	19	T	A	A	59	59	HIF3A	A	5	4
TEAD2	8463	broad.mit.edu	37	19	49846557	49846557	+	Silent	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49846557C>G	uc002pnj.2	-	10	1099	c.1008G>C	c.(1006-1008)CTG>CTC	p.L336L	uc002pnb.1_5'Flank|TEAD2_uc002png.2_Silent_p.L339L|TEAD2_uc002pnh.2_Silent_p.L340L|TEAD2_uc002pni.2_Silent_p.L339L|TEAD2_uc010yao.1_Silent_p.L208L|TEAD2_uc010emw.2_Silent_p.L339L	NM_003598	NP_003589	Q15562	TEAD2_HUMAN	TEA domain family member 2	336	Transcriptional activation (Potential).				hippo signaling cascade		DNA binding|protein binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(2)|ovary(1)	3		all_lung(116;7.65e-05)|Lung NSC(112;0.000132)|all_neural(266;0.0506)|Ovarian(192;0.15)		OV - Ovarian serous cystadenocarcinoma(262;0.00093)|GBM - Glioblastoma multiforme(486;0.0467)														---	---	---	---	capture		Silent	SNP	49846557	49846557	16266	19	C	G	G	21	21	TEAD2	G	3	3
SIGLEC9	27180	broad.mit.edu	37	19	51628650	51628650	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:51628650C>A	uc002pvu.2	+	1	486	c.419C>A	c.(418-420)ACA>AAA	p.T140K	SIGLEC9_uc010yct.1_Missense_Mutation_p.T140K	NM_014441	NP_055256	Q9Y336	SIGL9_HUMAN	sialic acid binding Ig-like lectin 9 precursor	140	Extracellular (Potential).|Ig-like V-type.				cell adhesion|cell surface receptor linked signaling pathway	integral to plasma membrane	sugar binding			skin(1)	1		all_neural(266;0.0529)		GBM - Glioblastoma multiforme(134;0.000826)|OV - Ovarian serous cystadenocarcinoma(262;0.00295)														---	---	---	---	capture		Missense_Mutation	SNP	51628650	51628650	14810	19	C	A	A	17	17	SIGLEC9	A	2	2
ZNF28	7576	broad.mit.edu	37	19	53303738	53303738	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53303738G>A	uc002qad.2	-	4	1480	c.1360C>T	c.(1360-1362)CTT>TTT	p.L454F	ZNF28_uc002qac.2_Missense_Mutation_p.L401F|ZNF28_uc010eqe.2_Missense_Mutation_p.L400F	NM_006969	NP_008900	P17035	ZNF28_HUMAN	zinc finger protein 28	454	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)	1				GBM - Glioblastoma multiforme(134;0.0386)|Lung(386;0.145)														---	---	---	---	capture		Missense_Mutation	SNP	53303738	53303738	18405	19	G	A	A	33	33	ZNF28	A	2	2
CNOT3	4849	broad.mit.edu	37	19	54649754	54649754	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54649754C>T	uc002qdj.1	+	9	1123	c.812C>T	c.(811-813)CCG>CTG	p.P271L	CNOT3_uc010yel.1_Missense_Mutation_p.P271L|CNOT3_uc002qdi.2_Missense_Mutation_p.P184L|CNOT3_uc002qdk.1_Missense_Mutation_p.P271L|CNOT3_uc010ere.1_RNA	NM_014516	NP_055331	O75175	CNOT3_HUMAN	CCR4-NOT transcription complex, subunit 3	271					nuclear-transcribed mRNA poly(A) tail shortening|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol|nucleus	protein binding			ovary(2)|haematopoietic_and_lymphoid_tissue(1)	3	all_cancers(19;0.0065)|all_epithelial(19;0.00348)|all_lung(19;0.0175)|Lung NSC(19;0.0325)|Ovarian(34;0.19)																	---	---	---	---	capture		Missense_Mutation	SNP	54649754	54649754	3758	19	C	T	T	23	23	CNOT3	T	1	1
TTYH1	57348	broad.mit.edu	37	19	54930341	54930341	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54930341G>T	uc002qfq.2	+	2	258	c.166G>T	c.(166-168)GGC>TGC	p.G56C	TTYH1_uc010yey.1_Missense_Mutation_p.G105C|TTYH1_uc002qfr.2_Missense_Mutation_p.G56C|TTYH1_uc002qft.2_Missense_Mutation_p.G56C|TTYH1_uc002qfu.1_5'Flank	NM_020659	NP_065710	Q9H313	TTYH1_HUMAN	tweety 1 isoform 1	56	Helical; Name=1; (Potential).				cell adhesion	chloride channel complex|plasma membrane	chloride channel activity|iron ion transmembrane transporter activity				0	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.0767)														---	---	---	---	capture		Missense_Mutation	SNP	54930341	54930341	17294	19	G	T	T	43	43	TTYH1	T	2	2
SYT5	6861	broad.mit.edu	37	19	55687076	55687076	+	Splice_Site	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55687076C>T	uc002qjm.1	-	4	1600	c.540_splice	c.e4+1	p.K180_splice	SYT5_uc002qjp.2_Splice_Site_p.K177_splice|SYT5_uc002qjn.1_Splice_Site_p.K180_splice|SYT5_uc002qjo.1_Splice_Site_p.K180_splice	NM_003180	NP_003171			synaptotagmin V						energy reserve metabolic process|regulation of insulin secretion|synaptic transmission	cell junction|integral to membrane|recycling endosome membrane|synaptic vesicle membrane	metal ion binding|transporter activity				0			BRCA - Breast invasive adenocarcinoma(297;0.209)	GBM - Glioblastoma multiforme(193;0.0452)														---	---	---	---	capture		Splice_Site	SNP	55687076	55687076	15998	19	C	T	T	18	18	SYT5	T	5	2
NLRP4	147945	broad.mit.edu	37	19	56388478	56388478	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56388478T>C	uc002qmd.3	+	8	3064	c.2642T>C	c.(2641-2643)GTG>GCG	p.V881A	NLRP4_uc002qmf.2_Missense_Mutation_p.V806A|NLRP4_uc010etf.2_Missense_Mutation_p.V656A	NM_134444	NP_604393	Q96MN2	NALP4_HUMAN	NLR family, pyrin domain containing 4	881	LRR 6.						ATP binding			ovary(5)|skin(4)|lung(3)|upper_aerodigestive_tract(1)|kidney(1)|pancreas(1)	15		Colorectal(82;0.0002)|Ovarian(87;0.221)		GBM - Glioblastoma multiforme(193;0.0606)														---	---	---	---	capture		Missense_Mutation	SNP	56388478	56388478	10882	19	T	C	C	59	59	NLRP4	C	4	4
USP29	57663	broad.mit.edu	37	19	57642755	57642755	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57642755G>T	uc002qny.2	+	4	3068	c.2712G>T	c.(2710-2712)CAG>CAT	p.Q904H		NM_020903	NP_065954	Q9HBJ7	UBP29_HUMAN	ubiquitin specific peptidase 29	904					protein modification process|ubiquitin-dependent protein catabolic process		cysteine-type peptidase activity|protein binding|ubiquitin thiolesterase activity			lung(6)|ovary(2)|breast(2)|pancreas(1)	11		Colorectal(82;5.46e-05)|all_neural(62;0.0218)|Ovarian(87;0.0822)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---	capture		Missense_Mutation	SNP	57642755	57642755	17623	19	G	T	T	35	35	USP29	T	2	2
ZIM3	114026	broad.mit.edu	37	19	57646494	57646494	+	Nonsense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57646494G>C	uc002qnz.1	-	5	1597	c.1211C>G	c.(1210-1212)TCA>TGA	p.S404*		NM_052882	NP_443114	Q96PE6	ZIM3_HUMAN	zinc finger, imprinted 3	404	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			pancreas(1)|skin(1)	2		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.243)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---	capture		Nonsense_Mutation	SNP	57646494	57646494	18276	19	G	C	C	45	45	ZIM3	C	5	3
AURKC	6795	broad.mit.edu	37	19	57744972	57744972	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57744972C>A	uc002qoe.2	+	5	769	c.580C>A	c.(580-582)CTG>ATG	p.L194M	AURKC_uc002qoc.2_Missense_Mutation_p.L175M|AURKC_uc002qod.2_Missense_Mutation_p.L160M|AURKC_uc010etv.2_Missense_Mutation_p.L191M	NM_001015878	NP_001015878	Q9UQB9	AURKC_HUMAN	aurora kinase C isoform 1	194	Protein kinase.			SLR -> LPE (in Ref. 2; AAC77369).	cell cycle|cytokinesis	condensed chromosome|cytoplasm|midbody|spindle midzone	ATP binding|protein serine/threonine kinase activity			lung(4)|ovary(2)	6		Colorectal(82;5.46e-05)|all_neural(62;0.0218)|Ovarian(87;0.0822)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0122)														---	---	---	---	capture		Missense_Mutation	SNP	57744972	57744972	1245	19	C	A	A	24	24	AURKC	A	2	2
ZNF548	147694	broad.mit.edu	37	19	57911091	57911091	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57911091G>A	uc002qom.2	+	3	1686	c.1436G>A	c.(1435-1437)TGC>TAC	p.C479Y	ZNF547_uc002qpm.3_Intron|ZNF548_uc002qon.2_Missense_Mutation_p.C482Y	NM_152909	NP_690873	Q8NEK5	ZN548_HUMAN	zinc finger protein 548	479	C2H2-type 11.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			breast(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.221)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---	capture		Missense_Mutation	SNP	57911091	57911091	18575	19	G	A	A	46	46	ZNF548	A	2	2
ZNF416	55659	broad.mit.edu	37	19	58084335	58084335	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58084335G>T	uc002qpf.2	-	4	1108	c.937C>A	c.(937-939)CTC>ATC	p.L313I	ZNF547_uc002qpm.3_Intron	NM_017879	NP_060349	Q9BWM5	ZN416_HUMAN	zinc finger protein 416	313	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0259)														---	---	---	---	capture		Missense_Mutation	SNP	58084335	58084335	18486	19	G	T	T	35	35	ZNF416	T	2	2
ZSCAN4	201516	broad.mit.edu	37	19	58190146	58190146	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58190146G>T	uc002qpu.2	+	5	1872	c.1175G>T	c.(1174-1176)GGA>GTA	p.G392V		NM_152677	NP_689890	Q8NAM6	ZSCA4_HUMAN	zinc finger and SCAN domain containing 4	392					telomere maintenance via telomere lengthening|viral reproduction	nuclear chromosome, telomeric region	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---	capture		Missense_Mutation	SNP	58190146	58190146	18841	19	G	T	T	41	41	ZSCAN4	T	2	2
ZNF135	7694	broad.mit.edu	37	19	58578819	58578819	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58578819G>A	uc010yhq.1	+	5	1099	c.1003G>A	c.(1003-1005)GAG>AAG	p.E335K	ZNF135_uc002qre.2_Missense_Mutation_p.E323K|ZNF135_uc002qrd.1_Missense_Mutation_p.E281K|ZNF135_uc002qrf.2_Missense_Mutation_p.E281K|ZNF135_uc002qrg.2_Missense_Mutation_p.E293K|ZNF135_uc010yhr.1_Missense_Mutation_p.E144K	NM_003436	NP_003427	B4DHH9	B4DHH9_HUMAN	zinc finger protein 135 isoform 2	335					regulation of transcription, DNA-dependent	intracellular	nucleic acid binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0412)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0161)														---	---	---	---	capture		Missense_Mutation	SNP	58578819	58578819	18316	19	G	A	A	37	37	ZNF135	A	1	1
ZNF584	201514	broad.mit.edu	37	19	58929131	58929131	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58929131G>T	uc002qsp.2	+	4	1698	c.1246G>T	c.(1246-1248)GGG>TGG	p.G416W	ZNF584_uc010yia.1_RNA|ZNF584_uc002qsr.2_Missense_Mutation_p.G371W|ZNF584_uc010yib.1_3'UTR	NM_173548	NP_775819	Q8IVC4	ZN584_HUMAN	zinc finger protein 584	416					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(17;5.3e-17)|all_epithelial(17;3.71e-12)|Lung NSC(17;8.3e-05)|Colorectal(82;0.000147)|all_lung(17;0.000386)|Renal(17;0.00528)|all_neural(62;0.0133)|Ovarian(87;0.156)|Medulloblastoma(540;0.232)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0271)														---	---	---	---	capture		Missense_Mutation	SNP	58929131	58929131	18611	19	G	T	T	47	47	ZNF584	T	2	2
GREB1	9687	broad.mit.edu	37	2	11767139	11767139	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:11767139C>T	uc002rbk.1	+	25	4658	c.4358C>T	c.(4357-4359)GCA>GTA	p.A1453V	GREB1_uc002rbp.1_Missense_Mutation_p.A451V	NM_014668	NP_055483	Q4ZG55	GREB1_HUMAN	growth regulation by estrogen in breast cancer 1	1453						integral to membrane				ovary(1)	1	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.115)|OV - Ovarian serous cystadenocarcinoma(76;0.186)														---	---	---	---	capture		Missense_Mutation	SNP	11767139	11767139	7037	2	C	T	T	25	25	GREB1	T	2	2
ITSN2	50618	broad.mit.edu	37	2	24507709	24507709	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:24507709C>A	uc002rfe.2	-	17	2125	c.1867G>T	c.(1867-1869)GGG>TGG	p.G623W	ITSN2_uc002rff.2_Intron|ITSN2_uc002rfg.2_Missense_Mutation_p.G623W	NM_006277	NP_006268	Q9NZM3	ITSN2_HUMAN	intersectin 2 isoform 1	623	Potential.				endocytosis|regulation of Rho protein signal transduction	cytoplasm	calcium ion binding|Rho guanyl-nucleotide exchange factor activity|SH3/SH2 adaptor activity			kidney(2)|ovary(1)|central_nervous_system(1)	4	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---	capture		Missense_Mutation	SNP	24507709	24507709	8231	2	C	A	A	21	21	ITSN2	A	2	2
SOS1	6654	broad.mit.edu	37	2	39294858	39294858	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:39294858C>G	uc002rrk.3	-	2	165	c.124G>C	c.(124-126)GAT>CAT	p.D42H	SOS1_uc010ynr.1_RNA	NM_005633	NP_005624	Q07889	SOS1_HUMAN	son of sevenless homolog 1	42					apoptosis|axon guidance|blood coagulation|epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|induction of apoptosis by extracellular signals|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|Ras protein signal transduction	cytosol	DNA binding|protein binding|Rho GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			ovary(4)|breast(3)|lung(2)|central_nervous_system(1)	10		all_hematologic(82;0.21)												Noonan_syndrome				---	---	---	---	capture		Missense_Mutation	SNP	39294858	39294858	15436	2	C	G	G	29	29	SOS1	G	3	3
PSME4	23198	broad.mit.edu	37	2	54117332	54117332	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:54117332C>A	uc002rxp.2	-	37	4261	c.4205G>T	c.(4204-4206)TGG>TTG	p.W1402L	PSME4_uc010yop.1_Missense_Mutation_p.W1288L|PSME4_uc010yoq.1_RNA|PSME4_uc010fbu.1_Missense_Mutation_p.W777L|PSME4_uc010fbv.1_Missense_Mutation_p.W546L|PSME4_uc010fbt.1_5'Flank	NM_014614	NP_055429	Q14997	PSME4_HUMAN	proteasome (prosome, macropain) activator	1402					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|cell differentiation|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|M/G1 transition of mitotic cell cycle|mRNA metabolic process|multicellular organismal development|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|spermatogenesis|viral reproduction	nuclear speck|proteasome complex	binding			ovary(2)|breast(2)|pancreas(1)	5			Lung(47;0.125)|LUSC - Lung squamous cell carcinoma(58;0.181)															---	---	---	---	capture		Missense_Mutation	SNP	54117332	54117332	13162	2	C	A	A	21	21	PSME4	A	2	2
PEX13	5194	broad.mit.edu	37	2	61258651	61258651	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61258651G>T	uc002sau.3	+	2	273	c.190G>T	c.(190-192)GGA>TGA	p.G64*		NM_002618	NP_002609	Q92968	PEX13_HUMAN	peroxisomal biogenesis factor 13	64	Lumenal (Potential).				cerebral cortex cell migration|fatty acid alpha-oxidation|locomotory behavior|microtubule-based peroxisome localization|neuron migration|protein import into peroxisome matrix, docking|suckling behavior	integral to peroxisomal membrane|membrane fraction	protein binding			skin(1)	1			LUSC - Lung squamous cell carcinoma(5;2.05e-06)|Lung(5;3.13e-05)|Epithelial(17;0.114)															---	---	---	---	capture		Nonsense_Mutation	SNP	61258651	61258651	12163	2	G	T	T	35	35	PEX13	T	5	2
USP34	9736	broad.mit.edu	37	2	61415429	61415429	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61415429C>G	uc002sbe.2	-	80	10471	c.10449G>C	c.(10447-10449)TTG>TTC	p.L3483F	USP34_uc002sbd.2_Missense_Mutation_p.L285F	NM_014709	NP_055524	Q70CQ2	UBP34_HUMAN	ubiquitin specific protease 34	3483					positive regulation of canonical Wnt receptor signaling pathway|protein K48-linked deubiquitination|ubiquitin-dependent protein catabolic process|Wnt receptor signaling pathway		cysteine-type endopeptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(8)|breast(5)|skin(3)|lung(2)|prostate(1)	19			Epithelial(17;0.229)															---	---	---	---	capture		Missense_Mutation	SNP	61415429	61415429	17629	2	C	G	G	29	29	USP34	G	3	3
DQX1	165545	broad.mit.edu	37	2	74749835	74749835	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74749835C>A	uc010yrw.1	-	8	1532	c.1367G>T	c.(1366-1368)GGG>GTG	p.G456V	DQX1_uc002smc.2_Missense_Mutation_p.G17V	NM_133637	NP_598376	Q8TE96	DQX1_HUMAN	DEAQ box polypeptide 1 (RNA-dependent ATPase)	456						nucleus	ATP binding|helicase activity|nucleic acid binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	74749835	74749835	4935	2	C	A	A	22	22	DQX1	A	2	2
LRRTM1	347730	broad.mit.edu	37	2	80530029	80530029	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:80530029G>T	uc002sok.1	-	2	1186	c.916C>A	c.(916-918)CTG>ATG	p.L306M	CTNNA2_uc010yse.1_Intron|CTNNA2_uc010ysf.1_Intron|CTNNA2_uc010ysg.1_Intron|CTNNA2_uc010ysh.1_Intron|CTNNA2_uc010ysi.1_5'Flank|LRRTM1_uc002soj.3_RNA	NM_178839	NP_849161	Q86UE6	LRRT1_HUMAN	leucine rich repeat transmembrane neuronal 1	306	Lumenal (Potential).					axon|endoplasmic reticulum membrane|growth cone|integral to membrane				ovary(3)|upper_aerodigestive_tract(1)|skin(1)	5															HNSCC(69;0.2)			---	---	---	---	capture		Missense_Mutation	SNP	80530029	80530029	9415	2	G	T	T	35	35	LRRTM1	T	2	2
C2orf55	343990	broad.mit.edu	37	2	99449451	99449451	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:99449451C>A	uc002szf.1	-	4	543	c.249G>T	c.(247-249)AGG>AGT	p.R83S		NM_207362	NP_997245	Q6NV74	CB055_HUMAN	hypothetical protein LOC343990	83											0																		---	---	---	---	capture		Missense_Mutation	SNP	99449451	99449451	2264	2	C	A	A	22	22	C2orf55	A	2	2
TSGA10	80705	broad.mit.edu	37	2	99634803	99634803	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:99634803G>A	uc002szg.3	-	18	2560	c.1932C>T	c.(1930-1932)GCC>GCT	p.A644A	TSGA10_uc002szh.3_Silent_p.A644A|TSGA10_uc002szi.3_Silent_p.A644A|TSGA10_uc010fin.1_Silent_p.A644A	NM_182911	NP_878915	Q9BZW7	TSG10_HUMAN	testis specific, 10	644	Interaction with HIF1A (By similarity).				spermatogenesis	cytoplasm|nuclear membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Silent	SNP	99634803	99634803	17168	2	G	A	A	39	39	TSGA10	A	1	1
GCC2	9648	broad.mit.edu	37	2	109086257	109086257	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:109086257G>A	uc002tec.2	+	6	626	c.472G>A	c.(472-474)GAA>AAA	p.E158K	GCC2_uc002ted.2_Missense_Mutation_p.E57K	NM_181453	NP_852118	Q8IWJ2	GCC2_HUMAN	GRIP and coiled-coil domain-containing 2	158	Potential.				Golgi ribbon formation|late endosome to Golgi transport|microtubule anchoring|microtubule organizing center organization|protein localization in Golgi apparatus|protein targeting to lysosome|recycling endosome to Golgi transport|regulation of protein exit from endoplasmic reticulum	membrane|trans-Golgi network	identical protein binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	109086257	109086257	6552	2	G	A	A	33	33	GCC2	A	2	2
TUBA3E	112714	broad.mit.edu	37	2	130951676	130951676	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:130951676C>T	uc002tqv.2	-	4	840	c.739G>A	c.(739-741)GCC>ACC	p.A247T		NM_207312	NP_997195	Q6PEY2	TBA3E_HUMAN	tubulin, alpha 3e	247					microtubule-based movement|protein polymerization	cytoplasm|microtubule	GTP binding|GTPase activity|structural molecule activity			skin(1)	1	Colorectal(110;0.1)																	---	---	---	---	capture		Missense_Mutation	SNP	130951676	130951676	17303	2	C	T	T	26	26	TUBA3E	T	2	2
PKP4	8502	broad.mit.edu	37	2	159535159	159535159	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:159535159G>A	uc002tzv.2	+	21	3583	c.3323G>A	c.(3322-3324)CGG>CAG	p.R1108Q	PKP4_uc002tzw.2_Missense_Mutation_p.R1065Q|PKP4_uc002tzx.2_Missense_Mutation_p.R765Q|PKP4_uc002uaa.2_Missense_Mutation_p.R917Q|uc002uab.1_Intron|PKP4_uc002uac.2_Missense_Mutation_p.R289Q|PKP4_uc002uad.2_RNA	NM_003628	NP_003619	Q99569	PKP4_HUMAN	plakophilin 4 isoform a	1108					cell adhesion	desmosome	protein binding			ovary(5)|skin(2)	7															HNSCC(62;0.18)			---	---	---	---	capture		Missense_Mutation	SNP	159535159	159535159	12412	2	G	A	A	39	39	PKP4	A	1	1
