Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	filter
CDK11A	728642	broad.mit.edu	37	1	1635743	1635743	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1635743C>T	uc009vks.2	-	15	1713	c.1605G>A	c.(1603-1605)GTG>GTA	p.V535V	CDK11B_uc001ags.1_Intron|CDK11B_uc001agt.1_Intron|CDK11B_uc001aha.1_Intron|CDK11B_uc001agw.1_Intron|CDK11B_uc001agv.1_Intron|CDK11B_uc001agy.1_Intron|CDK11B_uc001agx.1_Intron|CDK11B_uc001agz.1_Intron|SLC35E2B_uc001ahh.3_Intron|SLC35E2_uc009vkm.1_Intron|CDK11A_uc001ahj.3_Silent_p.V42V|CDK11A_uc009vkp.2_Silent_p.V152V|CDK11A_uc009vkq.2_RNA|CDK11A_uc009vkr.2_Silent_p.V525V|CDK11A_uc010nys.1_3'UTR	NM_024011	NP_076916	Q9UQ88	CD11A_HUMAN	cell division cycle 2-like 2 isoform 1	538	Protein kinase.				apoptosis|mitosis|regulation of cell growth|regulation of mRNA processing|regulation of transcription, DNA-dependent	cytoplasm|nucleus	ATP binding|cyclin-dependent protein kinase activity|protein binding			stomach(1)	1						GCAGGTGTTTCACCCCCCGCA	0.662													14	77	---	---	---	---	PASS
SKI	6497	broad.mit.edu	37	1	2160703	2160703	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:2160703C>A	uc001aja.3	+	1	570	c.498C>A	c.(496-498)ATC>ATA	p.I166I		NM_003036	NP_003027	P12755	SKI_HUMAN	v-ski sarcoma viral oncogene homolog	166					anterior/posterior axis specification|BMP signaling pathway|bone morphogenesis|cell motility|cell proliferation|embryonic limb morphogenesis|face morphogenesis|lens morphogenesis in camera-type eye|myelination in peripheral nervous system|myotube differentiation|negative regulation of activin receptor signaling pathway|negative regulation of BMP signaling pathway|negative regulation of fibroblast proliferation|negative regulation of osteoblast differentiation|negative regulation of Schwann cell proliferation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transforming growth factor beta receptor signaling pathway|neural tube closure|nose morphogenesis|olfactory bulb development|palate development|positive regulation of DNA binding|positive regulation of transcription from RNA polymerase II promoter|positive regulation of Wnt receptor signaling pathway|protein homotrimerization|regulation of apoptosis|retina development in camera-type eye|skeletal muscle fiber development|SMAD protein signal transduction|somatic stem cell maintenance|transcription, DNA-dependent|transforming growth factor beta receptor signaling pathway	cytoplasm|PML body|transcription factor complex|transcriptional repressor complex	histone deacetylase inhibitor activity|nucleotide binding|protein domain specific binding|protein kinase binding|repressing transcription factor binding|SMAD binding|transcription corepressor activity|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding			lung(1)|central_nervous_system(1)	2	all_cancers(77;0.000139)|all_epithelial(69;4.45e-05)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)			Epithelial(90;2.14e-37)|OV - Ovarian serous cystadenocarcinoma(86;2.72e-29)|GBM - Glioblastoma multiforme(42;2.45e-08)|Colorectal(212;5.33e-05)|COAD - Colon adenocarcinoma(227;0.000228)|Kidney(185;0.00268)|BRCA - Breast invasive adenocarcinoma(365;0.00471)|STAD - Stomach adenocarcinoma(132;0.0147)|KIRC - Kidney renal clear cell carcinoma(229;0.0385)|Lung(427;0.207)		TCATGGGCATCCTGCCCTTCT	0.667													4	12	---	---	---	---	PASS
AJAP1	55966	broad.mit.edu	37	1	4772184	4772184	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:4772184G>A	uc001alm.1	+	2	635	c.254G>A	c.(253-255)CGA>CAA	p.R85Q	AJAP1_uc001aln.2_Missense_Mutation_p.R85Q	NM_001042478	NP_001035943	Q9UKB5	AJAP1_HUMAN	adherens junction associated protein 1	85	Extracellular (Potential).				cell adhesion	adherens junction|apical plasma membrane|basolateral plasma membrane|integral to membrane				lung(1)	1	all_cancers(77;0.071)|Ovarian(185;0.0721)	all_cancers(23;1.77e-36)|all_epithelial(116;1.26e-21)|all_lung(118;3.51e-08)|Lung NSC(185;3.47e-06)|all_neural(13;8.84e-06)|all_hematologic(16;7.61e-05)|Breast(487;0.000507)|Renal(390;0.0007)|Colorectal(325;0.00117)|Hepatocellular(190;0.0071)|Glioma(11;0.0155)|Myeloproliferative disorder(586;0.0258)|Ovarian(437;0.0409)|Lung SC(97;0.133)|Medulloblastoma(700;0.215)		Epithelial(90;3.89e-35)|OV - Ovarian serous cystadenocarcinoma(86;1.97e-19)|GBM - Glioblastoma multiforme(42;3.71e-19)|Colorectal(212;4.57e-06)|COAD - Colon adenocarcinoma(227;0.00019)|Kidney(185;0.000969)|BRCA - Breast invasive adenocarcinoma(365;0.00122)|STAD - Stomach adenocarcinoma(132;0.00578)|KIRC - Kidney renal clear cell carcinoma(229;0.0126)|READ - Rectum adenocarcinoma(331;0.0689)		CGGCCGCCCCGAGTGGAGCGG	0.627													9	13	---	---	---	---	PASS
KIF1B	23095	broad.mit.edu	37	1	10425617	10425617	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:10425617G>A	uc001aqx.3	+	43	4865	c.4663G>A	c.(4663-4665)GAA>AAA	p.E1555K	KIF1B_uc001aqw.3_Missense_Mutation_p.E1509K|KIF1B_uc001aqy.2_Missense_Mutation_p.E1529K|KIF1B_uc001aqz.2_Missense_Mutation_p.E1555K|KIF1B_uc001ara.2_Missense_Mutation_p.E1515K|KIF1B_uc001arb.2_Missense_Mutation_p.E1541K	NM_015074	NP_055889	O60333	KIF1B_HUMAN	kinesin family member 1B isoform b	1555					anterograde axon cargo transport|apoptosis|neuromuscular synaptic transmission|neuron-neuron synaptic transmission	cytoplasmic vesicle membrane|microtubule|microtubule associated complex|mitochondrion	ATP binding|ATPase activity|kinesin binding|microtubule motor activity|protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	Ovarian(185;0.203)	all_lung(284;1.31e-05)|Lung NSC(185;2.2e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0259)|Colorectal(212;9.79e-07)|COAD - Colon adenocarcinoma(227;0.000143)|BRCA - Breast invasive adenocarcinoma(304;0.000413)|Kidney(185;0.00134)|KIRC - Kidney renal clear cell carcinoma(229;0.0037)|STAD - Stomach adenocarcinoma(132;0.0113)|READ - Rectum adenocarcinoma(331;0.0642)		CACTACCTTTGAAAGCGCCAT	0.552													14	194	---	---	---	---	PASS
KIF1B	23095	broad.mit.edu	37	1	10431296	10431296	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:10431296C>G	uc001aqx.3	+	45	5124	c.4922C>G	c.(4921-4923)TCT>TGT	p.S1641C	KIF1B_uc001aqw.3_Missense_Mutation_p.S1595C|KIF1B_uc001aqy.2_Missense_Mutation_p.S1615C|KIF1B_uc001aqz.2_Missense_Mutation_p.S1641C|KIF1B_uc001ara.2_Missense_Mutation_p.S1601C|KIF1B_uc001arb.2_Missense_Mutation_p.S1627C	NM_015074	NP_055889	O60333	KIF1B_HUMAN	kinesin family member 1B isoform b	1641					anterograde axon cargo transport|apoptosis|neuromuscular synaptic transmission|neuron-neuron synaptic transmission	cytoplasmic vesicle membrane|microtubule|microtubule associated complex|mitochondrion	ATP binding|ATPase activity|kinesin binding|microtubule motor activity|protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	Ovarian(185;0.203)	all_lung(284;1.31e-05)|Lung NSC(185;2.2e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0259)|Colorectal(212;9.79e-07)|COAD - Colon adenocarcinoma(227;0.000143)|BRCA - Breast invasive adenocarcinoma(304;0.000413)|Kidney(185;0.00134)|KIRC - Kidney renal clear cell carcinoma(229;0.0037)|STAD - Stomach adenocarcinoma(132;0.0113)|READ - Rectum adenocarcinoma(331;0.0642)		CTGGTAGACTCTAGGAGCAAC	0.473													7	110	---	---	---	---	PASS
PLOD1	5351	broad.mit.edu	37	1	12017937	12017937	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12017937C>T	uc001atm.2	+	8	871	c.780C>T	c.(778-780)TTC>TTT	p.F260F	PLOD1_uc010obb.1_Silent_p.F307F	NM_000302	NP_000293	Q02809	PLOD1_HUMAN	lysyl hydroxylase 1 precursor	260					epidermis development|hydroxylysine biosynthetic process|protein modification process|response to hypoxia	rough endoplasmic reticulum membrane	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|procollagen-lysine 5-dioxygenase activity|protein homodimerization activity			ovary(2)|breast(1)	3	Ovarian(185;0.249)	Lung NSC(185;8.69e-05)|all_lung(284;9.87e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Ovarian(437;0.00965)|Hepatocellular(190;0.0202)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;6.06e-06)|COAD - Colon adenocarcinoma(227;0.000273)|BRCA - Breast invasive adenocarcinoma(304;0.000311)|Kidney(185;0.000809)|KIRC - Kidney renal clear cell carcinoma(229;0.00267)|STAD - Stomach adenocarcinoma(313;0.00743)|READ - Rectum adenocarcinoma(331;0.0649)	Minoxidil(DB00350)|Succinic acid(DB00139)|Vitamin C(DB00126)	TCCCGCGCTTCTGGACCTTCG	0.637													75	276	---	---	---	---	PASS
SDHB	6390	broad.mit.edu	37	1	17359560	17359560	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17359560C>G	uc001bae.2	-	3	432	c.281G>C	c.(280-282)AGA>ACA	p.R94T		NM_003000	NP_002991	P21912	DHSB_HUMAN	succinate dehydrogenase complex, subunit B, iron	94	2Fe-2S ferredoxin-type.				respiratory electron transport chain|transport|tricarboxylic acid cycle	mitochondrial respiratory chain complex II	2 iron, 2 sulfur cluster binding|3 iron, 4 sulfur cluster binding|4 iron, 4 sulfur cluster binding|electron carrier activity|metal ion binding|protein binding|succinate dehydrogenase (ubiquinone) activity|ubiquinone binding			breast(1)	1		Colorectal(325;3.46e-05)|Breast(348;0.000162)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.00054)|Ovarian(437;0.00669)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0049)|COAD - Colon adenocarcinoma(227;1.18e-05)|BRCA - Breast invasive adenocarcinoma(304;2.41e-05)|Kidney(64;0.000188)|KIRC - Kidney renal clear cell carcinoma(64;0.00273)|STAD - Stomach adenocarcinoma(196;0.00656)|READ - Rectum adenocarcinoma(331;0.0656)|Lung(427;0.19)	Succinic acid(DB00139)	CTCACCTTCTCTGCATGATCT	0.433			Mis|N|F			paraganglioma|pheochromocytoma			Familial_Paragangliomas|Carney-Stratakis_syndrome|Cowden_syndrome				4	35	---	---	---	---	PASS
SDHB	6390	broad.mit.edu	37	1	17371320	17371320	+	Nonsense_Mutation	SNP	G	A	A	rs74315370		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17371320G>A	uc001bae.2	-	2	287	c.136C>T	c.(136-138)CGA>TGA	p.R46*		NM_003000	NP_002991	P21912	DHSB_HUMAN	succinate dehydrogenase complex, subunit B, iron	46	2Fe-2S ferredoxin-type.		R -> Q (in pheochromocytoma and PGL4).|R -> G (in pheochromocytoma).		respiratory electron transport chain|transport|tricarboxylic acid cycle	mitochondrial respiratory chain complex II	2 iron, 2 sulfur cluster binding|3 iron, 4 sulfur cluster binding|4 iron, 4 sulfur cluster binding|electron carrier activity|metal ion binding|protein binding|succinate dehydrogenase (ubiquinone) activity|ubiquinone binding			breast(1)	1		Colorectal(325;3.46e-05)|Breast(348;0.000162)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.00054)|Ovarian(437;0.00669)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0049)|COAD - Colon adenocarcinoma(227;1.18e-05)|BRCA - Breast invasive adenocarcinoma(304;2.41e-05)|Kidney(64;0.000188)|KIRC - Kidney renal clear cell carcinoma(64;0.00273)|STAD - Stomach adenocarcinoma(196;0.00656)|READ - Rectum adenocarcinoma(331;0.0656)|Lung(427;0.19)	Succinic acid(DB00139)	GGGTCCCATCGATAGATGGCA	0.438			Mis|N|F			paraganglioma|pheochromocytoma			Familial_Paragangliomas|Carney-Stratakis_syndrome|Cowden_syndrome				6	126	---	---	---	---	PASS
HEYL	26508	broad.mit.edu	37	1	40092476	40092476	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40092476C>A	uc001cdp.2	-	5	741	c.690G>T	c.(688-690)CTG>CTT	p.L230L	HEYL_uc010oiw.1_Silent_p.L202L	NM_014571	NP_055386	Q9NQ87	HEYL_HUMAN	hairy/enhancer-of-split related with YRPW	230	Pro-rich.				multicellular organismal development|Notch signaling pathway|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1	Lung NSC(20;3.81e-06)|Ovarian(52;0.00769)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;1.1e-18)|Epithelial(16;2.77e-17)|all cancers(16;5.64e-16)|LUSC - Lung squamous cell carcinoma(16;0.000261)|Lung(16;0.000457)			TCCGGGCTGGCAGGATGATGC	0.687													6	3	---	---	---	---	PASS
EFCAB7	84455	broad.mit.edu	37	1	64034100	64034100	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:64034100C>T	uc001dbf.2	+	12	1911	c.1617C>T	c.(1615-1617)AAC>AAT	p.N539N		NM_032437	NP_115813	A8K855	EFCB7_HUMAN	EF-hand calcium binding domain 7	539							calcium ion binding				0						TTCTTAGCAACGGTGATGCCA	0.368													7	139	---	---	---	---	PASS
SGIP1	84251	broad.mit.edu	37	1	67185068	67185068	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67185068C>T	uc001dcr.2	+	19	1939	c.1722C>T	c.(1720-1722)TTC>TTT	p.F574F	SGIP1_uc010opd.1_Silent_p.F174F|SGIP1_uc001dcs.2_Silent_p.F174F|SGIP1_uc001dct.2_Silent_p.F176F|SGIP1_uc009wat.2_Silent_p.F368F|SGIP1_uc001dcu.2_Silent_p.F79F	NM_032291	NP_115667	Q9BQI5	SGIP1_HUMAN	SH3-domain GRB2-like (endophilin) interacting	574					positive regulation of energy homeostasis|positive regulation of feeding behavior|positive regulation of receptor-mediated endocytosis|response to dietary excess	AP-2 adaptor complex	microtubule binding|phospholipid binding|SH3 domain binding			ovary(3)	3						ATGCCTATTTCAAAGGAGCAG	0.473													10	35	---	---	---	---	PASS
SLC44A5	204962	broad.mit.edu	37	1	75685032	75685032	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:75685032G>A	uc001dgu.2	-						SLC44A5_uc001dgt.2_Intron|SLC44A5_uc001dgs.2_Intron|SLC44A5_uc001dgr.2_Intron|SLC44A5_uc010oqz.1_Intron|SLC44A5_uc010ora.1_Intron|SLC44A5_uc010orb.1_Intron	NM_152697	NP_689910	Q8NCS7	CTL5_HUMAN	solute carrier family 44, member 5 isoform A							integral to membrane|plasma membrane	choline transmembrane transporter activity			ovary(2)|skin(2)	4						CCAAGAAACTGAATAAACTCC	0.378													18	91	---	---	---	---	PASS
NEXN	91624	broad.mit.edu	37	1	78401632	78401632	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:78401632C>G	uc001dic.3	+	11	1673	c.1376C>G	c.(1375-1377)TCT>TGT	p.S459C	NEXN_uc001dia.3_Missense_Mutation_p.S445C|NEXN_uc009wcb.1_Missense_Mutation_p.S381C|NEXN_uc001dib.3_Missense_Mutation_p.S395C|NEXN_uc001did.1_Missense_Mutation_p.S369C|NEXN_uc001dif.1_Missense_Mutation_p.S351C|NEXN_uc001dig.3_Missense_Mutation_p.S100C	NM_144573	NP_653174	Q0ZGT2	NEXN_HUMAN	nexilin (F actin binding protein)	459	Glu-rich.				regulation of cell migration|regulation of cytoskeleton organization	cytoskeleton|Z disc	actin filament binding|structural constituent of muscle			ovary(2)	2				Colorectal(170;0.114)		GGACAGTTGTCTGAAAAAGAA	0.338													23	81	---	---	---	---	PASS
TTLL7	79739	broad.mit.edu	37	1	84372075	84372075	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:84372075G>A	uc001djc.2	-	17	2460	c.2064C>T	c.(2062-2064)CTC>CTT	p.L688L	TTLL7_uc001djb.2_RNA|TTLL7_uc001djd.2_RNA|TTLL7_uc001dje.2_RNA|TTLL7_uc001djf.2_RNA|TTLL7_uc001djg.2_RNA	NM_024686	NP_078962	Q6ZT98	TTLL7_HUMAN	tubulin tyrosine ligase-like family, member 7	688					cell differentiation|nervous system development|protein modification process	cilium|dendrite|microtubule basal body|perikaryon	tubulin-tyrosine ligase activity			ovary(1)	1				all cancers(265;0.0126)|Epithelial(280;0.0372)|OV - Ovarian serous cystadenocarcinoma(397;0.16)		TCATGTCTTTGAGAACAAATA	0.373													12	164	---	---	---	---	PASS
VAV3	10451	broad.mit.edu	37	1	108115949	108115949	+	3'UTR	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:108115949G>C	uc001dvk.1	-	27					VAV3_uc010ouu.1_3'UTR|VAV3_uc001dvj.1_3'UTR|VAV3_uc010ouv.1_3'UTR|VAV3_uc010ouw.1_3'UTR	NM_006113	NP_006104	Q9UKW4	VAV3_HUMAN	vav 3 guanine nucleotide exchange factor isoform						angiogenesis|apoptosis|B cell receptor signaling pathway|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|platelet activation|positive regulation of B cell proliferation|regulation of Rho protein signal transduction|response to DNA damage stimulus|response to drug|small GTPase mediated signal transduction	cytosol	GTPase activator activity|metal ion binding|SH3/SH2 adaptor activity			ovary(5)|lung(2)|breast(2)	9		all_epithelial(167;5.38e-05)|all_lung(203;0.000314)|Lung NSC(277;0.000594)		Colorectal(144;0.0331)|Lung(183;0.128)|Epithelial(280;0.204)		CACGGGATTTGAATTTATTCA	0.393													5	95	---	---	---	---	PASS
FAM40A	85369	broad.mit.edu	37	1	110592124	110592124	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110592124C>A	uc001dza.1	+	17	1850	c.1831C>A	c.(1831-1833)CCT>ACT	p.P611T	FAM40A_uc001dyz.1_Missense_Mutation_p.P516T|FAM40A_uc009wfp.1_Missense_Mutation_p.P435T	NM_033088	NP_149079	Q5VSL9	FA40A_HUMAN	hypothetical protein LOC85369	611						nucleus	protein binding			ovary(3)|large_intestine(1)	4		all_cancers(81;8.51e-05)|all_epithelial(167;3.58e-05)|all_lung(203;0.000116)|Lung NSC(277;0.000233)		Lung(183;0.0154)|all cancers(265;0.0732)|Epithelial(280;0.0781)|Colorectal(144;0.115)|LUSC - Lung squamous cell carcinoma(189;0.137)		CAACTGCATTCCTTTGATCCT	0.468													34	241	---	---	---	---	PASS
REG4	83998	broad.mit.edu	37	1	120336814	120336814	+	3'UTR	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:120336814G>C	uc001eig.2	-	7					REG4_uc001eif.2_3'UTR	NM_001159352	NP_001152824	Q9BYZ8	REG4_HUMAN	regenerating islet-derived family, member 4							extracellular region	sugar binding			ovary(1)	1	all_cancers(5;4.81e-10)|all_epithelial(5;7.98e-11)|Melanoma(3;1.93e-05)|Breast(55;0.218)|all_neural(166;0.219)	all_lung(203;8.1e-07)|Lung NSC(69;5.89e-06)|all_epithelial(167;0.000959)		Lung(183;0.011)|LUSC - Lung squamous cell carcinoma(189;0.0588)		AGCAGGAGTTGAGTGGCTGGG	0.483													11	216	---	---	---	---	PASS
OTUD7B	56957	broad.mit.edu	37	1	149931639	149931639	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:149931639C>T	uc001etn.2	-	7	1165	c.809G>A	c.(808-810)CGA>CAA	p.R270Q		NM_020205	NP_064590	Q6GQQ9	OTU7B_HUMAN	zinc finger protein Cezanne	270	Catalytic.|OTU.|TRAF-binding.				negative regulation of I-kappaB kinase/NF-kappaB cascade	cytoplasm|microtubule cytoskeleton|nucleus	cysteine-type peptidase activity|DNA binding|protein binding|zinc ion binding			ovary(1)|breast(1)|skin(1)	3	Breast(34;0.0009)|Ovarian(49;0.0265)|all_hematologic(923;0.0597)|Hepatocellular(266;0.161)|Colorectal(459;0.171)		LUSC - Lung squamous cell carcinoma(543;0.171)|STAD - Stomach adenocarcinoma(528;0.247)			TAGATGCATTCGGGGTTCACT	0.527													49	285	---	---	---	---	PASS
ENSA	2029	broad.mit.edu	37	1	150599876	150599876	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150599876C>G	uc001eve.2	-						ENSA_uc001evd.2_Intron|ENSA_uc009wly.2_Missense_Mutation_p.E84Q|ENSA_uc001evg.2_Intron|ENSA_uc001evh.2_Intron|ENSA_uc009wlz.1_Missense_Mutation_p.E84Q|ENSA_uc001evi.2_Missense_Mutation_p.E84Q|ENSA_uc001evb.2_Intron|ENSA_uc001evc.2_Intron|ENSA_uc001evf.2_Intron	NM_004436	NP_004427	O43768	ENSA_HUMAN	endosulfine alpha isoform 3						cell division|G2/M transition of mitotic cell cycle|mitosis|response to nutrient|transport	cytoplasm	ion channel inhibitor activity|protein phosphatase 2A binding|protein phosphatase inhibitor activity|protein phosphatase type 2A regulator activity|receptor binding			central_nervous_system(1)	1	all_cancers(9;3.09e-52)|all_epithelial(9;4.47e-43)|all_lung(15;1.09e-34)|Lung NSC(24;4.04e-31)|Breast(34;0.000615)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Melanoma(130;0.128)|Colorectal(459;0.171)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0241)|Epithelial(6;9.85e-23)|all cancers(9;5.06e-22)|OV - Ovarian serous cystadenocarcinoma(6;1.67e-14)|BRCA - Breast invasive adenocarcinoma(12;0.000701)|LUSC - Lung squamous cell carcinoma(543;0.171)			AGTAGAACCTCTACAGACTTC	0.418													18	632	---	---	---	---	PASS
CTSS	1520	broad.mit.edu	37	1	150727507	150727507	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150727507C>G	uc001evn.2	-	4	502	c.369G>C	c.(367-369)GAG>GAC	p.E123D	CTSS_uc010pcj.1_Intron|CTSS_uc001evo.1_Missense_Mutation_p.E123D	NM_004079	NP_004070	P25774	CATS_HUMAN	cathepsin S preproprotein	123					immune response|proteolysis	extracellular region|lysosome	cysteine-type endopeptidase activity				0	all_cancers(9;6.17e-52)|all_epithelial(9;9.7e-43)|all_lung(15;5.74e-35)|Lung NSC(24;2.09e-31)|Breast(34;0.00146)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Melanoma(130;0.128)|Colorectal(459;0.171)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0485)|Epithelial(6;5.02e-21)|all cancers(9;1.28e-20)|OV - Ovarian serous cystadenocarcinoma(6;1.09e-14)|BRCA - Breast invasive adenocarcinoma(12;0.00501)|LUSC - Lung squamous cell carcinoma(543;0.171)			CACACCCTTTCTCTCTCCAGT	0.428													71	465	---	---	---	---	PASS
FLG	2312	broad.mit.edu	37	1	152279632	152279632	+	Nonsense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152279632G>C	uc001ezu.1	-	3	7766	c.7730C>G	c.(7729-7731)TCA>TGA	p.S2577*		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	2577	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			AGAGTCTTCTGAGTGTCCCTG	0.567									Ichthyosis				75	657	---	---	---	---	PASS
FLG	2312	broad.mit.edu	37	1	152280742	152280742	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152280742C>G	uc001ezu.1	-	3	6656	c.6620G>C	c.(6619-6621)GGG>GCG	p.G2207A		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	2207	Ser-rich.|Filaggrin 13.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			ATGATGCGACCCTGAGTGCCT	0.567									Ichthyosis				170	577	---	---	---	---	PASS
PYGO2	90780	broad.mit.edu	37	1	154933468	154933468	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154933468C>G	uc001fft.2	-	2	344	c.138G>C	c.(136-138)AGG>AGC	p.R46S		NM_138300	NP_612157	Q9BRQ0	PYGO2_HUMAN	pygopus homolog 2	46	Nuclear localization signal (Potential).|Pro-rich.				Wnt receptor signaling pathway	nucleus	protein binding|zinc ion binding			skin(1)	1	all_epithelial(22;4.9e-30)|all_lung(78;4.1e-28)|all_hematologic(923;0.0359)|Hepatocellular(266;0.0877)|all_neural(408;0.245)		BRCA - Breast invasive adenocarcinoma(34;0.00034)			TATTTGACTTCCTTCGCTTCT	0.502													46	864	---	---	---	---	PASS
CLK2	1196	broad.mit.edu	37	1	155240700	155240700	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155240700C>G	uc001fjy.2	-	2	359	c.69G>C	c.(67-69)CGG>CGC	p.R23R	RAG1AP1_uc010pey.1_Intron|CLK2_uc001fjw.2_Silent_p.R23R|CLK2_uc001fjx.2_5'UTR|CLK2_uc009wqm.2_Silent_p.R23R	NM_003993	NP_003984	P49760	CLK2_HUMAN	CDC-like kinase 2	23						nucleus	ATP binding|protein serine/threonine kinase activity|protein tyrosine kinase activity				0	all_lung(78;2.32e-23)|Hepatocellular(266;0.0877)|all_hematologic(923;0.088)		Epithelial(20;3.72e-10)|all cancers(21;1.19e-09)|BRCA - Breast invasive adenocarcinoma(34;0.000752)|LUSC - Lung squamous cell carcinoma(543;0.193)			GCTTTCGGCTCCGATAGTGTT	0.572								Other_conserved_DNA_damage_response_genes					11	374	---	---	---	---	PASS
PEAR1	375033	broad.mit.edu	37	1	156883063	156883063	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156883063C>T	uc001fqj.1	+	19	2616	c.2500C>T	c.(2500-2502)CCC>TCC	p.P834S	PEAR1_uc001fqk.1_Missense_Mutation_p.P459S	NM_001080471	NP_001073940	Q5VY43	PEAR1_HUMAN	platelet endothelial aggregation receptor 1	834	Pro-rich.					integral to membrane				ovary(2)|central_nervous_system(1)	3	all_hematologic(923;0.0839)|Hepatocellular(266;0.158)					AAACCCCCCACCCCCTAACAA	0.607													41	354	---	---	---	---	PASS
PEAR1	375033	broad.mit.edu	37	1	156883186	156883186	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156883186C>G	uc001fqj.1	+	20	2631	c.2515C>G	c.(2515-2517)CCA>GCA	p.P839A	PEAR1_uc001fqk.1_Missense_Mutation_p.P464A	NM_001080471	NP_001073940	Q5VY43	PEAR1_HUMAN	platelet endothelial aggregation receptor 1	839	Pro-rich.					integral to membrane				ovary(2)|central_nervous_system(1)	3	all_hematologic(923;0.0839)|Hepatocellular(266;0.158)					CTCTTAGGTTCCAGGCCCGCT	0.642													50	235	---	---	---	---	PASS
FCRL5	83416	broad.mit.edu	37	1	157504602	157504602	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:157504602C>G	uc001fqu.2	-	8	1641	c.1483G>C	c.(1483-1485)GAA>CAA	p.E495Q	FCRL5_uc009wsm.2_Missense_Mutation_p.E495Q|FCRL5_uc010phv.1_Missense_Mutation_p.E495Q|FCRL5_uc010phw.1_Missense_Mutation_p.E410Q|FCRL5_uc001fqv.1_Missense_Mutation_p.E495Q|FCRL5_uc010phx.1_Missense_Mutation_p.E246Q	NM_031281	NP_112571	Q96RD9	FCRL5_HUMAN	Fc receptor-like 5	495	Extracellular (Potential).|Ig-like C2-type 5.					integral to membrane|plasma membrane	receptor activity			ovary(3)|breast(2)|central_nervous_system(1)	6	all_hematologic(112;0.0378)|Hepatocellular(266;0.178)	Prostate(1639;0.231)				CTCTGGACTTCACAGTGAAGT	0.517													30	80	---	---	---	---	PASS
SPTA1	6708	broad.mit.edu	37	1	158604327	158604327	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158604327C>T	uc001fst.1	-							NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1						actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)					TCTTCCTGTTCCTCACCTGAG	0.388													31	260	---	---	---	---	PASS
SPTA1	6708	broad.mit.edu	37	1	158606445	158606445	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158606445C>T	uc001fst.1	-	37	5495	c.5296G>A	c.(5296-5298)GAG>AAG	p.E1766K		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	1766	Spectrin 17.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)					ATGGCAGGCTCATGGGCCACC	0.338													9	197	---	---	---	---	PASS
PYHIN1	149628	broad.mit.edu	37	1	158913720	158913720	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158913720G>C	uc001ftb.2	+	6	1388	c.1143G>C	c.(1141-1143)AAG>AAC	p.K381N	PYHIN1_uc001ftc.2_Missense_Mutation_p.K372N|PYHIN1_uc001ftd.2_Missense_Mutation_p.K381N|PYHIN1_uc001fte.2_Missense_Mutation_p.K372N	NM_152501	NP_689714	Q6K0P9	IFIX_HUMAN	pyrin and HIN domain family, member 1 alpha 1	381	HIN-200.				cell cycle	nuclear speck				ovary(3)|pancreas(1)	4	all_hematologic(112;0.0378)					GACTGAGAAAGAGGGAAAATA	0.358													23	149	---	---	---	---	PASS
ADAMTS4	9507	broad.mit.edu	37	1	161166625	161166625	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161166625C>G	uc001fyt.3	-	2	1107	c.679G>C	c.(679-681)GAT>CAT	p.D227H	ADAMTS4_uc001fyu.2_Missense_Mutation_p.D227H|NDUFS2_uc001fyv.2_5'Flank	NM_005099	NP_005090	O75173	ATS4_HUMAN	ADAM metallopeptidase with thrombospondin type 1	227	Peptidase M12B.				proteolysis|skeletal system development	extracellular space|proteinaceous extracellular matrix	metalloendopeptidase activity|protease binding|zinc ion binding			ovary(4)|central_nervous_system(1)	5	all_cancers(52;3.73e-19)|Breast(13;0.000577)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00275)			ATCTTGTCATCTGCCACCACC	0.542													224	614	---	---	---	---	PASS
RXRG	6258	broad.mit.edu	37	1	165397991	165397991	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:165397991G>C	uc001gda.2	-	2	562	c.262C>G	c.(262-264)CCA>GCA	p.P88A		NM_006917	NP_008848	P48443	RXRG_HUMAN	retinoid X receptor, gamma isoform a	88	Modulating (By similarity).				regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	retinoid-X receptor activity|sequence-specific DNA binding transcription factor activity|steroid binding|steroid hormone receptor activity|zinc ion binding				0	all_hematologic(923;0.0773)|Acute lymphoblastic leukemia(8;0.155)				Acitretin(DB00459)|Adapalene(DB00210)|Alitretinoin(DB00523)|Etretinate(DB00926)|Tretinoin(DB00755)	TTGATTCCTGGAGGCGCTGCA	0.587													53	109	---	---	---	---	PASS
CACNA1E	777	broad.mit.edu	37	1	181479628	181479628	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:181479628G>A	uc001gow.2	+	2	447	c.282G>A	c.(280-282)ATG>ATA	p.M94I	CACNA1E_uc009wxr.2_Missense_Mutation_p.M1I|CACNA1E_uc009wxs.2_Missense_Mutation_p.M1I	NM_000721	NP_000712	Q15878	CAC1E_HUMAN	calcium channel, voltage-dependent, R type,	94	I.|Helical; Name=S1 of repeat I.				energy reserve metabolic process|membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	voltage-gated calcium channel activity			ovary(3)|central_nervous_system(2)|pancreas(1)	6						TTGAGTACATGATCCTGGCCA	0.522													19	99	---	---	---	---	PASS
RGL1	23179	broad.mit.edu	37	1	183866988	183866988	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183866988A>G	uc001gqo.2	+	10	1344	c.1187A>G	c.(1186-1188)AAC>AGC	p.N396S	RGL1_uc010pof.1_Missense_Mutation_p.N201S|RGL1_uc001gqm.2_Missense_Mutation_p.N431S|RGL1_uc010pog.1_Missense_Mutation_p.N394S|RGL1_uc010poh.1_Missense_Mutation_p.N394S|RGL1_uc010poi.1_Missense_Mutation_p.N396S	NM_015149	NP_055964	Q9NZL6	RGL1_HUMAN	ral guanine nucleotide dissociation	396	Ras-GEF.				cellular lipid metabolic process|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	intracellular	protein binding|Ral guanyl-nucleotide exchange factor activity			breast(5)|ovary(4)|lung(2)	11						GTGAAAGAAAACCAGAAGCGT	0.517													25	60	---	---	---	---	PASS
HMCN1	83872	broad.mit.edu	37	1	185934984	185934984	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:185934984G>A	uc001grq.1	+	14	2378	c.2149G>A	c.(2149-2151)GAT>AAT	p.D717N	HMCN1_uc001grr.1_Missense_Mutation_p.D58N	NM_031935	NP_114141	Q96RW7	HMCN1_HUMAN	hemicentin 1 precursor	717	Ig-like C2-type 4.				response to stimulus|visual perception	basement membrane	calcium ion binding			ovary(22)|skin(1)	23						TGCCCTTGGGGATATAACCGT	0.398													25	171	---	---	---	---	PASS
FAM5C	339479	broad.mit.edu	37	1	190423988	190423988	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:190423988C>A	uc001gse.1	-	2	265	c.33G>T	c.(31-33)TTG>TTT	p.L11F	FAM5C_uc010pot.1_5'UTR	NM_199051	NP_950252	Q76B58	FAM5C_HUMAN	family with sequence similarity 5, member C	11						extracellular region				lung(2)|ovary(1)|kidney(1)|skin(1)	5	Prostate(682;0.198)					TCAGAGAGAACAATTCAGCAC	0.498													15	53	---	---	---	---	PASS
KCNT2	343450	broad.mit.edu	37	1	196398851	196398851	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:196398851C>A	uc001gtd.1	-	9	735	c.675G>T	c.(673-675)AAG>AAT	p.K225N	KCNT2_uc009wyt.1_RNA|KCNT2_uc001gte.1_Missense_Mutation_p.K225N|KCNT2_uc001gtf.1_Missense_Mutation_p.K225N|KCNT2_uc001gtg.1_Intron|KCNT2_uc009wyu.2_Missense_Mutation_p.K225N|KCNT2_uc009wyv.1_Missense_Mutation_p.K200N	NM_198503	NP_940905	Q6UVM3	KCNT2_HUMAN	potassium channel, subfamily T, member 2	225	Extracellular (Potential).					voltage-gated potassium channel complex	ATP binding|calcium-activated potassium channel activity|voltage-gated potassium channel activity			ovary(5)|breast(1)|skin(1)	7						GATTCAGCTTCTTTCCTATTC	0.383													12	63	---	---	---	---	PASS
DDX59	83479	broad.mit.edu	37	1	200617581	200617581	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200617581C>T	uc009wzk.2	-	7	1825	c.1582G>A	c.(1582-1584)GAG>AAG	p.E528K	DDX59_uc010ppl.1_Missense_Mutation_p.E528K	NM_001031725	NP_001026895	Q5T1V6	DDX59_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 59	528	Helicase C-terminal.					intracellular	ATP binding|ATP-dependent helicase activity|metal ion binding|RNA binding			ovary(2)|breast(1)|central_nervous_system(1)	4						TGGACATACTCATCCATACTT	0.403													10	205	---	---	---	---	PASS
TNNT2	7139	broad.mit.edu	37	1	201334331	201334331	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201334331G>C	uc001gwf.2	-	10	468	c.399C>G	c.(397-399)CTC>CTG	p.L133L	TNNT2_uc001gwg.2_Silent_p.L123L|TNNT2_uc001gwh.2_Silent_p.L118L|TNNT2_uc001gwi.2_Intron|TNNT2_uc009wzr.2_Silent_p.L64L|TNNT2_uc001gwj.1_5'Flank|TNNT2_uc009wzs.1_Silent_p.L98L|TNNT2_uc001gwk.1_Silent_p.L64L|TNNT2_uc009wzt.1_Silent_p.L123L	NM_000364	NP_000355	P45379	TNNT2_HUMAN	troponin T type 2, cardiac isoform 1	133					ATP catabolic process|muscle filament sliding|negative regulation of ATPase activity|positive regulation of ATPase activity|regulation of heart contraction|response to calcium ion|response to calcium ion|ventricular cardiac muscle tissue morphogenesis	cytosol|troponin complex	actin binding|tropomyosin binding|troponin C binding|troponin I binding				0						TCCTGTCTTTGAGAGAAACGA	0.498													23	517	---	---	---	---	PASS
PPFIA4	8497	broad.mit.edu	37	1	203008380	203008380	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:203008380G>A	uc009xaj.2	+									O75335	LIPA4_HUMAN	SubName: Full=Liprin alpha4;						cell communication	cell surface|cytoplasm	protein binding			ovary(4)|skin(1)	5						GGTAAGGCCCGAAGGCCTGCG	0.587											OREG0014109	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	5	11	---	---	---	---	PASS
SLC26A9	115019	broad.mit.edu	37	1	205896719	205896719	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205896719G>A	uc001hdq.2	-	10	1230	c.1116C>T	c.(1114-1116)CTC>CTT	p.L372L	SLC26A9_uc001hdo.2_Silent_p.L40L|SLC26A9_uc001hdp.2_Silent_p.L372L	NM_052934	NP_443166	Q7LBE3	S26A9_HUMAN	solute carrier family 26, member 9 isoform a	372						integral to membrane	chloride channel activity|secondary active sulfate transmembrane transporter activity			ovary(1)|skin(1)	2	Breast(84;0.201)		BRCA - Breast invasive adenocarcinoma(75;0.0458)			TGCTGCAGCCGAGAGCGATCA	0.557													15	47	---	---	---	---	PASS
LGTN	1939	broad.mit.edu	37	1	206784717	206784717	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206784717G>A	uc001heh.2	-	2	276	c.67C>T	c.(67-69)CGA>TGA	p.R23*	LGTN_uc009xbw.2_Nonsense_Mutation_p.R23*|LGTN_uc010prw.1_Nonsense_Mutation_p.R23*	NM_006893	NP_008824	P41214	EIF2D_HUMAN	ligatin	23					intracellular protein transport	cytoplasm	protein binding|receptor activity|translation initiation factor activity				0	Breast(84;0.183)		BRCA - Breast invasive adenocarcinoma(75;0.166)			ACATCAGCTCGAAGCTTTCTC	0.438													16	99	---	---	---	---	PASS
TGFB2	7042	broad.mit.edu	37	1	218520311	218520311	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:218520311G>A	uc001hlm.2	+	1	921	c.268G>A	c.(268-270)GAG>AAG	p.E90K	TGFB2_uc001hll.2_Missense_Mutation_p.E90K|TGFB2_uc001hln.2_Missense_Mutation_p.E90K|TGFB2_uc010pue.1_RNA|TGFB2_uc001hlo.2_RNA	NM_003238	NP_003229	P61812	TGFB2_HUMAN	transforming growth factor, beta 2 isoform 2	90					activation of protein kinase activity|angiogenesis|cardiac epithelial to mesenchymal transition|cardiac muscle cell proliferation|cardioblast differentiation|catagen|cell cycle arrest|cell death|cell growth|cell-cell junction organization|cell-cell signaling|collagen fibril organization|dopamine biosynthetic process|embryonic digestive tract development|eye development|glial cell migration|hair follicle morphogenesis|hemopoiesis|menstrual cycle phase|negative regulation of alkaline phosphatase activity|negative regulation of cell growth|negative regulation of epithelial cell proliferation|negative regulation of immune response|negative regulation of macrophage cytokine production|neuron development|neutrophil chemotaxis|odontogenesis|pathway-restricted SMAD protein phosphorylation|platelet activation|platelet degranulation|positive regulation of cardioblast differentiation|positive regulation of catagen|positive regulation of cell adhesion mediated by integrin|positive regulation of cell cycle|positive regulation of cell division|positive regulation of cell growth|positive regulation of cell proliferation|positive regulation of epithelial cell migration|positive regulation of epithelial to mesenchymal transition|positive regulation of heart contraction|positive regulation of immune response|positive regulation of integrin biosynthetic process|positive regulation of neuron apoptosis|positive regulation of ossification|positive regulation of phosphatidylinositol 3-kinase cascade|positive regulation of protein secretion|positive regulation of stress-activated MAPK cascade|regulation of transforming growth factor-beta2 production|response to hypoxia|response to progesterone stimulus|salivary gland morphogenesis|SMAD protein import into nucleus|somatic stem cell division|transforming growth factor beta receptor signaling pathway	axon|extracellular matrix|extracellular space|neuronal cell body|platelet alpha granule lumen	beta-amyloid binding|cytokine activity|growth factor activity|protein heterodimerization activity|protein homodimerization activity|receptor signaling protein serine/threonine kinase activity|type II transforming growth factor beta receptor binding				0				all cancers(67;0.0459)|OV - Ovarian serous cystadenocarcinoma(81;0.049)|GBM - Glioblastoma multiforme(131;0.0776)		GGCCGCCTGCGAGCGCGAGAG	0.572													6	31	---	---	---	---	PASS
HLX	3142	broad.mit.edu	37	1	221053402	221053402	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:221053402C>T	uc001hmv.3	+	1	660	c.203C>T	c.(202-204)TCG>TTG	p.S68L		NM_021958	NP_068777	Q14774	HLX_HUMAN	H2.0-like homeobox	68					cell differentiation	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)	2				GBM - Glioblastoma multiforme(131;0.00914)		GCAGGGGCCTCGGCCGCCGCC	0.731													5	7	---	---	---	---	PASS
CAPN2	824	broad.mit.edu	37	1	223958166	223958166	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223958166C>A	uc001hob.3	+	18	2066	c.1842C>A	c.(1840-1842)ATC>ATA	p.I614I	CAPN2_uc010puy.1_Silent_p.I536I|CAPN2_uc001hoc.2_Silent_p.I195I	NM_001748	NP_001739	P17655	CAN2_HUMAN	calpain 2 isoform 1	614	Domain IV.|EF-hand 2.				proteolysis	cytoplasm|plasma membrane				lung(3)|breast(1)|skin(1)	5				GBM - Glioblastoma multiforme(131;0.109)		ACCGAGAAATCGACGTTGACA	0.418													32	64	---	---	---	---	PASS
NVL	4931	broad.mit.edu	37	1	224514112	224514112	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:224514112C>G	uc001hok.2	-	2	155	c.112G>C	c.(112-114)GAT>CAT	p.D38H	NVL_uc001hol.2_Intron|NVL_uc010pvd.1_Missense_Mutation_p.D38H|NVL_uc010pve.1_Intron|NVL_uc010pvf.1_Intron|NVL_uc010pvg.1_Missense_Mutation_p.D38H	NM_002533	NP_002524	O15381	NVL_HUMAN	nuclear VCP-like isoform 1	38						aggresome|cytoplasm|nucleolus	ATP binding|nucleoside-triphosphatase activity			skin(2)	2				GBM - Glioblastoma multiforme(131;0.00501)		CTTTGTAAATCAGACGCTAAG	0.318													24	177	---	---	---	---	PASS