SCN1A	6323	broad.mit.edu	37	2	166901684	166901684	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:166901684C>T	uc010zcz.1	-	10	1549	c.1531G>A	c.(1531-1533)GGT>AGT	p.G511S	SCN1A_uc002udo.3_Missense_Mutation_p.G380S|SCN1A_uc010fpk.2_Missense_Mutation_p.G380S	NM_006920	NP_008851	P35498	SCN1A_HUMAN	sodium channel, voltage-gated, type I, alpha	511						voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(6)|skin(6)|large_intestine(1)	13					Lamotrigine(DB00555)|Levetiracetam(DB01202)|Phenacemide(DB01121)|Phenytoin(DB00252)|Topiramate(DB00273)|Zonisamide(DB00909)													---	---	---	---	capture		Missense_Mutation	SNP	166901684	166901684	14396	2	C	T	T	21	21	SCN1A	T	2	2
DLX1	1745	broad.mit.edu	37	2	172951530	172951530	+	Silent	SNP	T	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:172951530T>G	uc002uhl.2	+	2	660	c.462T>G	c.(460-462)GCT>GCG	p.A154A	DLX1_uc010fqj.1_Silent_p.A154A|DLX1_uc002uhm.2_Intron	NM_178120	NP_835221	P56177	DLX1_HUMAN	distal-less homeobox 1 isoform 1	154	Homeobox.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0			OV - Ovarian serous cystadenocarcinoma(117;0.216)															---	---	---	---	capture		Silent	SNP	172951530	172951530	4750	2	T	G	G	54	54	DLX1	G	4	4
ATP5G3	518	broad.mit.edu	37	2	176043809	176043809	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:176043809C>A	uc002ujz.3	-	3	560	c.290G>T	c.(289-291)GGC>GTC	p.G97V	ATP5G3_uc002uka.3_Missense_Mutation_p.G97V|ATP5G3_uc002ukb.1_Missense_Mutation_p.G97V	NM_001002258	NP_001002258	P48201	AT5G3_HUMAN	ATP synthase, H+ transporting, mitochondrial F0	97	Helical; (Potential).				ATP hydrolysis coupled proton transport|ATP synthesis coupled proton transport	integral to membrane|mitochondrial proton-transporting ATP synthase complex|proton-transporting ATP synthase complex, coupling factor F(o)	hydrogen ion transmembrane transporter activity|lipid binding|protein binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.147)															---	---	---	---	capture		Missense_Mutation	SNP	176043809	176043809	1174	2	C	A	A	26	26	ATP5G3	A	2	2
TTN	7273	broad.mit.edu	37	2	179596503	179596503	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179596503A>G	uc010zfg.1	-	55	13591	c.13367T>C	c.(13366-13368)GTA>GCA	p.V4456A	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Missense_Mutation_p.V1117A	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	5383							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---	capture		Missense_Mutation	SNP	179596503	179596503	17290	2	A	G	G	14	14	TTN	G	4	4
ZNF385B	151126	broad.mit.edu	37	2	180634369	180634369	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:180634369C>T	uc002unn.3	-	3	718	c.114G>A	c.(112-114)GTG>GTA	p.V38V		NM_152520	NP_689733	Q569K4	Z385B_HUMAN	zinc finger protein 385B isoform 1	38	Matrin-type 1.					nucleus	nucleic acid binding|zinc ion binding			ovary(1)	1			Epithelial(96;0.174)|OV - Ovarian serous cystadenocarcinoma(117;0.201)															---	---	---	---	capture		Silent	SNP	180634369	180634369	18469	2	C	T	T	17	17	ZNF385B	T	2	2
CERKL	375298	broad.mit.edu	37	2	182438605	182438605	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:182438605G>A	uc002unx.2	-	3	589	c.488C>T	c.(487-489)CCA>CTA	p.P163L	CERKL_uc002uny.2_Missense_Mutation_p.P163L|CERKL_uc010zfm.1_Intron|CERKL_uc002unz.2_5'UTR|CERKL_uc002uoa.2_Missense_Mutation_p.P163L|CERKL_uc002uob.2_Intron|CERKL_uc002uoc.2_Intron|CERKL_uc010frk.2_Intron|CERKL_uc002uod.1_5'UTR|CERKL_uc002uoe.2_Missense_Mutation_p.P163L	NM_001030311	NP_001025482	Q49MI3	CERKL_HUMAN	ceramide kinase-like isoform b	163					activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|anti-apoptosis	endoplasmic reticulum|endoplasmic reticulum|Golgi apparatus|Golgi apparatus|nucleolus|nucleolus	diacylglycerol kinase activity			ovary(2)|kidney(1)|skin(1)	4			OV - Ovarian serous cystadenocarcinoma(117;0.088)															---	---	---	---	capture		Missense_Mutation	SNP	182438605	182438605	3401	2	G	A	A	47	47	CERKL	A	2	2
FAM171B	165215	broad.mit.edu	37	2	187615909	187615909	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:187615909T>A	uc002ups.2	+	5	885	c.773T>A	c.(772-774)ATA>AAA	p.I258K	FAM171B_uc002upr.1_Missense_Mutation_p.I258K	NM_177454	NP_803237	Q6P995	F171B_HUMAN	KIAA1946	258	Extracellular (Potential).					integral to membrane	DNA binding			ovary(6)|breast(3)|central_nervous_system(1)	10																		---	---	---	---	capture		Missense_Mutation	SNP	187615909	187615909	5697	2	T	A	A	49	49	FAM171B	A	4	4
IKZF2	22807	broad.mit.edu	37	2	213921675	213921675	+	Silent	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:213921675G>C	uc002vem.2	-	4	457	c.288C>G	c.(286-288)GTC>GTG	p.V96V	IKZF2_uc010fuu.2_Intron|IKZF2_uc002vej.2_Silent_p.V43V|IKZF2_uc002vek.2_RNA|IKZF2_uc010fuv.2_Silent_p.V96V|IKZF2_uc002vel.2_Silent_p.V43V|IKZF2_uc010fuw.2_5'UTR|IKZF2_uc010fux.2_Intron|IKZF2_uc010fuy.2_Silent_p.V96V|IKZF2_uc002ven.2_Silent_p.V96V	NM_016260	NP_057344	Q9UKS7	IKZF2_HUMAN	helios isoform 1	96					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Esophageal squamous(248;0.0559)|Renal(323;0.218)		UCEC - Uterine corpus endometrioid carcinoma (47;0.214)|Epithelial(149;2.97e-07)|all cancers(144;1.53e-05)|LUSC - Lung squamous cell carcinoma(224;0.00599)|Lung(261;0.00792)														---	---	---	---	capture		Silent	SNP	213921675	213921675	7916	2	G	C	C	41	41	IKZF2	C	3	3
PNKD	25953	broad.mit.edu	37	2	219204777	219204777	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219204777C>A	uc002vhn.2	+	4	522	c.378C>A	c.(376-378)GTC>GTA	p.V126V	PNKD_uc002vhq.2_Silent_p.V102V	NM_015488	NP_056303	Q8N490	PNKD_HUMAN	myofibrillogenesis regulator 1 isoform 1	126						membrane|mitochondrion|nucleus	hydroxyacylglutathione hydrolase activity|zinc ion binding				0		Renal(207;0.0474)		Epithelial(149;7.33e-07)|all cancers(144;0.000133)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---	capture		Silent	SNP	219204777	219204777	12572	2	C	A	A	30	30	PNKD	A	2	2
C2orf24	27013	broad.mit.edu	37	2	220039778	220039778	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220039778G>A	uc002vju.3	-	4	465	c.313C>T	c.(313-315)CGG>TGG	p.R105W	C2orf24_uc002vjv.2_Missense_Mutation_p.R105W	NM_015680	NP_056495	Q9BV87	CNPD1_HUMAN	hypothetical protein LOC27013	105					regulation of cyclin-dependent protein kinase activity	integral to membrane	protein kinase binding				0		Renal(207;0.0915)		Epithelial(149;8.92e-07)|all cancers(144;0.000151)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---	capture		Missense_Mutation	SNP	220039778	220039778	2245	2	G	A	A	40	40	C2orf24	A	1	1
FAM134A	79137	broad.mit.edu	37	2	220046974	220046974	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220046974C>A	uc002vjw.3	+	9	1391	c.1255C>A	c.(1255-1257)CCA>ACA	p.P419T	FAM134A_uc010fwc.2_Missense_Mutation_p.P212T|FAM134A_uc002vjx.2_Missense_Mutation_p.P212T	NM_024293	NP_077269	Q8NC44	F134A_HUMAN	hypothetical protein LOC79137	419						endoplasmic reticulum|integral to membrane				ovary(1)|central_nervous_system(1)	2		Renal(207;0.0915)		Epithelial(149;8.92e-07)|all cancers(144;0.000151)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---	capture		Missense_Mutation	SNP	220046974	220046974	5642	2	C	A	A	22	22	FAM134A	A	2	2
KIAA1486	57624	broad.mit.edu	37	2	226516205	226516205	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:226516205C>T	uc002voe.2	+	6	2061	c.1886C>T	c.(1885-1887)CCA>CTA	p.P629L	KIAA1486_uc010fxa.1_3'UTR|KIAA1486_uc002vof.1_Missense_Mutation_p.P399L	NM_020864	NP_065915	Q9P242	K1486_HUMAN	hypothetical protein LOC57624	629										ovary(2)|central_nervous_system(1)	3		Renal(207;0.0112)|all_lung(227;0.0477)|Lung NSC(271;0.0644)|all_hematologic(139;0.101)|Esophageal squamous(248;0.129)		Epithelial(121;6.73e-10)|all cancers(144;4.32e-07)|Lung(261;0.0161)|LUSC - Lung squamous cell carcinoma(224;0.0223)														---	---	---	---	capture		Missense_Mutation	SNP	226516205	226516205	8546	2	C	T	T	21	21	KIAA1486	T	2	2
SPHKAP	80309	broad.mit.edu	37	2	228881839	228881839	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:228881839G>T	uc002vpq.2	-	7	3778	c.3731C>A	c.(3730-3732)TCC>TAC	p.S1244Y	SPHKAP_uc002vpp.2_Missense_Mutation_p.S1244Y|SPHKAP_uc010zlx.1_Missense_Mutation_p.S1244Y	NM_001142644	NP_001136116	Q2M3C7	SPKAP_HUMAN	sphingosine kinase type 1-interacting protein	1244						cytoplasm	protein binding			skin(5)|ovary(4)|lung(1)	10		Renal(207;0.025)|all_hematologic(139;0.15)|all_lung(227;0.204)|Acute lymphoblastic leukemia(138;0.205)|Esophageal squamous(248;0.23)		Epithelial(121;8.17e-11)|all cancers(144;7.92e-08)|Lung(261;0.0168)|LUSC - Lung squamous cell carcinoma(224;0.0232)														---	---	---	---	capture		Missense_Mutation	SNP	228881839	228881839	15560	2	G	T	T	41	41	SPHKAP	T	2	2
GIGYF2	26058	broad.mit.edu	37	2	233704607	233704607	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233704607C>G	uc002vti.3	+	25	3152	c.2815C>G	c.(2815-2817)CAG>GAG	p.Q939E	GIGYF2_uc002vtj.3_Missense_Mutation_p.Q960E|GIGYF2_uc002vtk.3_Missense_Mutation_p.Q939E|GIGYF2_uc002vth.3_Missense_Mutation_p.Q933E|GIGYF2_uc010zmk.1_RNA|GIGYF2_uc010zml.1_Missense_Mutation_p.Q770E|GIGYF2_uc002vtq.3_Missense_Mutation_p.Q272E	NM_015575	NP_056390	Q6Y7W6	PERQ2_HUMAN	GRB10 interacting GYF protein 2 isoform b	939	Gln-rich.				cell death		protein binding			ovary(4)|central_nervous_system(3)	7		Breast(86;0.00279)|all_hematologic(139;0.00793)|Renal(207;0.0112)|Acute lymphoblastic leukemia(138;0.0182)|all_lung(227;0.0271)|Lung NSC(271;0.0839)		Epithelial(121;7.37e-16)|BRCA - Breast invasive adenocarcinoma(100;0.000472)|LUSC - Lung squamous cell carcinoma(224;0.00902)|Lung(119;0.0118)|GBM - Glioblastoma multiforme(43;0.0145)														---	---	---	---	capture		Missense_Mutation	SNP	233704607	233704607	6646	2	C	G	G	29	29	GIGYF2	G	3	3
C20orf194	25943	broad.mit.edu	37	20	3305582	3305582	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3305582C>A	uc002wii.2	-	14	1273	c.1222G>T	c.(1222-1224)GGG>TGG	p.G408W	C20orf194_uc002wij.3_Missense_Mutation_p.G147W|C20orf194_uc002wik.2_Missense_Mutation_p.G82W|C20orf194_uc010gay.1_RNA	NM_001009984	NP_001009984	Q5TEA3	CT194_HUMAN	hypothetical protein LOC25943	408											0																		---	---	---	---	capture		Missense_Mutation	SNP	3305582	3305582	2177	20	C	A	A	21	21	C20orf194	A	2	2
GNAS	2778	broad.mit.edu	37	20	57484238	57484238	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:57484238G>A	uc002xzw.2	+	7	2766	c.2481G>A	c.(2479-2481)GTG>GTA	p.V827V	GNAS_uc002xzt.2_3'UTR|GNAS_uc010gjq.2_Silent_p.V125V|GNAS_uc002xzx.2_Silent_p.V125V|GNAS_uc010gjr.2_Silent_p.V75V|GNAS_uc002xzy.2_Silent_p.V110V|GNAS_uc002yaa.2_Silent_p.V170V|GNAS_uc010zzt.1_Silent_p.V185V|GNAS_uc002yab.2_Intron|GNAS_uc002yad.2_Silent_p.V75V|GNAS_uc002yae.2_Silent_p.V109V	NM_080425	NP_536350	P63092	GNAS2_HUMAN	GNAS complex locus XLas	184					activation of adenylate cyclase activity|cellular response to glucagon stimulus|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|intracellular transport|platelet activation|regulation of insulin secretion|sensory perception of smell|transmembrane transport|water transport	heterotrimeric G-protein complex|intrinsic to membrane|trans-Golgi network membrane	adenylate cyclase activity|GTP binding|GTPase activity|guanyl-nucleotide exchange factor activity|identical protein binding|signal transducer activity			pituitary(201)|thyroid(35)|ovary(15)|adrenal_gland(9)|liver(7)|large_intestine(5)|parathyroid(5)|kidney(5)|haematopoietic_and_lymphoid_tissue(3)|lung(2)|testis(1)|stomach(1)|small_intestine(1)|autonomic_ganglia(1)|pancreas(1)	292	all_lung(29;0.0104)		BRCA - Breast invasive adenocarcinoma(13;2.19e-08)|Colorectal(105;0.109)					Mis		pituitary adenoma		McCune-Albright syndrome; pseudohypoparathyroidism|type IA		3-Methylglutaconic_Aciduria_and_Myelodysplasia|McCune-Albright_syndrome|Mazabraud_syndrome	TSP Lung(22;0.16)			---	---	---	---	capture		Silent	SNP	57484238	57484238	6779	20	G	A	A	45	45	GNAS	A	2	2
TMPRSS15	5651	broad.mit.edu	37	21	19666726	19666726	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:19666726G>A	uc002ykw.2	-	21	2378	c.2347C>T	c.(2347-2349)CCA>TCA	p.P783S		NM_002772	NP_002763	P98073	ENTK_HUMAN	enterokinase precursor	783	Extracellular (Potential).				proteolysis	brush border|integral to membrane	scavenger receptor activity|serine-type endopeptidase activity			ovary(5)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	19666726	19666726	16787	21	G	A	A	43	43	TMPRSS15	A	2	2
DOPEY2	9980	broad.mit.edu	37	21	37610953	37610953	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:37610953G>C	uc002yvg.2	+	17	2909	c.2830G>C	c.(2830-2832)GAG>CAG	p.E944Q	DOPEY2_uc011aeb.1_Missense_Mutation_p.E893Q	NM_005128	NP_005119	Q9Y3R5	DOP2_HUMAN	pad-1-like	944					endoplasmic reticulum organization|Golgi to endosome transport|multicellular organismal development|protein transport	Golgi membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	37610953	37610953	4892	21	G	C	C	33	33	DOPEY2	C	3	3
CABIN1	23523	broad.mit.edu	37	22	24515526	24515526	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:24515526C>A	uc002zzi.1	+	28	4620	c.4493C>A	c.(4492-4494)CCG>CAG	p.P1498Q	CABIN1_uc002zzj.1_Missense_Mutation_p.P1419Q|CABIN1_uc002zzl.1_Missense_Mutation_p.P1498Q	NM_012295	NP_036427	Q9Y6J0	CABIN_HUMAN	calcineurin binding protein 1	1498					cell surface receptor linked signaling pathway|chromatin modification	nucleus	protein phosphatase inhibitor activity			ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	24515526	24515526	2644	22	C	A	A	23	23	CABIN1	A	1	1
GGT1	2678	broad.mit.edu	37	22	25007072	25007072	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:25007072G>A	uc003aan.1	+	5	511	c.24G>A	c.(22-24)CTG>CTA	p.L8L	GGT1_uc003aas.1_Silent_p.L8L|GGT1_uc003aat.1_Silent_p.L8L|GGT1_uc003aau.1_Silent_p.L8L|GGT1_uc003aav.1_Silent_p.L8L|GGT1_uc003aaw.1_Silent_p.L8L|GGT1_uc003aax.1_Silent_p.L8L	NM_013430	NP_038347	P19440	GGT1_HUMAN	gamma-glutamyltransferase 1 precursor	8	Helical; Signal-anchor for type II membrane protein; (Probable).				glutathione biosynthetic process	integral to membrane	acyltransferase activity|gamma-glutamyltransferase activity|protein binding				0					Glutathione(DB00143)													---	---	---	---	capture		Silent	SNP	25007072	25007072	6629	22	G	A	A	47	47	GGT1	A	2	2
MN1	4330	broad.mit.edu	37	22	28195045	28195045	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:28195045C>T	uc003adj.2	-	1	2442	c.1487G>A	c.(1486-1488)GGC>GAC	p.G496D		NM_002430	NP_002421	Q10571	MN1_HUMAN	meningioma  1	496							binding			central_nervous_system(3)|lung(3)|large_intestine(1)|breast(1)|skin(1)|ovary(1)	10								T	ETV6	AML|meningioma								---	---	---	---	capture		Missense_Mutation	SNP	28195045	28195045	10064	22	C	T	T	26	26	MN1	T	2	2
TOM1	10043	broad.mit.edu	37	22	35713920	35713920	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:35713920G>C	uc003ann.2	+	2	228	c.103G>C	c.(103-105)GAG>CAG	p.E35Q	TOM1_uc011ami.1_Missense_Mutation_p.E2Q|TOM1_uc011amj.1_5'UTR|TOM1_uc003ans.2_5'UTR|TOM1_uc011amk.1_Missense_Mutation_p.W13C|TOM1_uc003anp.2_Missense_Mutation_p.E35Q|TOM1_uc011aml.1_Missense_Mutation_p.E35Q|TOM1_uc003ano.2_RNA|TOM1_uc003anq.2_Missense_Mutation_p.E35Q|TOM1_uc003anr.2_5'UTR	NM_005488	NP_005479	O60784	TOM1_HUMAN	target of myb1 isoform 1	35	VHS.				endocytosis|endosome transport|intracellular protein transport	cytosol|early endosome|membrane	protein binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	35713920	35713920	16892	22	G	C	C	41	41	TOM1	C	3	3
ELFN2	114794	broad.mit.edu	37	22	37770023	37770023	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:37770023C>T	uc003asq.3	-	3	2338	c.1552G>A	c.(1552-1554)GAG>AAG	p.E518K		NM_052906	NP_443138	Q5R3F8	LRFN6_HUMAN	leucine rich repeat containing 62	518	Cytoplasmic (Potential).					cell surface|integral to membrane				upper_aerodigestive_tract(1)|ovary(1)	2	Melanoma(58;0.0574)																	---	---	---	---	capture		Missense_Mutation	SNP	37770023	37770023	5250	22	C	T	T	31	31	ELFN2	T	1	1
SH3BP1	23616	broad.mit.edu	37	22	38061599	38061599	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38061599G>T	uc003atj.1	+	17	2426	c.1539G>T	c.(1537-1539)TCG>TCT	p.S513S	PDXP_uc003atm.1_Silent_p.S204S			Q9Y3L3	3BP1_HUMAN	SubName: Full=cDNA FLJ44925 fis, clone BRAMY3014613, highly similar to Homo sapiens SH3-domain binding protein 1 (SH3BP1);	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					signal transduction	cytoplasm	GTPase activator activity|SH3 domain binding			central_nervous_system(1)	1	Melanoma(58;0.0574)																	---	---	---	---	capture		Silent	SNP	38061599	38061599	14735	22	G	T	T	39	39	SH3BP1	T	1	1
EFCAB6	64800	broad.mit.edu	37	22	43972302	43972302	+	Missense_Mutation	SNP	T	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43972302T>G	uc003bdy.1	-	26	3510	c.3295A>C	c.(3295-3297)AAG>CAG	p.K1099Q	EFCAB6_uc003bdz.1_Missense_Mutation_p.K947Q|EFCAB6_uc010gzi.1_Missense_Mutation_p.K947Q|EFCAB6_uc010gzj.1_Missense_Mutation_p.K325Q	NM_022785	NP_073622	Q5THR3	EFCB6_HUMAN	CAP-binding protein complex interacting protein	1099	EF-hand 12.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	calcium ion binding			ovary(3)|skin(2)|upper_aerodigestive_tract(1)|pancreas(1)	7		Ovarian(80;0.0247)|all_neural(38;0.025)																---	---	---	---	capture		Missense_Mutation	SNP	43972302	43972302	5126	22	T	G	G	61	61	EFCAB6	G	4	4
C22orf9	23313	broad.mit.edu	37	22	45607906	45607906	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:45607906G>T	uc003bfx.1	-	2	213	c.147C>A	c.(145-147)GAC>GAA	p.D49E	C22orf9_uc003bfv.1_Missense_Mutation_p.D58E|C22orf9_uc003bfw.1_Missense_Mutation_p.D54E|C22orf9_uc010gzx.2_Missense_Mutation_p.D31E	NM_001009880	NP_001009880	Q6ICG6	K0930_HUMAN	hypothetical protein LOC23313 isoform b	49							protein binding				0		Ovarian(80;0.00965)|all_neural(38;0.0244)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0178)|READ - Rectum adenocarcinoma(1;0.000617)|Colorectal(1;0.0024)														---	---	---	---	capture		Missense_Mutation	SNP	45607906	45607906	2234	22	G	T	T	40	40	C22orf9	T	1	1
MKRN2	23609	broad.mit.edu	37	3	12623706	12623706	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:12623706G>T	uc003bxd.2	+	8	1261	c.1205G>T	c.(1204-1206)GGG>GTG	p.G402V	MKRN2_uc003bxe.2_Missense_Mutation_p.G400V|MKRN2_uc011aus.1_Missense_Mutation_p.G359V	NM_014160	NP_054879	Q9H000	MKRN2_HUMAN	makorin ring finger protein 2	402						intracellular	ligase activity|nucleic acid binding|zinc ion binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	12623706	12623706	9997	3	G	T	T	43	43	MKRN2	T	2	2
RPL32	6161	broad.mit.edu	37	3	12880933	12880933	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:12880933T>C	uc003bxl.2	-	2	406	c.193A>G	c.(193-195)AAA>GAA	p.K65E	RPL32_uc003bxm.2_Missense_Mutation_p.K65E|RPL32_uc003bxn.2_Missense_Mutation_p.K65E	NM_001007074	NP_001007075	P62910	RL32_HUMAN	ribosomal protein L32	65					endocrine pancreas development|translational elongation|translational termination|viral transcription	cytosol|ribosome	protein binding|structural constituent of ribosome			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	12880933	12880933	14061	3	T	C	C	64	64	RPL32	C	4	4