GJC2	57165	broad.mit.edu	37	1	228345525	228345525	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228345525C>T	uc001hsk.2	+	2	241	c.66C>T	c.(64-66)TTC>TTT	p.F22F		NM_020435	NP_065168	Q5T442	CXG2_HUMAN	gap junction protein, gamma 2, 47kDa	22	Cytoplasmic (Potential).				cell death	connexon complex|integral to membrane					0		Prostate(94;0.0405)				ACTCCACCTTCGTGGGCAAGG	0.652													5	12	---	---	---	---	PASS
ACTA1	58	broad.mit.edu	37	1	229568731	229568731	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229568731G>C	uc001htm.2	-							NM_001100	NP_001091	P68133	ACTS_HUMAN	actin, alpha 1, skeletal muscle						muscle filament sliding|skeletal muscle fiber development|skeletal muscle thin filament assembly	actin filament|cytosol|stress fiber|striated muscle thin filament	ADP binding|ATP binding|myosin binding|structural constituent of cytoskeleton				0	Breast(184;0.0858)|Ovarian(103;0.103)	Prostate(94;0.167)			Dornase Alfa(DB00003)	GGGGCAGCCTGACCTGGTGTC	0.716													23	35	---	---	---	---	PASS
TTC13	79573	broad.mit.edu	37	1	231081203	231081203	+	Intron	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:231081203A>G	uc001huf.3	-						TTC13_uc009xfi.2_Intron|TTC13_uc009xfj.2_Intron|TTC13_uc001hug.3_Intron|TTC13_uc009xfk.1_Intron	NM_024525	NP_078801	Q8NBP0	TTC13_HUMAN	tetratricopeptide repeat domain 13 isoform a								binding			ovary(1)|skin(1)	2	Breast(184;0.0871)|Ovarian(103;0.183)	Prostate(94;0.167)		COAD - Colon adenocarcinoma(196;0.243)		GGCTCCTCCTAGTCAGACCAA	0.408													51	203	---	---	---	---	PASS
RYR2	6262	broad.mit.edu	37	1	237758861	237758861	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237758861C>G	uc001hyl.1	+	34	4620	c.4500C>G	c.(4498-4500)CGC>CGG	p.R1500R		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	1500	Cytoplasmic (By similarity).|B30.2/SPRY 3.|4 X approximate repeats.				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)			GGCAAGGACGCAACAATAATG	0.483													18	61	---	---	---	---	PASS
RYR2	6262	broad.mit.edu	37	1	237944913	237944913	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237944913G>C	uc001hyl.1	+	89	12049	c.11929G>C	c.(11929-11931)GAT>CAT	p.D3977H	RYR2_uc010pya.1_Missense_Mutation_p.D392H	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	3977					cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)			TCTGCAGAAGGATATGGTGGT	0.328													4	10	---	---	---	---	PASS
FMN2	56776	broad.mit.edu	37	1	240286514	240286514	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:240286514G>A	uc010pyd.1	+	2	1876	c.1651G>A	c.(1651-1653)GAG>AAG	p.E551K	FMN2_uc010pye.1_Missense_Mutation_p.E551K	NM_020066	NP_064450	Q9NZ56	FMN2_HUMAN	formin 2	551					actin cytoskeleton organization|establishment of meiotic spindle localization|intracellular signal transduction|meiotic chromosome movement towards spindle pole|meiotic metaphase I|multicellular organismal development|oogenesis|polar body extrusion after meiotic divisions		actin binding			ovary(4)|pancreas(3)|skin(3)|large_intestine(1)|central_nervous_system(1)	12	Ovarian(103;0.127)	all_cancers(173;0.013)	OV - Ovarian serous cystadenocarcinoma(106;0.0106)			CAGCCAGCAGGAGAACGGGCC	0.532													43	190	---	---	---	---	PASS
FMN2	56776	broad.mit.edu	37	1	240371515	240371515	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:240371515C>G	uc010pyd.1	+	5	3628	c.3403C>G	c.(3403-3405)CTT>GTT	p.L1135V	FMN2_uc010pye.1_Missense_Mutation_p.L1139V	NM_020066	NP_064450	Q9NZ56	FMN2_HUMAN	formin 2	1135	Pro-rich.|FH1.				actin cytoskeleton organization|establishment of meiotic spindle localization|intracellular signal transduction|meiotic chromosome movement towards spindle pole|meiotic metaphase I|multicellular organismal development|oogenesis|polar body extrusion after meiotic divisions		actin binding			ovary(4)|pancreas(3)|skin(3)|large_intestine(1)|central_nervous_system(1)	12	Ovarian(103;0.127)	all_cancers(173;0.013)	OV - Ovarian serous cystadenocarcinoma(106;0.0106)			TCCTCCCCCTCTTCCCGGAGC	0.706													3	35	---	---	---	---	PASS
NLRP3	114548	broad.mit.edu	37	1	247587146	247587146	+	Intron	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247587146T>C	uc001icr.2	+						NLRP3_uc001ics.2_Intron|NLRP3_uc001icu.2_Intron|NLRP3_uc001icw.2_Intron|NLRP3_uc001icv.2_Intron|NLRP3_uc010pyw.1_Intron|NLRP3_uc001ict.1_Intron	NM_001079821	NP_001073289	Q96P20	NALP3_HUMAN	NLR family, pyrin domain containing 3 isoform a						detection of biotic stimulus|induction of apoptosis|inflammatory response|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|positive regulation of interleukin-1 beta secretion|protein oligomerization|signal transduction	cytoplasm	ATP binding|peptidoglycan binding|protein binding			lung(8)|skin(8)|ovary(7)|upper_aerodigestive_tract(1)|breast(1)|pancreas(1)	26	all_cancers(71;9.66e-05)|all_epithelial(71;1.85e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)	all_cancers(173;0.0172)	OV - Ovarian serous cystadenocarcinoma(106;0.0141)			GTCTTTGCCGTAGATTACCGT	0.512													5	76	---	---	---	---	PASS
OR2C3	81472	broad.mit.edu	37	1	247695440	247695440	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247695440G>T	uc009xgy.2	-	2	736	c.374C>A	c.(373-375)GCT>GAT	p.A125D	C1orf150_uc009xgw.2_Intron|C1orf150_uc001ida.3_Intron|C1orf150_uc001idb.3_Intron|C1orf150_uc009xgx.2_Intron|LOC148824_uc001idd.2_5'Flank	NM_198074	NP_932340	Q8N628	OR2C3_HUMAN	olfactory receptor, family 2, subfamily C,	125	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2	all_cancers(71;4.51e-05)|all_epithelial(71;1.3e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)	all_cancers(173;0.0242)	OV - Ovarian serous cystadenocarcinoma(106;0.0241)			GCAGATGGCAGCGTAGCGGTC	0.567													19	86	---	---	---	---	PASS
TRIM58	25893	broad.mit.edu	37	1	248028218	248028218	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248028218C>T	uc001ido.2	+	3	776	c.728C>T	c.(727-729)CCG>CTG	p.P243L		NM_015431	NP_056246	Q8NG06	TRI58_HUMAN	tripartite motif-containing 58	243						intracellular	zinc ion binding			skin(3)|ovary(1)|pancreas(1)|lung(1)|central_nervous_system(1)	7	all_cancers(71;0.000139)|all_epithelial(71;1.58e-05)|Breast(184;0.0117)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)	all_cancers(173;0.0286)	OV - Ovarian serous cystadenocarcinoma(106;0.0319)			TGCCAGCGCCCGGCCCTGGGT	0.622													8	17	---	---	---	---	PASS
OR2L2	26246	broad.mit.edu	37	1	248202246	248202246	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248202246G>T	uc001idw.2	+	1	773	c.677G>T	c.(676-678)CGC>CTC	p.R226L	OR2L13_uc001ids.2_Intron	NM_001004686	NP_001004686	Q8NH16	OR2L2_HUMAN	olfactory receptor, family 2, subfamily L,	226	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3	all_cancers(71;0.000149)|all_epithelial(71;1.27e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0278)			GCTGTCTACCGCATGCACTCT	0.483													113	333	---	---	---	---	PASS
OR2L3	391192	broad.mit.edu	37	1	248224439	248224439	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248224439G>T	uc001idx.1	+	1	456	c.456G>T	c.(454-456)TCG>TCT	p.S152S	OR2L13_uc001ids.2_Intron	NM_001004687	NP_001004687	Q8NG85	OR2L3_HUMAN	olfactory receptor, family 2, subfamily L,	152	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(71;0.000149)|all_epithelial(71;1.27e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0278)			TCATAGGCTCGATCAATGCTT	0.433													174	290	---	---	---	---	PASS
OR2T3	343173	broad.mit.edu	37	1	248637513	248637513	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248637513C>T	uc001iel.1	+	1	862	c.862C>T	c.(862-864)CCT>TCT	p.P288S		NM_001005495	NP_001005495	Q8NH03	OR2T3_HUMAN	olfactory receptor, family 2, subfamily T,	288	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)			CATCTTCACTCCTGTGCTGAA	0.498													31	620	---	---	---	---	PASS
OR2T34	127068	broad.mit.edu	37	1	248737197	248737197	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248737197G>A	uc001iep.1	-	1	862	c.862C>T	c.(862-864)CCT>TCT	p.P288S		NM_001001821	NP_001001821	Q8NGX1	O2T34_HUMAN	olfactory receptor, family 2, subfamily T,	288	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(1)|ovary(1)	2	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)			TTCAGCACAGGAGTGAAGATG	0.498													11	148	---	---	---	---	PASS
ZNF692	55657	broad.mit.edu	37	1	249149643	249149643	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:249149643C>T	uc001ifc.1	-	9	1141	c.974G>A	c.(973-975)AGA>AAA	p.R325K	ZNF692_uc001iez.1_Missense_Mutation_p.R47K|ZNF692_uc001ifa.1_Missense_Mutation_p.R47K|ZNF692_uc001ifb.1_Missense_Mutation_p.R121K|ZNF692_uc001ifd.1_Missense_Mutation_p.R324K|ZNF692_uc001ife.1_RNA|ZNF692_uc001iff.1_Missense_Mutation_p.R280K|ZNF692_uc010pzr.1_Missense_Mutation_p.R330K	NM_017865	NP_060335	Q9BU19	ZN692_HUMAN	zinc finger protein 692 isoform 2	325					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(71;3.33e-06)|all_epithelial(71;2.41e-06)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.0458)|Lung NSC(105;0.0494)|Melanoma(84;0.199)	all_cancers(173;0.19)	OV - Ovarian serous cystadenocarcinoma(106;0.00805)			CATCAGCTCTCTTTTGGCAGC	0.577													22	185	---	---	---	---	PASS
TPO	7173	broad.mit.edu	37	2	1437379	1437379	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1437379G>A	uc002qww.2	+	4	440	c.349G>A	c.(349-351)GAT>AAT	p.D117N	TPO_uc010ewj.2_Intron|TPO_uc010yin.1_Missense_Mutation_p.D117N|TPO_uc002qwu.2_Missense_Mutation_p.D117N|TPO_uc002qwr.2_Missense_Mutation_p.D117N|TPO_uc002qwx.2_Missense_Mutation_p.D117N|TPO_uc010yio.1_Missense_Mutation_p.D117N|TPO_uc010yip.1_Missense_Mutation_p.D117N	NM_000547	NP_000538	P07202	PERT_HUMAN	thyroid peroxidase isoform a	117	Extracellular (Potential).				cellular nitrogen compound metabolic process|hormone biosynthetic process|hydrogen peroxide catabolic process	cell surface|cytoplasm|integral to plasma membrane	calcium ion binding|heme binding|iodide peroxidase activity			ovary(7)|pancreas(6)|skin(5)|lung(1)|kidney(1)	20	all_hematologic(175;0.0487)|Acute lymphoblastic leukemia(172;0.0627)	all_cancers(51;0.0338)		all cancers(51;0.0356)|OV - Ovarian serous cystadenocarcinoma(76;0.0748)|Epithelial(75;0.12)	Carbimazole(DB00389)|Methimazole(DB00763)|Propylthiouracil(DB00550)	GCATCCAACGGGTAATGTGTG	0.498													19	56	---	---	---	---	PASS
PXDN	7837	broad.mit.edu	37	2	1653434	1653434	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1653434G>A	uc002qxa.2	-	17	2182	c.2118C>T	c.(2116-2118)AAC>AAT	p.N706N		NM_012293	NP_036425	Q92626	PXDN_HUMAN	peroxidasin precursor	706					extracellular matrix organization|hydrogen peroxide catabolic process|immune response	endoplasmic reticulum|extracellular space|proteinaceous extracellular matrix	extracellular matrix structural constituent|heme binding|interleukin-1 receptor antagonist activity|peroxidase activity			pancreas(6)|ovary(2)	8	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.0845)|Lung NSC(108;0.00641)|all_epithelial(98;0.00716)		all cancers(51;0.0492)|OV - Ovarian serous cystadenocarcinoma(76;0.0973)|Epithelial(75;0.17)|GBM - Glioblastoma multiforme(21;0.228)		ACACCAGGTCGTTGTAGTGGT	0.592													35	158	---	---	---	---	PASS
CMPK2	129607	broad.mit.edu	37	2	7003644	7003644	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:7003644G>A	uc002qyo.2	-	2	850	c.741C>T	c.(739-741)ATC>ATT	p.I247I	CMPK2_uc010yis.1_Silent_p.I247I|CMPK2_uc010ewv.2_Silent_p.I247I	NM_207315	NP_997198	Q5EBM0	CMPK2_HUMAN	UMP-CMP kinase 2 precursor	247					dTDP biosynthetic process	mitochondrion	ATP binding|cytidylate kinase activity|thymidylate kinase activity|UMP kinase activity				0	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)					TTCCTTTCTGGATCTGTTTTG	0.453													26	285	---	---	---	---	PASS
PDIA6	10130	broad.mit.edu	37	2	10930911	10930911	+	Silent	SNP	C	T	T	rs145487229	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:10930911C>T	uc002rau.2	-	7	771	c.633G>A	c.(631-633)ACG>ACA	p.T211T	PDIA6_uc010yjg.1_Silent_p.T208T|PDIA6_uc002rav.2_Silent_p.T263T|PDIA6_uc010yjh.1_Silent_p.T216T|PDIA6_uc002raw.2_Silent_p.T259T	NM_005742	NP_005733	Q15084	PDIA6_HUMAN	protein disulfide isomerase A6 precursor	211	Thioredoxin 2.				cell redox homeostasis|glycerol ether metabolic process|protein folding	endoplasmic reticulum lumen|ER-Golgi intermediate compartment|melanosome|plasma membrane	electron carrier activity|protein binding|protein disulfide isomerase activity|protein disulfide oxidoreductase activity				0	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.191)			Epithelial(75;0.149)|OV - Ovarian serous cystadenocarcinoma(76;0.15)		CTTTTCCTTTCGTCTGCTCTT	0.383													24	160	---	---	---	---	PASS
NBAS	51594	broad.mit.edu	37	2	15676580	15676580	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:15676580G>A	uc002rcc.1	-	8	635	c.609C>T	c.(607-609)GTC>GTT	p.V203V	NBAS_uc002rcd.1_RNA	NM_015909	NP_056993	A2RRP1	NBAS_HUMAN	neuroblastoma-amplified protein	203										ovary(2)|liver(1)|skin(1)	4						GGTAATTGATGACCAGGAGTT	0.363													45	249	---	---	---	---	PASS
ITSN2	50618	broad.mit.edu	37	2	24494810	24494810	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:24494810C>T	uc002rfe.2	-	19	2340	c.2082G>A	c.(2080-2082)AGG>AGA	p.R694R	ITSN2_uc002rff.2_Silent_p.R667R|ITSN2_uc002rfg.2_Silent_p.R694R	NM_006277	NP_006268	Q9NZM3	ITSN2_HUMAN	intersectin 2 isoform 1	694	Potential.				endocytosis|regulation of Rho protein signal transduction	cytoplasm	calcium ion binding|Rho guanyl-nucleotide exchange factor activity|SH3/SH2 adaptor activity			kidney(2)|ovary(1)|central_nervous_system(1)	4	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					gctttgctttcctttACATAA	0.139													4	38	---	---	---	---	PASS
MEMO1	51072	broad.mit.edu	37	2	32145919	32145919	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32145919G>A	uc002rnx.2	-	4	655	c.273C>T	c.(271-273)TCC>TCT	p.S91S	MEMO1_uc010ymu.1_Silent_p.S68S|MEMO1_uc010ezq.2_Silent_p.S91S|MEMO1_uc002rny.2_RNA|MEMO1_uc002rnz.2_RNA|MEMO1_uc010ymv.1_RNA	NM_015955	NP_057039	Q9Y316	MEMO1_HUMAN	mediator of cell motility 1 isoform 1	91					regulation of microtubule-based process	cytosol|nucleus				ovary(1)|skin(1)	2	Acute lymphoblastic leukemia(172;0.155)					TATCCACACTGGAAAGTGCAC	0.378													16	165	---	---	---	---	PASS
STON1-GTF2A1L	286749	broad.mit.edu	37	2	48897062	48897062	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48897062G>A	uc010yol.1	+	6	3198	c.3151G>A	c.(3151-3153)GAG>AAG	p.E1051K	STON1-GTF2A1L_uc002rwp.1_Missense_Mutation_p.E1098K|GTF2A1L_uc002rws.1_Missense_Mutation_p.E394K|GTF2A1L_uc010yom.1_Missense_Mutation_p.E360K|GTF2A1L_uc002rwt.2_Missense_Mutation_p.E394K	NM_006873	NP_006864	B7ZL16	B7ZL16_HUMAN	stonin 1	1051					endocytosis|intracellular protein transport|transcription initiation from RNA polymerase II promoter	clathrin adaptor complex|transcription factor TFIIA complex				ovary(3)|pancreas(1)|skin(1)	5		all_hematologic(82;0.151)|Acute lymphoblastic leukemia(82;0.176)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)			TATTTCAAATGAGGATTCAGC	0.383													8	202	---	---	---	---	PASS
LHCGR	3973	broad.mit.edu	37	2	48950583	48950583	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48950583G>A	uc002rwu.3	-						GTF2A1L_uc002rwt.2_Intron|LHCGR_uc002rwv.2_Intron	NM_000233	NP_000224	P22888	LSHR_HUMAN	luteinizing hormone/choriogonadotropin receptor						male genitalia development|male gonad development	endosome|integral to plasma membrane	luteinizing hormone receptor activity			ovary(3)|lung(2)|breast(2)|skin(1)	8		all_hematologic(82;0.151)|Acute lymphoblastic leukemia(82;0.176)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)		Cetrorelix(DB00050)|Choriogonadotropin alfa(DB00097)|Goserelin(DB00014)|Lutropin alfa(DB00044)|Menotropins(DB00032)	ACAAATCTGGGAGTTTACTCA	0.418									Familial_Male-Limited_Precocious_Puberty				8	81	---	---	---	---	PASS
NRXN1	9378	broad.mit.edu	37	2	51254939	51254939	+	Missense_Mutation	SNP	A	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:51254939A>T	uc010fbq.2	-	2	1950	c.473T>A	c.(472-474)CTG>CAG	p.L158Q	NRXN1_uc002rxe.3_Missense_Mutation_p.L158Q|NRXN1_uc002rxd.1_Missense_Mutation_p.L158Q	NM_001135659	NP_001129131	P58400	NRX1B_HUMAN	neurexin 1 isoform alpha2 precursor	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					angiogenesis|neuron cell-cell adhesion|neuronal signal transduction	cell surface|endocytic vesicle|integral to membrane|presynaptic membrane	cell adhesion molecule binding|receptor binding			ovary(2)	2		all_hematologic(82;0.152)|Acute lymphoblastic leukemia(82;0.192)	Lung(47;0.0813)|LUSC - Lung squamous cell carcinoma(58;0.116)			TTCCGGGGGCAGCCCCCCGAC	0.657													6	42	---	---	---	---	PASS
ASB3	51130	broad.mit.edu	37	2	53897777	53897777	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:53897777G>A	uc002rxg.1	-	10	1555	c.1420C>T	c.(1420-1422)CTA>TTA	p.L474L	ASB3_uc002rxh.1_Silent_p.L401L|ASB3_uc002rxi.3_Silent_p.L512L|ASB3_uc002rxf.1_RNA	NM_016115	NP_057199	Q9Y575	ASB3_HUMAN	ankyrin repeat and SOCS box-containing protein 3	474	SOCS box.				intracellular signal transduction					ovary(1)|kidney(1)	2			Lung(47;0.125)|LUSC - Lung squamous cell carcinoma(58;0.181)			TCTGATTTTAGACTGGACCGA	0.403													14	90	---	---	---	---	PASS
BCL11A	53335	broad.mit.edu	37	2	60689209	60689209	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:60689209C>G	uc002sae.1	-	4	1066	c.838G>C	c.(838-840)GAG>CAG	p.E280Q	BCL11A_uc002sab.2_Missense_Mutation_p.E280Q|BCL11A_uc002sac.2_Intron|BCL11A_uc010ypi.1_Intron|BCL11A_uc010ypj.1_Missense_Mutation_p.E246Q|BCL11A_uc002sad.1_Missense_Mutation_p.E128Q|BCL11A_uc002saf.1_Missense_Mutation_p.E246Q	NM_022893	NP_075044	Q9H165	BC11A_HUMAN	B-cell CLL/lymphoma 11A isoform 1	280	Pro-rich.				negative regulation of axon extension|negative regulation of collateral sprouting|negative regulation of dendrite development|positive regulation of collateral sprouting|positive regulation of neuron projection development|positive regulation of transcription from RNA polymerase II promoter|protein sumoylation|regulation of dendrite development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|cytoplasm|nucleus|nucleus	nucleic acid binding|protein heterodimerization activity|protein homodimerization activity|zinc ion binding			central_nervous_system(6)|breast(3)|ovary(2)|skin(2)	13			LUSC - Lung squamous cell carcinoma(5;9.29e-08)|Lung(5;1.34e-06)|Epithelial(17;0.0562)|all cancers(80;0.199)			CCCAGGCGCTCTATGCGGTGG	0.627			T	IGH@	B-CLL								32	203	---	---	---	---	PASS
USP34	9736	broad.mit.edu	37	2	61512052	61512052	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61512052C>T	uc002sbe.2	-	35	4812	c.4790G>A	c.(4789-4791)CGA>CAA	p.R1597Q		NM_014709	NP_055524	Q70CQ2	UBP34_HUMAN	ubiquitin specific protease 34	1597					positive regulation of canonical Wnt receptor signaling pathway|protein K48-linked deubiquitination|ubiquitin-dependent protein catabolic process|Wnt receptor signaling pathway		cysteine-type endopeptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(8)|breast(5)|skin(3)|lung(2)|prostate(1)	19			Epithelial(17;0.229)			AGACATAAGTCGCTGAATCAA	0.294													3	26	---	---	---	---	PASS
RAB1A	5861	broad.mit.edu	37	2	65316076	65316076	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:65316076C>T	uc002sdm.2	-	5	803	c.417G>A	c.(415-417)GCG>GCA	p.A139A	RAB1A_uc002sdn.2_Intron|RAB1A_uc010yqe.1_Silent_p.A107A|RAB1A_uc002sdo.2_Silent_p.A75A	NM_004161	NP_004152	P62820	RAB1A_HUMAN	RAB1A, member RAS oncogene family isoform 1	139					protein transport|small GTPase mediated signal transduction|vesicle-mediated transport	endoplasmic reticulum|Golgi apparatus	GTP binding|GTPase activity				0						AACATACCTTCGCTGTTGTGT	0.353													3	22	---	---	---	---	PASS
NFU1	27247	broad.mit.edu	37	2	69642328	69642328	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:69642328G>A	uc002sfk.2	-	5	672	c.473C>T	c.(472-474)TCA>TTA	p.S158L	NFU1_uc002sfj.2_Missense_Mutation_p.S134L|NFU1_uc002sfl.2_Missense_Mutation_p.S17L|NFU1_uc002sfm.2_Missense_Mutation_p.S17L|NFU1_uc010fdi.2_RNA|NFU1_uc002sfn.1_Missense_Mutation_p.S158L	NM_001002755	NP_001002755	Q9UMS0	NFU1_HUMAN	HIRA interacting protein 5 isoform 2	158				S -> P (in Ref. 4; AAD27742).	iron-sulfur cluster assembly	cytosol|mitochondrion|nucleus	4 iron, 4 sulfur cluster binding|iron ion binding|protein binding				0						TGCTTCTCCTGAAGGTGTTTC	0.343													21	109	---	---	---	---	PASS
ZNF638	27332	broad.mit.edu	37	2	71651066	71651066	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71651066G>A	uc002shx.2	+	22	4741	c.4422G>A	c.(4420-4422)CTG>CTA	p.L1474L	ZNF638_uc010yqw.1_Silent_p.L1053L|ZNF638_uc002shy.2_Silent_p.L1474L|ZNF638_uc002shz.2_Silent_p.L1474L|ZNF638_uc002sia.2_Silent_p.L1474L|ZNF638_uc002sib.1_Intron|ZNF638_uc010fed.2_Intron|ZNF638_uc002sic.2_Silent_p.L571L|ZNF638_uc002sid.2_Intron	NM_014497	NP_055312	Q14966	ZN638_HUMAN	zinc finger protein 638	1474					RNA splicing	cytoplasm|nuclear speck	double-stranded DNA binding|nucleotide binding|RNA binding|zinc ion binding			pancreas(2)|ovary(1)|skin(1)	4						TCTCAGCCCTGCAAGGCAAGC	0.463													7	73	---	---	---	---	PASS
ALMS1	7840	broad.mit.edu	37	2	73675343	73675343	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73675343G>A	uc002sje.1	+	10	1803	c.1692G>A	c.(1690-1692)CAG>CAA	p.Q564Q	ALMS1_uc002sjf.1_Silent_p.Q520Q|ALMS1_uc002sjg.2_5'UTR|ALMS1_uc002sjh.1_5'UTR	NM_015120	NP_055935	Q8TCU4	ALMS1_HUMAN	Alstrom syndrome 1	562	1.|34 X 47 AA approximate tandem repeat.				G2/M transition of mitotic cell cycle	centrosome|cilium|cytosol|microtubule basal body|spindle pole				skin(3)|ovary(2)|breast(2)|pancreas(1)|lung(1)	9						CAGCTGACCAGAAGACTGCAA	0.468													27	156	---	---	---	---	PASS
VAMP5	10791	broad.mit.edu	37	2	85820097	85820097	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:85820097G>A	uc002spu.1	+	3	251	c.168G>A	c.(166-168)CAG>CAA	p.Q56Q	RNF181_uc002spv.1_5'Flank	NM_006634	NP_006625	O95183	VAMP5_HUMAN	vesicle-associated membrane protein 5	56	v-SNARE coiled-coil homology.|Cytoplasmic (Potential).				cell differentiation|vesicle-mediated transport	endomembrane system					0						AGACTACACAGAACCTGGCCC	0.582													42	292	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	2	89247041	89247041	+	RNA	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:89247041G>A	uc010ytr.1	-	101		c.8018C>T			uc002stl.2_Intron					Parts of antibodies, mostly variable regions.																		CCCGGCAAGTGATGGTGACTC	0.488													9	254	---	---	---	---	PASS
SNRNP200	23020	broad.mit.edu	37	2	96942733	96942733	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:96942733G>A	uc002svu.2	-						SNRNP200_uc002svt.2_Intron|SNRNP200_uc010yuj.1_Intron	NM_014014	NP_054733	O75643	U520_HUMAN	activating signal cointegrator 1 complex subunit							catalytic step 2 spliceosome|nucleoplasm|U5 snRNP	ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding			ovary(5)|skin(4)|large_intestine(1)	10						ACTGCAGGGGGAGAGGAGGGG	0.642													16	171	---	---	---	---	PASS
RANBP2	5903	broad.mit.edu	37	2	109400049	109400049	+	Intron	SNP	C	T	T	rs74532818		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:109400049C>T	uc002tem.3	+							NM_006267	NP_006258	P49792	RBP2_HUMAN	RAN binding protein 2						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA transport|protein folding|protein import into nucleus|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|nuclear pore	peptidyl-prolyl cis-trans isomerase activity|Ran GTPase binding|zinc ion binding		RANBP2/ALK(16)	soft_tissue(16)|lung(1)|pancreas(1)	18						atctttttttCAGGGAGGAGA	0.289													8	128	---	---	---	---	PASS
ZC3H6	376940	broad.mit.edu	37	2	113088861	113088861	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:113088861G>C	uc002thq.1	+	12	2760	c.2366G>C	c.(2365-2367)AGA>ACA	p.R789T		NM_198581	NP_940983	P61129	ZC3H6_HUMAN	zinc finger CCCH-type domain containing 6	789							nucleic acid binding|zinc ion binding			ovary(3)|central_nervous_system(1)	4						AGGAAATTGAGAGGGAATGGA	0.473													21	142	---	---	---	---	PASS
ZC3H6	376940	broad.mit.edu	37	2	113089966	113089966	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:113089966G>A	uc002thq.1	+	12	3865	c.3471G>A	c.(3469-3471)GGG>GGA	p.G1157G		NM_198581	NP_940983	P61129	ZC3H6_HUMAN	zinc finger CCCH-type domain containing 6	1157							nucleic acid binding|zinc ion binding			ovary(3)|central_nervous_system(1)	4						CAGGACAGGGGAGCCCGACCC	0.483													21	121	---	---	---	---	PASS
IL1F5	26525	broad.mit.edu	37	2	113818440	113818440	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:113818440C>T	uc002tis.2	+	3	174	c.41C>T	c.(40-42)TCG>TTG	p.S14L	IL1F5_uc002tit.2_Missense_Mutation_p.S14L	NM_173170	NP_775262	Q9UBH0	I36RA_HUMAN	interleukin 1 family, member 5	14						extracellular space	cytokine activity|interleukin-1 receptor antagonist activity				0						ATGAAGGACTCGGCATTGAAG	0.502													6	86	---	---	---	---	PASS
MARCO	8685	broad.mit.edu	37	2	119699912	119699912	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:119699912C>G	uc002tln.1	+	1	168	c.36C>G	c.(34-36)CTC>CTG	p.L12L	MARCO_uc010yyf.1_5'UTR	NM_006770	NP_006761	Q9UEW3	MARCO_HUMAN	macrophage receptor with collagenous structure	12	Cytoplasmic (Potential).				cell surface receptor linked signaling pathway|innate immune response	collagen|integral to plasma membrane	pattern recognition receptor activity|scavenger receptor activity			ovary(3)|skin(2)|central_nervous_system(1)	6						AGGACGAGCTCTTGAGTGAGA	0.438													23	176	---	---	---	---	PASS
GPR39	2863	broad.mit.edu	37	2	133403613	133403613	+	3'UTR	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:133403613C>A	uc002ttl.2	+	2					LYPD1_uc002ttm.3_3'UTR|LYPD1_uc002ttn.2_3'UTR|LYPD1_uc002tto.2_3'UTR	NM_001508	NP_001499	O43194	GPR39_HUMAN	G protein-coupled receptor 39							integral to plasma membrane	G-protein coupled receptor activity|metal ion binding				0						GCATCTCCTTCAGCTTCAGCA	0.582													21	129	---	---	---	---	PASS
MGAT5	4249	broad.mit.edu	37	2	135102562	135102562	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:135102562G>C	uc002ttv.1	+	8	1184	c.1039G>C	c.(1039-1041)GAG>CAG	p.E347Q		NM_002410	NP_002401	Q09328	MGT5A_HUMAN	N-acetylglucosaminyltransferase V	347	Lumenal (Potential).				post-translational protein modification|protein N-linked glycosylation via asparagine	Golgi membrane|integral to membrane	alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase activity			ovary(2)|skin(1)	3				BRCA - Breast invasive adenocarcinoma(221;0.0964)		CAGAATTGTTGAGCTCATTTA	0.413													8	181	---	---	---	---	PASS
DARS	1615	broad.mit.edu	37	2	136700965	136700965	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:136700965C>G	uc002tux.1	-	5	590	c.406G>C	c.(406-408)GAG>CAG	p.E136Q	DARS_uc010fnj.1_Missense_Mutation_p.E36Q	NM_001349	NP_001340	P14868	SYDC_HUMAN	aspartyl-tRNA synthetase	136					aspartyl-tRNA aminoacylation|protein complex assembly	cytosol|nuclear membrane|plasma membrane|soluble fraction	aminoacylase activity|aspartate-tRNA ligase activity|ATP binding|nucleic acid binding|protein binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.168)	L-Aspartic Acid(DB00128)	ACATGTAACTCAACGTCTTGC	0.323													14	317	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141200073	141200073	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141200073C>T	uc002tvj.1	-	66	11386	c.10414G>A	c.(10414-10416)GAT>AAT	p.D3472N		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	3472	Extracellular (Potential).|LDL-receptor class A 24.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		AGACACTCACCGCAGTTGGCC	0.448										TSP Lung(27;0.18)			10	118	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141272315	141272315	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141272315C>A	uc002tvj.1	-	51	9148	c.8176G>T	c.(8176-8178)GCT>TCT	p.A2726S		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	2726	Extracellular (Potential).|LDL-receptor class A 16.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		GCGGAACAAGCAAATTGGTTC	0.323										TSP Lung(27;0.18)			23	113	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141272329	141272329	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141272329G>T	uc002tvj.1	-	51	9134	c.8162C>A	c.(8161-8163)TCT>TAT	p.S2721Y		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	2721	Extracellular (Potential).|LDL-receptor class A 16.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		TTGGTTCCAAGAGCAAGAAGA	0.303										TSP Lung(27;0.18)			13	109	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141474323	141474323	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141474323G>A	uc002tvj.1	-	36	6793	c.5821C>T	c.(5821-5823)CAG>TAG	p.Q1941*		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	1941	Extracellular (Potential).|LDL-receptor class B 19.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		TTCCAAGTCTGATCTCTTTTA	0.373										TSP Lung(27;0.18)			12	191	---	---	---	---	PASS
ORC4L	5000	broad.mit.edu	37	2	148705764	148705764	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:148705764C>T	uc002twi.2	-	9	753	c.618G>A	c.(616-618)GTG>GTA	p.V206V	ORC4L_uc002twj.2_Silent_p.V206V|ORC4L_uc010zbo.1_Silent_p.V132V|ORC4L_uc010zbp.1_5'UTR|ORC4L_uc010fnr.2_Silent_p.V206V|ORC4L_uc010zbq.1_Silent_p.V122V|ORC4L_uc002twk.2_Silent_p.V206V|ORC4L_uc010zbr.1_Silent_p.V206V	NM_181741	NP_859525	O43929	ORC4_HUMAN	origin recognition complex subunit 4	206					cell cycle checkpoint|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|S phase of mitotic cell cycle	nuclear origin of replication recognition complex|nucleoplasm	ATP binding|DNA replication origin binding|nucleoside-triphosphatase activity|protein binding				0				BRCA - Breast invasive adenocarcinoma(221;0.0963)|COAD - Colon adenocarcinoma(177;0.203)		ATCTTGACTTCACTCTTTTTT	0.299													10	119	---	---	---	---	PASS
MBD5	55777	broad.mit.edu	37	2	149247447	149247447	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:149247447G>C	uc002twm.3	+	12	4535	c.3547G>C	c.(3547-3549)GAA>CAA	p.E1183Q	MBD5_uc010zbs.1_Intron|MBD5_uc010fns.2_Missense_Mutation_p.E1183Q|MBD5_uc002two.2_Missense_Mutation_p.E441Q|MBD5_uc002twp.2_Missense_Mutation_p.E233Q	NM_018328	NP_060798	Q9P267	MBD5_HUMAN	methyl-CpG binding domain protein 5	1183						chromosome|nucleus	chromatin binding|DNA binding			skin(3)|ovary(2)	5				BRCA - Breast invasive adenocarcinoma(221;0.0569)		AGATGGGTTTGAATATTTCAA	0.493													11	195	---	---	---	---	PASS
GALNT5	11227	broad.mit.edu	37	2	158115055	158115055	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:158115055C>G	uc002tzg.2	+	1	716	c.461C>G	c.(460-462)TCC>TGC	p.S154C	GALNT5_uc010zci.1_RNA	NM_014568	NP_055383	Q7Z7M9	GALT5_HUMAN	N-acetylgalactosaminyltransferase 5	154	Lumenal (Potential).				glycosaminoglycan biosynthetic process	Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			breast(3)|skin(1)	4						CCTGAAGCCTCCTCTCACCAG	0.532													15	143	---	---	---	---	PASS
CCDC148	130940	broad.mit.edu	37	2	159166154	159166154	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:159166154G>A	uc002tzq.2	-						CCDC148_uc002tzr.2_Intron|CCDC148_uc010foh.2_Intron|CCDC148_uc010foi.1_Intron|CCDC148_uc010foj.1_Intron|CCDC148_uc010fok.1_Intron	NM_138803	NP_620158	Q8NFR7	CC148_HUMAN	coiled-coil domain containing 148											ovary(2)	2						TGTTCAACCTGAAAAGATAAC	0.284													25	84	---	---	---	---	PASS
PLA2R1	22925	broad.mit.edu	37	2	160806154	160806154	+	Nonsense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160806154G>C	uc002ube.1	-	25	3881	c.3674C>G	c.(3673-3675)TCA>TGA	p.S1225*	PLA2R1_uc010zcp.1_Nonsense_Mutation_p.S1225*|PLA2R1_uc002ubf.2_Nonsense_Mutation_p.S1225*	NM_007366	NP_031392	Q13018	PLA2R_HUMAN	phospholipase A2 receptor 1 isoform 1 precursor	1225	Extracellular (Potential).|C-type lectin 7.				endocytosis	extracellular space|integral to plasma membrane	receptor activity|sugar binding			skin(2)|ovary(1)	3						TTGCAGAAATGACTCGCAGGC	0.363													14	76	---	---	---	---	PASS
IFIH1	64135	broad.mit.edu	37	2	163130385	163130385	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:163130385C>T	uc002uce.2	-	12	2596	c.2374G>A	c.(2374-2376)GCA>ACA	p.A792T		NM_022168	NP_071451	Q9BYX4	IFIH1_HUMAN	interferon induced with helicase C domain 1	792	Helicase C-terminal.				detection of virus|innate immune response|interspecies interaction between organisms|negative regulation of type I interferon production|positive regulation of interferon-alpha production|positive regulation of interferon-beta production|regulation of apoptosis	cytosol|nucleus	ATP binding|DNA binding|double-stranded RNA binding|helicase activity|protein binding|ribonucleoprotein binding|zinc ion binding			ovary(1)	1						CCTTCTTCTGCCACTGTGGTA	0.338													33	148	---	---	---	---	PASS
KCNH7	90134	broad.mit.edu	37	2	163374451	163374451	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:163374451G>T	uc002uch.1	-	4	893	c.681C>A	c.(679-681)CCC>CCA	p.P227P	KCNH7_uc002uci.2_Silent_p.P227P	NM_033272	NP_150375	Q9NS40	KCNH7_HUMAN	potassium voltage-gated channel, subfamily H,	227	Cytoplasmic (Potential).				regulation of transcription, DNA-dependent	integral to membrane	protein binding|signal transducer activity			ovary(3)|skin(2)	5					Ibutilide(DB00308)	TATTCACCAAGGGAGAACATT	0.483													43	199	---	---	---	---	PASS
FIGN	55137	broad.mit.edu	37	2	164468167	164468167	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:164468167T>C	uc002uck.1	-	3	486	c.175A>G	c.(175-177)ATA>GTA	p.I59V		NM_018086	NP_060556	Q5HY92	FIGN_HUMAN	fidgetin	59						nuclear matrix	ATP binding|nucleoside-triphosphatase activity			large_intestine(2)|ovary(1)|skin(1)	4						AGAGCAGATATGTCATCATTC	0.493													91	224	---	---	---	---	PASS
SCN3A	6328	broad.mit.edu	37	2	165994424	165994424	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:165994424C>T	uc002ucx.2	-	15	2848	c.2356G>A	c.(2356-2358)GAG>AAG	p.E786K	SCN3A_uc002ucy.2_Missense_Mutation_p.E737K|SCN3A_uc002ucz.2_Missense_Mutation_p.E737K|SCN3A_uc002uda.1_Missense_Mutation_p.E606K|SCN3A_uc002udb.1_Missense_Mutation_p.E606K	NM_006922	NP_008853	Q9NY46	SCN3A_HUMAN	sodium channel, voltage-gated, type III, alpha	786						voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(4)|breast(3)|skin(2)|central_nervous_system(1)	10					Lamotrigine(DB00555)	CTGAATTGCTCAGTCATGGGG	0.383													25	137	---	---	---	---	PASS
TTC21B	79809	broad.mit.edu	37	2	166786171	166786171	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:166786171C>A	uc002udk.2	-	10	1307	c.1174G>T	c.(1174-1176)GGA>TGA	p.G392*	TTC21B_uc002udl.2_Nonsense_Mutation_p.G392*	NM_024753	NP_079029	Q7Z4L5	TT21B_HUMAN	tetratricopeptide repeat domain 21B	392						cilium axoneme|cytoplasm|cytoskeleton	binding			ovary(2)|pancreas(2)|breast(1)	5						GCAGATTTTCCAATGGATTGC	0.323													23	67	---	---	---	---	PASS
XIRP2	129446	broad.mit.edu	37	2	168100159	168100159	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:168100159G>A	uc002udx.2	+	8	2275	c.2257G>A	c.(2257-2259)GAA>AAA	p.E753K	XIRP2_uc010fpn.2_Intron|XIRP2_uc010fpo.2_Intron|XIRP2_uc010fpp.2_Intron|XIRP2_uc002udy.2_Missense_Mutation_p.E578K|XIRP2_uc010fpq.2_Missense_Mutation_p.E531K|XIRP2_uc010fpr.2_Intron	NM_152381	NP_689594	A4UGR9	XIRP2_HUMAN	xin actin-binding repeat containing 2 isoform 1	578					actin cytoskeleton organization	cell junction	actin binding			skin(7)|ovary(6)|pancreas(1)	14						CCAAATGCTGGAAATTAAAAC	0.363													9	137	---	---	---	---	PASS
LRP2	4036	broad.mit.edu	37	2	170012911	170012911	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170012911G>A	uc002ues.2	-	65	12237	c.12024C>T	c.(12022-12024)ATC>ATT	p.I4008I		NM_004525	NP_004516	P98164	LRP2_HUMAN	low density lipoprotein-related protein 2	4008	EGF-like 15; calcium-binding (Potential).|Extracellular (Potential).				hormone biosynthetic process|protein glycosylation|receptor-mediated endocytosis|vitamin D metabolic process	coated pit|integral to membrane|lysosome	calcium ion binding|receptor activity|SH3 domain binding			ovary(13)|skin(6)|central_nervous_system(4)|large_intestine(3)|kidney(2)|pancreas(1)	29				STAD - Stomach adenocarcinoma(1183;0.000766)|COAD - Colon adenocarcinoma(177;0.0101)	Gentamicin(DB00798)|Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Urokinase(DB00013)	CACATTCATTGATATCTGTAG	0.418													11	169	---	---	---	---	PASS
LRP2	4036	broad.mit.edu	37	2	170097688	170097688	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170097688G>A	uc002ues.2	-	25	4068	c.3855C>T	c.(3853-3855)CAC>CAT	p.H1285H	LRP2_uc010zdf.1_Silent_p.H1148H	NM_004525	NP_004516	P98164	LRP2_HUMAN	low density lipoprotein-related protein 2	1285	LDL-receptor class A 14.|Extracellular (Potential).				hormone biosynthetic process|protein glycosylation|receptor-mediated endocytosis|vitamin D metabolic process	coated pit|integral to membrane|lysosome	calcium ion binding|receptor activity|SH3 domain binding			ovary(13)|skin(6)|central_nervous_system(4)|large_intestine(3)|kidney(2)|pancreas(1)	29				STAD - Stomach adenocarcinoma(1183;0.000766)|COAD - Colon adenocarcinoma(177;0.0101)	Gentamicin(DB00798)|Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Urokinase(DB00013)	GCCATGCCCTGTGGATGCAGT	0.527													81	182	---	---	---	---	PASS