EFHB	151651	broad.mit.edu	37	3	19956850	19956850	+	Silent	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:19956850T>C	uc003cbl.3	-	5	1429	c.1233A>G	c.(1231-1233)AAA>AAG	p.K411K	EFHB_uc003cbm.2_Silent_p.K281K	NM_144715	NP_653316	Q8N7U6	EFHB_HUMAN	EF hand domain family, member B	411					signal transduction	proteinaceous extracellular matrix	calcium ion binding				0																		---	---	---	---	capture		Silent	SNP	19956850	19956850	5133	3	T	C	C	56	56	EFHB	C	4	4
TGFBR2	7048	broad.mit.edu	37	3	30713559	30713559	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:30713559C>G	uc003ceo.2	+	4	1266	c.884C>G	c.(883-885)TCA>TGA	p.S295*	TGFBR2_uc003cen.2_Nonsense_Mutation_p.S320*	NM_003242	NP_003233	P37173	TGFR2_HUMAN	transforming growth factor, beta receptor II	295	Protein kinase.|Cytoplasmic (Potential).				activation of protein kinase activity|brain development|embryonic cranial skeleton morphogenesis|embryonic hemopoiesis|heart development|myeloid dendritic cell differentiation|palate development|pathway-restricted SMAD protein phosphorylation|patterning of blood vessels|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|positive regulation of B cell tolerance induction|positive regulation of mesenchymal cell proliferation|positive regulation of NK T cell differentiation|positive regulation of reactive oxygen species metabolic process|positive regulation of T cell tolerance induction|positive regulation of tolerance induction to self antigen|response to cholesterol|response to drug|transforming growth factor beta receptor signaling pathway|transforming growth factor beta receptor signaling pathway|vasculogenesis	caveola|external side of plasma membrane	ATP binding|glycosaminoglycan binding|metal ion binding|protein binding|receptor signaling protein serine/threonine kinase activity|SMAD binding|transforming growth factor beta binding|transforming growth factor beta receptor activity, type II|type I transforming growth factor beta receptor binding|type I transforming growth factor beta receptor binding|type III transforming growth factor beta receptor binding			pancreas(9)|large_intestine(6)|stomach(4)|lung(3)|ovary(3)|central_nervous_system(1)	26																		---	---	---	---	capture		Nonsense_Mutation	SNP	30713559	30713559	16350	3	C	G	G	29	29	TGFBR2	G	5	3
XYLB	9942	broad.mit.edu	37	3	38406756	38406756	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38406756C>T	uc003cic.2	+	5	467	c.358C>T	c.(358-360)CGG>TGG	p.R120W	XYLB_uc011ayp.1_5'UTR|XYLB_uc003cid.1_Missense_Mutation_p.R42W	NM_005108	NP_005099	O75191	XYLB_HUMAN	xylulokinase	120					D-xylose metabolic process|generation of precursor metabolites and energy|xylulose catabolic process		ATP binding|xylulokinase activity			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.00372)|Kidney(284;0.00405)														---	---	---	---	capture		Missense_Mutation	SNP	38406756	38406756	18045	3	C	T	T	23	23	XYLB	T	1	1
FYCO1	79443	broad.mit.edu	37	3	45965227	45965227	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:45965227G>T	uc003cpb.3	-	17	4488	c.4282C>A	c.(4282-4284)CAC>AAC	p.H1428N	FYCO1_uc011bal.1_Missense_Mutation_p.H1448N	NM_024513	NP_078789	Q9BQS8	FYCO1_HUMAN	FYVE and coiled-coil domain containing 1	1428	GOLD.				transport	integral to membrane	metal ion binding|protein binding			central_nervous_system(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.00147)|KIRC - Kidney renal clear cell carcinoma(197;0.0272)|Kidney(197;0.0323)														---	---	---	---	capture		Missense_Mutation	SNP	45965227	45965227	6376	3	G	T	T	47	47	FYCO1	T	2	2
MST1R	4486	broad.mit.edu	37	3	49928037	49928037	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49928037G>A	uc003cxy.3	-	18	3955	c.3691C>T	c.(3691-3693)CGC>TGC	p.R1231C	MST1R_uc011bdc.1_Missense_Mutation_p.R110C	NM_002447	NP_002438	Q04912	RON_HUMAN	macrophage stimulating 1 receptor precursor	1231	Cytoplasmic (Potential).|Protein kinase.				cellular component movement|defense response|multicellular organismal development|positive regulation of cell proliferation|single fertilization|transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|macrophage colony-stimulating factor receptor activity|protein binding			ovary(5)|lung(1)	6				BRCA - Breast invasive adenocarcinoma(193;4.65e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.00553)|Kidney(197;0.00625)														---	---	---	---	capture		Missense_Mutation	SNP	49928037	49928037	10284	3	G	A	A	39	39	MST1R	A	1	1
RBM6	10180	broad.mit.edu	37	3	50114516	50114516	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:50114516C>T	uc003cyc.2	+	21	3455	c.3322C>T	c.(3322-3324)CGA>TGA	p.R1108*	RBM6_uc003cyd.2_Nonsense_Mutation_p.R586*|RBM6_uc003cye.2_Nonsense_Mutation_p.R586*|RBM6_uc011bdi.1_Nonsense_Mutation_p.R450*|RBM6_uc010hld.1_Intron|RBM6_uc010hle.1_Intron|RBM6_uc010hlf.1_Intron	NM_005777	NP_005768	P78332	RBM6_HUMAN	RNA binding motif protein 6	1108					RNA processing	nucleus	DNA binding|nucleotide binding|RNA binding|zinc ion binding			ovary(2)	2				BRCA - Breast invasive adenocarcinoma(193;6.81e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.0084)|Kidney(197;0.00977)														---	---	---	---	capture		Nonsense_Mutation	SNP	50114516	50114516	13606	3	C	T	T	23	23	RBM6	T	5	1
PRKCD	5580	broad.mit.edu	37	3	53212538	53212538	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:53212538G>C	uc003dgl.2	+	3	453	c.100G>C	c.(100-102)GAG>CAG	p.E34Q	PRKCD_uc003dgm.2_Missense_Mutation_p.E34Q|PRKCD_uc003dgn.2_Missense_Mutation_p.E34Q	NM_006254	NP_006245	Q05655	KPCD_HUMAN	protein kinase C, delta	34	C2.				activation of phospholipase C activity|cellular component disassembly involved in apoptosis|cellular senescence|interferon-gamma-mediated signaling pathway|intracellular signal transduction|mRNA metabolic process|negative regulation of insulin receptor signaling pathway|negative regulation of MAP kinase activity|negative regulation of peptidyl-tyrosine phosphorylation|negative regulation of protein binding|nerve growth factor receptor signaling pathway|platelet activation|positive regulation of ceramide biosynthetic process|positive regulation of glucosylceramide catabolic process|positive regulation of protein dephosphorylation|positive regulation of sphingomyelin catabolic process|protein stabilization|regulation of receptor activity|termination of signal transduction	cytosol|endoplasmic reticulum|nucleoplasm	ATP binding|calcium-independent protein kinase C activity|enzyme activator activity|enzyme binding|insulin receptor substrate binding|metal ion binding|protein C-terminus binding			central_nervous_system(4)|lung(3)|stomach(1)|skin(1)	9		Ovarian(412;0.0728)		OV - Ovarian serous cystadenocarcinoma(275;3.58e-08)|BRCA - Breast invasive adenocarcinoma(193;0.000142)|Kidney(197;0.00153)|KIRC - Kidney renal clear cell carcinoma(197;0.00173)														---	---	---	---	capture		Missense_Mutation	SNP	53212538	53212538	12952	3	G	C	C	41	41	PRKCD	C	3	3
PDZRN3	23024	broad.mit.edu	37	3	73433611	73433611	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:73433611G>A	uc003dpl.1	-	10	2202	c.2106C>T	c.(2104-2106)ATC>ATT	p.I702I	PDZRN3_uc011bgh.1_Silent_p.I359I|PDZRN3_uc010hoe.1_Silent_p.I400I|PDZRN3_uc011bgf.1_Silent_p.I419I|PDZRN3_uc011bgg.1_Silent_p.I422I	NM_015009	NP_055824	Q9UPQ7	PZRN3_HUMAN	PDZ domain containing ring finger 3	702	Potential.						ubiquitin-protein ligase activity|zinc ion binding			pancreas(2)|ovary(2)|skin(2)|large_intestine(1)	7		Prostate(10;0.114)|Lung NSC(201;0.187)|Lung SC(41;0.236)		BRCA - Breast invasive adenocarcinoma(55;0.00041)|Epithelial(33;0.0023)|LUSC - Lung squamous cell carcinoma(21;0.0048)|Lung(16;0.0105)|KIRC - Kidney renal clear cell carcinoma(39;0.111)|Kidney(39;0.134)														---	---	---	---	capture		Silent	SNP	73433611	73433611	12130	3	G	A	A	37	37	PDZRN3	A	1	1
GPR128	84873	broad.mit.edu	37	3	100362185	100362185	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100362185G>A	uc003duc.2	+	7	1042	c.774G>A	c.(772-774)CAG>CAA	p.Q258Q	GPR128_uc011bhc.1_Intron	NM_032787	NP_116176	Q96K78	GP128_HUMAN	G protein-coupled receptor 128 precursor	258	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)|skin(1)	4																		---	---	---	---	capture		Silent	SNP	100362185	100362185	6915	3	G	A	A	36	36	GPR128	A	2	2
GPR128	84873	broad.mit.edu	37	3	100362212	100362212	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100362212G>T	uc003duc.2	+	7	1069	c.801G>T	c.(799-801)GCG>GCT	p.A267A	GPR128_uc011bhc.1_Intron	NM_032787	NP_116176	Q96K78	GP128_HUMAN	G protein-coupled receptor 128 precursor	267	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)|skin(1)	4																		---	---	---	---	capture		Silent	SNP	100362212	100362212	6915	3	G	T	T	39	39	GPR128	T	1	1
CD200	4345	broad.mit.edu	37	3	112066467	112066467	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:112066467G>T	uc003dyw.2	+	5	703	c.559G>T	c.(559-561)GCC>TCC	p.A187S	CD200_uc010hqd.1_Missense_Mutation_p.A46S|CD200_uc003dyx.2_Missense_Mutation_p.A162S|CD200_uc003dyy.2_Missense_Mutation_p.A46S|CD200_uc003dyz.2_Missense_Mutation_p.A88S	NM_001004196	NP_001004196	P41217	OX2G_HUMAN	CD200 antigen isoform b	162	Ig-like C2-type.|Extracellular (Potential).				regulation of immune response	integral to plasma membrane					0		Acute lymphoblastic leukemia(4;1.7e-08)|all_hematologic(4;8.82e-05)																---	---	---	---	capture		Missense_Mutation	SNP	112066467	112066467	3107	3	G	T	T	46	46	CD200	T	2	2
C3orf17	25871	broad.mit.edu	37	3	112724646	112724646	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:112724646T>C	uc003dzr.2	-	9	1502	c.1441A>G	c.(1441-1443)ACA>GCA	p.T481A	GTPBP8_uc011bhy.1_Intron|C3orf17_uc003dzq.2_Missense_Mutation_p.T106A|C3orf17_uc011bhz.1_Missense_Mutation_p.T106A|C3orf17_uc010hqh.2_Missense_Mutation_p.T106A|C3orf17_uc003dzt.2_Missense_Mutation_p.T384A|C3orf17_uc003dzs.2_Missense_Mutation_p.T345A|C3orf17_uc010hqg.2_Missense_Mutation_p.T306A|C3orf17_uc011bia.1_Missense_Mutation_p.T278A|C3orf17_uc003dzu.2_Missense_Mutation_p.T410A|C3orf17_uc011bib.1_Missense_Mutation_p.T370A|C3orf17_uc011bic.1_Missense_Mutation_p.T314A|C3orf17_uc011bid.1_RNA	NM_015412	NP_056227	Q6NW34	CC017_HUMAN	hypothetical protein LOC25871	481						integral to membrane					0																		---	---	---	---	capture		Missense_Mutation	SNP	112724646	112724646	2303	3	T	C	C	57	57	C3orf17	C	4	4
SIDT1	54847	broad.mit.edu	37	3	113286504	113286504	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113286504C>A	uc003eak.2	+	3	1113	c.462C>A	c.(460-462)CCC>CCA	p.P154P	SIDT1_uc011bif.1_RNA|SIDT1_uc003eaj.1_Silent_p.P154P|SIDT1_uc011big.1_5'UTR	NM_017699	NP_060169	Q9NXL6	SIDT1_HUMAN	SID1 transmembrane family, member 1 precursor	154	Extracellular (Potential).					integral to membrane				ovary(3)|pancreas(1)|skin(1)	5																		---	---	---	---	capture		Silent	SNP	113286504	113286504	14797	3	C	A	A	22	22	SIDT1	A	2	2
ZNF80	7634	broad.mit.edu	37	3	113955426	113955426	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113955426A>G	uc010hqo.2	-	1	1000	c.496T>C	c.(496-498)TGT>CGT	p.C166R	ZNF80_uc003ebf.2_RNA	NM_007136	NP_009067	P51504	ZNF80_HUMAN	zinc finger protein 80	166	C2H2-type 5.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Lung NSC(201;0.0233)|all_neural(597;0.0837)																---	---	---	---	capture		Missense_Mutation	SNP	113955426	113955426	18766	3	A	G	G	8	8	ZNF80	G	4	4
TOPBP1	11073	broad.mit.edu	37	3	133337159	133337159	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133337159G>C	uc003eps.2	-	21	3622	c.3490C>G	c.(3490-3492)CCT>GCT	p.P1164A	TOPBP1_uc003ept.1_Missense_Mutation_p.P168A	NM_007027	NP_008958	Q92547	TOPB1_HUMAN	topoisomerase (DNA) II binding protein 1	1164					DNA repair|response to ionizing radiation	microtubule organizing center|PML body|spindle pole	DNA binding|protein C-terminus binding			ovary(2)|kidney(2)|skin(1)|lung(1)|pancreas(1)	7													Other_conserved_DNA_damage_response_genes					---	---	---	---	capture		Missense_Mutation	SNP	133337159	133337159	16911	3	G	C	C	42	42	TOPBP1	C	3	3
AADACL2	344752	broad.mit.edu	37	3	151451952	151451952	+	Silent	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:151451952T>C	uc003ezc.2	+	1	249	c.129T>C	c.(127-129)TGT>TGC	p.C43C	AADACL2_uc010hvn.2_5'UTR	NM_207365	NP_997248	Q6P093	ADCL2_HUMAN	arylacetamide deacetylase-like 2 precursor	43						extracellular region|integral to membrane	carboxylesterase activity				0			LUSC - Lung squamous cell carcinoma(72;0.0394)|Lung(72;0.0813)															---	---	---	---	capture		Silent	SNP	151451952	151451952	12	3	T	C	C	57	57	AADACL2	C	4	4
PEX5L	51555	broad.mit.edu	37	3	179529630	179529630	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179529630C>T	uc003fki.1	-	11	1243	c.1113G>A	c.(1111-1113)GCG>GCA	p.A371A	PEX5L_uc011bqd.1_Silent_p.A328A|PEX5L_uc011bqe.1_Silent_p.A179A|PEX5L_uc011bqf.1_Silent_p.A263A|PEX5L_uc003fkj.1_Silent_p.A336A|PEX5L_uc010hxd.1_Silent_p.A369A|PEX5L_uc011bqg.1_Silent_p.A347A|PEX5L_uc011bqh.1_Silent_p.A312A	NM_016559	NP_057643	Q8IYB4	PEX5R_HUMAN	peroxisomal biogenesis factor 5-like	371	TPR 1.				protein import into peroxisome matrix|regulation of cAMP-mediated signaling	cytosol|peroxisomal membrane	peroxisome matrix targeting signal-1 binding			ovary(3)|large_intestine(1)	4	all_cancers(143;3.94e-14)|Ovarian(172;0.0338)|Breast(254;0.183)		OV - Ovarian serous cystadenocarcinoma(80;1.75e-26)|GBM - Glioblastoma multiforme(14;0.000518)															---	---	---	---	capture		Silent	SNP	179529630	179529630	12171	3	C	T	T	23	23	PEX5L	T	1	1
TP63	8626	broad.mit.edu	37	3	189526078	189526078	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:189526078G>T	uc003fry.2	+	4	431	c.342G>T	c.(340-342)CTG>CTT	p.L114L	TP63_uc003frx.2_Silent_p.L114L|TP63_uc003frz.2_Silent_p.L114L|TP63_uc010hzc.1_Silent_p.L114L|TP63_uc003fsa.2_Silent_p.L20L|TP63_uc003fsb.2_Silent_p.L20L|TP63_uc003fsc.2_Silent_p.L20L|TP63_uc003fsd.2_Silent_p.L20L|TP63_uc010hzd.1_Intron|TP63_uc003fse.1_5'UTR	NM_003722	NP_003713	Q9H3D4	P63_HUMAN	tumor protein p63 isoform 1	114					anti-apoptosis|cellular response to UV|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|mitotic cell cycle G1/S transition DNA damage checkpoint|negative regulation of transcription from RNA polymerase II promoter|Notch signaling pathway|positive regulation of Notch signaling pathway|protein homotetramerization|regulation of neuron apoptosis|response to gamma radiation|response to X-ray	chromatin|cytosol|dendrite|Golgi apparatus|transcription factor complex	chromatin binding|damaged DNA binding|double-stranded DNA binding|identical protein binding|metal ion binding|p53 binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			skin(5)|lung(4)|ovary(2)|upper_aerodigestive_tract(1)	12	all_cancers(143;3.35e-10)|Ovarian(172;0.0925)		Lung(62;3.33e-05)	GBM - Glioblastoma multiforme(93;0.0227)										Hay-Wells_syndrome	HNSCC(45;0.13)			---	---	---	---	capture		Silent	SNP	189526078	189526078	16936	3	G	T	T	47	47	TP63	T	2	2
GAK	2580	broad.mit.edu	37	4	861013	861013	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:861013G>T	uc003gbm.3	-	21	2802	c.2603C>A	c.(2602-2604)CCG>CAG	p.P868Q	GAK_uc003gbn.3_Missense_Mutation_p.P789Q|GAK_uc010ibk.1_Missense_Mutation_p.P762Q|GAK_uc010ibi.2_Missense_Mutation_p.P49Q|GAK_uc010ibj.2_RNA|GAK_uc003gbl.3_Missense_Mutation_p.P732Q	NM_005255	NP_005246	O14976	GAK_HUMAN	cyclin G associated kinase	868					cell cycle	focal adhesion|Golgi apparatus|perinuclear region of cytoplasm	ATP binding|heat shock protein binding|protein serine/threonine kinase activity			lung(2)|central_nervous_system(1)|skin(1)	4				Colorectal(103;0.219)														---	---	---	---	capture		Missense_Mutation	SNP	861013	861013	6459	4	G	T	T	39	39	GAK	T	1	1
EVC2	132884	broad.mit.edu	37	4	5642280	5642280	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:5642280C>A	uc003gij.2	-	10	1485	c.1431G>T	c.(1429-1431)ATG>ATT	p.M477I	EVC2_uc011bwb.1_5'UTR|EVC2_uc003gik.2_Missense_Mutation_p.M397I	NM_147127	NP_667338	Q86UK5	LBN_HUMAN	limbin	477	Potential.					integral to membrane				large_intestine(3)|ovary(2)	5																		---	---	---	---	capture		Missense_Mutation	SNP	5642280	5642280	5479	4	C	A	A	21	21	EVC2	A	2	2
ACOX3	8310	broad.mit.edu	37	4	8383231	8383231	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:8383231C>G	uc010idk.2	-	14	1786	c.1641G>C	c.(1639-1641)AGG>AGC	p.R547S	ACOX3_uc003glc.3_Missense_Mutation_p.R547S|ACOX3_uc003gld.3_Missense_Mutation_p.R547S|ACOX3_uc003gle.1_Missense_Mutation_p.R452S	NM_003501	NP_003492	O15254	ACOX3_HUMAN	acyl-Coenzyme A oxidase 3 isoform a	547					bile acid metabolic process|fatty acid beta-oxidation using acyl-CoA oxidase	peroxisomal matrix	acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding|pristanoyl-CoA oxidase activity			central_nervous_system(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	8383231	8383231	161	4	C	G	G	30	30	ACOX3	G	3	3
CLRN2	645104	broad.mit.edu	37	4	17528651	17528651	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:17528651G>C	uc003gpg.1	+	3	747	c.645G>C	c.(643-645)GAG>GAC	p.E215D		NM_001079827	NP_001073296	A0PK11	CLRN2_HUMAN	clarin 2	215						integral to membrane					0																		---	---	---	---	capture		Missense_Mutation	SNP	17528651	17528651	3696	4	G	C	C	33	33	CLRN2	C	3	3
MED28	80306	broad.mit.edu	37	4	17616413	17616413	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:17616413G>C	uc003gpi.1	+	1	148	c.136G>C	c.(136-138)GAC>CAC	p.D46H	MED28_uc003gpj.2_RNA	NM_025205	NP_079481	Q9H204	MED28_HUMAN	mediator complex subunit 28	46					regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|membrane|nucleus	actin binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	17616413	17616413	9835	4	G	C	C	41	41	MED28	C	3	3
STIM2	57620	broad.mit.edu	37	4	26921165	26921165	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:26921165A>G	uc003gsh.3	+	2	668	c.452A>G	c.(451-453)GAA>GGA	p.E151G	STIM2_uc003gsg.3_Missense_Mutation_p.E151G|STIM2_uc010iex.2_Missense_Mutation_p.E151G	NM_020860	NP_065911	Q9P246	STIM2_HUMAN	stromal interaction molecule 2	64	Extracellular (Potential).				activation of store-operated calcium channel activity|calcium ion transport|cellular calcium ion homeostasis|negative regulation of calcium ion transport via store-operated calcium channel activity	endoplasmic reticulum membrane|integral to membrane|plasma membrane	calcium channel regulator activity|calcium ion binding|protein binding			central_nervous_system(1)|skin(1)	2		Breast(46;0.0503)																---	---	---	---	capture		Missense_Mutation	SNP	26921165	26921165	15804	4	A	G	G	9	9	STIM2	G	4	4
ATP8A1	10396	broad.mit.edu	37	4	42618096	42618096	+	Splice_Site	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:42618096C>T	uc003gwr.2	-	5	596	c.364_splice	c.e5-1	p.K122_splice	ATP8A1_uc003gws.2_Splice_Site_p.K122_splice|ATP8A1_uc011byz.1_Splice_Site_p.K122_splice	NM_006095	NP_006086			ATPase, aminophospholipid transporter (APLT),						ATP biosynthetic process	chromaffin granule membrane|integral to membrane|plasma membrane	aminophospholipid transporter activity|ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|cation-transporting ATPase activity|magnesium ion binding|phospholipid-translocating ATPase activity			skin(2)|central_nervous_system(1)	3					Phosphatidylserine(DB00144)													---	---	---	---	capture		Splice_Site	SNP	42618096	42618096	1211	4	C	T	T	32	32	ATP8A1	T	5	2
ADAMTS3	9508	broad.mit.edu	37	4	73154571	73154571	+	Silent	SNP	G	A	A	rs112565530		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73154571G>A	uc003hgk.1	-	21	2983	c.2946C>T	c.(2944-2946)TGC>TGT	p.C982C		NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	982	TSP type-1 4.				collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)															---	---	---	---	capture		Silent	SNP	73154571	73154571	268	4	G	A	A	38	38	ADAMTS3	A	1	1
C4orf17	84103	broad.mit.edu	37	4	100460512	100460512	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:100460512G>T	uc003huw.2	+	7	1144	c.821G>T	c.(820-822)GGG>GTG	p.G274V	C4orf17_uc003hux.2_RNA	NM_032149	NP_115525	Q53FE4	CD017_HUMAN	hypothetical protein LOC84103	274											0				OV - Ovarian serous cystadenocarcinoma(123;2.08e-08)														---	---	---	---	capture		Missense_Mutation	SNP	100460512	100460512	2347	4	G	T	T	43	43	C4orf17	T	2	2
LARP7	51574	broad.mit.edu	37	4	113568634	113568634	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:113568634G>T	uc003iay.2	+	7	1204	c.926G>T	c.(925-927)CGA>CTA	p.R309L	LARP7_uc003iaz.2_Missense_Mutation_p.R316L|LARP7_uc003iba.2_Missense_Mutation_p.R230L|LARP7_uc003ibb.2_Missense_Mutation_p.R309L	NM_016648	NP_057732	Q4G0J3	LARP7_HUMAN	La ribonucleoprotein domain family, member 7	309	Lys-rich.				RNA processing	nucleoplasm|ribonucleoprotein complex	nucleotide binding|RNA binding			ovary(3)	3		Ovarian(17;0.0443)|Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.000603)														---	---	---	---	capture		Missense_Mutation	SNP	113568634	113568634	8956	4	G	T	T	37	37	LARP7	T	1	1
ACCN5	51802	broad.mit.edu	37	4	156757901	156757901	+	Missense_Mutation	SNP	G	T	T	rs139903903		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:156757901G>T	uc003ipe.1	-	8	1222	c.1175C>A	c.(1174-1176)CCA>CAA	p.P392Q		NM_017419	NP_059115	Q9NY37	ACCN5_HUMAN	amiloride-sensitive cation channel 5,	392	Extracellular (Potential).					integral to membrane|plasma membrane				ovary(2)|skin(1)	3	all_hematologic(180;0.24)	Renal(120;0.0458)		KIRC - Kidney renal clear cell carcinoma(143;0.0464)|Kidney(143;0.058)|COAD - Colon adenocarcinoma(41;0.141)														---	---	---	---	capture		Missense_Mutation	SNP	156757901	156757901	133	4	G	T	T	47	47	ACCN5	T	2	2
ETFDH	2110	broad.mit.edu	37	4	159620142	159620142	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:159620142G>A	uc003iqb.2	+	9	1308	c.976G>A	c.(976-978)GGT>AGT	p.G326S	ETFDH_uc011cjg.1_Missense_Mutation_p.G279S|ETFDH_uc010iqr.2_Intron|ETFDH_uc011cjh.1_Missense_Mutation_p.G265S|ETFDH_uc010iqs.2_Missense_Mutation_p.G248S	NM_004453	NP_004444	Q16134	ETFD_HUMAN	electron-transferring-flavoprotein dehydrogenase	326					fatty acid beta-oxidation using acyl-CoA dehydrogenase|respiratory electron transport chain|response to oxidative stress|transport	integral to mitochondrial inner membrane|mitochondrial matrix	4 iron, 4 sulfur cluster binding|electron carrier activity|electron-transferring-flavoprotein dehydrogenase activity|flavin adenine dinucleotide binding|metal ion binding|oxidoreductase activity, oxidizing metal ions with flavin as acceptor|ubiquinone binding			large_intestine(2)|skin(1)	3	all_hematologic(180;0.24)	Renal(120;0.0458)		COAD - Colon adenocarcinoma(41;0.0172)														---	---	---	---	capture		Missense_Mutation	SNP	159620142	159620142	5464	4	G	A	A	47	47	ETFDH	A	2	2
ADAM29	11086	broad.mit.edu	37	4	175897673	175897673	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:175897673C>A	uc003iuc.2	+	5	1667	c.997C>A	c.(997-999)CAT>AAT	p.H333N	ADAM29_uc003iud.2_Missense_Mutation_p.H333N|ADAM29_uc010irr.2_Missense_Mutation_p.H333N|ADAM29_uc011cki.1_Missense_Mutation_p.H333N	NM_014269	NP_055084	Q9UKF5	ADA29_HUMAN	ADAM metallopeptidase domain 29 preproprotein	333	Peptidase M12B.|Extracellular (Potential).				proteolysis|spermatogenesis	integral to plasma membrane	metalloendopeptidase activity|zinc ion binding			skin(5)|central_nervous_system(3)|ovary(3)|large_intestine(2)|lung(2)|pancreas(1)	16		Breast(14;0.00908)|Melanoma(52;0.00951)|Prostate(90;0.00996)|Renal(120;0.0183)|all_hematologic(60;0.107)|all_neural(102;0.164)		all cancers(43;3.08e-19)|Epithelial(43;6.24e-18)|OV - Ovarian serous cystadenocarcinoma(60;1.78e-09)|STAD - Stomach adenocarcinoma(60;0.00303)|GBM - Glioblastoma multiforme(59;0.0106)|LUSC - Lung squamous cell carcinoma(193;0.0286)														---	---	---	---	capture		Missense_Mutation	SNP	175897673	175897673	248	4	C	A	A	29	29	ADAM29	A	2	2
ADAM29	11086	broad.mit.edu	37	4	175898265	175898265	+	Missense_Mutation	SNP	G	C	C	rs148692882		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:175898265G>C	uc003iuc.2	+	5	2259	c.1589G>C	c.(1588-1590)CGT>CCT	p.R530P	ADAM29_uc003iud.2_Missense_Mutation_p.R530P|ADAM29_uc010irr.2_Missense_Mutation_p.R530P|ADAM29_uc011cki.1_Missense_Mutation_p.R530P	NM_014269	NP_055084	Q9UKF5	ADA29_HUMAN	ADAM metallopeptidase domain 29 preproprotein	530	Cys-rich.|Extracellular (Potential).				proteolysis|spermatogenesis	integral to plasma membrane	metalloendopeptidase activity|zinc ion binding			skin(5)|central_nervous_system(3)|ovary(3)|large_intestine(2)|lung(2)|pancreas(1)	16		Breast(14;0.00908)|Melanoma(52;0.00951)|Prostate(90;0.00996)|Renal(120;0.0183)|all_hematologic(60;0.107)|all_neural(102;0.164)		all cancers(43;3.08e-19)|Epithelial(43;6.24e-18)|OV - Ovarian serous cystadenocarcinoma(60;1.78e-09)|STAD - Stomach adenocarcinoma(60;0.00303)|GBM - Glioblastoma multiforme(59;0.0106)|LUSC - Lung squamous cell carcinoma(193;0.0286)														---	---	---	---	capture		Missense_Mutation	SNP	175898265	175898265	248	4	G	C	C	40	40	ADAM29	C	3	3
FAT1	2195	broad.mit.edu	37	4	187540391	187540391	+	Nonsense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187540391G>C	uc003izf.2	-	10	7537	c.7349C>G	c.(7348-7350)TCA>TGA	p.S2450*		NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	2450	Extracellular (Potential).|Cadherin 22.				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12															HNSCC(5;0.00058)			---	---	---	---	capture		Nonsense_Mutation	SNP	187540391	187540391	5925	4	G	C	C	45	45	FAT1	C	5	3
FAT1	2195	broad.mit.edu	37	4	187540705	187540705	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187540705G>A	uc003izf.2	-	10	7223	c.7035C>T	c.(7033-7035)CTC>CTT	p.L2345L		NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	2345	Extracellular (Potential).|Cadherin 21.				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12															HNSCC(5;0.00058)			---	---	---	---	capture		Silent	SNP	187540705	187540705	5925	4	G	A	A	45	45	FAT1	A	2	2
SLC12A7	10723	broad.mit.edu	37	5	1085507	1085507	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:1085507C>A	uc003jbu.2	-	7	823	c.757G>T	c.(757-759)GTG>TTG	p.V253L		NM_006598	NP_006589	Q9Y666	S12A7_HUMAN	solute carrier family 12 (potassium/chloride	253	Helical; (Potential).				potassium ion transport|sodium ion transport	integral to plasma membrane	potassium:chloride symporter activity			skin(2)|large_intestine(1)|ovary(1)	4	Lung NSC(6;2.47e-13)|all_lung(6;1.67e-12)|all_epithelial(6;5.44e-09)		Epithelial(17;0.000497)|OV - Ovarian serous cystadenocarcinoma(19;0.00239)|all cancers(22;0.00241)|Lung(60;0.165)		Potassium Chloride(DB00761)													---	---	---	---	capture		Missense_Mutation	SNP	1085507	1085507	14883	5	C	A	A	17	17	SLC12A7	A	2	2
TRIO	7204	broad.mit.edu	37	5	14297283	14297283	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:14297283G>C	uc003jff.2	+	7	1285	c.1279G>C	c.(1279-1281)GAG>CAG	p.E427Q	TRIO_uc003jfg.2_RNA|TRIO_uc011cna.1_Missense_Mutation_p.E378Q|TRIO_uc003jfh.1_Missense_Mutation_p.E76Q	NM_007118	NP_009049	O75962	TRIO_HUMAN	triple functional domain (PTPRF interacting)	427					apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|transmembrane receptor protein tyrosine phosphatase signaling pathway	cytosol	ATP binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			skin(4)|central_nervous_system(3)|ovary(3)|large_intestine(2)|stomach(2)|breast(2)|upper_aerodigestive_tract(1)|kidney(1)	18	Lung NSC(4;0.000742)																	---	---	---	---	capture		Missense_Mutation	SNP	14297283	14297283	17102	5	G	C	C	41	41	TRIO	C	3	3
TRIO	7204	broad.mit.edu	37	5	14378141	14378141	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:14378141C>A	uc003jff.2	+	20	3358	c.3352C>A	c.(3352-3354)CAA>AAA	p.Q1118K	TRIO_uc003jfg.2_RNA|TRIO_uc011cna.1_Missense_Mutation_p.Q1069K|TRIO_uc003jfh.1_Missense_Mutation_p.Q767K	NM_007118	NP_009049	O75962	TRIO_HUMAN	triple functional domain (PTPRF interacting)	1118	Spectrin 4.				apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|transmembrane receptor protein tyrosine phosphatase signaling pathway	cytosol	ATP binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			skin(4)|central_nervous_system(3)|ovary(3)|large_intestine(2)|stomach(2)|breast(2)|upper_aerodigestive_tract(1)|kidney(1)	18	Lung NSC(4;0.000742)																	---	---	---	---	capture		Missense_Mutation	SNP	14378141	14378141	17102	5	C	A	A	21	21	TRIO	A	2	2
CDH10	1008	broad.mit.edu	37	5	24488226	24488226	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:24488226C>A	uc003jgr.1	-	12	2245	c.1913G>T	c.(1912-1914)CGA>CTA	p.R638L	CDH10_uc011cnu.1_RNA	NM_006727	NP_006718	Q9Y6N8	CAD10_HUMAN	cadherin 10, type 2 preproprotein	638	Cytoplasmic (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding	p.R638Q(1)		ovary(6)|pancreas(4)|breast(2)	12				STAD - Stomach adenocarcinoma(35;0.0556)											HNSCC(23;0.051)			---	---	---	---	capture		Missense_Mutation	SNP	24488226	24488226	3225	5	C	A	A	31	31	CDH10	A	1	1
RNASEN	29102	broad.mit.edu	37	5	31429647	31429647	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31429647C>T	uc003jhg.2	-	26	3510	c.3151G>A	c.(3151-3153)GTT>ATT	p.V1051I	RNASEN_uc003jhh.2_Missense_Mutation_p.V1014I|RNASEN_uc003jhi.2_Missense_Mutation_p.V1014I	NM_013235	NP_037367	Q9NRR4	RNC_HUMAN	ribonuclease III, nuclear isoform 1	1051	Necessary for interaction with DGCR8 and pri-miRNA processing activity.|RNase III 1.				gene silencing by RNA|ribosome biogenesis|RNA processing	nucleolus|nucleoplasm	double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	31429647	31429647	13894	5	C	T	T	17	17	RNASEN	T	2	2
RANBP3L	202151	broad.mit.edu	37	5	36257555	36257555	+	Splice_Site	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:36257555C>T	uc003jkh.2	-	9	1265	c.772_splice	c.e9+1	p.R258_splice	RANBP3L_uc011cow.1_Splice_Site_p.R283_splice	NM_145000	NP_659437			RAN binding protein 3-like isoform 2						intracellular transport					ovary(1)	1	all_lung(31;4.52e-05)		Epithelial(62;0.0543)|Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|all cancers(62;0.149)|Colorectal(62;0.202)															---	---	---	---	capture		Splice_Site	SNP	36257555	36257555	13490	5	C	T	T	20	20	RANBP3L	T	5	2
HCN1	348980	broad.mit.edu	37	5	45262388	45262388	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:45262388T>C	uc003jok.2	-	8	2333	c.2308A>G	c.(2308-2310)AGC>GGC	p.S770G		NM_021072	NP_066550	O60741	HCN1_HUMAN	hyperpolarization activated cyclic	770	Cytoplasmic (Potential).					integral to membrane	cAMP binding|sodium channel activity|voltage-gated potassium channel activity			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	45262388	45262388	7278	5	T	C	C	54	54	HCN1	C	4	4
ALDH7A1	501	broad.mit.edu	37	5	125896775	125896775	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:125896775C>A	uc003ktx.2	-	10	1105	c.913G>T	c.(913-915)GCC>TCC	p.A305S	ALDH7A1_uc003ktv.2_5'UTR|ALDH7A1_uc003kty.2_RNA|ALDH7A1_uc011cxa.1_Missense_Mutation_p.A332S	NM_001182	NP_001173	P49419	AL7A1_HUMAN	aldehyde dehydrogenase 7 family, member A1	305					cellular aldehyde metabolic process|lysine catabolic process|sensory perception of sound	cytosol|mitochondrial matrix|nucleus	aldehyde dehydrogenase (NAD) activity|betaine-aldehyde dehydrogenase activity|L-aminoadipate-semialdehyde dehydrogenase activity			kidney(2)|ovary(1)	3		all_cancers(142;0.24)|Prostate(80;0.081)	KIRC - Kidney renal clear cell carcinoma(527;0.0584)|Kidney(363;0.0934)	Epithelial(69;0.0417)|OV - Ovarian serous cystadenocarcinoma(64;0.068)|all cancers(49;0.109)	NADH(DB00157)|Pyridoxine(DB00165)													---	---	---	---	capture		Missense_Mutation	SNP	125896775	125896775	507	5	C	A	A	21	21	ALDH7A1	A	2	2
ADAMTS19	171019	broad.mit.edu	37	5	129001218	129001218	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:129001218G>T	uc003kvb.1	+	16	2434	c.2434G>T	c.(2434-2436)GCT>TCT	p.A812S	ADAMTS19_uc010jdh.1_RNA	NM_133638	NP_598377	Q8TE59	ATS19_HUMAN	ADAM metallopeptidase with thrombospondin type 1	812	Spacer.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(5)|breast(2)|lung(1)|skin(1)	9		all_cancers(142;0.0148)|Prostate(80;0.0494)|Breast(839;0.238)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)	OV - Ovarian serous cystadenocarcinoma(64;0.222)														---	---	---	---	capture		Missense_Mutation	SNP	129001218	129001218	265	5	G	T	T	46	46	ADAMTS19	T	2	2
FNIP1	96459	broad.mit.edu	37	5	131008511	131008511	+	Silent	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:131008511A>G	uc003kvs.1	-	14	1768	c.1626T>C	c.(1624-1626)TTT>TTC	p.F542F	RAPGEF6_uc003kvp.1_Intron|FNIP1_uc003kvt.1_Silent_p.F514F|FNIP1_uc010jdm.1_Silent_p.F497F	NM_133372	NP_588613	Q8TF40	FNIP1_HUMAN	folliculin interacting protein 1 isoform 1	542					regulation of protein phosphorylation	cytoplasm	protein binding			pancreas(1)|skin(1)	2		all_cancers(142;0.00347)|Lung NSC(810;0.106)|all_lung(232;0.123)|Breast(839;0.198)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)	Lung(113;0.0665)														---	---	---	---	capture		Silent	SNP	131008511	131008511	6217	5	A	G	G	13	13	FNIP1	G	4	4
WNT8A	7478	broad.mit.edu	37	5	137420286	137420286	+	Missense_Mutation	SNP	A	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137420286A>T	uc003lcd.1	+	3	207	c.202A>T	c.(202-204)AAT>TAT	p.N68Y	BRD8_uc003lcc.1_Intron|WNT8A_uc011cyj.1_Missense_Mutation_p.N86Y|WNT8A_uc011cyk.1_Missense_Mutation_p.N86Y	NM_058244	NP_490645	Q9H1J5	WNT8A_HUMAN	wingless-type MMTV integration site family,	68					brain segmentation|canonical Wnt receptor signaling pathway involved in neural crest cell differentiation|cell migration involved in gastrulation|dorsal/ventral pattern formation|ectoderm development|endoderm development|eye development|hindbrain development|mesodermal cell fate commitment|negative regulation of Wnt receptor signaling pathway|neural crest cell fate commitment|neural plate pattern specification|notochord development|palate development|polarity specification of anterior/posterior axis|polarity specification of proximal/distal axis|positive regulation of fibroblast growth factor receptor signaling pathway|regulation of transcription involved in anterior/posterior axis specification|response to retinoic acid|somitogenesis|spinal cord anterior/posterior patterning|tail morphogenesis|Wnt receptor signaling pathway, calcium modulating pathway	extracellular space|plasma membrane|proteinaceous extracellular matrix	frizzled binding|signal transducer activity			ovary(1)|lung(1)|breast(1)|skin(1)	4			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0109)															---	---	---	---	capture		Missense_Mutation	SNP	137420286	137420286	17970	5	A	T	T	1	1	WNT8A	T	4	4
PCDHA2	56146	broad.mit.edu	37	5	140175262	140175262	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140175262A>G	uc003lhd.2	+	1	819	c.713A>G	c.(712-714)AAT>AGT	p.N238S	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhc.1_Missense_Mutation_p.N238S|PCDHA2_uc011czy.1_Missense_Mutation_p.N238S	NM_018905	NP_061728	Q9Y5H9	PCDA2_HUMAN	protocadherin alpha 2 isoform 1 precursor	238	Extracellular (Potential).|Cadherin 2.				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(4)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---	capture		Missense_Mutation	SNP	140175262	140175262	11944	5	A	G	G	4	4	PCDHA2	G	4	4
PCDHB4	56131	broad.mit.edu	37	5	140502911	140502911	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140502911A>G	uc003lip.1	+	1	1331	c.1331A>G	c.(1330-1332)AAT>AGT	p.N444S		NM_018938	NP_061761	Q9Y5E5	PCDB4_HUMAN	protocadherin beta 4 precursor	444	Cadherin 4.|Extracellular (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	cytoplasm|integral to plasma membrane|intermediate filament cytoskeleton	calcium ion binding			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---	capture		Missense_Mutation	SNP	140502911	140502911	11964	5	A	G	G	4	4	PCDHB4	G	4	4
PCDHB8	56128	broad.mit.edu	37	5	140558610	140558610	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140558610G>A	uc011dai.1	+	1	1181	c.995G>A	c.(994-996)TGC>TAC	p.C332Y	PCDHB16_uc003liv.2_5'Flank	NM_019120	NP_061993	Q9UN66	PCDB8_HUMAN	protocadherin beta 8 precursor	332	Cadherin 3.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			skin(4)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---	capture		Missense_Mutation	SNP	140558610	140558610	11968	5	G	A	A	46	46	PCDHB8	A	2	2
PCDHGB2	56103	broad.mit.edu	37	5	140741324	140741324	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140741324C>T	uc003ljs.1	+	1	1622	c.1622C>T	c.(1621-1623)GCG>GTG	p.A541V	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGA5_uc003lju.1_5'Flank|PCDHGB2_uc011dar.1_Missense_Mutation_p.A541V|PCDHGA5_uc011das.1_5'Flank	NM_018923	NP_061746	Q9Y5G2	PCDGE_HUMAN	protocadherin gamma subfamily B, 2 isoform 1	541	Extracellular (Potential).|Cadherin 5.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---	capture		Missense_Mutation	SNP	140741324	140741324	11983	5	C	T	T	27	27	PCDHGB2	T	1	1
KCTD16	57528	broad.mit.edu	37	5	143587013	143587013	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:143587013C>A	uc003lnm.1	+	3	1365	c.736C>A	c.(736-738)CAC>AAC	p.H246N	KCTD16_uc003lnn.1_Missense_Mutation_p.H246N	NM_020768	NP_065819	Q68DU8	KCD16_HUMAN	potassium channel tetramerisation domain	246						cell junction|postsynaptic membrane|presynaptic membrane|voltage-gated potassium channel complex	voltage-gated potassium channel activity			large_intestine(2)|ovary(1)|skin(1)	4		all_hematologic(541;0.118)	KIRC - Kidney renal clear cell carcinoma(527;0.00111)|Kidney(363;0.00176)															---	---	---	---	capture		Missense_Mutation	SNP	143587013	143587013	8409	5	C	A	A	21	21	KCTD16	A	2	2