HOXD4	3233	broad.mit.edu	37	2	177017467	177017467	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:177017467C>T	uc002uks.2	+	2	814	c.565C>T	c.(565-567)CAC>TAC	p.H189Y		NM_014621	NP_055436	P09016	HXD4_HUMAN	homeobox D4	189	Homeobox.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			pancreas(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.00765)|Epithelial(96;0.105)	Colorectal(32;0.0224)|READ - Rectum adenocarcinoma(9;0.0556)		TGAAATCGCTCACACCCTGTG	0.512													19	233	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179453829	179453829	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179453829C>T	uc010zfg.1	-	253	55143	c.54919G>A	c.(54919-54921)GAT>AAT	p.D18307N	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.D12002N|TTN_uc010zfi.1_Missense_Mutation_p.D11935N|TTN_uc010zfj.1_Missense_Mutation_p.D11810N	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	19234							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			CTGGACACATCAACAATTTTC	0.418													26	92	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179458966	179458966	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179458966G>C	uc010zfg.1	-	246	50674	c.50450C>G	c.(50449-50451)CCC>CGC	p.P16817R	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.P10512R|TTN_uc010zfi.1_Missense_Mutation_p.P10445R|TTN_uc010zfj.1_Missense_Mutation_p.P10320R	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	17744							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			AAGCGTTGGGGGTGCTAAAAT	0.393													20	76	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179544672	179544672	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179544672C>A	uc010zfg.1	-	137	30021	c.29797G>T	c.(29797-29799)GAA>TAA	p.E9933*	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Nonsense_Mutation_p.E6594*|TTN_uc010fre.1_Intron|TTN_uc002una.1_5'Flank|TTN_uc010frf.1_5'Flank	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	10860							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			AACTCCTCTTCTTCATGAATG	0.428													23	99	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179598557	179598557	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179598557G>T	uc010zfg.1	-	50	12051	c.11827C>A	c.(11827-11829)CTG>ATG	p.L3943M	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Missense_Mutation_p.L604M	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	4870							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			GCAGCTTGCAGGGTAACGGTT	0.408													44	153	---	---	---	---	PASS
ZNF385B	151126	broad.mit.edu	37	2	180309645	180309645	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:180309645G>A	uc002unn.3	-	9	1759	c.1155C>T	c.(1153-1155)TAC>TAT	p.Y385Y	ZNF385B_uc002unj.2_Silent_p.Y283Y|ZNF385B_uc002unk.2_RNA|ZNF385B_uc002unl.2_Silent_p.Y282Y|ZNF385B_uc002unm.2_Silent_p.Y309Y	NM_152520	NP_689733	Q569K4	Z385B_HUMAN	zinc finger protein 385B isoform 1	385						nucleus	nucleic acid binding|zinc ion binding			ovary(1)	1			Epithelial(96;0.174)|OV - Ovarian serous cystadenocarcinoma(117;0.201)			TGTAAGGGCTGTATTTTGGCT	0.488													18	526	---	---	---	---	PASS
PDE1A	5136	broad.mit.edu	37	2	183099170	183099170	+	Missense_Mutation	SNP	C	A	A	rs148461027		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:183099170C>A	uc002uos.2	-	5	538	c.454G>T	c.(454-456)GTA>TTA	p.V152L	PDE1A_uc010zfp.1_Missense_Mutation_p.V48L|PDE1A_uc002uoq.1_Missense_Mutation_p.V152L|PDE1A_uc010zfq.1_Missense_Mutation_p.V152L|PDE1A_uc002uor.2_Missense_Mutation_p.V136L|PDE1A_uc002uou.2_Missense_Mutation_p.V118L	NM_001003683	NP_001003683	P54750	PDE1A_HUMAN	phosphodiesterase 1A isoform 2	152					activation of phospholipase C activity|nerve growth factor receptor signaling pathway|platelet activation	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|3',5'-cyclic-GMP phosphodiesterase activity|calmodulin binding|calmodulin-dependent cyclic-nucleotide phosphodiesterase activity|metal ion binding			skin(2)|ovary(1)	3			OV - Ovarian serous cystadenocarcinoma(117;0.061)			TTTAATGTTACGATGACAGCT	0.269													18	74	---	---	---	---	PASS
ZNF804A	91752	broad.mit.edu	37	2	185731138	185731138	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:185731138G>A	uc002uph.2	+	2	748	c.154G>A	c.(154-156)GAT>AAT	p.D52N		NM_194250	NP_919226	Q7Z570	Z804A_HUMAN	zinc finger protein 804A	52						intracellular	zinc ion binding			ovary(6)|skin(3)|large_intestine(1)|pancreas(1)	11						AGCTCTGGAAGATCTGAAGGC	0.373													16	95	---	---	---	---	PASS
DIRC1	116093	broad.mit.edu	37	2	189599558	189599558	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:189599558C>A	uc002uqi.1	-	2	361	c.90G>T	c.(88-90)TTG>TTT	p.L30F		NM_052952	NP_443184	Q969H9	DIRC1_HUMAN	disrupted in renal carcinoma 1	30											0			OV - Ovarian serous cystadenocarcinoma(117;0.00842)|Epithelial(96;0.102)			TGAGTGGTGGCAAGTAACAGG	0.512													18	211	---	---	---	---	PASS
SLC39A10	57181	broad.mit.edu	37	2	196578165	196578165	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196578165G>A	uc002utg.3	+	6	1798	c.1584G>A	c.(1582-1584)CAG>CAA	p.Q528Q	SLC39A10_uc002uth.3_Silent_p.Q528Q|SLC39A10_uc010zgp.1_Silent_p.Q78Q	NM_001127257	NP_001120729	Q9ULF5	S39AA_HUMAN	solute carrier family 39 (zinc transporter),	528					zinc ion transport	integral to membrane	metal ion transmembrane transporter activity			pancreas(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.221)			AGGGAAAACAGAAATGGTTTA	0.313													5	55	---	---	---	---	PASS
DNAH7	56171	broad.mit.edu	37	2	196709816	196709816	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196709816C>T	uc002utj.3	-	47	8956	c.8855G>A	c.(8854-8856)GGT>GAT	p.G2952D		NM_018897	NP_061720	Q8WXX0	DYH7_HUMAN	dynein, axonemal, heavy chain 7	2952					ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(10)|ovary(2)	12						TCCCAGGGTACCCATAAGAGA	0.378													30	77	---	---	---	---	PASS
C2orf66	401027	broad.mit.edu	37	2	197674075	197674075	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197674075G>A	uc002utv.2	-	1	926	c.37C>T	c.(37-39)CAG>TAG	p.Q13*		NM_213608	NP_998773	Q6UXQ4	CB066_HUMAN	hypothetical protein LOC401027 precursor	13						extracellular region					0						GAGTGAAGCTGAGTGAAAGAG	0.498													43	224	---	---	---	---	PASS
FAM117B	150864	broad.mit.edu	37	2	203591054	203591054	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:203591054C>T	uc010zhx.1	+	4	938	c.928C>T	c.(928-930)CAT>TAT	p.H310Y		NM_173511	NP_775782	Q6P1L5	F117B_HUMAN	amyotrophic lateral sclerosis 2 (juvenile)	310										ovary(1)	1						GTCTCCATTTCATGGCAACCA	0.388													9	154	---	---	---	---	PASS
MAP2	4133	broad.mit.edu	37	2	210560660	210560660	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:210560660C>G	uc002vde.1	+	7	4014	c.3766C>G	c.(3766-3768)CAG>GAG	p.Q1256E	MAP2_uc002vdc.1_Missense_Mutation_p.Q1256E|MAP2_uc002vdd.1_Intron|MAP2_uc002vdf.1_Intron|MAP2_uc002vdg.1_Intron|MAP2_uc002vdh.1_Intron|MAP2_uc002vdi.1_Missense_Mutation_p.Q1252E	NM_002374	NP_002365	P11137	MAP2_HUMAN	microtubule-associated protein 2 isoform 1	1256					central nervous system neuron development|dendrite morphogenesis|negative regulation of microtubule depolymerization	cytoplasm|microtubule|microtubule associated complex	beta-dystroglycan binding|calmodulin binding|structural molecule activity			ovary(9)|upper_aerodigestive_tract(2)|large_intestine(2)|pancreas(2)|central_nervous_system(1)|skin(1)	17		Hepatocellular(293;0.137)|Lung NSC(271;0.163)|Renal(323;0.202)		UCEC - Uterine corpus endometrioid carcinoma (47;6.64e-05)|Epithelial(149;3.12e-100)|all cancers(144;6.88e-91)|Lung(261;0.0624)|LUSC - Lung squamous cell carcinoma(261;0.0662)|STAD - Stomach adenocarcinoma(1183;0.18)	Estramustine(DB01196)	AGACACCCTTCAGATAACTGA	0.488													24	150	---	---	---	---	PASS
MAP2	4133	broad.mit.edu	37	2	210574737	210574737	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:210574737C>T	uc002vde.1	+	12	5080	c.4832C>T	c.(4831-4833)TCA>TTA	p.S1611L	MAP2_uc002vdd.1_Missense_Mutation_p.S312L|MAP2_uc002vdf.1_Missense_Mutation_p.S255L|MAP2_uc002vdg.1_Missense_Mutation_p.S255L|MAP2_uc002vdh.1_Missense_Mutation_p.S312L|MAP2_uc002vdi.1_Missense_Mutation_p.S1607L	NM_002374	NP_002365	P11137	MAP2_HUMAN	microtubule-associated protein 2 isoform 1	1611					central nervous system neuron development|dendrite morphogenesis|negative regulation of microtubule depolymerization	cytoplasm|microtubule|microtubule associated complex	beta-dystroglycan binding|calmodulin binding|structural molecule activity			ovary(9)|upper_aerodigestive_tract(2)|large_intestine(2)|pancreas(2)|central_nervous_system(1)|skin(1)	17		Hepatocellular(293;0.137)|Lung NSC(271;0.163)|Renal(323;0.202)		UCEC - Uterine corpus endometrioid carcinoma (47;6.64e-05)|Epithelial(149;3.12e-100)|all cancers(144;6.88e-91)|Lung(261;0.0624)|LUSC - Lung squamous cell carcinoma(261;0.0662)|STAD - Stomach adenocarcinoma(1183;0.18)	Estramustine(DB01196)	AGTTATTCTTCACGCACACCA	0.582													18	189	---	---	---	---	PASS
ABCA12	26154	broad.mit.edu	37	2	215813451	215813451	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:215813451G>C	uc002vew.2	-	47	7193	c.6973C>G	c.(6973-6975)CAC>GAC	p.H2325D	ABCA12_uc002vev.2_Missense_Mutation_p.H2007D|ABCA12_uc010zjn.1_Missense_Mutation_p.H1252D	NM_173076	NP_775099	Q86UK0	ABCAC_HUMAN	ATP-binding cassette, sub-family A, member 12	2325	ABC transporter 2.				cellular homeostasis|lipid transport	integral to membrane	ATP binding|ATPase activity			ovary(6)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	11		Renal(323;0.127)		Epithelial(149;1.01e-05)|all cancers(144;0.00112)|LUSC - Lung squamous cell carcinoma(224;0.00829)|Lung(261;0.011)		GAATCAACGTGACCCAGAGAT	0.423													33	128	---	---	---	---	PASS
ATIC	471	broad.mit.edu	37	2	216191601	216191601	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:216191601G>T	uc002vex.3	+	7	762	c.588G>T	c.(586-588)CAG>CAT	p.Q196H	ATIC_uc010zjo.1_Missense_Mutation_p.Q137H|ATIC_uc002vey.3_Missense_Mutation_p.Q195H	NM_004044	NP_004035	P31939	PUR9_HUMAN	5-aminoimidazole-4-carboxamide ribonucleotide	196					IMP biosynthetic process|purine base metabolic process	cytosol	IMP cyclohydrolase activity|phosphoribosylaminoimidazolecarboxamide formyltransferase activity|protein homodimerization activity		ATIC/ALK(24)	haematopoietic_and_lymphoid_tissue(22)|ovary(2)|lung(2)|soft_tissue(2)|skin(1)	29		Renal(323;0.229)		Epithelial(149;2.02e-06)|all cancers(144;0.000316)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.0097)	Tetrahydrofolic acid(DB00116)	TCAGGAAACAGTACAGCAAAG	0.463			T	ALK	ALCL								138	358	---	---	---	---	PASS
STK36	27148	broad.mit.edu	37	2	219563856	219563856	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219563856A>G	uc002viu.2	+	26	3855	c.3589A>G	c.(3589-3591)ATG>GTG	p.M1197V	STK36_uc002viv.2_Missense_Mutation_p.M1176V|STK36_uc002viw.2_Missense_Mutation_p.M375V|STK36_uc002vix.2_Missense_Mutation_p.M242V	NM_015690	NP_056505	Q9NRP7	STK36_HUMAN	serine/threonine kinase 36	1197					cilium assembly|positive regulation of hh target transcription factor activity|positive regulation of smoothened signaling pathway|post-embryonic development	aggresome|cytoplasm|focal adhesion|intermediate filament cytoskeleton|nucleus	ATP binding|protein serine/threonine kinase activity|transcription factor binding			ovary(4)|stomach(2)|lung(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)	11		Renal(207;0.0915)		Epithelial(149;9.65e-07)|all cancers(144;0.000174)|LUSC - Lung squamous cell carcinoma(224;0.00813)|Lung(261;0.00984)		AGTGCCCAGTATGACCCAGCT	0.592													40	103	---	---	---	---	PASS
TTLL4	9654	broad.mit.edu	37	2	219614860	219614860	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219614860C>G	uc002viy.2	+	15	3234	c.2864C>G	c.(2863-2865)TCC>TGC	p.S955C	TTLL4_uc010zkl.1_Missense_Mutation_p.S790C|TTLL4_uc010fvx.2_Missense_Mutation_p.S891C|TTLL4_uc010zkm.1_Missense_Mutation_p.S158C	NM_014640	NP_055455	Q14679	TTLL4_HUMAN	tubulin tyrosine ligase-like family, member 4	955					protein polyglutamylation	cilium|microtubule basal body	ATP binding|tubulin binding|tubulin-tyrosine ligase activity			ovary(2)|skin(1)	3		Renal(207;0.0915)		Epithelial(149;5.03e-07)|all cancers(144;0.000106)|LUSC - Lung squamous cell carcinoma(224;0.00829)|Lung(261;0.0101)		TGCAGCAGCTCCACCACCAGG	0.537													29	274	---	---	---	---	PASS
ANKZF1	55139	broad.mit.edu	37	2	220098130	220098130	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220098130G>T	uc002vkg.2	+	7	968	c.794G>T	c.(793-795)CGC>CTC	p.R265L	ANKZF1_uc010zkv.1_Missense_Mutation_p.R209L|ANKZF1_uc010zkw.1_Missense_Mutation_p.R55L|ANKZF1_uc002vkh.2_Missense_Mutation_p.R55L|ANKZF1_uc002vki.2_Missense_Mutation_p.R265L|ANKZF1_uc002vkj.1_Missense_Mutation_p.R253L	NM_018089	NP_060559	Q9H8Y5	ANKZ1_HUMAN	ankyrin repeat and zinc finger domain containing	265						intracellular	zinc ion binding			ovary(2)	2		Renal(207;0.0474)		Epithelial(149;1.2e-06)|all cancers(144;0.000197)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		AACCTGAGGCGCTACAATGAA	0.512													22	68	---	---	---	---	PASS
ACCN4	55515	broad.mit.edu	37	2	220400040	220400040	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220400040A>G	uc002vma.2	+	5	1561	c.1547A>G	c.(1546-1548)TAC>TGC	p.Y516C	ACCN4_uc002vlz.2_Missense_Mutation_p.Y535C|ACCN4_uc002vmb.2_Missense_Mutation_p.Y189C	NM_182847	NP_878267	Q96FT7	ACCN4_HUMAN	amiloride-sensitive cation channel 4 isoform 2	516	Extracellular (Potential).					integral to plasma membrane	sodium channel activity|sodium ion transmembrane transporter activity			ovary(2)	2		Renal(207;0.0183)		Epithelial(149;5.47e-10)|all cancers(144;9e-08)|LUSC - Lung squamous cell carcinoma(224;0.00813)|Lung(261;0.0086)|READ - Rectum adenocarcinoma(5;0.156)		AACGAGACCTACATACGgtat	0.368													11	61	---	---	---	---	PASS
STK11IP	114790	broad.mit.edu	37	2	220466708	220466708	+	Splice_Site	SNP	A	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220466708A>T	uc002vml.2	+	5	419	c.376_splice	c.e5-2	p.L126_splice	STK11IP_uc010zlj.1_3'UTR|STK11IP_uc010zlk.1_Splice_Site_p.L115_splice|STK11IP_uc010zll.1_Splice_Site_p.L115_splice|STK11IP_uc002vmm.1_Splice_Site_p.L115_splice	NM_052902	NP_443134	Q8N1F8	S11IP_HUMAN	LKB1 interacting protein						protein localization	cytoplasm	protein kinase binding			ovary(1)	1		Renal(207;0.0183)		Epithelial(149;2.69e-07)|all cancers(144;5.91e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		TCCTTGTCCCAGCTCCGAGGT	0.582													7	49	---	---	---	---	PASS
STK11IP	114790	broad.mit.edu	37	2	220478611	220478611	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220478611G>A	uc002vml.2	+	21	2751	c.2708G>A	c.(2707-2709)CGA>CAA	p.R903Q		NM_052902	NP_443134	Q8N1F8	S11IP_HUMAN	LKB1 interacting protein	903					protein localization	cytoplasm	protein kinase binding			ovary(1)	1		Renal(207;0.0183)		Epithelial(149;2.69e-07)|all cancers(144;5.91e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		CTGCTGCCCCGAGATGCCAGG	0.577													7	82	---	---	---	---	PASS
SERPINE2	5270	broad.mit.edu	37	2	224866483	224866483	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:224866483C>T	uc002vnu.2	-	2	378	c.135G>A	c.(133-135)TCG>TCA	p.S45S	SERPINE2_uc002vnt.2_Silent_p.S45S|SERPINE2_uc010zlr.1_Silent_p.S57S|SERPINE2_uc002vnv.2_Silent_p.S45S	NM_006216	NP_006207	P07093	GDN_HUMAN	plasminogen activator inhibitor type 1, member 2	45					negative regulation of blood coagulation|negative regulation of plasminogen activation|negative regulation of platelet aggregation|positive regulation of astrocyte differentiation|regulation of cell migration	cytosol|extracellular matrix|extracellular space|extrinsic to external side of plasma membrane|neuromuscular junction|platelet alpha granule	heparin binding|receptor binding|serine-type endopeptidase inhibitor activity			breast(2)|ovary(1)|central_nervous_system(1)	4		Renal(207;0.025)|all_lung(227;0.0586)|Lung NSC(271;0.0682)|all_hematologic(139;0.0797)		Epithelial(121;5.68e-10)|all cancers(144;1.9e-07)|Lung(261;0.0088)|LUSC - Lung squamous cell carcinoma(224;0.00902)		CATGAGGCCTCGACTTCACAA	0.572													41	261	---	---	---	---	PASS
DOCK10	55619	broad.mit.edu	37	2	225635262	225635262	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:225635262C>T	uc010fwz.1	-	54	6544	c.6305G>A	c.(6304-6306)AGG>AAG	p.R2102K	DOCK10_uc002vob.2_Missense_Mutation_p.R2096K|DOCK10_uc002voa.2_Missense_Mutation_p.R758K	NM_014689	NP_055504	Q96BY6	DOC10_HUMAN	dedicator of cytokinesis 10	2102	DHR-2.						GTP binding			ovary(2)	2		Renal(207;0.0113)|all_lung(227;0.0486)|Lung NSC(271;0.0653)|all_hematologic(139;0.14)		Epithelial(121;2.37e-10)|all cancers(144;2.26e-07)|Lung(261;0.0143)|LUSC - Lung squamous cell carcinoma(224;0.0178)		AGAAGCTTACCTGAAGATCTC	0.468													29	71	---	---	---	---	PASS
SPHKAP	80309	broad.mit.edu	37	2	228881719	228881719	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:228881719C>A	uc002vpq.2	-	7	3898	c.3851G>T	c.(3850-3852)GGT>GTT	p.G1284V	SPHKAP_uc002vpp.2_Missense_Mutation_p.G1284V|SPHKAP_uc010zlx.1_Missense_Mutation_p.G1284V	NM_001142644	NP_001136116	Q2M3C7	SPKAP_HUMAN	sphingosine kinase type 1-interacting protein	1284						cytoplasm	protein binding			skin(5)|ovary(4)|lung(1)	10		Renal(207;0.025)|all_hematologic(139;0.15)|all_lung(227;0.204)|Acute lymphoblastic leukemia(138;0.205)|Esophageal squamous(248;0.23)		Epithelial(121;8.17e-11)|all cancers(144;7.92e-08)|Lung(261;0.0168)|LUSC - Lung squamous cell carcinoma(224;0.0232)		TTTGCAGAGACCGGATGAGGA	0.507													35	203	---	---	---	---	PASS
SP140L	93349	broad.mit.edu	37	2	231236354	231236354	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:231236354A>G	uc010fxm.1	+	7	716	c.625A>G	c.(625-627)AAG>GAG	p.K209E	SP140L_uc010fxn.1_Missense_Mutation_p.K122E|SP140L_uc010fxo.1_Missense_Mutation_p.K16E	NM_138402	NP_612411	Q9H930	LY10L_HUMAN	SP140 nuclear body protein-like	209						nucleus	DNA binding|metal ion binding			central_nervous_system(1)	1						GGGAAAACCCAAGAGGAAAAG	0.279													11	71	---	---	---	---	PASS
IQCA1	79781	broad.mit.edu	37	2	237405854	237405854	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:237405854C>A	uc002vvz.1	-	2	470	c.288G>T	c.(286-288)ACG>ACT	p.T96T	IQCA1_uc002vwb.2_Silent_p.T103T|IQCA1_uc002vwa.1_RNA|IQCA1_uc010zni.1_Silent_p.T96T	NM_024726	NP_079002	Q86XH1	IQCA1_HUMAN	IQ motif containing with AAA domain 1	96							ATP binding			ovary(1)	1						AATGGAACTCCGTGAGTTCCA	0.473													19	46	---	---	---	---	PASS
PPP1R7	5510	broad.mit.edu	37	2	242105863	242105863	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242105863C>T	uc002wat.1	+						PPP1R7_uc010fzm.1_Intron|PPP1R7_uc002war.2_Intron|PPP1R7_uc002was.2_Intron|PPP1R7_uc002wau.1_Intron|PPP1R7_uc002wav.1_Intron	NM_002712	NP_002703	Q15435	PP1R7_HUMAN	protein phosphatase 1, regulatory subunit 7							cytoplasm|nucleus	protein binding|protein phosphatase type 1 regulator activity			ovary(3)	3		all_cancers(19;6.1e-33)|all_epithelial(40;1.07e-13)|Breast(86;0.000141)|Renal(207;0.00528)|all_lung(227;0.0446)|Ovarian(221;0.104)|Lung NSC(271;0.115)|Esophageal squamous(248;0.131)|all_hematologic(139;0.182)|Melanoma(123;0.238)		Epithelial(32;6.92e-32)|all cancers(36;5.35e-29)|OV - Ovarian serous cystadenocarcinoma(60;3.4e-14)|Kidney(56;4.23e-09)|KIRC - Kidney renal clear cell carcinoma(57;4.24e-08)|BRCA - Breast invasive adenocarcinoma(100;3.56e-06)|Lung(119;0.000588)|LUSC - Lung squamous cell carcinoma(224;0.0048)|Colorectal(34;0.0137)|COAD - Colon adenocarcinoma(134;0.096)		CAATGTAAGACACCCACTGTC	0.622													13	63	---	---	---	---	PASS
FARP2	9855	broad.mit.edu	37	2	242402832	242402832	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242402832A>G	uc002wbi.1	+	16	1877	c.1760A>G	c.(1759-1761)TAT>TGT	p.Y587C	FARP2_uc010zoq.1_Missense_Mutation_p.Y587C|FARP2_uc010zor.1_Missense_Mutation_p.Y587C	NM_014808	NP_055623	O94887	FARP2_HUMAN	FERM, RhoGEF and pleckstrin domain protein 2	587	DH.				axon guidance|neuron remodeling|Rac protein signal transduction|regulation of Rho protein signal transduction	cytoskeleton|cytosol|extrinsic to membrane	cytoskeletal protein binding|Rho guanyl-nucleotide exchange factor activity			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3		all_cancers(19;4.88e-34)|all_epithelial(40;4.81e-14)|Breast(86;0.000141)|Renal(207;0.0143)|all_lung(227;0.0344)|Lung NSC(271;0.0886)|Ovarian(221;0.0905)|Esophageal squamous(248;0.131)|all_hematologic(139;0.182)|Melanoma(123;0.238)		Epithelial(32;1.81e-33)|all cancers(36;1.61e-30)|OV - Ovarian serous cystadenocarcinoma(60;6.83e-15)|Kidney(56;1.19e-08)|KIRC - Kidney renal clear cell carcinoma(57;8.98e-08)|BRCA - Breast invasive adenocarcinoma(100;1.49e-06)|Lung(119;0.000152)|LUSC - Lung squamous cell carcinoma(224;0.00125)|Colorectal(34;0.0199)|COAD - Colon adenocarcinoma(134;0.121)		GATCCCATCTATGAGTTCCAC	0.592													12	196	---	---	---	---	PASS
CNTN6	27255	broad.mit.edu	37	3	1424979	1424979	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:1424979C>T	uc003boz.2	+	19	2671	c.2404C>T	c.(2404-2406)CCT>TCT	p.P802S	CNTN6_uc011asj.1_Missense_Mutation_p.P730S|CNTN6_uc003bpa.2_Missense_Mutation_p.P802S	NM_014461	NP_055276	Q9UQ52	CNTN6_HUMAN	contactin 6 precursor	802	Fibronectin type-III 3.				axon guidance|cell adhesion|central nervous system development|Notch signaling pathway	anchored to membrane|plasma membrane				skin(3)|lung(2)|breast(2)|pancreas(1)	8		all_cancers(2;0.000164)|all_epithelial(2;0.107)		Epithelial(13;0.000233)|all cancers(10;0.0013)|OV - Ovarian serous cystadenocarcinoma(96;0.0139)		GATGGTAGAACCTCAACTGGC	0.423													71	358	---	---	---	---	PASS
ITPR1	3708	broad.mit.edu	37	3	4808361	4808361	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:4808361G>C	uc003bqa.2	+	42	5896	c.5548G>C	c.(5548-5550)GAG>CAG	p.E1850Q	ITPR1_uc010hca.1_Missense_Mutation_p.E1835Q|ITPR1_uc011asu.1_Intron|ITPR1_uc003bqc.2_Missense_Mutation_p.E820Q	NM_001099952	NP_001093422	Q14643	ITPR1_HUMAN	inositol 1,4,5-triphosphate receptor, type 1	1898	Cytoplasmic (Potential).				activation of phospholipase C activity|cell death|energy reserve metabolic process|nerve growth factor receptor signaling pathway|platelet activation|regulation of insulin secretion|response to hypoxia	endoplasmic reticulum membrane|integral to membrane|platelet dense granule membrane|platelet dense tubular network membrane	calcium ion transmembrane transporter activity|inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity|intracellular ligand-gated calcium channel activity|phosphatidylinositol binding|protein binding			lung(7)|breast(5)|ovary(4)|large_intestine(1)|liver(1)|skin(1)|kidney(1)|pancreas(1)	21				Epithelial(13;0.0199)|OV - Ovarian serous cystadenocarcinoma(96;0.0361)|all cancers(10;0.0982)		GAAAGACGATGAGGTAGACAG	0.438													9	67	---	---	---	---	PASS
KCNH8	131096	broad.mit.edu	37	3	19554594	19554594	+	Missense_Mutation	SNP	C	G	G	rs138619397		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:19554594C>G	uc003cbk.1	+	13	2407	c.2212C>G	c.(2212-2214)CGC>GGC	p.R738G	KCNH8_uc010hex.1_Missense_Mutation_p.R199G	NM_144633	NP_653234	Q96L42	KCNH8_HUMAN	potassium voltage-gated channel, subfamily H,	738	Cytoplasmic (Potential).					integral to membrane	two-component sensor activity	p.R738L(1)		lung(4)|ovary(1)	5						ATCTTCTTCGCGCAACAAGAA	0.428													21	64	---	---	---	---	PASS
KAT2B	8850	broad.mit.edu	37	3	20189783	20189783	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:20189783C>T	uc003cbq.2	+	16	2651	c.2205C>T	c.(2203-2205)ATC>ATT	p.I735I		NM_003884	NP_003875	Q92831	KAT2B_HUMAN	K(lysine) acetyltransferase 2B	735					cell cycle arrest|cellular response to insulin stimulus|chromatin remodeling|histone H3 acetylation|interspecies interaction between organisms|N-terminal peptidyl-lysine acetylation|negative regulation of cell proliferation|transcription initiation from RNA polymerase I promoter	Ada2/Gcn5/Ada3 transcription activator complex|chromatin remodeling complex|PCAF complex	cyclin-dependent protein kinase inhibitor activity|histone acetyltransferase activity|histone deacetylase binding|protein kinase binding|transcription coactivator activity|transcription factor binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3						TCAAGAGCATCCTCCAGCAGG	0.408													25	82	---	---	---	---	PASS
RARB	5915	broad.mit.edu	37	3	25636025	25636025	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:25636025G>C	uc011awl.1	+	7	1093	c.1027G>C	c.(1027-1029)GAG>CAG	p.E343Q	RARB_uc003cdi.1_Missense_Mutation_p.E224Q|RARB_uc003cdh.2_Missense_Mutation_p.E336Q	NM_016152	NP_057236	P10826	RARB_HUMAN	retinoic acid receptor, beta isoform 2	343	Ligand-binding.				embryonic digestive tract development|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	cytoplasm|nucleoplasm	protein binding|retinoic acid receptor activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)|large_intestine(1)|pancreas(1)	3					Acitretin(DB00459)|Adapalene(DB00210)|Alitretinoin(DB00523)|Etretinate(DB00926)|Tamibarotene(DB04942)|Tazarotene(DB00799)	CCAGGACCTTGAGGAACCGAC	0.398													7	110	---	---	---	---	PASS
EOMES	8320	broad.mit.edu	37	3	27759023	27759023	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:27759023G>C	uc003cdx.2	-	6	1599	c.1599C>G	c.(1597-1599)ATC>ATG	p.I533M	EOMES_uc003cdy.3_Missense_Mutation_p.I552M|EOMES_uc010hfn.2_3'UTR|EOMES_uc011axc.1_Missense_Mutation_p.I257M	NM_005442	NP_005433	O95936	EOMES_HUMAN	eomesodermin	533					CD8-positive, alpha-beta T cell differentiation involved in immune response|cell differentiation involved in embryonic placenta development|endoderm formation|mesoderm formation|mesodermal to mesenchymal transition involved in gastrulation|positive regulation of transcription, DNA-dependent	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(3)|breast(1)	4						CATAGGAACTGATGTCTAGTT	0.532													15	340	---	---	---	---	PASS
EOMES	8320	broad.mit.edu	37	3	27763641	27763641	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:27763641C>G	uc003cdx.2	-	1	145	c.145G>C	c.(145-147)GAC>CAC	p.D49H	EOMES_uc003cdy.3_Missense_Mutation_p.D49H|EOMES_uc010hfn.2_Missense_Mutation_p.D49H|EOMES_uc011axc.1_Intron	NM_005442	NP_005433	O95936	EOMES_HUMAN	eomesodermin	49				D -> G (in Ref. 1; BAA83417).	CD8-positive, alpha-beta T cell differentiation involved in immune response|cell differentiation involved in embryonic placenta development|endoderm formation|mesoderm formation|mesodermal to mesenchymal transition involved in gastrulation|positive regulation of transcription, DNA-dependent	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(3)|breast(1)	4						GACGCTTTGTCTAAGTCCAAC	0.697													2	10	---	---	---	---	PASS
ARPP21	10777	broad.mit.edu	37	3	35778738	35778738	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:35778738C>T	uc003cgb.2	+	16	1792	c.1528C>T	c.(1528-1530)CGA>TGA	p.R510*	ARPP21_uc003cga.2_Nonsense_Mutation_p.R456*|ARPP21_uc011axy.1_Nonsense_Mutation_p.R476*|ARPP21_uc003cgf.2_Nonsense_Mutation_p.R311*|ARPP21_uc003cgg.2_5'UTR	NM_016300	NP_057384	Q9UBL0	ARP21_HUMAN	cyclic AMP-regulated phosphoprotein, 21 kD	510	Gln-rich.					cytoplasm	nucleic acid binding			ovary(2)|skin(1)	3						GCAGCCCCTGCGAAGCGCCAT	0.612													9	120	---	---	---	---	PASS
ANO10	55129	broad.mit.edu	37	3	43618347	43618347	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:43618347C>G	uc003cmv.2	-	6	1170	c.999G>C	c.(997-999)ATG>ATC	p.M333I	ANO10_uc011azs.1_Missense_Mutation_p.M333I|ANO10_uc003cmw.2_Missense_Mutation_p.M267I|ANO10_uc010hil.2_Intron|ANO10_uc011azt.1_Missense_Mutation_p.M222I	NM_018075	NP_060545	Q9NW15	ANO10_HUMAN	transmembrane protein 16K	333	Helical; (Potential).				cell death	chloride channel complex	chloride channel activity			ovary(2)	2						AGTAAATCATCATGACATACA	0.512													7	57	---	---	---	---	PASS
COL7A1	1294	broad.mit.edu	37	3	48627116	48627116	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48627116G>A	uc003ctz.2	-	16	2087	c.2086C>T	c.(2086-2088)CAG>TAG	p.Q696*		NM_000094	NP_000085	Q02388	CO7A1_HUMAN	alpha 1 type VII collagen precursor	696	Nonhelical region (NC1).|Fibronectin type-III 6.				cell adhesion|epidermis development	basement membrane|collagen type VII	protein binding|serine-type endopeptidase inhibitor activity			ovary(4)|breast(3)|skin(3)|central_nervous_system(1)	11				BRCA - Breast invasive adenocarcinoma(193;0.000293)|KIRC - Kidney renal clear cell carcinoma(197;0.00558)|Kidney(197;0.00632)		CTGCTGGCCTGAGTCACATGG	0.607													70	151	---	---	---	---	PASS
DALRD3	55152	broad.mit.edu	37	3	49054726	49054726	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49054726C>T	uc003cvk.1	-	5	882	c.862G>A	c.(862-864)GAG>AAG	p.E288K	DALRD3_uc003cvl.1_Missense_Mutation_p.E288K|DALRD3_uc003cvm.1_Missense_Mutation_p.E121K|DALRD3_uc010hko.1_Missense_Mutation_p.E121K|DALRD3_uc011bca.1_Missense_Mutation_p.E288K	NM_001009996	NP_001009996	Q5D0E6	DALD3_HUMAN	DALR anticodon binding domain containing 3	288					arginyl-tRNA aminoacylation	cytoplasm	arginine-tRNA ligase activity|ATP binding				0				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.00218)|KIRC - Kidney renal clear cell carcinoma(197;0.00244)		TGCTGGAACTCCTCCTCACAG	0.512													20	333	---	---	---	---	PASS
CAMKV	79012	broad.mit.edu	37	3	49899591	49899591	+	Silent	SNP	G	A	A	rs111501823	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49899591G>A	uc003cxt.1	-	3	307	c.114C>T	c.(112-114)ATC>ATT	p.I38I	CAMKV_uc011bcy.1_5'UTR|CAMKV_uc003cxv.1_Silent_p.I38I|CAMKV_uc003cxw.1_5'UTR|CAMKV_uc003cxx.1_5'UTR|CAMKV_uc003cxu.2_Silent_p.I38I|CAMKV_uc011bcz.1_Missense_Mutation_p.S15F|CAMKV_uc011bda.1_Silent_p.I38I|CAMKV_uc011bdb.1_RNA	NM_024046	NP_076951	Q8NCB2	CAMKV_HUMAN	CaM kinase-like vesicle-associated	38	Protein kinase.					cytoplasmic vesicle membrane|plasma membrane	ATP binding|protein serine/threonine kinase activity			ovary(2)|lung(2)|large_intestine(2)|central_nervous_system(1)	7				BRCA - Breast invasive adenocarcinoma(193;4.62e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.00551)|Kidney(197;0.00621)		TGGCCCGGAAGATTTCACAAA	0.592													24	70	---	---	---	---	PASS
VPRBP	9730	broad.mit.edu	37	3	51457744	51457744	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51457744C>T	uc003dbe.1	-	14	2848	c.2680G>A	c.(2680-2682)GCT>ACT	p.A894T	VPRBP_uc003dbf.1_Missense_Mutation_p.A170T	NM_014703	NP_055518	Q9Y4B6	VPRBP_HUMAN	HIV-1 Vpr binding protein	894					interspecies interaction between organisms	cytoplasm|nucleus	protein binding			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.000272)|Kidney(197;0.000729)|KIRC - Kidney renal clear cell carcinoma(197;0.000875)		ACAGGAGAAGCAGCAGCAGTG	0.577													60	121	---	---	---	---	PASS
ACY1	95	broad.mit.edu	37	3	52021212	52021212	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52021212G>C	uc003dcp.2	+	10	768	c.707G>C	c.(706-708)AGG>ACG	p.R236T	ACY1_uc011bea.1_Missense_Mutation_p.R326T|ACY1_uc011beb.1_Missense_Mutation_p.R236T|ACY1_uc003dcq.2_Missense_Mutation_p.R236T	NM_000666	NP_000657	Q03154	ACY1_HUMAN	aminoacylase 1	236					cellular amino acid metabolic process|proteolysis	cytosol	aminoacylase activity|metal ion binding|metallopeptidase activity			breast(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.000534)|KIRC - Kidney renal clear cell carcinoma(197;0.000716)	L-Aspartic Acid(DB00128)	GAATGGCAGAGGTGAGGCAGC	0.557													136	206	---	---	---	---	PASS
GLT8D1	55830	broad.mit.edu	37	3	52734477	52734477	+	5'UTR	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52734477C>G	uc003dfi.3	-	2					GLT8D1_uc003dfj.2_5'UTR|GLT8D1_uc003dfk.2_5'UTR|GLT8D1_uc003dfl.2_5'UTR|GLT8D1_uc003dfm.2_5'UTR|GLT8D1_uc003dfn.2_5'UTR|GLT8D1_uc003dfo.1_5'UTR|GLT8D1_uc010hmm.1_RNA	NM_152932	NP_690909	Q68CQ7	GL8D1_HUMAN	glycosyltransferase 8 domain containing 1							integral to membrane|mitochondrion	transferase activity, transferring glycosyl groups				0				BRCA - Breast invasive adenocarcinoma(193;6.78e-05)|Kidney(197;0.000618)|KIRC - Kidney renal clear cell carcinoma(197;0.000779)|OV - Ovarian serous cystadenocarcinoma(275;0.0482)		GGAATGACATCTTTTTCTTCT	0.338													15	105	---	---	---	---	PASS
DNAH12	201625	broad.mit.edu	37	3	57494205	57494205	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:57494205G>C	uc003dit.2	-	7	786	c.605C>G	c.(604-606)TCT>TGT	p.S202C	DNAH12_uc003diu.2_Missense_Mutation_p.S202C	NM_178504	NP_848599	Q6ZR08	DYH12_HUMAN	dynein heavy chain domain 2 isoform 1	202	Stem (By similarity).				microtubule-based movement	cilium axoneme|cytoplasm|dynein complex|microtubule	ATP binding|ATPase activity|microtubule motor activity			pancreas(1)|skin(1)	2						GTGCAAATTAGAGAATATTTG	0.343													14	58	---	---	---	---	PASS
ATXN7	6314	broad.mit.edu	37	3	63938123	63938123	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:63938123C>T	uc003dlw.3	+	5	1016	c.463C>T	c.(463-465)CAG>TAG	p.Q155*	ATXN7_uc003dlv.2_Nonsense_Mutation_p.Q155*|ATXN7_uc010hnv.2_Nonsense_Mutation_p.Q155*	NM_000333	NP_000324	O15265	ATX7_HUMAN	ataxin 7 isoform a	155					cell death|histone deubiquitination|nucleus organization|regulation of transcription, DNA-dependent|transcription, DNA-dependent|visual perception	cytoplasm|nuclear matrix|nucleolus	protein binding|zinc ion binding				0		Prostate(884;0.0181)		BRCA - Breast invasive adenocarcinoma(55;0.000614)|KIRC - Kidney renal clear cell carcinoma(15;0.00294)|Kidney(15;0.00305)		CGACTGTAATCAGGTTGTCAA	0.373													14	164	---	---	---	---	PASS
ADAMTS9	56999	broad.mit.edu	37	3	64527054	64527054	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:64527054C>T	uc003dmg.2	-	35	5361	c.5329G>A	c.(5329-5331)GAG>AAG	p.E1777K	ADAMTS9_uc011bfo.1_Missense_Mutation_p.E1749K|ADAMTS9_uc011bfp.1_Missense_Mutation_p.E688K	NM_182920	NP_891550	Q9P2N4	ATS9_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1777	GON.				glycoprotein catabolic process|multicellular organismal development|proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(2)|urinary_tract(1)|skin(1)	4		Lung NSC(201;0.00682)		BRCA - Breast invasive adenocarcinoma(55;0.00142)|Kidney(15;0.00202)|KIRC - Kidney renal clear cell carcinoma(15;0.00221)		GTCACGTACTCTTTGGGGTGG	0.502													85	172	---	---	---	---	PASS
OR5AC2	81050	broad.mit.edu	37	3	97806185	97806185	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97806185C>T	uc011bgs.1	+	1	169	c.169C>T	c.(169-171)CTT>TTT	p.L57F		NM_054106	NP_473447	Q9NZP5	O5AC2_HUMAN	olfactory receptor, family 5, subfamily AC,	57	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1						CGACCCCCATCTTCATATGCC	0.438													84	646	---	---	---	---	PASS
ALCAM	214	broad.mit.edu	37	3	105264155	105264155	+	Silent	SNP	G	A	A	rs139344282	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:105264155G>A	uc003dvx.2	+	9	1620	c.1080G>A	c.(1078-1080)AGG>AGA	p.R360R	ALCAM_uc003dvw.1_Silent_p.R360R|ALCAM_uc003dvy.2_Silent_p.R360R|ALCAM_uc010hpp.2_Silent_p.R82R|ALCAM_uc003dvz.2_5'UTR	NM_001627	NP_001618	Q13740	CD166_HUMAN	activated leukocyte cell adhesion molecule	360	Extracellular (Potential).|Ig-like C2-type 2.				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(2)|breast(1)	3						CTGCTAGCAGGAATGCAACTG	0.388													14	219	---	---	---	---	PASS
GAP43	2596	broad.mit.edu	37	3	115395195	115395195	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:115395195G>A	uc003ebq.2	+	2	752	c.366G>A	c.(364-366)CAG>CAA	p.Q122Q	GAP43_uc003ebr.2_Silent_p.Q158Q	NM_002045	NP_002036	P17677	NEUM_HUMAN	growth associated protein 43 isoform 2	122					activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|cell differentiation|nervous system development|regulation of filopodium assembly|regulation of growth|response to wounding	cell junction|filopodium membrane|growth cone membrane|synapse	calmodulin binding			ovary(1)	1				GBM - Glioblastoma multiforme(114;0.164)		CCACAGAGCAGGCAGCCCCCC	0.607													41	42	---	---	---	---	PASS
C3orf30	152405	broad.mit.edu	37	3	118865717	118865717	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:118865717C>A	uc003ecb.1	+	1	721	c.681C>A	c.(679-681)GAC>GAA	p.D227E	IGSF11_uc003eby.2_5'Flank|IGSF11_uc003ebz.2_5'Flank|IGSF11_uc010hqs.2_5'Flank|C3orf30_uc011biw.1_Missense_Mutation_p.D227E	NM_152539	NP_689752	Q96M34	CC030_HUMAN	hypothetical protein LOC152405	227										ovary(2)	2				GBM - Glioblastoma multiforme(114;0.222)		TGCAGATTGACAGTGGGTCAT	0.493													43	386	---	---	---	---	PASS
ARHGAP31	57514	broad.mit.edu	37	3	119121087	119121087	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:119121087C>T	uc003ecj.3	+	10	2020	c.1488C>T	c.(1486-1488)CTC>CTT	p.L496L		NM_020754	NP_065805	Q2M1Z3	RHG31_HUMAN	Cdc42 GTPase-activating protein	496					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|focal adhesion|lamellipodium	GTPase activator activity			ovary(2)	2						CTGTGCCGCTCCGCGTGTCCG	0.587													40	412	---	---	---	---	PASS