ODZ2	57451	broad.mit.edu	37	5	167673804	167673804	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:167673804G>C	uc010jjd.2	+	27	5833	c.5833G>C	c.(5833-5835)GAG>CAG	p.E1945Q	ODZ2_uc003lzr.3_Missense_Mutation_p.E1715Q|ODZ2_uc003lzt.3_Missense_Mutation_p.E1318Q|ODZ2_uc010jje.2_Missense_Mutation_p.E1209Q	NM_001122679	NP_001116151			odz, odd Oz/ten-m homolog 2											ovary(6)|central_nervous_system(4)	10	Renal(175;0.00124)|Lung NSC(126;0.136)|all_lung(126;0.242)	Medulloblastoma(196;0.0241)|all_neural(177;0.026)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.0444)|OV - Ovarian serous cystadenocarcinoma(192;0.0694)|Epithelial(171;0.124)														---	---	---	---	capture		Missense_Mutation	SNP	167673804	167673804	11240	5	G	C	C	45	45	ODZ2	C	3	3
ODZ2	57451	broad.mit.edu	37	5	167674284	167674284	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:167674284G>T	uc010jjd.2	+	27	6313	c.6313G>T	c.(6313-6315)GTT>TTT	p.V2105F	ODZ2_uc003lzr.3_Missense_Mutation_p.V1875F|ODZ2_uc003lzt.3_Missense_Mutation_p.V1478F|ODZ2_uc010jje.2_Missense_Mutation_p.V1369F	NM_001122679	NP_001116151			odz, odd Oz/ten-m homolog 2											ovary(6)|central_nervous_system(4)	10	Renal(175;0.00124)|Lung NSC(126;0.136)|all_lung(126;0.242)	Medulloblastoma(196;0.0241)|all_neural(177;0.026)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.0444)|OV - Ovarian serous cystadenocarcinoma(192;0.0694)|Epithelial(171;0.124)														---	---	---	---	capture		Missense_Mutation	SNP	167674284	167674284	11240	5	G	T	T	40	40	ODZ2	T	1	1
RANBP17	64901	broad.mit.edu	37	5	170610401	170610401	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:170610401A>G	uc003mba.2	+	18	2021	c.2005A>G	c.(2005-2007)ACA>GCA	p.T669A	RANBP17_uc003mbb.2_5'UTR|RANBP17_uc003mbd.2_Missense_Mutation_p.T32A|RANBP17_uc010jjs.2_RNA|RANBP17_uc003mbc.2_Missense_Mutation_p.T32A	NM_022897	NP_075048	Q9H2T7	RBP17_HUMAN	RAN binding protein 17	669					mRNA transport|protein import into nucleus|transmembrane transport	cytoplasm|nuclear pore	GTP binding|protein transporter activity			ovary(2)|central_nervous_system(1)	3	Renal(175;0.000159)|Lung NSC(126;0.00751)|all_lung(126;0.0123)	Medulloblastoma(196;0.0399)|all_neural(177;0.0966)	Kidney(164;7.24e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000516)					T	TRD@	ALL								---	---	---	---	capture		Missense_Mutation	SNP	170610401	170610401	13487	5	A	G	G	6	6	RANBP17	G	4	4
BTNL9	153579	broad.mit.edu	37	5	180486679	180486679	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:180486679C>T	uc003mmt.2	+	11	1656	c.1425C>T	c.(1423-1425)CAC>CAT	p.H475H		NM_152547	NP_689760	Q6UXG8	BTNL9_HUMAN	butyrophilin-like 9 precursor	475	Cytoplasmic (Potential).|B30.2/SPRY.					integral to membrane				ovary(1)|central_nervous_system(1)	2	all_cancers(89;2.45e-05)|all_epithelial(37;3.77e-06)|Renal(175;0.000159)|Lung NSC(126;0.00211)|all_lung(126;0.00371)|Breast(19;0.114)	all_cancers(40;0.0801)|Medulloblastoma(196;0.0392)|all_neural(177;0.0529)|all_hematologic(541;0.191)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---	capture		Silent	SNP	180486679	180486679	1602	5	C	T	T	19	19	BTNL9	T	1	1
EXOC2	55770	broad.mit.edu	37	6	633008	633008	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:633008G>T	uc003mtd.2	-	3	362	c.228C>A	c.(226-228)GTC>GTA	p.V76V	EXOC2_uc003mte.2_Silent_p.V76V|EXOC2_uc011dho.1_Intron	NM_018303	NP_060773	Q96KP1	EXOC2_HUMAN	Sec5 protein	76	IPT/TIG.				exocytosis|protein transport					breast(4)|ovary(2)|pancreas(1)	7	Ovarian(93;0.0733)	Breast(5;0.0014)|all_lung(73;0.0697)|all_hematologic(90;0.0897)		OV - Ovarian serous cystadenocarcinoma(45;0.0507)|BRCA - Breast invasive adenocarcinoma(62;0.14)														---	---	---	---	capture		Silent	SNP	633008	633008	5495	6	G	T	T	45	45	EXOC2	T	2	2
HIST1H2BD	3017	broad.mit.edu	37	6	26158772	26158772	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26158772C>A	uc003ngr.2	+	1	424	c.375C>A	c.(373-375)TCC>TCA	p.S125S	HIST1H2BD_uc003ngs.2_Silent_p.S125S	NM_021063	NP_066407	P58876	H2B1D_HUMAN	histone cluster 1, H2bd	125					nucleosome assembly	nucleosome|nucleus	DNA binding			ovary(1)|pancreas(1)	2																		---	---	---	---	capture		Silent	SNP	26158772	26158772	7428	6	C	A	A	21	21	HIST1H2BD	A	2	2
ZNF391	346157	broad.mit.edu	37	6	27368656	27368656	+	Silent	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27368656A>G	uc003njf.1	+	3	1025	c.507A>G	c.(505-507)GAA>GAG	p.E169E		NM_001076781	NP_001070249	Q9UJN7	ZN391_HUMAN	zinc finger protein 391	169	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			pancreas(2)|skin(1)	3																		---	---	---	---	capture		Silent	SNP	27368656	27368656	18472	6	A	G	G	4	4	ZNF391	G	4	4
OR2B2	81697	broad.mit.edu	37	6	27879341	27879341	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27879341C>A	uc011dkw.1	-	1	757	c.757G>T	c.(757-759)GGT>TGT	p.G253C		NM_033057	NP_149046	Q9GZK3	OR2B2_HUMAN	olfactory receptor, family 2, subfamily B,	253	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	27879341	27879341	11395	6	C	A	A	21	21	OR2B2	A	2	2
GPX6	257202	broad.mit.edu	37	6	28472214	28472214	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28472214A>G	uc011dlj.1	-	6	571	c.521T>C	c.(520-522)ATG>ACG	p.M174T	GPX6_uc010jrg.1_RNA	NM_182701	NP_874360	P59796	GPX6_HUMAN	glutathione peroxidase 6 precursor	174					response to oxidative stress	extracellular region	glutathione peroxidase activity			ovary(3)|pancreas(1)|skin(1)	5					Glutathione(DB00143)													---	---	---	---	capture		Missense_Mutation	SNP	28472214	28472214	7020	6	A	G	G	8	8	GPX6	G	4	4
OR5V1	81696	broad.mit.edu	37	6	29323727	29323727	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29323727C>T	uc011dlo.1	-	1	328	c.246G>A	c.(244-246)ATG>ATA	p.M82I		NM_030876	NP_110503	Q9UGF6	OR5V1_HUMAN	olfactory receptor, family 5, subfamily V,	82	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(3)|kidney(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	29323727	29323727	11594	6	C	T	T	21	21	OR5V1	T	2	2
TRIM39	56658	broad.mit.edu	37	6	30309968	30309968	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30309968C>T	uc010jrz.2	+	9	1801	c.1489C>T	c.(1489-1491)CCA>TCA	p.P497S	TRIM39_uc003npz.2_Missense_Mutation_p.P467S|TRIM39_uc003nqb.2_Missense_Mutation_p.P467S|TRIM39_uc003nqc.2_Missense_Mutation_p.P467S|TRIM39_uc010jsa.1_Intron|RPP21_uc003nqd.1_5'Flank|RPP21_uc003nqe.1_5'Flank|RPP21_uc003nqf.1_5'Flank	NM_021253	NP_067076	Q9HCM9	TRI39_HUMAN	tripartite motif-containing 39 isoform 1	497	B30.2/SPRY.				apoptosis	cytosol|mitochondrion	identical protein binding|zinc ion binding			ovary(3)	3																		---	---	---	---	capture		Missense_Mutation	SNP	30309968	30309968	17057	6	C	T	T	22	22	TRIM39	T	2	2
C6orf136	221545	broad.mit.edu	37	6	30619146	30619146	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30619146G>A	uc003nqw.3	+	4	860	c.667G>A	c.(667-669)GAG>AAG	p.E223K	C6orf136_uc003nqx.3_Missense_Mutation_p.E404K|C6orf136_uc011dmn.1_Missense_Mutation_p.E89K	NM_001109938	NP_001103408	Q5SQH8	CF136_HUMAN	hypothetical protein LOC221545 isoform 1	223											0																		---	---	---	---	capture		Missense_Mutation	SNP	30619146	30619146	2434	6	G	A	A	45	45	C6orf136	A	2	2
CCHCR1	54535	broad.mit.edu	37	6	31112669	31112669	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31112669G>T	uc003nsr.3	-	14	1914	c.1791C>A	c.(1789-1791)TAC>TAA	p.Y597*	CCHCR1_uc011dne.1_Nonsense_Mutation_p.Y597*|CCHCR1_uc003nsq.3_Nonsense_Mutation_p.Y650*|CCHCR1_uc003nsp.3_Nonsense_Mutation_p.Y686*|CCHCR1_uc010jsk.1_Nonsense_Mutation_p.Y597*	NM_019052	NP_061925	Q8TD31	CCHCR_HUMAN	coiled-coil alpha-helical rod protein 1 isoform	597	Potential.				cell differentiation|multicellular organismal development	cytoplasm|nucleus	protein binding			skin(1)	1																		---	---	---	---	capture		Nonsense_Mutation	SNP	31112669	31112669	3002	6	G	T	T	40	40	CCHCR1	T	5	1
SKIV2L	6499	broad.mit.edu	37	6	31936487	31936487	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31936487C>T	uc003nyn.1	+	25	3483	c.3094C>T	c.(3094-3096)CAG>TAG	p.Q1032*	SKIV2L_uc011dou.1_Nonsense_Mutation_p.Q874*|SKIV2L_uc011dov.1_Nonsense_Mutation_p.Q839*|STK19_uc003nyt.2_5'Flank	NM_006929	NP_008860	Q15477	SKIV2_HUMAN	superkiller viralicidic activity 2-like homolog	1032						nucleus	ATP binding|ATP-dependent RNA helicase activity|protein binding|RNA binding			ovary(1)|large_intestine(1)|breast(1)|central_nervous_system(1)	4																		---	---	---	---	capture		Nonsense_Mutation	SNP	31936487	31936487	14854	6	C	T	T	25	25	SKIV2L	T	5	2
TNXB	7148	broad.mit.edu	37	6	32032739	32032739	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32032739G>T	uc003nzl.2	-	19	6902	c.6700C>A	c.(6700-6702)CAG>AAG	p.Q2234K		NM_019105	NP_061978	P22105	TENX_HUMAN	tenascin XB isoform 1 precursor	2306	Fibronectin type-III 15.				actin cytoskeleton organization|cell adhesion|collagen metabolic process|elastic fiber assembly|signal transduction	extracellular space|intracellular|proteinaceous extracellular matrix	heparin binding|integrin binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	32032739	32032739	16887	6	G	T	T	46	46	TNXB	T	2	2
TNXB	7148	broad.mit.edu	37	6	32037522	32037522	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32037522G>A	uc003nzl.2	-	15	5597	c.5395C>T	c.(5395-5397)CCT>TCT	p.P1799S		NM_019105	NP_061978	P22105	TENX_HUMAN	tenascin XB isoform 1 precursor	1881	Fibronectin type-III 11.				actin cytoskeleton organization|cell adhesion|collagen metabolic process|elastic fiber assembly|signal transduction	extracellular space|intracellular|proteinaceous extracellular matrix	heparin binding|integrin binding				0																		---	---	---	---	capture		Missense_Mutation	SNP	32037522	32037522	16887	6	G	A	A	43	43	TNXB	A	2	2
EGFL8	80864	broad.mit.edu	37	6	32134946	32134946	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32134946C>A	uc003oab.1	+	6	571	c.513C>A	c.(511-513)CCC>CCA	p.P171P	PPT2_uc003nzy.1_RNA|EGFL8_uc003oac.1_Silent_p.P171P	NM_030652	NP_085155	Q99944	EGFL8_HUMAN	NG3 protein precursor	171	EGF-like 2; calcium-binding (Potential).					extracellular region|integral to membrane	calcium ion binding				0																		---	---	---	---	capture		Silent	SNP	32134946	32134946	5154	6	C	A	A	22	22	EGFL8	A	2	2
C6orf10	10665	broad.mit.edu	37	6	32260883	32260883	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32260883C>A	uc011dpy.1	-	12	1740	c.1567G>T	c.(1567-1569)GGT>TGT	p.G523C	C6orf10_uc011dpx.1_Intron	NM_006781	NP_006772	Q5SRN2	CF010_HUMAN	chromosome 6 open reading frame 10	523	Lys-rich.					integral to membrane				skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	32260883	32260883	2418	6	C	A	A	24	24	C6orf10	A	2	2
KIAA0240	23506	broad.mit.edu	37	6	42797822	42797822	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42797822C>A	uc003osn.1	+	6	1902	c.1751C>A	c.(1750-1752)TCT>TAT	p.S584Y	KIAA0240_uc003osm.1_Missense_Mutation_p.S584Y|KIAA0240_uc011duw.1_Missense_Mutation_p.S584Y|KIAA0240_uc003oso.1_Missense_Mutation_p.S584Y|KIAA0240_uc003osp.1_Missense_Mutation_p.S584Y	NM_015349	NP_056164	Q6AI39	K0240_HUMAN	hypothetical protein LOC23506	584										ovary(1)	1	Colorectal(47;0.196)		Colorectal(64;0.00237)|COAD - Colon adenocarcinoma(64;0.00473)|all cancers(41;0.00524)|KIRC - Kidney renal clear cell carcinoma(15;0.02)|Kidney(15;0.0388)|OV - Ovarian serous cystadenocarcinoma(102;0.104)															---	---	---	---	capture		Missense_Mutation	SNP	42797822	42797822	8471	6	C	A	A	32	32	KIAA0240	A	2	2
ABCC10	89845	broad.mit.edu	37	6	43413575	43413575	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43413575G>T	uc003ouy.1	+	15	3484	c.3269G>T	c.(3268-3270)CGG>CTG	p.R1090L	ABCC10_uc003ouz.1_Missense_Mutation_p.R1062L|ABCC10_uc010jyo.1_Missense_Mutation_p.R196L	NM_033450	NP_258261	Q5T3U5	MRP7_HUMAN	ATP-binding cassette, sub-family C, member 10	1090	ABC transmembrane type-1 2.					integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(6)|central_nervous_system(1)	7	all_lung(25;0.00536)		Colorectal(64;0.00245)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.0152)|OV - Ovarian serous cystadenocarcinoma(102;0.0804)															---	---	---	---	capture		Missense_Mutation	SNP	43413575	43413575	51	6	G	T	T	39	39	ABCC10	T	1	1
SLC29A1	2030	broad.mit.edu	37	6	44201226	44201226	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44201226G>T	uc003owu.1	+	13	1661	c.1332G>T	c.(1330-1332)CTG>CTT	p.L444L	SLC29A1_uc003owv.1_Silent_p.L444L|SLC29A1_uc003oww.1_Silent_p.L523L|SLC29A1_uc003owx.1_Silent_p.L444L|SLC29A1_uc003owy.1_Silent_p.L444L|SLC29A1_uc003owz.1_Silent_p.L444L	NM_004955	NP_004946	Q99808	S29A1_HUMAN	equilibrative nucleoside transporter 1	444	Helical; (Potential).				nucleobase, nucleoside and nucleotide metabolic process	apical plasma membrane|basolateral plasma membrane|integral to plasma membrane|membrane fraction	nucleoside transmembrane transporter activity|protein binding			large_intestine(2)|skin(1)	3	all_cancers(18;3.19e-06)|Lung NSC(15;0.00108)|all_lung(25;0.00278)|Hepatocellular(11;0.00908)|Ovarian(13;0.0273)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)		Troglitazone(DB00197)													---	---	---	---	capture		Silent	SNP	44201226	44201226	15031	6	G	T	T	47	47	SLC29A1	T	2	2
GPR115	221393	broad.mit.edu	37	6	47682138	47682138	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47682138C>A	uc003oza.1	+	6	1415	c.1157C>A	c.(1156-1158)TCT>TAT	p.S386Y	GPR115_uc003oyz.1_Missense_Mutation_p.S443Y|GPR115_uc003ozb.1_Missense_Mutation_p.S384Y	NM_153838	NP_722580	Q8IZF3	GP115_HUMAN	G-protein coupled receptor 115 precursor	386	GPS.|Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)|skin(3)|upper_aerodigestive_tract(1)|breast(1)	8																		---	---	---	---	capture		Missense_Mutation	SNP	47682138	47682138	6906	6	C	A	A	32	32	GPR115	A	2	2
CRISP1	167	broad.mit.edu	37	6	49803029	49803029	+	Nonstop_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49803029C>A	uc003ozw.2	-	8	829	c.750G>T	c.(748-750)TAG>TAT	p.*250Y	CRISP1_uc003ozx.2_3'UTR	NM_001131	NP_001122	P54107	CRIS1_HUMAN	acidic epididymal glycoprotein-like 1 isoform 1	250					fusion of sperm to egg plasma membrane	extracellular space					0	Lung NSC(77;0.0358)																	---	---	---	---	capture		Nonstop_Mutation	SNP	49803029	49803029	4018	6	C	A	A	24	24	CRISP1	A	5	2
PKHD1	5314	broad.mit.edu	37	6	51890834	51890834	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51890834G>T	uc003pah.1	-	32	4050	c.3774C>A	c.(3772-3774)CCC>CCA	p.P1258P	PKHD1_uc003pai.2_Silent_p.P1258P	NM_138694	NP_619639	P08F94	PKHD1_HUMAN	fibrocystin isoform 1	1258	Extracellular (Potential).|IPT/TIG 7.				cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity			lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)																	---	---	---	---	capture		Silent	SNP	51890834	51890834	12396	6	G	T	T	39	39	PKHD1	T	1	1
C6orf142	90523	broad.mit.edu	37	6	54095515	54095515	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:54095515G>T	uc003pcg.3	+	11	1230	c.1117G>T	c.(1117-1119)GTA>TTA	p.V373L	C6orf142_uc003pch.3_Intron|C6orf142_uc011dxa.1_Missense_Mutation_p.V908L	NM_138569	NP_612636	Q5VWP3	MLIP_HUMAN	hypothetical protein LOC90523	373						nuclear envelope|PML body	protein binding				0	Lung NSC(77;0.0317)																	---	---	---	---	capture		Missense_Mutation	SNP	54095515	54095515	2437	6	G	T	T	48	48	C6orf142	T	2	2
BMP5	653	broad.mit.edu	37	6	55739374	55739374	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:55739374G>T	uc003pcq.2	-	1	1002	c.290C>A	c.(289-291)TCG>TAG	p.S97*	BMP5_uc011dxf.1_Nonsense_Mutation_p.S97*	NM_021073	NP_066551	P22003	BMP5_HUMAN	bone morphogenetic protein 5 preproprotein	97					cartilage development|cell differentiation|growth|ossification	extracellular space	BMP receptor binding|cytokine activity|growth factor activity			ovary(2)	2	Lung NSC(77;0.0462)		LUSC - Lung squamous cell carcinoma(124;0.181)															---	---	---	---	capture		Nonsense_Mutation	SNP	55739374	55739374	1488	6	G	T	T	37	37	BMP5	T	5	1
ZNF451	26036	broad.mit.edu	37	6	57012894	57012894	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:57012894C>A	uc003pdm.1	+	10	2235	c.2011C>A	c.(2011-2013)CTT>ATT	p.L671I	ZNF451_uc003pdl.2_Missense_Mutation_p.L671I|ZNF451_uc003pdn.1_Missense_Mutation_p.L671I|uc003pdq.1_Intron|ZNF451_uc003pdk.1_Missense_Mutation_p.L671I	NM_001031623	NP_001026794	Q9Y4E5	ZN451_HUMAN	zinc finger protein 451 isoform 1	671	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)|pancreas(1)	2	Lung NSC(77;0.145)		LUSC - Lung squamous cell carcinoma(124;0.0785)|Lung(124;0.13)															---	---	---	---	capture		Missense_Mutation	SNP	57012894	57012894	18515	6	C	A	A	28	28	ZNF451	A	2	2
ZNF451	26036	broad.mit.edu	37	6	57012976	57012976	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:57012976C>G	uc003pdm.1	+	10	2317	c.2093C>G	c.(2092-2094)TCA>TGA	p.S698*	ZNF451_uc003pdl.2_Nonsense_Mutation_p.S698*|ZNF451_uc003pdn.1_Nonsense_Mutation_p.S698*|uc003pdq.1_Intron|ZNF451_uc003pdk.1_Nonsense_Mutation_p.S698*	NM_001031623	NP_001026794	Q9Y4E5	ZN451_HUMAN	zinc finger protein 451 isoform 1	698					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)|pancreas(1)	2	Lung NSC(77;0.145)		LUSC - Lung squamous cell carcinoma(124;0.0785)|Lung(124;0.13)															---	---	---	---	capture		Nonsense_Mutation	SNP	57012976	57012976	18515	6	C	G	G	29	29	ZNF451	G	5	3
COL19A1	1310	broad.mit.edu	37	6	70847580	70847580	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70847580G>A	uc003pfc.1	+	19	1504	c.1387G>A	c.(1387-1389)GAA>AAA	p.E463K	COL19A1_uc010kam.1_Missense_Mutation_p.E359K	NM_001858	NP_001849	Q14993	COJA1_HUMAN	alpha 1 type XIX collagen precursor	463	Triple-helical region 3 (COL3).				cell differentiation|cell-cell adhesion|extracellular matrix organization|skeletal system development	collagen	extracellular matrix structural constituent|protein binding, bridging			ovary(2)|breast(2)	4																		---	---	---	---	capture		Missense_Mutation	SNP	70847580	70847580	3814	6	G	A	A	45	45	COL19A1	A	2	2
IMPG1	3617	broad.mit.edu	37	6	76728524	76728524	+	Missense_Mutation	SNP	C	A	A	rs139136879	byFrequency;by1000genomes	TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76728524C>A	uc003pik.1	-	7	848	c.718G>T	c.(718-720)GTC>TTC	p.V240F		NM_001563	NP_001554	Q17R60	IMPG1_HUMAN	interphotoreceptor matrix proteoglycan 1	240	SEA 1.				visual perception	proteinaceous extracellular matrix	extracellular matrix structural constituent|receptor activity			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(125;0.0418)|all_hematologic(105;0.222)																---	---	---	---	capture		Missense_Mutation	SNP	76728524	76728524	8029	6	C	A	A	19	19	IMPG1	A	1	1
DOPEY1	23033	broad.mit.edu	37	6	83839921	83839921	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:83839921G>C	uc003pjs.1	+	17	2681	c.2421G>C	c.(2419-2421)CAG>CAC	p.Q807H	DOPEY1_uc011dyy.1_Missense_Mutation_p.Q798H|DOPEY1_uc010kbl.1_Missense_Mutation_p.Q798H	NM_015018	NP_055833	Q5JWR5	DOP1_HUMAN	dopey family member 1	807					protein transport					ovary(2)|breast(1)|central_nervous_system(1)	4		all_cancers(76;2.29e-06)|Acute lymphoblastic leukemia(125;3.41e-06)|all_hematologic(105;0.000865)|all_epithelial(107;0.00203)		BRCA - Breast invasive adenocarcinoma(397;0.053)														---	---	---	---	capture		Missense_Mutation	SNP	83839921	83839921	4891	6	G	C	C	33	33	DOPEY1	C	3	3