ADPRH	141	broad.mit.edu	37	3	119301094	119301094	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:119301094C>T	uc003ecs.2	+	3	376	c.78C>T	c.(76-78)TTC>TTT	p.F26F	ADPRH_uc010hqv.2_Silent_p.F26F|ADPRH_uc011bjb.1_Intron|ADPRH_uc003ect.2_Silent_p.F26F	NM_001125	NP_001116	P54922	ADPRH_HUMAN	ADP-ribosylarginine hydrolase	26					protein de-ADP-ribosylation		ADP-ribosylarginine hydrolase activity|magnesium ion binding			ovary(1)	1		Lung NSC(201;0.0977)		GBM - Glioblastoma multiforme(114;0.23)		AGTGGGAGTTCCTCCAGGATG	0.572													11	186	---	---	---	---	PASS
POLQ	10721	broad.mit.edu	37	3	121206895	121206895	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121206895G>A	uc003eee.3	-	16	5012	c.4883C>T	c.(4882-4884)TCA>TTA	p.S1628L	POLQ_uc003eed.2_Missense_Mutation_p.S800L	NM_199420	NP_955452	O75417	DPOLQ_HUMAN	DNA polymerase theta	1628					DNA repair|DNA replication	nucleoplasm	ATP binding|ATP-dependent helicase activity|damaged DNA binding|DNA-directed DNA polymerase activity|single-stranded DNA-dependent ATPase activity			ovary(4)|breast(3)|lung(2)|upper_aerodigestive_tract(1)|skin(1)	11				GBM - Glioblastoma multiforme(114;0.0915)		CCATATGAATGAATGATTTTG	0.393								DNA_polymerases_(catalytic_subunits)					45	683	---	---	---	---	PASS
ARGFX	503582	broad.mit.edu	37	3	121305451	121305451	+	3'UTR	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121305451G>C	uc003eef.2	+	5						NM_001012659	NP_001012677	A6NJG6	ARGFX_HUMAN	arginine-fifty homeobox							nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			skin(2)|ovary(1)	3				GBM - Glioblastoma multiforme(114;0.152)		TCTCTGACCAGAGTACTAATA	0.398													11	136	---	---	---	---	PASS
GOLGB1	2804	broad.mit.edu	37	3	121413392	121413392	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121413392T>C	uc003eei.3	-	13	6089	c.5963A>G	c.(5962-5964)AAG>AGG	p.K1988R	GOLGB1_uc010hrc.2_Missense_Mutation_p.K1993R|GOLGB1_uc003eej.3_Missense_Mutation_p.K1954R|GOLGB1_uc011bjm.1_Missense_Mutation_p.K1874R|GOLGB1_uc010hrd.1_Missense_Mutation_p.K1952R	NM_004487	NP_004478	Q14789	GOGB1_HUMAN	golgi autoantigen, golgin subfamily b,	1988	Cytoplasmic (Potential).|Potential.				Golgi organization	ER-Golgi intermediate compartment|Golgi membrane|Golgi stack|integral to membrane	protein binding			ovary(6)|breast(2)|skin(2)	10				GBM - Glioblastoma multiforme(114;0.0989)		CAAATATTCCTTTCGTATTTC	0.353													278	360	---	---	---	---	PASS
MYLK	4638	broad.mit.edu	37	3	123452594	123452594	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:123452594C>T	uc003ego.2	-	10	1531	c.1249G>A	c.(1249-1251)GAG>AAG	p.E417K	MYLK_uc011bjw.1_Missense_Mutation_p.E417K|MYLK_uc003egp.2_Missense_Mutation_p.E417K|MYLK_uc003egq.2_Missense_Mutation_p.E417K|MYLK_uc003egr.2_Missense_Mutation_p.E417K|MYLK_uc003egs.2_Missense_Mutation_p.E241K	NM_053025	NP_444253	Q15746	MYLK_HUMAN	myosin light chain kinase isoform 1	417	Ig-like C2-type 3.				aorta smooth muscle tissue morphogenesis|muscle contraction	cytosol	actin binding|ATP binding|calmodulin binding|metal ion binding|myosin light chain kinase activity			ovary(6)|skin(2)|stomach(1)	9		Lung NSC(201;0.0496)		GBM - Glioblastoma multiforme(114;0.0736)		GGCTTGCTCTCAAATTTGGGG	0.512													76	595	---	---	---	---	PASS
MCM2	4171	broad.mit.edu	37	3	127335943	127335943	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:127335943C>T	uc003ejp.2	+	10	1812	c.1755C>T	c.(1753-1755)CTC>CTT	p.L585L	MCM2_uc011bkm.1_Silent_p.L455L|MCM2_uc010hsl.2_RNA|MCM2_uc011bkn.1_Silent_p.L538L	NM_004526	NP_004517	P49736	MCM2_HUMAN	minichromosome maintenance complex component 2	585	MCM.				cell cycle checkpoint|DNA strand elongation involved in DNA replication|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|S phase of mitotic cell cycle	chromatin|MCM complex	ATP binding|helicase activity|metal ion binding			ovary(3)|skin(1)	4						GAGTGTGTCTCATTGATGAAT	0.617													70	452	---	---	---	---	PASS
COL29A1	256076	broad.mit.edu	37	3	130174344	130174344	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130174344C>T	uc010htj.1	+	37	7118	c.6624C>T	c.(6622-6624)TTC>TTT	p.F2208F	COL29A1_uc010hti.1_RNA|COL29A1_uc010htk.1_Silent_p.F247F	NM_153264	NP_694996	A8TX70	CO6A5_HUMAN	collagen, type XXIX, alpha 1	2208	Nonhelical region.				axon guidance|cell adhesion	collagen					0						GTAATGGCTTCATTGGCCAAG	0.373													8	53	---	---	---	---	PASS
ACAD11	84129	broad.mit.edu	37	3	132277834	132277834	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132277834C>G	uc003eov.3	-	20	2704	c.2324G>C	c.(2323-2325)AGA>ACA	p.R775T		NM_032169	NP_115545	Q709F0	ACD11_HUMAN	putative acyl-CoA dehydrogenase	775						peroxisome	acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding|transferase activity, transferring phosphorus-containing groups			ovary(1)	1						GGCTGTCAGTCTTTTGGCTTG	0.458													7	98	---	---	---	---	PASS
SLCO2A1	6578	broad.mit.edu	37	3	133666117	133666117	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133666117G>T	uc003eqa.3	-	9	1552	c.1278C>A	c.(1276-1278)GCC>GCA	p.A426A	SLCO2A1_uc003eqb.3_Silent_p.A350A|SLCO2A1_uc011blv.1_Silent_p.A245A	NM_005630	NP_005621	Q92959	SO2A1_HUMAN	solute carrier organic anion transporter family,	426	Extracellular (Potential).				sodium-independent organic anion transport	integral to plasma membrane|membrane fraction	prostaglandin transmembrane transporter activity|protein binding			central_nervous_system(1)	1						GGTAGACTTCGGCCACAGTTG	0.498													77	121	---	---	---	---	PASS
PIK3CB	5291	broad.mit.edu	37	3	138375001	138375001	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:138375001C>G	uc011bmq.1	-	21	3058	c.3058G>C	c.(3058-3060)GAT>CAT	p.D1020H	PIK3CB_uc011bmn.1_Missense_Mutation_p.D532H|PIK3CB_uc011bmo.1_Missense_Mutation_p.D471H|PIK3CB_uc011bmp.1_Missense_Mutation_p.D607H|PIK3CB_uc003est.1_5'Flank	NM_006219	NP_006210	P42338	PK3CB_HUMAN	catalytic phosphatidylinositol 3-kinase beta	1020	PI3K/PI4K.				activation of MAPK activity|chemotaxis|fibroblast growth factor receptor signaling pathway|G-protein coupled receptor protein signaling pathway|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|platelet activation|T cell receptor signaling pathway	phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity			breast(2)|ovary(1)|lung(1)|skin(1)	5						TACTGTATATCTTTGACTGAT	0.423													10	146	---	---	---	---	PASS
PIK3CB	5291	broad.mit.edu	37	3	138382880	138382880	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:138382880G>C	uc011bmq.1	-						PIK3CB_uc011bmn.1_Intron|PIK3CB_uc011bmo.1_Intron|PIK3CB_uc011bmp.1_Intron	NM_006219	NP_006210	P42338	PK3CB_HUMAN	catalytic phosphatidylinositol 3-kinase beta						activation of MAPK activity|chemotaxis|fibroblast growth factor receptor signaling pathway|G-protein coupled receptor protein signaling pathway|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|platelet activation|T cell receptor signaling pathway	phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity			breast(2)|ovary(1)|lung(1)|skin(1)	5						CCCTGAACAAGAGAAAAGAAC	0.448													9	79	---	---	---	---	PASS
XRN1	54464	broad.mit.edu	37	3	142090072	142090072	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142090072C>T	uc003eus.2	-						XRN1_uc010huu.2_Intron|XRN1_uc003eut.2_Intron|XRN1_uc003euu.2_Intron	NM_019001	NP_061874	Q8IZH2	XRN1_HUMAN	5'-3' exoribonuclease 1 isoform a						exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay|histone mRNA catabolic process|nuclear mRNA surveillance|rRNA catabolic process	cytosol|Golgi apparatus|intermediate filament cytoskeleton|plasma membrane	5'-3' exonuclease activity|DNA binding|protein binding|RNA binding			ovary(3)	3						TATCATAAATCTTGCTTACCC	0.313													8	81	---	---	---	---	PASS
XRN1	54464	broad.mit.edu	37	3	142103448	142103448	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142103448G>C	uc003eus.2	-	21	2486	c.2419C>G	c.(2419-2421)CAA>GAA	p.Q807E	XRN1_uc010huu.2_Missense_Mutation_p.Q273E|XRN1_uc003eut.2_Missense_Mutation_p.Q807E|XRN1_uc003euu.2_Missense_Mutation_p.Q807E|XRN1_uc003euv.1_Missense_Mutation_p.Q668E	NM_019001	NP_061874	Q8IZH2	XRN1_HUMAN	5'-3' exoribonuclease 1 isoform a	807					exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay|histone mRNA catabolic process|nuclear mRNA surveillance|rRNA catabolic process	cytosol|Golgi apparatus|intermediate filament cytoskeleton|plasma membrane	5'-3' exonuclease activity|DNA binding|protein binding|RNA binding			ovary(3)	3						TGATTTATTTGATATTTACGA	0.313													33	435	---	---	---	---	PASS
PLS1	5357	broad.mit.edu	37	3	142389917	142389917	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142389917G>C	uc010huv.2	+	4	476	c.317G>C	c.(316-318)GGA>GCA	p.G106A	PLS1_uc003euz.2_Missense_Mutation_p.G106A|PLS1_uc003eva.2_Missense_Mutation_p.G106A	NM_001145319	NP_001138791	Q14651	PLSI_HUMAN	plastin 1	106						cytoplasm	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(1)	1						ACTGCTATTGGAGGAACTTCA	0.353													26	596	---	---	---	---	PASS
SLC9A9	285195	broad.mit.edu	37	3	142985730	142985730	+	Silent	SNP	C	T	T	rs144511019		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142985730C>T	uc003evn.2	-	16	1934	c.1752G>A	c.(1750-1752)CAG>CAA	p.Q584Q		NM_173653	NP_775924	Q8IVB4	SL9A9_HUMAN	solute carrier family 9 (sodium/hydrogen	584					regulation of pH	integral to membrane|late endosome membrane|recycling endosome	sodium:hydrogen antiporter activity			ovary(2)|skin(1)	3						CTAGTTCATCCTGGTTTACAA	0.493													26	338	---	---	---	---	PASS
PLOD2	5352	broad.mit.edu	37	3	145789130	145789130	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:145789130C>G	uc003evs.1	-	17	2372	c.1866G>C	c.(1864-1866)TGG>TGC	p.W622C	PLOD2_uc003evq.1_Missense_Mutation_p.W303C|PLOD2_uc011bnm.1_Missense_Mutation_p.W588C|PLOD2_uc003evr.1_Missense_Mutation_p.W643C	NM_000935	NP_000926	O00469	PLOD2_HUMAN	procollagen-lysine, 2-oxoglutarate 5-dioxygenase	622					protein modification process|response to hypoxia	rough endoplasmic reticulum membrane	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|procollagen-lysine 5-dioxygenase activity|protein binding			ovary(1)|skin(1)	2					Vitamin C(DB00126)	TAAAATGAAGCCATACATTCT	0.413													54	184	---	---	---	---	PASS
PLCH1	23007	broad.mit.edu	37	3	155215124	155215124	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:155215124C>T	uc011bok.1	-	14	2120	c.1843G>A	c.(1843-1845)GAC>AAC	p.D615N	PLCH1_uc011boj.1_Missense_Mutation_p.D615N|PLCH1_uc011bol.1_Missense_Mutation_p.D597N	NM_001130960	NP_001124432	Q4KWH8	PLCH1_HUMAN	phospholipase C eta 1 isoform a	615	PI-PLC Y-box.				lipid catabolic process|phosphatidylinositol-mediated signaling	membrane	calcium ion binding|calcium-dependent phospholipase C activity|phosphatidylinositol phospholipase C activity|signal transducer activity			skin(3)|ovary(1)	4			Lung(72;0.11)|LUSC - Lung squamous cell carcinoma(72;0.114)			TCCACAATGTCCTGAGCGGCC	0.428													112	176	---	---	---	---	PASS
VEPH1	79674	broad.mit.edu	37	3	157081156	157081156	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:157081156C>T	uc003fbj.1	-	9	2049	c.1732G>A	c.(1732-1734)GAA>AAA	p.E578K	VEPH1_uc003fbk.1_Missense_Mutation_p.E578K|VEPH1_uc010hvu.1_Missense_Mutation_p.E578K	NM_024621	NP_078897	Q14D04	MELT_HUMAN	ventricular zone expressed PH domain homolog 1	578						plasma membrane				breast(3)|ovary(1)|lung(1)	5			Lung(72;0.0272)|LUSC - Lung squamous cell carcinoma(72;0.0461)			CACTTACCTTCAATGGTACAC	0.378													18	558	---	---	---	---	PASS
VEPH1	79674	broad.mit.edu	37	3	157081393	157081393	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:157081393C>T	uc003fbj.1	-	9	1812	c.1495G>A	c.(1495-1497)GAG>AAG	p.E499K	VEPH1_uc003fbk.1_Missense_Mutation_p.E499K|VEPH1_uc010hvu.1_Missense_Mutation_p.E499K	NM_024621	NP_078897	Q14D04	MELT_HUMAN	ventricular zone expressed PH domain homolog 1	499						plasma membrane				breast(3)|ovary(1)|lung(1)	5			Lung(72;0.0272)|LUSC - Lung squamous cell carcinoma(72;0.0461)			TGTGATCTCTCAGTGTCTGTC	0.428													14	378	---	---	---	---	PASS
RSRC1	51319	broad.mit.edu	37	3	157841720	157841720	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:157841720C>T	uc003fbt.2	+	3	371	c.260C>T	c.(259-261)TCA>TTA	p.S87L	RSRC1_uc011bou.1_Missense_Mutation_p.S87L|RSRC1_uc003fbu.1_Missense_Mutation_p.S87L|RSRC1_uc003fbv.2_Missense_Mutation_p.S87L	NM_016625	NP_057709	Q96IZ7	RSRC1_HUMAN	arginine/serine-rich coiled-coil 1	87	Arg/Ser-rich.				nucleocytoplasmic transport	cytoplasm|nuclear speck	protein binding				0			Lung(72;0.00416)|LUSC - Lung squamous cell carcinoma(72;0.00575)			CGAAGTCGTTCAAGGGGTCGA	0.363													15	227	---	---	---	---	PASS
KPNA4	3840	broad.mit.edu	37	3	160232848	160232848	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160232848C>G	uc003fdn.2	-						SCARNA7_uc003fdo.2_RNA	NM_002268	NP_002259	O00629	IMA4_HUMAN	karyopherin alpha 4						NLS-bearing substrate import into nucleus	cytoplasm|nuclear pore	protein binding				0			Lung(72;0.00149)|LUSC - Lung squamous cell carcinoma(72;0.00216)			ACTCCAATATCAGCATCACCA	0.413													34	319	---	---	---	---	PASS
BCHE	590	broad.mit.edu	37	3	165547523	165547523	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:165547523G>A	uc003fem.3	-	2	1459	c.1299C>T	c.(1297-1299)TTC>TTT	p.F433F	BCHE_uc003fen.3_Intron	NM_000055	NP_000046	P06276	CHLE_HUMAN	butyrylcholinesterase precursor	433					choline metabolic process|cocaine metabolic process|synaptic transmission, cholinergic	endoplasmic reticulum lumen|extracellular space|membrane	acetylcholinesterase activity|beta-amyloid binding|carboxylesterase activity|cholinesterase activity|enzyme binding			ovary(3)|pancreas(1)	4					Ambenonium(DB01122)|Atropine(DB00572)|Bambuterol(DB01408)|Chlorpromazine(DB00477)|Choline(DB00122)|Cinnarizine(DB00568)|Demecarium bromide(DB00944)|Dibucaine(DB00527)|Donepezil(DB00843)|Echothiophate Iodide(DB01057)|Edrophonium(DB01010)|Ethopropazine(DB00392)|Etomidate(DB00292)|Galantamine(DB00674)|Hexafluronium bromide(DB00941)|Isoflurophate(DB00677)|Mefloquine(DB00358)|Mivacurium(DB01226)|Neostigmine(DB01400)|Pancuronium(DB01337)|Pralidoxime(DB00733)|Procainamide(DB01035)|Pyridostigmine(DB00545)|Rivastigmine(DB00989)|Succinylcholine(DB00202)|Terbutaline(DB00871)|Trimethaphan(DB01116)	ACTTCTTGGTGAACTCCAAGG	0.448													35	284	---	---	---	---	PASS
ZBBX	79740	broad.mit.edu	37	3	167016129	167016129	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:167016129C>G	uc003fep.2	-	18	2166	c.1843G>C	c.(1843-1845)GAA>CAA	p.E615Q	ZBBX_uc011bpc.1_Missense_Mutation_p.E615Q|ZBBX_uc003feq.2_Missense_Mutation_p.E586Q	NM_024687	NP_078963	A8MT70	ZBBX_HUMAN	zinc finger, B-box domain containing	615						intracellular	zinc ion binding			ovary(2)	2						TTGTTGCATTCTAAACGATGA	0.333													22	194	---	---	---	---	PASS
MECOM	2122	broad.mit.edu	37	3	168849256	168849256	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:168849256C>T	uc003ffi.3	-	3	279	c.10G>A	c.(10-12)GAA>AAA	p.E4K	MECOM_uc010hwk.1_Missense_Mutation_p.E27K|MECOM_uc003ffj.3_Missense_Mutation_p.E68K|MECOM_uc011bpi.1_Missense_Mutation_p.E4K|MECOM_uc003ffn.3_Missense_Mutation_p.E4K|MECOM_uc003ffk.2_Missense_Mutation_p.E4K|MECOM_uc003ffl.2_Missense_Mutation_p.E164K|MECOM_uc011bpj.1_Missense_Mutation_p.E192K|MECOM_uc011bpk.1_5'UTR|MECOM_uc010hwn.2_Missense_Mutation_p.E192K|MECOM_uc003ffm.1_Missense_Mutation_p.E68K	NM_005241	NP_005232	Q03112	EVI1_HUMAN	MDS1 and EVI1 complex locus isoform b	4	Interaction with MAPK9, SMAD3 and probably SUV39H1.				apoptosis|cell differentiation|hemopoietic stem cell proliferation|negative regulation of JNK cascade|negative regulation of programmed cell death|negative regulation of transcription, DNA-dependent|regulation of cell cycle	nuclear speck	DNA binding|protein binding|protein homodimerization activity|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(5)|skin(5)|upper_aerodigestive_tract(1)|central_nervous_system(1)|ovary(1)|pancreas(1)	14						GGATAGTCTTCGCTCTTCATG	0.458													15	107	---	---	---	---	PASS
NLGN1	22871	broad.mit.edu	37	3	173322732	173322732	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:173322732C>A	uc003fio.1	+	3	767	c.344C>A	c.(343-345)CCT>CAT	p.P115H	NLGN1_uc010hww.1_Missense_Mutation_p.P115H|NLGN1_uc003fip.1_Missense_Mutation_p.P115H	NM_014932	NP_055747	Q8N2Q7	NLGN1_HUMAN	neuroligin 1	115	Extracellular (Potential).				calcium-dependent cell-cell adhesion|neuron cell-cell adhesion|neuronal signal transduction|positive regulation of dendritic spine development|positive regulation of excitatory postsynaptic membrane potential|positive regulation of intracellular protein kinase cascade|positive regulation of synaptogenesis|protein targeting|regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|regulation of N-methyl-D-aspartate selective glutamate receptor activity|synapse assembly|synaptic vesicle targeting	cell junction|cell surface|dendrite|integral to plasma membrane|postsynaptic density|postsynaptic membrane	cell adhesion molecule binding|neurexin binding|receptor activity			lung(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)|ovary(1)|pancreas(1)	7	Ovarian(172;0.0025)		LUSC - Lung squamous cell carcinoma(14;5.36e-13)|Lung(28;9.49e-13)			CAATTTGCTCCTGTGTGTCCC	0.478													54	488	---	---	---	---	PASS
PIK3CA	5290	broad.mit.edu	37	3	178928079	178928079	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:178928079G>A	uc003fjk.2	+	8	1514	c.1357G>A	c.(1357-1359)GAA>AAA	p.E453K		NM_006218	NP_006209	P42336	PK3CA_HUMAN	phosphoinositide-3-kinase, catalytic, alpha	453	C2 PI3K-type.		E -> Q (in cancer; shows an increase in lipid kinase activity; may disrupt the interaction of the C2 PI3K-type domain with the iSH2 region of the p85 regulatory subunit).		epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|platelet activation|T cell costimulation|T cell receptor signaling pathway		1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity	p.E453K(5)|p.E453Q(1)|p.E453A(1)|p.P449_L455del(1)|p.G451_L456>V(1)|p.E453del(1)		breast(1564)|large_intestine(776)|endometrium(246)|urinary_tract(195)|ovary(141)|skin(112)|stomach(98)|thyroid(77)|central_nervous_system(69)|lung(65)|upper_aerodigestive_tract(58)|haematopoietic_and_lymphoid_tissue(27)|cervix(25)|biliary_tract(22)|liver(20)|oesophagus(17)|pancreas(11)|penis(8)|pituitary(8)|autonomic_ganglia(4)|prostate(3)|kidney(2)|meninges(1)|eye(1)|NS(1)|soft_tissue(1)|bone(1)	3553	all_cancers(143;1.19e-17)|Ovarian(172;0.00769)|Breast(254;0.155)		OV - Ovarian serous cystadenocarcinoma(80;9.59e-28)|GBM - Glioblastoma multiforme(14;0.003)|BRCA - Breast invasive adenocarcinoma(182;0.0282)			TCATGGATTAGAAGATTTGCT	0.348		57	Mis		colorectal|gastric|gliobastoma|breast					HNSCC(19;0.045)|TSP Lung(28;0.18)			35	334	---	---	---	---	PASS