SNAP91	9892	broad.mit.edu	37	6	84417613	84417613	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:84417613C>A	uc011dze.1	-	2	351	c.34G>T	c.(34-36)GCC>TCC	p.A12S	SNAP91_uc003pkb.2_5'UTR|SNAP91_uc003pkc.2_Missense_Mutation_p.A12S|SNAP91_uc003pkd.2_Missense_Mutation_p.A12S|SNAP91_uc003pka.2_Missense_Mutation_p.A12S|SNAP91_uc011dzf.1_5'UTR	NM_014841	NP_055656	O60641	AP180_HUMAN	synaptosomal-associated protein, 91kDa homolog	12					clathrin coat assembly	clathrin coat|coated pit|plasma membrane	1-phosphatidylinositol binding|clathrin binding			ovary(1)	1		all_cancers(76;0.000243)|Acute lymphoblastic leukemia(125;2.91e-07)|all_hematologic(105;0.000337)|all_epithelial(107;0.0575)		BRCA - Breast invasive adenocarcinoma(397;0.0967)														---	---	---	---	capture		Missense_Mutation	SNP	84417613	84417613	15333	6	C	A	A	27	27	SNAP91	A	1	1
TBX18	9096	broad.mit.edu	37	6	85472385	85472385	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:85472385G>A	uc003pkl.1	-	2	374	c.374C>T	c.(373-375)TCC>TTC	p.S125F	TBX18_uc010kbq.1_5'UTR	NM_001080508	NP_001073977	O95935	TBX18_HUMAN	T-box 18	125					multicellular organismal development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)|pancreas(2)|lung(1)	5		all_cancers(76;0.000283)|Acute lymphoblastic leukemia(125;3.66e-08)|all_hematologic(105;8.61e-05)|all_epithelial(107;0.0858)		BRCA - Breast invasive adenocarcinoma(108;0.0267)														---	---	---	---	capture		Missense_Mutation	SNP	85472385	85472385	16179	6	G	A	A	41	41	TBX18	A	2	2
RRAGD	58528	broad.mit.edu	37	6	90097269	90097269	+	Silent	SNP	C	A	A	rs142842793	by1000genomes	TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90097269C>A	uc003pnd.3	-	2	472	c.189G>T	c.(187-189)CCG>CCT	p.P63P	RRAGD_uc010kcc.2_Intron	NM_021244	NP_067067	Q9NQL2	RRAGD_HUMAN	Ras-related GTP binding D	63					cellular protein localization|cellular response to amino acid stimulus|positive regulation of TOR signaling cascade	lysosome|nucleus	GTP binding|protein heterodimerization activity			ovary(2)|central_nervous_system(1)	3		all_cancers(76;7.01e-07)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00139)		BRCA - Breast invasive adenocarcinoma(108;0.0144)														---	---	---	---	capture		Silent	SNP	90097269	90097269	14155	6	C	A	A	31	31	RRAGD	A	1	1
FUT9	10690	broad.mit.edu	37	6	96651208	96651208	+	Missense_Mutation	SNP	T	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:96651208T>G	uc003pop.3	+	3	518	c.177T>G	c.(175-177)GAT>GAG	p.D59E		NM_006581	NP_006572	Q9Y231	FUT9_HUMAN	fucosyltransferase 9 (alpha (1,3)	59	Lumenal (Potential).				L-fucose catabolic process|protein glycosylation	Golgi cisterna membrane|integral to membrane	alpha(1,3)-fucosyltransferase activity			skin(4)|ovary(1)	5		all_cancers(76;4.77e-07)|Acute lymphoblastic leukemia(125;4.01e-09)|all_hematologic(75;1.25e-06)|all_epithelial(107;0.00279)|Colorectal(196;0.0356)		BRCA - Breast invasive adenocarcinoma(108;0.08)														---	---	---	---	capture		Missense_Mutation	SNP	96651208	96651208	6362	6	T	G	G	52	52	FUT9	G	4	4
MCHR2	84539	broad.mit.edu	37	6	100403844	100403844	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:100403844T>C	uc003pqh.1	-	2	495	c.180A>G	c.(178-180)ATA>ATG	p.I60M	MCHR2_uc003pqi.1_Missense_Mutation_p.I60M	NM_001040179	NP_001035269	Q969V1	MCHR2_HUMAN	melanin-concentrating hormone receptor 2	60	Helical; Name=1; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(3)|ovary(2)|breast(1)|central_nervous_system(1)|skin(1)	8		all_cancers(76;4.87e-05)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0309)|Colorectal(196;0.069)		BRCA - Breast invasive adenocarcinoma(108;0.0429)														---	---	---	---	capture		Missense_Mutation	SNP	100403844	100403844	9772	6	T	C	C	61	61	MCHR2	C	4	4
QRSL1	55278	broad.mit.edu	37	6	107103556	107103556	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:107103556A>G	uc003prm.2	+	9	1225	c.1109A>G	c.(1108-1110)AAT>AGT	p.N370S		NM_018292	NP_060762	Q9H0R6	QRSL1_HUMAN	glutaminyl-tRNA synthase	370					translation		ATP binding|carbon-nitrogen ligase activity, with glutamine as amido-N-donor				0	Breast(9;0.0107)|all_epithelial(6;0.14)	all_cancers(87;0.00768)|Acute lymphoblastic leukemia(125;2.27e-07)|all_hematologic(75;1.38e-05)|all_epithelial(87;0.248)	Epithelial(6;0.000334)|all cancers(7;0.00157)|BRCA - Breast invasive adenocarcinoma(8;0.00721)|OV - Ovarian serous cystadenocarcinoma(5;0.0152)	BRCA - Breast invasive adenocarcinoma(108;0.118)|all cancers(137;0.167)|Epithelial(106;0.176)														---	---	---	---	capture		Missense_Mutation	SNP	107103556	107103556	13339	6	A	G	G	4	4	QRSL1	G	4	4
PDSS2	57107	broad.mit.edu	37	6	107475972	107475972	+	Nonsense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:107475972T>A	uc003prt.2	-	8	1341	c.1051A>T	c.(1051-1053)AGA>TGA	p.R351*	PDSS2_uc011eak.1_Nonsense_Mutation_p.R215*|PDSS2_uc011eal.1_Nonsense_Mutation_p.R249*	NM_020381	NP_065114	Q86YH6	DLP1_HUMAN	prenyl diphosphate synthase, subunit 2	351					isoprenoid biosynthetic process|ubiquinone biosynthetic process	mitochondrion	protein heterodimerization activity			ovary(2)	2	Breast(9;0.0127)	all_cancers(87;3.63e-05)|Acute lymphoblastic leukemia(125;2.86e-08)|all_hematologic(75;1.14e-06)|all_epithelial(87;0.0108)|Colorectal(196;0.156)|Lung NSC(302;0.211)	BRCA - Breast invasive adenocarcinoma(8;0.0101)|all cancers(7;0.243)	BRCA - Breast invasive adenocarcinoma(108;0.112)|OV - Ovarian serous cystadenocarcinoma(136;0.173)|all cancers(137;0.191)														---	---	---	---	capture		Nonsense_Mutation	SNP	107475972	107475972	12115	6	T	A	A	56	56	PDSS2	A	5	4
C6orf182	285753	broad.mit.edu	37	6	109484003	109484003	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:109484003G>T	uc010kdk.2	+	13	1790	c.1213G>T	c.(1213-1215)GGT>TGT	p.G405C	C6orf182_uc003psx.3_3'UTR|C6orf182_uc010kdl.2_Missense_Mutation_p.G405C|C6orf182_uc003psy.3_Missense_Mutation_p.G405C	NM_001083535	NP_001077004	Q8IYX8	CE57L_HUMAN	hypothetical protein LOC285753	405						microtubule|microtubule organizing center					0		all_cancers(87;4.45e-07)|Acute lymphoblastic leukemia(125;2.15e-10)|all_hematologic(75;3.25e-08)|all_epithelial(87;0.000254)|Colorectal(196;0.0293)|all_lung(197;0.11)		BRCA - Breast invasive adenocarcinoma(108;0.00123)|Epithelial(106;0.0022)|all cancers(137;0.00405)|OV - Ovarian serous cystadenocarcinoma(136;0.0233)														---	---	---	---	capture		Missense_Mutation	SNP	109484003	109484003	2451	6	G	T	T	35	35	C6orf182	T	2	2
GPR6	2830	broad.mit.edu	37	6	110301392	110301392	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:110301392C>A	uc011eaw.1	+	2	1257	c.1077C>A	c.(1075-1077)CCC>CCA	p.P359P	GPR6_uc011eav.1_Silent_p.P374P|GPR6_uc003ptu.2_Silent_p.P359P	NM_005284	NP_005275	P46095	GPR6_HUMAN	G protein-coupled receptor 6	359	Cytoplasmic (Potential).					integral to plasma membrane					0		all_cancers(87;1.64e-05)|Acute lymphoblastic leukemia(125;2.66e-08)|all_hematologic(75;1.13e-06)|all_epithelial(87;2.83e-05)|all_lung(197;0.00016)|Lung NSC(302;0.000318)|Colorectal(196;0.0488)		BRCA - Breast invasive adenocarcinoma(108;8.01e-05)|Epithelial(106;8.76e-05)|all cancers(137;0.000197)|OV - Ovarian serous cystadenocarcinoma(136;0.0307)														---	---	---	---	capture		Silent	SNP	110301392	110301392	6976	6	C	A	A	21	21	GPR6	A	2	2
CDK19	23097	broad.mit.edu	37	6	110953347	110953347	+	Nonsense_Mutation	SNP	T	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:110953347T>A	uc003puh.1	-	6	605	c.532A>T	c.(532-534)AGA>TGA	p.R178*	CDK19_uc003pui.1_Nonsense_Mutation_p.R118*|CDK19_uc011eax.1_Nonsense_Mutation_p.R54*	NM_015076	NP_055891	Q9BWU1	CDK19_HUMAN	cell division cycle 2-like 6 (CDK8-like)	178	Protein kinase.						ATP binding|cyclin-dependent protein kinase activity|protein binding			ovary(2)|central_nervous_system(1)|skin(1)	4																		---	---	---	---	capture		Nonsense_Mutation	SNP	110953347	110953347	3264	6	T	A	A	55	55	CDK19	A	5	4
LAMA4	3910	broad.mit.edu	37	6	112496574	112496574	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112496574C>A	uc003pvu.2	-	11	1607	c.1298G>T	c.(1297-1299)CGT>CTT	p.R433L	LAMA4_uc003pvv.2_Missense_Mutation_p.R426L|LAMA4_uc003pvt.2_Missense_Mutation_p.R426L	NM_001105206	NP_001098676	Q16363	LAMA4_HUMAN	laminin, alpha 4 isoform 1 precursor	433	Domain II and I.				cell adhesion|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	extracellular matrix structural constituent|receptor binding			ovary(4)|breast(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	9		all_cancers(87;0.000196)|all_hematologic(75;0.000114)|all_epithelial(87;0.00542)|Colorectal(196;0.0209)		all cancers(137;0.0335)|OV - Ovarian serous cystadenocarcinoma(136;0.0578)|Epithelial(106;0.0748)|BRCA - Breast invasive adenocarcinoma(108;0.242)														---	---	---	---	capture		Missense_Mutation	SNP	112496574	112496574	8931	6	C	A	A	19	19	LAMA4	A	1	1
RSPO3	84870	broad.mit.edu	37	6	127517050	127517050	+	Missense_Mutation	SNP	A	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:127517050A>C	uc003qar.2	+	5	1007	c.717A>C	c.(715-717)GAA>GAC	p.E239D	RSPO3_uc003qas.1_Missense_Mutation_p.E239D	NM_032784	NP_116173	Q9BXY4	RSPO3_HUMAN	R-spondin 3 precursor	239						extracellular region	heparin binding				0				GBM - Glioblastoma multiforme(226;0.0555)														---	---	---	---	capture		Missense_Mutation	SNP	127517050	127517050	14191	6	A	C	C	4	4	RSPO3	C	4	4
LAMA2	3908	broad.mit.edu	37	6	129785527	129785527	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:129785527C>G	uc003qbn.2	+	49	7190	c.7085C>G	c.(7084-7086)TCC>TGC	p.S2362C	LAMA2_uc003qbo.2_Missense_Mutation_p.S2362C	NM_000426	NP_000417	P24043	LAMA2_HUMAN	laminin alpha 2 subunit isoform a precursor	2362	Laminin G-like 2.				cell adhesion|muscle organ development|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	receptor binding|structural molecule activity			ovary(8)|breast(1)|skin(1)	10				OV - Ovarian serous cystadenocarcinoma(136;0.178)|all cancers(137;0.245)														---	---	---	---	capture		Missense_Mutation	SNP	129785527	129785527	8929	6	C	G	G	30	30	LAMA2	G	3	3
TCF21	6943	broad.mit.edu	37	6	134210701	134210701	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:134210701C>A	uc003qei.3	+	1	442	c.166C>A	c.(166-168)CTG>ATG	p.L56M	uc003qeg.1_5'Flank|TCF21_uc003qej.2_Missense_Mutation_p.L56M	NM_003206	NP_003197	O43680	TCF21_HUMAN	transcription factor 21	56					branching involved in ureteric bud morphogenesis|mesoderm development|negative regulation of androgen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent	nucleus	androgen receptor binding|E-box binding|protein dimerization activity|sequence-specific DNA binding transcription factor activity				0	Colorectal(23;0.221)|Breast(56;0.247)			GBM - Glioblastoma multiforme(68;0.00518)|OV - Ovarian serous cystadenocarcinoma(155;0.00783)														---	---	---	---	capture		Missense_Mutation	SNP	134210701	134210701	16217	6	C	A	A	24	24	TCF21	A	2	2
UTRN	7402	broad.mit.edu	37	6	144769802	144769802	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144769802C>T	uc003qkt.2	+	16	2061	c.1969C>T	c.(1969-1971)CGT>TGT	p.R657C	UTRN_uc010khq.1_Missense_Mutation_p.R657C	NM_007124	NP_009055	P46939	UTRO_HUMAN	utrophin	657	Interaction with SYNM.				muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)														---	---	---	---	capture		Missense_Mutation	SNP	144769802	144769802	17668	6	C	T	T	31	31	UTRN	T	1	1
CCR6	1235	broad.mit.edu	37	6	167549917	167549917	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:167549917G>T	uc003qvl.2	+	13	2675	c.199G>T	c.(199-201)GTG>TTG	p.V67L	CCR6_uc010kkm.2_Missense_Mutation_p.V67L|CCR6_uc003qvn.3_Missense_Mutation_p.V67L|CCR6_uc003qvm.3_Missense_Mutation_p.V67L	NM_031409	NP_113597	P51684	CCR6_HUMAN	chemokine (C-C motif) receptor 6	67	Helical; Name=1; (Potential).				cellular defense response|dendritic cell chemotaxis|elevation of cytosolic calcium ion concentration|humoral immune response	integral to plasma membrane	C-C chemokine receptor activity			ovary(1)	1		Breast(66;1.53e-05)|Ovarian(120;0.0606)		OV - Ovarian serous cystadenocarcinoma(33;8.21e-20)|BRCA - Breast invasive adenocarcinoma(81;4.55e-06)|GBM - Glioblastoma multiforme(31;0.00507)														---	---	---	---	capture		Missense_Mutation	SNP	167549917	167549917	3072	6	G	T	T	44	44	CCR6	T	2	2
C7orf27	221927	broad.mit.edu	37	7	2577959	2577959	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2577959C>A	uc003smi.2	-	14	2252	c.2210G>T	c.(2209-2211)CGG>CTG	p.R737L	C7orf27_uc003smh.3_Missense_Mutation_p.R169L	NM_152743	NP_689956	Q6PJG6	BRAT1_HUMAN	hypothetical protein LOC221927 precursor	737					response to ionizing radiation	nucleus	protein binding				0		Ovarian(82;0.0779)		OV - Ovarian serous cystadenocarcinoma(56;2.91e-14)														---	---	---	---	capture		Missense_Mutation	SNP	2577959	2577959	2489	7	C	A	A	23	23	C7orf27	A	1	1
HDAC9	9734	broad.mit.edu	37	7	18631171	18631171	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:18631171C>A	uc003suh.2	+	4	480	c.439C>A	c.(439-441)CTT>ATT	p.L147I	HDAC9_uc003sue.2_Missense_Mutation_p.L147I|HDAC9_uc011jyd.1_Missense_Mutation_p.L147I|HDAC9_uc003sui.2_Missense_Mutation_p.L150I|HDAC9_uc003suj.2_Missense_Mutation_p.L150I|HDAC9_uc011jya.1_Missense_Mutation_p.L188I|HDAC9_uc003sua.1_Missense_Mutation_p.L169I|HDAC9_uc011jyb.1_Missense_Mutation_p.L147I|HDAC9_uc003sud.1_Missense_Mutation_p.L147I|HDAC9_uc011jyc.1_Missense_Mutation_p.L150I|HDAC9_uc003suf.1_Missense_Mutation_p.L178I|HDAC9_uc010kud.1_Missense_Mutation_p.L150I|HDAC9_uc011jye.1_Missense_Mutation_p.L119I|HDAC9_uc011jyf.1_Missense_Mutation_p.L116I|HDAC9_uc010kue.1_5'UTR	NM_058176	NP_478056	Q9UKV0	HDAC9_HUMAN	histone deacetylase 9 isoform 1	147	Interaction with MEF2 (By similarity).				B cell differentiation|cellular response to insulin stimulus|heart development|histone H3 deacetylation|histone H4 deacetylation|inflammatory response|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|peptidyl-lysine deacetylation|positive regulation of cell migration involved in sprouting angiogenesis|regulation of skeletal muscle fiber development|transcription, DNA-dependent	cytoplasm|histone deacetylase complex|histone methyltransferase complex|transcription factor complex	histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|histone deacetylase binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|protein binding|protein kinase C binding|repressing transcription factor binding|transcription corepressor activity			lung(2)|central_nervous_system(2)|kidney(1)	5	all_lung(11;0.187)				Valproic Acid(DB00313)													---	---	---	---	capture		Missense_Mutation	SNP	18631171	18631171	7297	7	C	A	A	28	28	HDAC9	A	2	2
AMPH	273	broad.mit.edu	37	7	38471795	38471795	+	Silent	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:38471795T>C	uc003tgu.2	-	13	1221	c.1152A>G	c.(1150-1152)CTA>CTG	p.L384L	AMPH_uc003tgv.2_Silent_p.L384L|AMPH_uc003tgt.2_Silent_p.L137L|AMPH_uc003tgw.1_5'Flank|AMPH_uc010kxl.1_5'Flank	NM_001635	NP_001626	P49418	AMPH_HUMAN	amphiphysin isoform 1	384					endocytosis|synaptic transmission	actin cytoskeleton|cell junction|synaptic vesicle membrane				ovary(3)|liver(1)|skin(1)	5																		---	---	---	---	capture		Silent	SNP	38471795	38471795	591	7	T	C	C	49	49	AMPH	C	4	4
URGCP	55665	broad.mit.edu	37	7	43916608	43916608	+	Silent	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:43916608T>C	uc003tiw.2	-	6	2511	c.2454A>G	c.(2452-2454)GTA>GTG	p.V818V	URGCP_uc003tiu.2_Silent_p.V775V|URGCP_uc003tiv.2_Silent_p.V743V|URGCP_uc003tix.2_Silent_p.V809V|URGCP_uc003tiy.2_Silent_p.V775V|URGCP_uc003tiz.2_Silent_p.V775V|URGCP_uc011kbj.1_Silent_p.V775V	NM_001077663	NP_001071131	Q8TCY9	URGCP_HUMAN	up-regulated gene 4 isoform 3	818					cell cycle	centrosome|nucleus	GTP binding			ovary(2)|liver(1)|skin(1)	4																		---	---	---	---	capture		Silent	SNP	43916608	43916608	17588	7	T	C	C	49	49	URGCP	C	4	4
ZNF680	340252	broad.mit.edu	37	7	64004166	64004166	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:64004166T>C	uc003tta.2	-	3	345	c.172A>G	c.(172-174)AAG>GAG	p.K58E	ZNF680_uc010kzr.2_Intron|ZNF680_uc003ttb.2_Missense_Mutation_p.K58E	NM_178558	NP_848653	Q8NEM1	ZN680_HUMAN	zinc finger protein 680 isoform 1	58	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Lung NSC(55;0.118)|all_lung(88;0.243)																---	---	---	---	capture		Missense_Mutation	SNP	64004166	64004166	18682	7	T	C	C	61	61	ZNF680	C	4	4
C7orf42	55069	broad.mit.edu	37	7	66410077	66410077	+	Missense_Mutation	SNP	G	A	A	rs56128303		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:66410077G>A	uc003tvk.2	+	3	538	c.274G>A	c.(274-276)GGG>AGG	p.G92R	C7orf42_uc010lah.2_RNA|C7orf42_uc003tvl.2_Missense_Mutation_p.G92R	NM_017994	NP_060464	Q9NWD8	CG042_HUMAN	hypothetical protein LOC55069	92						integral to membrane				ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	66410077	66410077	2499	7	G	A	A	39	39	C7orf42	A	1	1
STAG3L4	64940	broad.mit.edu	37	7	66773997	66773997	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:66773997G>T	uc003tvt.3	+	3	430	c.163G>T	c.(163-165)GGG>TGG	p.G55W	STAG3L4_uc010laj.2_RNA	NM_022906	NP_075057	Q8TBR4	STG34_HUMAN	stromal antigen 3-like 4	55											0		Lung NSC(55;0.0839)|all_lung(88;0.181)																---	---	---	---	capture		Missense_Mutation	SNP	66773997	66773997	15766	7	G	T	T	43	43	STAG3L4	T	2	2
ELN	2006	broad.mit.edu	37	7	73474756	73474756	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:73474756G>A	uc003tzw.2	+	25	1781	c.1690G>A	c.(1690-1692)GGC>AGC	p.G564S	RFC2_uc011kfa.1_Intron|ELN_uc003tzn.2_Missense_Mutation_p.G558S|ELN_uc003tzz.2_Missense_Mutation_p.G477S|ELN_uc003tzo.2_Missense_Mutation_p.G510S|ELN_uc003tzp.2_Missense_Mutation_p.G469S|ELN_uc003tzq.2_Missense_Mutation_p.G422S|ELN_uc003tzr.2_Intron|ELN_uc003tzs.2_Missense_Mutation_p.G539S|ELN_uc003tzt.2_Missense_Mutation_p.G563S|ELN_uc003tzu.2_Missense_Mutation_p.G544S|ELN_uc003tzv.2_Missense_Mutation_p.G529S|ELN_uc003tzx.2_Missense_Mutation_p.G548S|ELN_uc011kff.1_Missense_Mutation_p.G558S|ELN_uc003tzy.2_Missense_Mutation_p.G534S	NM_000501	NP_001075224	P15502	ELN_HUMAN	elastin isoform a precursor	587	Ala-rich.				blood circulation|cell proliferation|organ morphogenesis|respiratory gaseous exchange	proteinaceous extracellular matrix	extracellular matrix constituent conferring elasticity|protein binding			ovary(3)|pancreas(2)	5		Lung NSC(55;0.159)			Rofecoxib(DB00533)			T	PAX5	B-ALL		Supravalvular Aortic Stenosis|Cutis laxa |Williams-Beuren Syndrome						---	---	---	---	capture		Missense_Mutation	SNP	73474756	73474756	5263	7	G	A	A	39	39	ELN	A	1	1
PTPN12	5782	broad.mit.edu	37	7	77256840	77256840	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:77256840G>T	uc003ugh.2	+	13	1935	c.1844G>T	c.(1843-1845)GGT>GTT	p.G615V	PTPN12_uc011kgp.1_Missense_Mutation_p.G496V|PTPN12_uc011kgq.1_Missense_Mutation_p.G485V|PTPN12_uc010lds.2_Missense_Mutation_p.G347V	NM_002835	NP_002826	Q05209	PTN12_HUMAN	protein tyrosine phosphatase, non-receptor type	615						soluble fraction	non-membrane spanning protein tyrosine phosphatase activity|SH3 domain binding			ovary(1)|breast(1)|pancreas(1)	3																		---	---	---	---	capture		Missense_Mutation	SNP	77256840	77256840	13236	7	G	T	T	44	44	PTPN12	T	2	2
ANKIB1	54467	broad.mit.edu	37	7	92027804	92027804	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92027804G>A	uc003ulw.2	+	20	3187	c.2811G>A	c.(2809-2811)CTG>CTA	p.L937L	ANKIB1_uc010lew.1_Silent_p.L206L	NM_019004	NP_061877	Q9P2G1	AKIB1_HUMAN	ankyrin repeat and IBR domain containing 1	937							protein binding|zinc ion binding			lung(1)	1	all_cancers(62;2.06e-09)|all_epithelial(64;9.24e-09)|Breast(17;0.0034)|all_lung(186;0.0509)|Lung NSC(181;0.0692)		STAD - Stomach adenocarcinoma(171;6.16e-05)|all cancers(6;0.00183)|Lung(22;0.123)|LUSC - Lung squamous cell carcinoma(200;0.225)															---	---	---	---	capture		Silent	SNP	92027804	92027804	633	7	G	A	A	45	45	ANKIB1	A	2	2
CALCR	799	broad.mit.edu	37	7	93055874	93055874	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:93055874C>A	uc003umv.1	-	15	1582	c.1321G>T	c.(1321-1323)GCC>TCC	p.A441S	CALCR_uc011kia.1_Missense_Mutation_p.A221S|CALCR_uc003ums.1_RNA|CALCR_uc003umt.1_RNA|CALCR_uc003umu.1_Missense_Mutation_p.A407S|CALCR_uc003umw.2_Missense_Mutation_p.A407S	NM_001742	NP_001733	P30988	CALCR_HUMAN	calcitonin receptor isoform 2 precursor	423	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|elevation of cytosolic calcium ion concentration|positive regulation of adenylate cyclase activity|response to glucocorticoid stimulus	integral to plasma membrane	calcitonin binding|calcitonin binding|calcitonin receptor activity|calcitonin receptor activity|protein binding			ovary(3)|lung(3)|skin(2)|pancreas(1)	9	all_cancers(62;3.18e-12)|all_epithelial(64;1.34e-11)|Breast(17;0.000675)|Lung NSC(181;0.207)		STAD - Stomach adenocarcinoma(171;0.000244)		Salmon Calcitonin(DB00017)													---	---	---	---	capture		Missense_Mutation	SNP	93055874	93055874	2695	7	C	A	A	26	26	CALCR	A	2	2
DYNC1I1	1780	broad.mit.edu	37	7	95614288	95614288	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:95614288G>T	uc003uoc.3	+	8	1070	c.793G>T	c.(793-795)GGG>TGG	p.G265W	DYNC1I1_uc003uod.3_Missense_Mutation_p.G248W|DYNC1I1_uc003uob.2_Missense_Mutation_p.G228W|DYNC1I1_uc003uoe.3_Missense_Mutation_p.G245W|DYNC1I1_uc010lfl.2_Missense_Mutation_p.G254W	NM_004411	NP_004402	O14576	DC1I1_HUMAN	dynein, cytoplasmic 1, intermediate chain 1	265					vesicle transport along microtubule	condensed chromosome kinetochore|cytoplasmic dynein complex|microtubule|perinuclear region of cytoplasm|spindle pole|vesicle	microtubule binding|microtubule motor activity			ovary(3)|kidney(1)	4	all_cancers(62;9.39e-10)|all_epithelial(64;2.28e-09)|Lung NSC(181;0.165)|all_lung(186;0.191)		STAD - Stomach adenocarcinoma(171;0.0957)															---	---	---	---	capture		Missense_Mutation	SNP	95614288	95614288	5028	7	G	T	T	47	47	DYNC1I1	T	2	2
SLC25A13	10165	broad.mit.edu	37	7	95822420	95822420	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:95822420C>A	uc003uof.3	-	6	735	c.544G>T	c.(544-546)GAC>TAC	p.D182Y	SLC25A13_uc003uog.3_Missense_Mutation_p.D182Y|SLC25A13_uc011kik.1_Missense_Mutation_p.D74Y	NM_014251	NP_055066	Q9UJS0	CMC2_HUMAN	solute carrier family 25, member 13 isoform 2	182	3.|EF-hand 4.				ATP biosynthetic process|gluconeogenesis|malate-aspartate shuttle|response to calcium ion	integral to plasma membrane|mitochondrial inner membrane	calcium ion binding|L-aspartate transmembrane transporter activity|L-glutamate transmembrane transporter activity			central_nervous_system(3)|skin(1)	4	all_cancers(62;7.75e-08)|all_epithelial(64;1.16e-07)		STAD - Stomach adenocarcinoma(171;0.194)		L-Aspartic Acid(DB00128)													---	---	---	---	capture		Missense_Mutation	SNP	95822420	95822420	14972	7	C	A	A	31	31	SLC25A13	A	1	1
PTCD1	26024	broad.mit.edu	37	7	99022669	99022669	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99022669C>G	uc003uqh.2	-	6	1617	c.1486G>C	c.(1486-1488)GTG>CTG	p.V496L	PTCD1_uc011kiw.1_Missense_Mutation_p.V545L	NM_015545	NP_056360	O75127	PTCD1_HUMAN	pentatricopeptide repeat domain 1	496										ovary(1)	1	all_cancers(62;2.54e-08)|all_epithelial(64;2.55e-09)|Lung NSC(181;0.0053)|all_lung(186;0.00895)|Esophageal squamous(72;0.0166)		STAD - Stomach adenocarcinoma(171;0.215)															---	---	---	---	capture		Missense_Mutation	SNP	99022669	99022669	13181	7	C	G	G	18	18	PTCD1	G	3	3
ZAN	7455	broad.mit.edu	37	7	100372950	100372950	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100372950G>T	uc003uwj.2	+	33	5945	c.5780G>T	c.(5779-5781)GGT>GTT	p.G1927V	ZAN_uc003uwk.2_Missense_Mutation_p.G1927V|ZAN_uc003uwl.2_RNA|ZAN_uc010lhh.2_RNA|ZAN_uc010lhi.2_RNA|ZAN_uc011kke.1_Missense_Mutation_p.G14V	NM_003386	NP_003377	Q9Y493	ZAN_HUMAN	zonadhesin isoform 3	1927	Extracellular (Potential).				binding of sperm to zona pellucida|cell-cell adhesion	integral to membrane|plasma membrane				ovary(4)|large_intestine(3)|central_nervous_system(2)|pancreas(2)	11	Lung NSC(181;0.041)|all_lung(186;0.0581)		STAD - Stomach adenocarcinoma(171;0.19)															---	---	---	---	capture		Missense_Mutation	SNP	100372950	100372950	18096	7	G	T	T	44	44	ZAN	T	2	2
CPA4	51200	broad.mit.edu	37	7	129950677	129950677	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:129950677G>C	uc003vpr.2	+	9	891	c.844G>C	c.(844-846)GCC>CCC	p.A282P	CPA4_uc011kpd.1_Missense_Mutation_p.A249P|CPA4_uc011kpe.1_Missense_Mutation_p.A178P	NM_016352	NP_057436	Q9UI42	CBPA4_HUMAN	carboxypeptidase A4 preproprotein	282					histone acetylation|proteolysis	extracellular region	metallocarboxypeptidase activity|zinc ion binding			ovary(1)	1	Melanoma(18;0.0435)																	---	---	---	---	capture		Missense_Mutation	SNP	129950677	129950677	3930	7	G	C	C	38	38	CPA4	C	3	3
CHRM2	1129	broad.mit.edu	37	7	136700338	136700338	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:136700338G>T	uc003vtf.1	+	4	1349	c.726G>T	c.(724-726)AAG>AAT	p.K242N	CHRM2_uc003vtg.1_Missense_Mutation_p.K242N|CHRM2_uc003vtj.1_Missense_Mutation_p.K242N|CHRM2_uc003vtk.1_Missense_Mutation_p.K242N|CHRM2_uc003vtl.1_Missense_Mutation_p.K242N|CHRM2_uc003vtm.1_Missense_Mutation_p.K242N|CHRM2_uc003vti.1_Missense_Mutation_p.K242N|CHRM2_uc003vto.1_Missense_Mutation_p.K242N|CHRM2_uc003vtn.1_Missense_Mutation_p.K242N|uc003vtp.1_Intron	NM_001006630	NP_001006631	P08172	ACM2_HUMAN	cholinergic receptor, muscarinic 2	242	Cytoplasmic (By similarity).				activation of phospholipase C activity by muscarinic acetylcholine receptor signaling pathway|G-protein signaling, coupled to cAMP nucleotide second messenger|nervous system development|regulation of heart contraction|response to virus	cell junction|integral to plasma membrane|postsynaptic membrane	muscarinic acetylcholine receptor activity|protein binding			ovary(4)|central_nervous_system(1)	5					Anisotropine Methylbromide(DB00517)|Atropine(DB00572)|Benzquinamide(DB00767)|Carbachol(DB00411)|Cryptenamine(DB00785)|Cyclizine(DB01176)|Desipramine(DB01151)|Diphenidol(DB01231)|Doxacurium(DB01334)|Doxacurium chloride(DB01135)|Flavoxate(DB01148)|Gallamine Triethiodide(DB00483)|Homatropine Methylbromide(DB00725)|Hyoscyamine(DB00424)|Ipratropium(DB00332)|Methotrimeprazine(DB01403)|Metixene(DB00340)|Metocurine(DB01336)|Mivacurium(DB01226)|Olanzapine(DB00334)|Oxybutynin(DB01062)|Oxyphencyclimine(DB00383)|Pilocarpine(DB01085)|Procyclidine(DB00387)|Promazine(DB00420)|Promethazine(DB01069)|Propiomazine(DB00777)|Rocuronium(DB00728)|Thiethylperazine(DB00372)|Tolterodine(DB01036)|Tridihexethyl(DB00505)|Triflupromazine(DB00508)													---	---	---	---	capture		Missense_Mutation	SNP	136700338	136700338	3511	7	G	T	T	34	34	CHRM2	T	2	2
UBN2	254048	broad.mit.edu	37	7	138978162	138978162	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138978162C>T	uc011kqr.1	+	16	3854	c.3854C>T	c.(3853-3855)ACC>ATC	p.T1285I		NM_173569	NP_775840	Q6ZU65	UBN2_HUMAN	ubinuclein 2	1285										ovary(1)|skin(1)	2																		---	---	---	---	capture		Missense_Mutation	SNP	138978162	138978162	17451	7	C	T	T	18	18	UBN2	T	2	2
WEE2	494551	broad.mit.edu	37	7	141408804	141408804	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141408804G>A	uc003vwn.2	+	1	652	c.246G>A	c.(244-246)AGG>AGA	p.R82R	FLJ40852_uc011krh.1_Intron|FLJ40852_uc010lnm.2_Intron|FLJ40852_uc010lnn.2_Intron|FLJ40852_uc003vwm.3_Intron|FLJ40852_uc010lno.2_Intron	NM_001105558	NP_001099028	P0C1S8	WEE2_HUMAN	WEE1 homolog 2	82					egg activation|female meiosis|female pronucleus assembly|meiotic metaphase II|meiotic prophase I|mitosis|negative regulation of oocyte development|regulation of meiosis I	centrosome|nucleus	ATP binding|magnesium ion binding|non-membrane spanning protein tyrosine kinase activity|protein serine/threonine kinase activity			ovary(1)|stomach(1)	2	Melanoma(164;0.0171)																	---	---	---	---	capture		Silent	SNP	141408804	141408804	17919	7	G	A	A	41	41	WEE2	A	2	2
PDIA4	9601	broad.mit.edu	37	7	148716232	148716232	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:148716232C>A	uc003wff.2	-	3	609	c.327G>T	c.(325-327)AAG>AAT	p.K109N		NM_004911	NP_004902	P13667	PDIA4_HUMAN	protein disulfide isomerase A4 precursor	109	Thioredoxin 1.				cell redox homeostasis|glycerol ether metabolic process|protein secretion	endoplasmic reticulum lumen|melanosome	electron carrier activity|protein binding|protein disulfide isomerase activity|protein disulfide oxidoreductase activity			lung(5)|ovary(1)	6	Melanoma(164;0.15)		OV - Ovarian serous cystadenocarcinoma(82;0.00385)															---	---	---	---	capture		Missense_Mutation	SNP	148716232	148716232	12091	7	C	A	A	24	24	PDIA4	A	2	2
ABCF2	10061	broad.mit.edu	37	7	150921066	150921066	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150921066C>G	uc003wjp.2	-	4	613	c.502G>C	c.(502-504)GAG>CAG	p.E168Q	ABCF2_uc003wjo.1_Missense_Mutation_p.E168Q	NM_007189	NP_009120	Q9UG63	ABCF2_HUMAN	ATP-binding cassette, sub-family F, member 2	168	ABC transporter 1.					ATP-binding cassette (ABC) transporter complex|mitochondrial envelope	ATP binding|ATPase activity|transporter activity			central_nervous_system(1)	1			OV - Ovarian serous cystadenocarcinoma(82;0.00448)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---	capture		Missense_Mutation	SNP	150921066	150921066	67	7	C	G	G	32	32	ABCF2	G	3	3
ABCF2	10061	broad.mit.edu	37	7	150921083	150921083	+	Missense_Mutation	SNP	A	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150921083A>T	uc003wjp.2	-	4	596	c.485T>A	c.(484-486)GTG>GAG	p.V162E	ABCF2_uc003wjo.1_Missense_Mutation_p.V162E	NM_007189	NP_009120	Q9UG63	ABCF2_HUMAN	ATP-binding cassette, sub-family F, member 2	162	ABC transporter 1.					ATP-binding cassette (ABC) transporter complex|mitochondrial envelope	ATP binding|ATPase activity|transporter activity			central_nervous_system(1)	1			OV - Ovarian serous cystadenocarcinoma(82;0.00448)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---	capture		Missense_Mutation	SNP	150921083	150921083	67	7	A	T	T	6	6	ABCF2	T	4	4
HTR5A	3361	broad.mit.edu	37	7	154876035	154876035	+	Silent	SNP	C	G	G	rs140450324		TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:154876035C>G	uc003wlu.1	+	2	976	c.912C>G	c.(910-912)ACC>ACG	p.T304T		NM_024012	NP_076917	P47898	5HT5A_HUMAN	5-hydroxytryptamine receptor 5A	304	Extracellular (By similarity).					integral to plasma membrane	serotonin receptor activity			ovary(2)|large_intestine(1)	3	all_neural(206;0.119)	all_hematologic(28;0.0592)	OV - Ovarian serous cystadenocarcinoma(82;0.0238)	UCEC - Uterine corpus endometrioid carcinoma (81;0.171)														---	---	---	---	capture		Silent	SNP	154876035	154876035	7750	7	C	G	G	23	23	HTR5A	G	3	3
SGK223	157285	broad.mit.edu	37	8	8233763	8233763	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:8233763C>T	uc003wsh.3	-	2	2156	c.2156G>A	c.(2155-2157)CGG>CAG	p.R719Q		NM_001080826	NP_001074295	Q86YV5	SG223_HUMAN	pragmin	719							ATP binding|non-membrane spanning protein tyrosine kinase activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	8233763	8233763	14701	8	C	T	T	23	23	SGK223	T	1	1
CDCA2	157313	broad.mit.edu	37	8	25317919	25317919	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:25317919G>T	uc003xep.1	+	3	560	c.81G>T	c.(79-81)TTG>TTT	p.L27F	PPP2R2A_uc003xek.2_Intron|KCTD9_uc003xeo.2_5'Flank|CDCA2_uc011lae.1_Missense_Mutation_p.L27F|CDCA2_uc003xeq.1_Missense_Mutation_p.L12F	NM_152562	NP_689775	Q69YH5	CDCA2_HUMAN	cell division cycle associated 2	27					cell division|mitosis	cytoplasm|nucleus					0		all_cancers(63;0.0378)|Ovarian(32;0.000878)|all_epithelial(46;0.0162)|Breast(100;0.0164)|Prostate(55;0.191)		UCEC - Uterine corpus endometrioid carcinoma (27;0.022)|Epithelial(17;1.37e-11)|Colorectal(74;0.0129)|COAD - Colon adenocarcinoma(73;0.0443)														---	---	---	---	capture		Missense_Mutation	SNP	25317919	25317919	3215	8	G	T	T	47	47	CDCA2	T	2	2
KIF13B	23303	broad.mit.edu	37	8	28989937	28989937	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:28989937C>T	uc003xhh.3	-	23	2889	c.2830G>A	c.(2830-2832)GAA>AAA	p.E944K	uc003xhi.1_Intron	NM_015254	NP_056069	Q9NQT8	KI13B_HUMAN	kinesin family member 13B	944					microtubule-based movement|protein targeting|signal transduction|T cell activation	cytoplasm|microtubule	ATP binding|microtubule motor activity|protein kinase binding				0		Ovarian(32;0.000536)		KIRC - Kidney renal clear cell carcinoma(542;0.152)|Kidney(114;0.181)														---	---	---	---	capture		Missense_Mutation	SNP	28989937	28989937	8586	8	C	T	T	31	31	KIF13B	T	1	1
TEX15	56154	broad.mit.edu	37	8	30702390	30702390	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:30702390C>G	uc003xil.2	-	1	4144	c.4144G>C	c.(4144-4146)GAG>CAG	p.E1382Q		NM_031271	NP_112561	Q9BXT5	TEX15_HUMAN	testis expressed 15	1382										ovary(3)|upper_aerodigestive_tract(2)|skin(2)	7				KIRC - Kidney renal clear cell carcinoma(542;0.0918)|Kidney(114;0.111)														---	---	---	---	capture		Missense_Mutation	SNP	30702390	30702390	16306	8	C	G	G	32	32	TEX15	G	3	3
SOX17	64321	broad.mit.edu	37	8	55372456	55372456	+	Silent	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:55372456T>C	uc003xsb.3	+	2	1350	c.1146T>C	c.(1144-1146)CAT>CAC	p.H382H		NM_022454	NP_071899	Q9H6I2	SOX17_HUMAN	SRY-box 17	382	Sox C-terminal.				angiogenesis|cardiac cell fate determination|endocardial cell differentiation|endocardium formation|endoderm formation|heart formation|heart looping|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cell growth|outflow tract morphogenesis|positive regulation of transcription, DNA-dependent|protein destabilization|protein stabilization|regulation of embryonic development|renal system development|vasculogenesis|Wnt receptor signaling pathway	transcription factor complex	beta-catenin binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|transcription factor binding|transcription regulatory region DNA binding			lung(1)	1		Lung NSC(129;0.109)|all_epithelial(80;0.176)|all_lung(136;0.181)	OV - Ovarian serous cystadenocarcinoma(7;1.9e-07)|Epithelial(17;1.7e-05)|all cancers(17;0.000159)															---	---	---	---	capture		Silent	SNP	55372456	55372456	15447	8	T	C	C	51	51	SOX17	C	4	4
RP1	6101	broad.mit.edu	37	8	55541069	55541069	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:55541069G>C	uc003xsd.1	+	4	4775	c.4627G>C	c.(4627-4629)GAT>CAT	p.D1543H	RP1_uc011ldy.1_Intron	NM_006269	NP_006260	P56715	RP1_HUMAN	retinitis pigmentosa RP1 protein	1543					axoneme assembly|intracellular signal transduction|photoreceptor cell maintenance|photoreceptor cell outer segment organization|phototransduction, visible light|retinal cone cell development|retinal rod cell development	cilium axoneme|cytoplasm|microtubule|microtubule associated complex|photoreceptor connecting cilium|photoreceptor inner segment|photoreceptor outer segment	microtubule binding			skin(7)|ovary(4)|pancreas(1)	12		all_lung(136;0.0831)|Lung NSC(129;0.109)|all_epithelial(80;0.123)	OV - Ovarian serous cystadenocarcinoma(7;4.4e-07)|Epithelial(17;3.37e-05)|all cancers(17;0.000285)															---	---	---	---	capture		Missense_Mutation	SNP	55541069	55541069	14011	8	G	C	C	45	45	RP1	C	3	3
YTHDF3	253943	broad.mit.edu	37	8	64099372	64099372	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:64099372C>T	uc003xuy.2	+	5	1119	c.803C>T	c.(802-804)CCT>CTT	p.P268L	YTHDF3_uc010lys.2_Missense_Mutation_p.P212L|YTHDF3_uc003xuz.2_Missense_Mutation_p.P212L|YTHDF3_uc003xva.2_Missense_Mutation_p.P212L|YTHDF3_uc011len.1_Missense_Mutation_p.P212L	NM_152758	NP_689971	Q7Z739	YTHD3_HUMAN	YTH domain family, member 3	268											0	Breast(64;0.0716)	all_cancers(86;0.169)|Lung NSC(129;0.0324)|all_lung(136;0.0593)|all_epithelial(80;0.146)	BRCA - Breast invasive adenocarcinoma(89;0.161)															---	---	---	---	capture		Missense_Mutation	SNP	64099372	64099372	18083	8	C	T	T	24	24	YTHDF3	T	2	2
ZFHX4	79776	broad.mit.edu	37	8	77776502	77776502	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77776502C>T	uc003yav.2	+	11	10804	c.10417C>T	c.(10417-10419)CTT>TTT	p.L3473F		NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	3469	Ser-rich.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)												HNSCC(33;0.089)			---	---	---	---	capture		Missense_Mutation	SNP	77776502	77776502	18223	8	C	T	T	32	32	ZFHX4	T	2	2
CNBD1	168975	broad.mit.edu	37	8	88365862	88365862	+	Splice_Site	SNP	A	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:88365862A>T	uc003ydy.2	+	10	1201	c.1153_splice	c.e10-2	p.K385_splice		NM_173538	NP_775809			cyclic nucleotide binding domain containing 1											ovary(3)	3																		---	---	---	---	capture		Splice_Site	SNP	88365862	88365862	3729	8	A	T	T	7	7	CNBD1	T	5	4
ZNF7	7553	broad.mit.edu	37	8	146067258	146067258	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:146067258G>T	uc003zeg.3	+	5	903	c.766G>T	c.(766-768)GGG>TGG	p.G256W	ZNF7_uc010mge.2_Missense_Mutation_p.G267W|ZNF7_uc011lln.1_Missense_Mutation_p.G160W|ZNF7_uc003zeh.2_Intron|ZNF7_uc003zek.3_Missense_Mutation_p.G160W|COMMD5_uc003zel.1_Intron	NM_003416	NP_003407	P17097	ZNF7_HUMAN	zinc finger protein 7	256	C2H2-type 2.				multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(4)	4	all_cancers(97;1.03e-11)|all_epithelial(106;6.69e-11)|Lung NSC(106;4.08e-05)|all_lung(105;0.000125)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)	Breast(495;0.0812)|Ovarian(118;0.0822)|Acute lymphoblastic leukemia(644;0.143)	Epithelial(56;8.75e-39)|OV - Ovarian serous cystadenocarcinoma(54;1.13e-38)|all cancers(56;8.48e-34)|BRCA - Breast invasive adenocarcinoma(115;0.0355)|Colorectal(110;0.055)	GBM - Glioblastoma multiforme(99;2.11e-07)														---	---	---	---	capture		Missense_Mutation	SNP	146067258	146067258	18697	8	G	T	T	47	47	ZNF7	T	2	2
SMARCA2	6595	broad.mit.edu	37	9	2116022	2116022	+	Silent	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:2116022C>T	uc003zhc.2	+	25	3756	c.3657C>T	c.(3655-3657)GCC>GCT	p.A1219A	SMARCA2_uc003zhd.2_Silent_p.A1219A|SMARCA2_uc010mha.2_Silent_p.A1152A	NM_003070	NP_003061	P51531	SMCA2_HUMAN	SWI/SNF-related matrix-associated	1219					chromatin remodeling|negative regulation of cell growth|negative regulation of transcription from RNA polymerase II promoter|nervous system development	intermediate filament cytoskeleton|nBAF complex|npBAF complex|nuclear chromatin|nucleoplasm|SWI/SNF complex|WINAC complex	ATP binding|DNA-dependent ATPase activity|helicase activity|protein binding|RNA polymerase II transcription coactivator activity|transcription regulatory region DNA binding			ovary(2)|central_nervous_system(1)	3		all_lung(10;2.06e-09)|Lung NSC(10;2.43e-09)		GBM - Glioblastoma multiforme(50;0.0475)												OREG0019074	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	2116022	2116022	15267	9	C	T	T	21	21	SMARCA2	T	2	2
KIAA1432	57589	broad.mit.edu	37	9	5753220	5753220	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:5753220G>T	uc003zji.2	+	12	1329	c.1236G>T	c.(1234-1236)GAG>GAT	p.E412D	KIAA1432_uc003zjh.2_Missense_Mutation_p.E412D|KIAA1432_uc003zjl.3_Missense_Mutation_p.E412D|KIAA1432_uc003zjj.1_Intron	NM_020829	NP_065880	Q4ADV7	RIC1_HUMAN	connexin 43-interacting protein 150 isoform a	491						integral to membrane					0		Acute lymphoblastic leukemia(23;0.154)		GBM - Glioblastoma multiforme(50;0.000525)|Lung(218;0.122)														---	---	---	---	capture		Missense_Mutation	SNP	5753220	5753220	8542	9	G	T	T	33	33	KIAA1432	T	2	2
ZNF658	26149	broad.mit.edu	37	9	40774478	40774478	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:40774478C>A	uc004abs.2	-	5	949	c.797G>T	c.(796-798)AGG>ATG	p.R266M	ZNF658_uc010mmm.1_Missense_Mutation_p.R266M|ZNF658_uc010mmn.1_Missense_Mutation_p.R266M	NM_033160	NP_149350	Q5TYW1	ZN658_HUMAN	zinc finger protein 658	266					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1				GBM - Glioblastoma multiforme(29;0.02)|Lung(182;0.0681)														---	---	---	---	capture		Missense_Mutation	SNP	40774478	40774478	18664	9	C	A	A	24	24	ZNF658	A	2	2
C9orf85	138241	broad.mit.edu	37	9	74526683	74526683	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:74526683C>A	uc004ain.2	+	1	261	c.33C>A	c.(31-33)TCC>TCA	p.S11S	C9orf85_uc004aio.2_RNA|C9orf85_uc010mou.2_RNA|C9orf85_uc010mov.2_RNA|FAM108B1_uc004ail.2_5'Flank|FAM108B1_uc004aim.1_5'Flank	NM_182505	NP_872311	Q96MD7	CI085_HUMAN	hypothetical protein LOC138241	11											0																		---	---	---	---	capture		Silent	SNP	74526683	74526683	2617	9	C	A	A	21	21	C9orf85	A	2	2
SHC3	53358	broad.mit.edu	37	9	91661806	91661806	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:91661806G>A	uc004aqg.2	-	8	1373	c.1066C>T	c.(1066-1068)CTT>TTT	p.L356F		NM_016848	NP_058544	Q92529	SHC3_HUMAN	src homology 2 domain-containing transforming	356	CH1.				central nervous system development|epidermal growth factor receptor signaling pathway|insulin receptor signaling pathway|nerve growth factor receptor signaling pathway|Ras protein signal transduction	cytosol	protein binding|signal transducer activity			lung(3)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	91661806	91661806	14764	9	G	A	A	33	33	SHC3	A	2	2
SPTLC1	10558	broad.mit.edu	37	9	94812283	94812283	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:94812283C>A	uc004arl.1	-	9	885	c.847G>T	c.(847-849)GGA>TGA	p.G283*	SPTLC1_uc011ltv.1_Nonsense_Mutation_p.G283*	NM_006415	NP_006406	O15269	SPTC1_HUMAN	serine palmitoyltransferase subunit 1 isoform a	283	Cytoplasmic (Potential).					integral to membrane|SPOTS complex	protein binding|pyridoxal phosphate binding|serine C-palmitoyltransferase activity|transferase activity, transferring nitrogenous groups			ovary(1)|breast(1)	2					L-Serine(DB00133)|Pyridoxal Phosphate(DB00114)													---	---	---	---	capture		Nonsense_Mutation	SNP	94812283	94812283	15637	9	C	A	A	24	24	SPTLC1	A	5	2
ZNF367	195828	broad.mit.edu	37	9	99160542	99160542	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:99160542C>T	uc004awf.2	-	2	830	c.475G>A	c.(475-477)GAA>AAA	p.E159K	ZNF367_uc004awg.2_Missense_Mutation_p.E159K	NM_153695	NP_710162	Q7RTV3	ZN367_HUMAN	zinc finger protein 367	159					regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Acute lymphoblastic leukemia(62;0.0167)																---	---	---	---	capture		Missense_Mutation	SNP	99160542	99160542	18463	9	C	T	T	29	29	ZNF367	T	2	2
PALM2-AKAP2	445815	broad.mit.edu	37	9	112898583	112898583	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:112898583C>A	uc004bei.2	+	9	1647	c.1455C>A	c.(1453-1455)CCC>CCA	p.P485P	PALM2-AKAP2_uc004bek.3_Silent_p.P253P|PALM2-AKAP2_uc004bej.3_Silent_p.P253P|PALM2-AKAP2_uc004bel.1_Silent_p.P63P|AKAP2_uc011lwi.1_Silent_p.P111P|AKAP2_uc004bem.2_Silent_p.P111P|PALM2-AKAP2_uc010mtw.1_Silent_p.P71P|AKAP2_uc011lwj.1_Silent_p.P22P|PALM2-AKAP2_uc004ben.2_Silent_p.P22P	NM_001136562	NP_001130034	Q9Y2D5	AKAP2_HUMAN	A kinase (PRKA) anchor protein 2 isoform 2	22							enzyme binding			ovary(3)|central_nervous_system(2)|skin(1)	6																		---	---	---	---	capture		Silent	SNP	112898583	112898583	11826	9	C	A	A	21	21	PALM2-AKAP2	A	2	2
COL27A1	85301	broad.mit.edu	37	9	116997889	116997889	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:116997889G>T	uc011lxl.1	+	17	2576	c.2576G>T	c.(2575-2577)GGG>GTG	p.G859V	COL27A1_uc004bii.2_RNA	NM_032888	NP_116277	Q8IZC6	CORA1_HUMAN	collagen, type XXVII, alpha 1 precursor	859	Pro-rich.|Triple-helical region.|Collagen-like 4.				cell adhesion		extracellular matrix structural constituent			ovary(3)|skin(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	116997889	116997889	3823	9	G	T	T	43	43	COL27A1	T	2	2
PAPPA	5069	broad.mit.edu	37	9	119109373	119109373	+	Silent	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:119109373C>G	uc004bjn.2	+	15	4230	c.3849C>G	c.(3847-3849)GTC>GTG	p.V1283V	PAPPA_uc011lxq.1_Silent_p.V658V	NM_002581	NP_002572	Q13219	PAPP1_HUMAN	pregnancy-associated plasma protein A	1283	Sushi 2.				cell differentiation|female pregnancy	cytoplasm|extracellular region|membrane	metalloendopeptidase activity|zinc ion binding			ovary(4)|skin(4)|pancreas(1)	9																		---	---	---	---	capture		Silent	SNP	119109373	119109373	11849	9	C	G	G	31	31	PAPPA	G	3	3
DBC1	1620	broad.mit.edu	37	9	122075433	122075433	+	Silent	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:122075433G>T	uc004bkc.2	-	2	657	c.201C>A	c.(199-201)ACC>ACA	p.T67T	DBC1_uc004bkd.2_Silent_p.T67T	NM_014618	NP_055433	O60477	DBC1_HUMAN	deleted in bladder cancer 1 precursor	67					cell cycle arrest|cell death	cytoplasm	protein binding			skin(3)|ovary(2)|central_nervous_system(2)|large_intestine(1)	8																		---	---	---	---	capture		Silent	SNP	122075433	122075433	4418	9	G	T	T	47	47	DBC1	T	2	2
SPTAN1	6709	broad.mit.edu	37	9	131345357	131345357	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131345357A>G	uc004bvl.3	+	15	1921	c.1808A>G	c.(1807-1809)GAT>GGT	p.D603G	SPTAN1_uc011mbg.1_Missense_Mutation_p.D603G|SPTAN1_uc011mbh.1_Missense_Mutation_p.D615G|SPTAN1_uc004bvm.3_Missense_Mutation_p.D603G|SPTAN1_uc004bvn.3_Missense_Mutation_p.D603G	NM_003127	NP_003118	Q13813	SPTA2_HUMAN	spectrin, alpha, non-erythrocytic 1	603	Spectrin 7.				actin filament capping|axon guidance|cellular component disassembly involved in apoptosis	cytosol|intracellular membrane-bounded organelle|membrane fraction|microtubule cytoskeleton|spectrin	actin binding|calcium ion binding|calmodulin binding|structural constituent of cytoskeleton			breast(5)|ovary(4)|pancreas(1)	10																		---	---	---	---	capture		Missense_Mutation	SNP	131345357	131345357	15631	9	A	G	G	12	12	SPTAN1	G	4	4
TTF1	7270	broad.mit.edu	37	9	135273587	135273587	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135273587G>T	uc004cbl.2	-	4	1770	c.1718C>A	c.(1717-1719)CCT>CAT	p.P573H	TTF1_uc011mcp.1_RNA|TTF1_uc004cbm.2_Missense_Mutation_p.P58H	NM_007344	NP_031370	Q15361	TTF1_HUMAN	transcription termination factor, RNA polymerase	573					negative regulation of DNA replication|regulation of transcription, DNA-dependent|termination of RNA polymerase I transcription	nucleolus|nucleoplasm	DNA binding			ovary(2)|upper_aerodigestive_tract(1)|pancreas(1)	4		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;4.25e-06)|Epithelial(140;9.09e-05)														---	---	---	---	capture		Missense_Mutation	SNP	135273587	135273587	17273	9	G	T	T	35	35	TTF1	T	2	2
ADAMTS13	11093	broad.mit.edu	37	9	136319552	136319552	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136319552C>A	uc004cdv.3	+	24	3504	c.3060C>A	c.(3058-3060)TCC>TCA	p.S1020S	ADAMTS13_uc004cdp.3_Silent_p.S247S|ADAMTS13_uc004cdt.1_Silent_p.S1020S|ADAMTS13_uc004cdu.1_Silent_p.S989S|ADAMTS13_uc004cdw.3_Silent_p.S1020S|ADAMTS13_uc004cdx.3_Silent_p.S989S|ADAMTS13_uc004cdz.3_Silent_p.S690S|ADAMTS13_uc004cea.1_5'Flank|ADAMTS13_uc004ceb.3_5'Flank	NM_139025	NP_620594	Q76LX8	ATS13_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1020	TSP type-1 7.				cell-matrix adhesion|glycoprotein metabolic process|integrin-mediated signaling pathway|peptide catabolic process|platelet activation|protein processing|proteolysis	cell surface|proteinaceous extracellular matrix	calcium ion binding|integrin binding|metalloendopeptidase activity|zinc ion binding			central_nervous_system(2)|skin(2)|ovary(1)|kidney(1)	6				OV - Ovarian serous cystadenocarcinoma(145;1.06e-07)|Epithelial(140;1.28e-06)|all cancers(34;1.46e-05)														---	---	---	---	capture		Silent	SNP	136319552	136319552	259	9	C	A	A	22	22	ADAMTS13	A	2	2
CD99	4267	broad.mit.edu	37	X	2640679	2640679	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:2640679G>C	uc004cqm.2	+	6	448	c.274G>C	c.(274-276)GAT>CAT	p.D92H	CD99_uc010nda.2_Missense_Mutation_p.D76H|CD99_uc004cqn.2_RNA|CD99_uc004cqo.2_Missense_Mutation_p.D92H	NM_002414	NP_002405	P14209	CD99_HUMAN	CD99 antigen isoform a precursor	92	Extracellular (Potential).				cell adhesion	cytoplasm|integral to plasma membrane				skin(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	2640679	2640679	3178	23	G	C	C	33	33	CD99	C	3	3
PNPLA4	8228	broad.mit.edu	37	X	7894053	7894053	+	Silent	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:7894053G>A	uc011mhq.1	-	2	270	c.108C>T	c.(106-108)GTC>GTT	p.V36V	PNPLA4_uc011mhr.1_Silent_p.V36V|PNPLA4_uc011mhs.1_Intron	NM_004650	NP_004641	P41247	PLPL4_HUMAN	patatin-like phospholipase domain containing 4	36	Patatin.				lipid catabolic process		triglyceride lipase activity				0		Colorectal(8;0.0329)|Medulloblastoma(8;0.232)														OREG0019651	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---	capture		Silent	SNP	7894053	7894053	12594	23	G	A	A	45	45	PNPLA4	A	2	2
TAB3	257397	broad.mit.edu	37	X	30872850	30872850	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:30872850A>G	uc004dcj.2	-	6	1595	c.932T>C	c.(931-933)GTG>GCG	p.V311A	TAB3_uc004dck.2_Missense_Mutation_p.V311A|TAB3_uc010ngl.2_Missense_Mutation_p.V311A	NM_152787	NP_690000	Q8N5C8	TAB3_HUMAN	mitogen-activated protein kinase kinase kinase 7	311	Pro-rich.				activation of MAPK activity|I-kappaB kinase/NF-kappaB cascade|innate immune response|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of NF-kappaB transcription factor activity|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|endosome membrane|plasma membrane	protein binding|zinc ion binding			ovary(1)	1																		---	---	---	---	capture		Missense_Mutation	SNP	30872850	30872850	16018	23	A	G	G	6	6	TAB3	G	4	4
KDM6A	7403	broad.mit.edu	37	X	44936072	44936072	+	Splice_Site	SNP	G	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:44936072G>A	uc004dge.3	+	18	3207	c.2832_splice	c.e18+1	p.Y944_splice	KDM6A_uc010nhk.2_Splice_Site_p.Y910_splice|KDM6A_uc011mkz.1_Splice_Site_p.Y996_splice|KDM6A_uc011mla.1_Splice_Site_p.Y899_splice|KDM6A_uc011mlb.1_Splice_Site_p.Y951_splice|KDM6A_uc011mlc.1_Splice_Site_p.Y648_splice|KDM6A_uc011mld.1_Splice_Site_p.Y583_splice	NM_021140	NP_066963			ubiquitously transcribed tetratricopeptide						histone H3-K4 methylation		metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			kidney(24)|haematopoietic_and_lymphoid_tissue(23)|oesophagus(11)|large_intestine(7)|lung(5)|breast(4)|central_nervous_system(3)|urinary_tract(3)|endometrium(2)|pancreas(2)	84								D|N|F|S		renal|oesophageal SCC|MM								---	---	---	---	capture		Splice_Site	SNP	44936072	44936072	8443	23	G	A	A	40	40	KDM6A	A	5	1
RBM10	8241	broad.mit.edu	37	X	47044725	47044725	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:47044725A>G	uc004dhf.2	+	19	2504	c.2125A>G	c.(2125-2127)ACC>GCC	p.T709A	RBM10_uc004dhg.2_Missense_Mutation_p.T631A|RBM10_uc004dhh.2_Missense_Mutation_p.T708A|RBM10_uc010nhq.2_Missense_Mutation_p.T632A|RBM10_uc004dhi.2_Missense_Mutation_p.T774A	NM_005676	NP_005667	P98175	RBM10_HUMAN	RNA binding motif protein 10 isoform 1	709					mRNA processing|RNA splicing	chromatin remodeling complex	nucleotide binding|RNA binding|zinc ion binding			ovary(1)|large_intestine(1)|prostate(1)|breast(1)|pancreas(1)	5																		---	---	---	---	capture		Missense_Mutation	SNP	47044725	47044725	13572	23	A	G	G	6	6	RBM10	G	4	4
KDM5C	8242	broad.mit.edu	37	X	53231062	53231062	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53231062C>A	uc004drz.2	-	13	2373	c.1840G>T	c.(1840-1842)GCT>TCT	p.A614S	KDM5C_uc011moc.1_RNA|KDM5C_uc011mod.1_Missense_Mutation_p.A547S|KDM5C_uc004dsa.2_Missense_Mutation_p.A613S	NM_004187	NP_004178	P41229	KDM5C_HUMAN	jumonji, AT rich interactive domain 1C isoform	614	JmjC.				chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|zinc ion binding			kidney(9)|ovary(5)|salivary_gland(1)|autonomic_ganglia(1)|haematopoietic_and_lymphoid_tissue(1)|oesophagus(1)	18								N|F|S		clear cell renal carcinoma								---	---	---	---	capture		Missense_Mutation	SNP	53231062	53231062	8441	23	C	A	A	26	26	KDM5C	A	2	2
CYSLTR1	10800	broad.mit.edu	37	X	77528293	77528293	+	Silent	SNP	C	A	A			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:77528293C>A	uc004edb.2	-	3	1351	c.951G>T	c.(949-951)GTG>GTT	p.V317V	CYSLTR1_uc010nma.2_Silent_p.V317V|CYSLTR1_uc010nmb.2_Silent_p.V317V	NM_006639	NP_006630	Q9Y271	CLTR1_HUMAN	cysteinyl leukotriene receptor 1	317	Cytoplasmic (Potential).				elevation of cytosolic calcium ion concentration|respiratory gaseous exchange	integral to plasma membrane|membrane fraction	leukotriene receptor activity			ovary(1)	1					Amlexanox(DB01025)|Cinalukast(DB00587)|Montelukast(DB00471)|Nedocromil(DB00716)|Pranlukast(DB01411)|Zafirlukast(DB00549)													---	---	---	---	capture		Silent	SNP	77528293	77528293	4366	23	C	A	A	29	29	CYSLTR1	A	2	2
TEX13A	56157	broad.mit.edu	37	X	104464811	104464811	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:104464811G>C	uc004ema.2	-	2	383	c.271C>G	c.(271-273)CGG>GGG	p.R91G	IL1RAPL2_uc004elz.1_Intron|TEX13A_uc004emb.2_Missense_Mutation_p.R91G	NM_031274	NP_112564	Q9BXU3	TX13A_HUMAN	testis expressed sequence 13A	91						intracellular	zinc ion binding			ovary(2)	2																		---	---	---	---	capture		Missense_Mutation	SNP	104464811	104464811	16303	23	G	C	C	38	38	TEX13A	C	3	3
PRPS1	5631	broad.mit.edu	37	X	106885651	106885651	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:106885651G>T	uc004ene.3	+	4	666	c.461G>T	c.(460-462)TGG>TTG	p.W154L	PRPS1_uc010npg.2_Missense_Mutation_p.W121L|PRPS1_uc011msj.1_Intron	NM_002764	NP_002755	P60891	PRPS1_HUMAN	phosphoribosyl pyrophosphate synthetase 1	154					5-phosphoribose 1-diphosphate biosynthetic process|hypoxanthine biosynthetic process|nervous system development|nucleoside metabolic process|purine nucleotide biosynthetic process|pyrimidine nucleotide biosynthetic process|ribonucleoside monophosphate biosynthetic process|urate biosynthetic process	cytosol	ATP binding|kinase activity|magnesium ion binding|protein homodimerization activity|ribose phosphate diphosphokinase activity			breast(3)|large_intestine(1)	4																		---	---	---	---	capture		Missense_Mutation	SNP	106885651	106885651	13021	23	G	T	T	47	47	PRPS1	T	2	2
IL13RA1	3597	broad.mit.edu	37	X	117895230	117895230	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:117895230C>G	uc004eqs.2	+	6	849	c.806C>G	c.(805-807)ACT>AGT	p.T269S	IL13RA1_uc004eqr.1_Missense_Mutation_p.T269S|IL13RA1_uc004eqt.1_Missense_Mutation_p.T269S	NM_001560	NP_001551	P78552	I13R1_HUMAN	interleukin 13 receptor, alpha 1 precursor	269	Extracellular (Potential).					interleukin-13 receptor complex	cytokine receptor activity				0																		---	---	---	---	capture		Missense_Mutation	SNP	117895230	117895230	7930	23	C	G	G	20	20	IL13RA1	G	3	3
KIAA1210	57481	broad.mit.edu	37	X	118222757	118222757	+	Silent	SNP	T	C	C			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:118222757T>C	uc004era.3	-	11	2436	c.2436A>G	c.(2434-2436)CAA>CAG	p.Q812Q		NM_020721	NP_065772	Q9ULL0	K1210_HUMAN	hypothetical protein LOC57481	812										ovary(4)|skin(1)	5																		---	---	---	---	capture		Silent	SNP	118222757	118222757	8522	23	T	C	C	56	56	KIAA1210	C	4	4
ARHGAP36	158763	broad.mit.edu	37	X	130215797	130215797	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:130215797A>G	uc004evz.2	+	2	503	c.158A>G	c.(157-159)CAC>CGC	p.H53R	ARHGAP36_uc004ewa.2_Missense_Mutation_p.H41R|ARHGAP36_uc004ewb.2_Missense_Mutation_p.H22R|ARHGAP36_uc004ewc.2_5'Flank	NM_144967	NP_659404	Q6ZRI8	RHG36_HUMAN	hypothetical protein LOC158763 precursor	53					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(3)	3																		---	---	---	---	capture		Missense_Mutation	SNP	130215797	130215797	895	23	A	G	G	6	6	ARHGAP36	G	4	4
MAGEC3	139081	broad.mit.edu	37	X	140985615	140985615	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:140985615G>T	uc011mwp.1	+	8	1929	c.1929G>T	c.(1927-1929)GAG>GAT	p.E643D	MAGEC3_uc004fbs.2_3'UTR|MAGEC3_uc010nsj.2_3'UTR	NM_138702	NP_619647	Q8TD91	MAGC3_HUMAN	melanoma antigen family C, 3 isoform 1	643	MAGE 2.									skin(2)|central_nervous_system(1)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---	capture		Missense_Mutation	SNP	140985615	140985615	9563	23	G	T	T	36	36	MAGEC3	T	2	2
MAGEC1	9947	broad.mit.edu	37	X	140996228	140996228	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2791-01	TCGA-66-2791-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:140996228A>G	uc004fbt.2	+	4	3324	c.3038A>G	c.(3037-3039)TAT>TGT	p.Y1013C	MAGEC1_uc010nsl.1_Missense_Mutation_p.Y80C	NM_005462	NP_005453	O60732	MAGC1_HUMAN	melanoma antigen family C, 1	1013	MAGE.						protein binding			ovary(1)|kidney(1)|central_nervous_system(1)|skin(1)	4	Acute lymphoblastic leukemia(192;6.56e-05)														HNSCC(15;0.026)			---	---	---	---	capture		Missense_Mutation	SNP	140996228	140996228	9561	23	A	G	G	16	16	MAGEC1	G	4	4