FXR1	8087	broad.mit.edu	37	3	180671612	180671612	+	Silent	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180671612T>A	uc003fkq.2	+	9	886	c.864T>A	c.(862-864)GTT>GTA	p.V288V	FXR1_uc003fkp.2_Silent_p.V203V|FXR1_uc003fkr.2_Silent_p.V288V|FXR1_uc011bqj.1_Silent_p.V202V|FXR1_uc003fks.2_Silent_p.V202V|FXR1_uc011bqk.1_Silent_p.V239V|FXR1_uc011bql.1_Silent_p.V275V	NM_005087	NP_005078	P51114	FXR1_HUMAN	fragile X mental retardation-related protein 1	288	KH 2.				apoptosis|cell differentiation|muscle organ development	nucleolus|polysome				breast(1)	1	all_cancers(143;6.07e-14)|Ovarian(172;0.0212)		Epithelial(37;3.05e-35)|OV - Ovarian serous cystadenocarcinoma(80;2.4e-22)			TTATTCAGGTTCCTAGGAATC	0.323													36	327	---	---	---	---	PASS
ALG3	10195	broad.mit.edu	37	3	183960603	183960603	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183960603G>C	uc003fne.2	-	8	1183	c.1152C>G	c.(1150-1152)CTC>CTG	p.L384L	ALG3_uc011brc.1_Silent_p.L349L|ALG3_uc011brd.1_Silent_p.L328L|ALG3_uc011bre.1_Silent_p.L336L	NM_005787	NP_005778	Q92685	ALG3_HUMAN	alpha-1,3-mannosyltransferase ALG3 isoform a	384					dolichol-linked oligosaccharide biosynthetic process|post-translational protein modification|protein N-linked glycosylation via asparagine	endoplasmic reticulum membrane|integral to membrane	alpha-1,3-mannosyltransferase activity				0	all_cancers(143;1.39e-10)|Ovarian(172;0.0339)		Epithelial(37;8.28e-34)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)			GCTGGTACCTGAGCAGGTGTG	0.597													24	266	---	---	---	---	PASS
EPHB3	2049	broad.mit.edu	37	3	184295449	184295449	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184295449G>A	uc003foz.2	+	7	1920	c.1483G>A	c.(1483-1485)GAG>AAG	p.E495K		NM_004443	NP_004434	P54753	EPHB3_HUMAN	ephrin receptor EphB3 precursor	495	Fibronectin type-III 2.|Extracellular (Potential).					integral to plasma membrane	ATP binding|ephrin receptor activity			lung(5)|breast(2)|upper_aerodigestive_tract(1)|stomach(1)|skin(1)|ovary(1)	11	all_cancers(143;1.89e-10)|Ovarian(172;0.0339)		Epithelial(37;1.27e-34)|OV - Ovarian serous cystadenocarcinoma(80;3.8e-22)			ATTGCAGAGCGAGGGCATCGC	0.657													53	319	---	---	---	---	PASS
FGF12	2257	broad.mit.edu	37	3	192125893	192125893	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:192125893C>A	uc003fsx.2	-	1	946	c.120G>T	c.(118-120)CTG>CTT	p.L40L	FGF12_uc003fsy.2_Intron	NM_021032	NP_066360	P61328	FGF12_HUMAN	fibroblast growth factor 12 isoform 1	40					cell-cell signaling|heart development|JNK cascade|nervous system development|signal transduction	extracellular space|nucleus	growth factor activity|heparin binding			ovary(1)|skin(1)|lung(1)|pancreas(1)	4	all_cancers(143;1.72e-08)|Ovarian(172;0.0634)|Breast(254;0.247)	Lung NSC(153;0.21)	LUSC - Lung squamous cell carcinoma(58;5.45e-06)|Lung(62;6.17e-06)	GBM - Glioblastoma multiforme(46;0.00032)		GCCTCTCGCACAGGGAGCGCC	0.672													148	319	---	---	---	---	PASS
ATP13A4	84239	broad.mit.edu	37	3	193232645	193232645	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:193232645G>A	uc003ftd.2	-	2	184	c.76C>T	c.(76-78)CGG>TGG	p.R26W	ATP13A4_uc003fte.1_Missense_Mutation_p.R26W|ATP13A4_uc011bsr.1_5'UTR	NM_032279	NP_115655	Q4VNC1	AT134_HUMAN	ATPase type 13A4	26	Cytoplasmic (Potential).				ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			ovary(2)	2	all_cancers(143;1.76e-08)|Ovarian(172;0.0386)		OV - Ovarian serous cystadenocarcinoma(49;2.72e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;0.000109)		CCTTGAGTCCGATAGCCAAAT	0.418													11	111	---	---	---	---	PASS
KIAA0226	9711	broad.mit.edu	37	3	197421306	197421306	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:197421306G>A	uc003fyc.2	-	10	1807	c.1624C>T	c.(1624-1626)CGG>TGG	p.R542W	KIAA0226_uc003fyd.3_Missense_Mutation_p.R497W|KIAA0226_uc003fye.1_Missense_Mutation_p.R249W|KIAA0226_uc003fyf.2_Missense_Mutation_p.R390W	NM_014687	NP_055502	Q92622	RUBIC_HUMAN	hypothetical protein LOC9711 isoform 2.	542					autophagy|endocytosis|negative regulation of autophagy|negative regulation of endocytosis	early endosome|late endosome|lysosome	protein binding				0	all_cancers(143;8.26e-10)|Ovarian(172;0.0418)|Breast(254;0.0976)		Epithelial(36;2.19e-23)|all cancers(36;1.39e-21)|OV - Ovarian serous cystadenocarcinoma(49;1.21e-18)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(93;0.0446)		TGCTGGCGCCGAAGGCGGATC	0.542													24	616	---	---	---	---	PASS
ZFYVE28	57732	broad.mit.edu	37	4	2307005	2307005	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:2307005G>A	uc003gex.1	-	8	1381	c.1062C>T	c.(1060-1062)GAC>GAT	p.D354D	ZFYVE28_uc011bvk.1_Silent_p.D284D|ZFYVE28_uc011bvl.1_Silent_p.D324D|ZFYVE28_uc003gew.1_Silent_p.D240D	NM_020972	NP_066023	Q9HCC9	LST2_HUMAN	zinc finger, FYVE domain containing 28	354					negative regulation of epidermal growth factor receptor activity	cytosol|early endosome membrane	metal ion binding|phosphatidylinositol-3-phosphate binding|protein binding			skin(2)|ovary(1)	3						AGGACATCTCGTCCCCCGCCC	0.657													27	87	---	---	---	---	PASS
DRD5	1816	broad.mit.edu	37	4	9784820	9784820	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:9784820C>T	uc003gmb.3	+	1	1563	c.1167C>T	c.(1165-1167)ATC>ATT	p.I389I		NM_000798	NP_000789	P21918	DRD5_HUMAN	dopamine receptor D5	389	Cytoplasmic (Potential).				activation of adenylate cyclase activity by dopamine receptor signaling pathway|activation of phospholipase C activity by dopamine receptor signaling pathway|cellular calcium ion homeostasis|negative regulation of NAD(P)H oxidase activity|reactive oxygen species metabolic process|synaptic transmission, dopaminergic	integral to plasma membrane				skin(1)	1					Apomorphine(DB00714)|Carphenazine(DB01038)|Fenoldopam(DB00800)|Zuclopenthixol(DB01624)	CGGTGAACATCAGCAATGAGC	0.572													13	104	---	---	---	---	PASS
HS3ST1	9957	broad.mit.edu	37	4	11400967	11400967	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:11400967G>A	uc003gmq.2	-	2	986	c.663C>T	c.(661-663)ATC>ATT	p.I221I		NM_005114	NP_005105	O14792	HS3S1_HUMAN	heparan sulfate D-glucosaminyl	221						Golgi lumen|integral to membrane	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity			skin(1)	1						AGGGGTCCCTGATGAGGCGGT	0.547													13	34	---	---	---	---	PASS
BOD1L	259282	broad.mit.edu	37	4	13605967	13605967	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:13605967C>G	uc003gmz.1	-	10	2674	c.2557G>C	c.(2557-2559)GAT>CAT	p.D853H	BOD1L_uc010idr.1_Missense_Mutation_p.D190H	NM_148894	NP_683692	Q8NFC6	BOD1L_HUMAN	biorientation of chromosomes in cell division	853	Lys-rich.						DNA binding			ovary(5)|breast(1)	6						CCCAGAGAATCTTTCTGAATT	0.368													7	61	---	---	---	---	PASS
CLRN2	645104	broad.mit.edu	37	4	17528677	17528677	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:17528677C>A	uc003gpg.1	+	3	773	c.671C>A	c.(670-672)ACG>AAG	p.T224K		NM_001079827	NP_001073296	A0PK11	CLRN2_HUMAN	clarin 2	224						integral to membrane					0						GAAGAGGCCACGGTCACAGCT	0.512													59	235	---	---	---	---	PASS
NCAPG	64151	broad.mit.edu	37	4	17841431	17841431	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:17841431C>T	uc003gpp.2	+	17	2775	c.2599C>T	c.(2599-2601)CTT>TTT	p.L867F	NCAPG_uc011bxj.1_Missense_Mutation_p.L376F	NM_022346	NP_071741	Q9BPX3	CND3_HUMAN	chromosome condensation protein G	867	HEAT 10.				cell division|mitotic chromosome condensation	condensin complex|cytoplasm|nucleus	protein binding			large_intestine(1)	1				STAD - Stomach adenocarcinoma(129;0.18)		TGCAAAAGATCTTCTGGTTCT	0.338													6	22	---	---	---	---	PASS
CORIN	10699	broad.mit.edu	37	4	47647215	47647215	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47647215G>C	uc003gxm.2	-						CORIN_uc011bzf.1_Intron|CORIN_uc011bzg.1_Intron|CORIN_uc011bzh.1_Intron	NM_006587	NP_006578	Q9Y5Q5	CORIN_HUMAN	corin						peptide hormone processing|regulation of systemic arterial blood pressure by atrial natriuretic peptide	integral to membrane|plasma membrane	scavenger receptor activity|serine-type endopeptidase activity|serine-type exopeptidase activity			ovary(1)|central_nervous_system(1)	2						TTACAACCTAGAGACAGAAGA	0.353													7	150	---	---	---	---	PASS
CORIN	10699	broad.mit.edu	37	4	47667041	47667041	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47667041C>G	uc003gxm.2	-						CORIN_uc011bzf.1_Intron|CORIN_uc011bzg.1_Intron|CORIN_uc011bzh.1_Intron|CORIN_uc011bzi.1_Intron	NM_006587	NP_006578	Q9Y5Q5	CORIN_HUMAN	corin						peptide hormone processing|regulation of systemic arterial blood pressure by atrial natriuretic peptide	integral to membrane|plasma membrane	scavenger receptor activity|serine-type endopeptidase activity|serine-type exopeptidase activity			ovary(1)|central_nervous_system(1)	2						TAGATCCCATCATATTACCTG	0.423													5	96	---	---	---	---	PASS
SPINK2	6691	broad.mit.edu	37	4	57686746	57686746	+	Splice_Site	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57686746C>A	uc003hcg.1	-	2	121	c.56_splice	c.e2-1	p.A19_splice		NM_021114	NP_066937	P20155	ISK2_HUMAN	serine protease inhibitor, Kazal type 2							extracellular region	serine-type endopeptidase inhibitor activity				0	Glioma(25;0.08)|all_neural(26;0.181)					ATCAGAGAGGCTGTAAGAAGA	0.299													27	142	---	---	---	---	PASS
REST	5978	broad.mit.edu	37	4	57796764	57796764	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57796764G>C	uc003hch.2	+	4	2087	c.1740G>C	c.(1738-1740)AAG>AAC	p.K580N	REST_uc003hci.2_Missense_Mutation_p.K580N|REST_uc010ihf.2_Missense_Mutation_p.K254N	NM_005612	NP_005603	Q13127	REST_HUMAN	RE1-silencing transcription factor	580	Lys-rich.				cardiac muscle cell myoblast differentiation|cellular response to drug|cellular response to electrical stimulus|cellular response to glucocorticoid stimulus|histone H4 deacetylation|negative regulation by host of viral transcription|negative regulation of aldosterone biosynthetic process|negative regulation of calcium ion-dependent exocytosis|negative regulation of cell proliferation|negative regulation of cortisol biosynthetic process|negative regulation of dense core granule biogenesis|negative regulation of insulin secretion|negative regulation of mesenchymal stem cell differentiation|negative regulation of neurogenesis|negative regulation of neuron differentiation|positive regulation of apoptosis|positive regulation of caspase activity|positive regulation of transcription, DNA-dependent	cytoplasm|transcriptional repressor complex	calcium channel activity|chromatin binding|core promoter proximal region sequence-specific DNA binding|core promoter sequence-specific DNA binding|outward rectifier potassium channel activity|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription|zinc ion binding			skin(5)|upper_aerodigestive_tract(1)|ovary(1)|lung(1)|central_nervous_system(1)	9	Glioma(25;0.08)|all_neural(26;0.181)					AAAGTACAAAGAAGAAAACTC	0.388													9	51	---	---	---	---	PASS
POLR2B	5431	broad.mit.edu	37	4	57889874	57889874	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57889874G>A	uc003hcl.1	+	20	2856	c.2813G>A	c.(2812-2814)CGA>CAA	p.R938Q	POLR2B_uc011cae.1_Missense_Mutation_p.R931Q|POLR2B_uc011caf.1_Missense_Mutation_p.R863Q|POLR2B_uc003hcm.1_Missense_Mutation_p.R431Q	NM_000938	NP_000929	P30876	RPB2_HUMAN	DNA directed RNA polymerase II polypeptide B	938					mRNA capping|nuclear mRNA splicing, via spliceosome|positive regulation of viral transcription|protein phosphorylation|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair|viral reproduction	DNA-directed RNA polymerase II, core complex	DNA binding|DNA-directed RNA polymerase activity|metal ion binding|protein binding|ribonucleoside binding			ovary(2)	2	Glioma(25;0.08)|all_neural(26;0.181)					TTTGCTAGTCGACATGGTCAA	0.338													35	132	---	---	---	---	PASS
YTHDC1	91746	broad.mit.edu	37	4	69188478	69188478	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:69188478C>T	uc003hdx.2	-	11	1943	c.1590G>A	c.(1588-1590)CGG>CGA	p.R530R	YTHDC1_uc003hdy.2_Silent_p.R512R	NM_001031732	NP_001026902	Q96MU7	YTDC1_HUMAN	splicing factor YT521-B isoform 1	530	Arg-rich.									upper_aerodigestive_tract(1)|ovary(1)	2						TTCCCACATCCCGGACTGGTT	0.448													29	43	---	---	---	---	PASS
ENAM	10117	broad.mit.edu	37	4	71510219	71510219	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:71510219G>C	uc011caw.1	+	9	3357	c.3076G>C	c.(3076-3078)GAA>CAA	p.E1026Q		NM_031889	NP_114095	Q9NRM1	ENAM_HUMAN	enamelin precursor	1026					bone mineralization|odontogenesis	proteinaceous extracellular matrix	structural constituent of tooth enamel			ovary(3)	3			Lung(101;0.235)			TACACCTGATGAAGGCTCCAA	0.433													37	148	---	---	---	---	PASS
MOBKL1A	92597	broad.mit.edu	37	4	71844841	71844841	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:71844841C>G	uc003hfw.2	+						MOBKL1A_uc011cba.1_Intron	NM_173468	NP_775739	Q7L9L4	MOL1A_HUMAN	MOB1, Mps One Binder kinase activator-like 1A						hippo signaling cascade|protein autophosphorylation	cytoplasm|nucleus	kinase activator activity|kinase binding|metal ion binding				0		all_hematologic(202;0.21)	Lung(101;0.235)			TATCTCTTTTCTAGGTGTCCC	0.393													28	173	---	---	---	---	PASS
SLC4A4	8671	broad.mit.edu	37	4	72319301	72319301	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:72319301C>T	uc003hfy.2	+	12	1529	c.1412C>T	c.(1411-1413)TCG>TTG	p.S471L	SLC4A4_uc010iic.2_Missense_Mutation_p.S471L|SLC4A4_uc010iib.2_Missense_Mutation_p.S471L|SLC4A4_uc003hfz.2_Missense_Mutation_p.S471L|SLC4A4_uc003hgc.3_Missense_Mutation_p.S427L|SLC4A4_uc010iid.2_Intron|SLC4A4_uc003hga.2_Missense_Mutation_p.S349L|SLC4A4_uc003hgb.3_Missense_Mutation_p.S427L	NM_001098484	NP_001091954	Q9Y6R1	S4A4_HUMAN	solute carrier family 4, sodium bicarbonate	471	Helical; (Potential).		S -> L (in pRTA-OA; mistargeting to the apical membrane and altered function).			basolateral plasma membrane|integral to plasma membrane	inorganic anion exchanger activity|protein binding|sodium:bicarbonate symporter activity			ovary(3)|kidney(1)|skin(1)	5			Lung(101;0.0739)|LUSC - Lung squamous cell carcinoma(112;0.225)			CAAGCTCTTTCGGCAATTCTC	0.413													55	238	---	---	---	---	PASS
NPFFR2	10886	broad.mit.edu	37	4	73012911	73012911	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73012911G>A	uc003hgg.2	+	4	1049	c.951G>A	c.(949-951)ATG>ATA	p.M317I	NPFFR2_uc010iig.1_Missense_Mutation_p.M99I|NPFFR2_uc003hgi.2_Missense_Mutation_p.M218I|NPFFR2_uc003hgh.2_Missense_Mutation_p.M215I|NPFFR2_uc003hgj.2_RNA	NM_004885	NP_004876	Q9Y5X5	NPFF2_HUMAN	neuropeptide FF receptor 2 isoform 1	317	Extracellular (Potential).				detection of abiotic stimulus	actin cytoskeleton|integral to plasma membrane	neuropeptide receptor activity			ovary(2)|central_nervous_system(1)	3			Lung(101;0.0935)|LUSC - Lung squamous cell carcinoma(112;0.138)			ATCAGGAAATGAGGAAGATCT	0.463													17	89	---	---	---	---	PASS
CCDC158	339965	broad.mit.edu	37	4	77288932	77288932	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:77288932G>C	uc003hkb.3	-							NM_001042784	NP_001036249	Q5M9N0	CD158_HUMAN	coiled-coil domain containing 158											skin(3)|ovary(2)|pancreas(1)	6						GCTGCCATCTGATTGTTAAAG	0.373													18	69	---	---	---	---	PASS
SHROOM3	57619	broad.mit.edu	37	4	77662936	77662936	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:77662936G>A	uc011cbx.1	+	5	4563	c.3610G>A	c.(3610-3612)GAG>AAG	p.E1204K	SHROOM3_uc011cbz.1_Missense_Mutation_p.E1028K|SHROOM3_uc003hkf.1_Missense_Mutation_p.E1079K|SHROOM3_uc003hkg.2_Missense_Mutation_p.E982K	NM_020859	NP_065910	Q8TF72	SHRM3_HUMAN	shroom family member 3 protein	1204					apical protein localization|cell morphogenesis|cellular pigment accumulation|pattern specification process|regulation of cell shape	adherens junction|apical junction complex|apical plasma membrane|cytoplasm|microtubule	actin binding			skin(2)|ovary(1)	3			Lung(101;0.0903)			GAGAGGGGATGAGACCCCCAG	0.706													5	7	---	---	---	---	PASS
IBSP	3381	broad.mit.edu	37	4	88723554	88723554	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:88723554C>T	uc003hqx.3	+	2	139	c.41C>T	c.(40-42)GCC>GTC	p.A14V		NM_004967	NP_004958	P21815	SIAL_HUMAN	integrin-binding sialoprotein precursor	14					biomineral tissue development|cell adhesion|ossification						0		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;0.000333)|COAD - Colon adenocarcinoma(81;0.154)		TTGGGAATGGCCTGTGCTTTC	0.284													18	79	---	---	---	---	PASS
ADH1C	126	broad.mit.edu	37	4	100268235	100268235	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:100268235G>A	uc003huu.2	-	3	272	c.187C>T	c.(187-189)CCT>TCT	p.P63S		NM_000669	NP_000660	P00326	ADH1G_HUMAN	class I alcohol dehydrogenase, gamma subunit	63					ethanol oxidation|xenobiotic metabolic process	cytosol	alcohol dehydrogenase (NAD) activity|zinc ion binding				0				OV - Ovarian serous cystadenocarcinoma(123;1.08e-07)	Fomepizole(DB01213)|NADH(DB00157)	AAAATCACAGGAAGGGGGGTC	0.488									Naso-/Oropharyngeal/Laryngeal_Cancer_Familial_Clustering_of				46	246	---	---	---	---	PASS
BDH2	56898	broad.mit.edu	37	4	104013856	104013856	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:104013856G>A	uc003hwz.2	-						BDH2_uc003hxa.2_Intron	NM_020139	NP_064524	Q9BUT1	BDH2_HUMAN	3-hydroxybutyrate dehydrogenase, type 2						fatty acid beta-oxidation|heme metabolic process|iron ion homeostasis|siderophore biosynthetic process	cytoplasm	3-hydroxybutyrate dehydrogenase activity|NAD binding|oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor				0		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;2.02e-08)		TTGAATACCTGAAAAATAAAA	0.368													3	31	---	---	---	---	PASS
CFI	3426	broad.mit.edu	37	4	110662037	110662037	+	3'UTR	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:110662037G>C	uc003hzr.3	-	13					CFI_uc003hzq.2_3'UTR|CFI_uc011cft.1_3'UTR|CFI_uc003hzs.3_3'UTR	NM_000204	NP_000195	P05156	CFAI_HUMAN	complement factor I preproprotein						complement activation, classical pathway|innate immune response|proteolysis	extracellular space|membrane	scavenger receptor activity|serine-type endopeptidase activity				0		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.000331)		AATGAAGAGAGAGATCACAAT	0.343													10	108	---	---	---	---	PASS
ANK2	287	broad.mit.edu	37	4	114280095	114280095	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:114280095C>G	uc003ibe.3	+	38	10421	c.10321C>G	c.(10321-10323)CGA>GGA	p.R3441G	ANK2_uc003ibd.3_Intron|ANK2_uc003ibf.3_Intron|ANK2_uc011cgc.1_Intron|ANK2_uc003ibg.3_Intron|ANK2_uc003ibh.3_Intron|ANK2_uc011cgd.1_Missense_Mutation_p.R743G|ANK2_uc011cgb.1_Missense_Mutation_p.R3456G	NM_001148	NP_001139	Q01484	ANK2_HUMAN	ankyrin 2 isoform 1	3408					axon guidance|signal transduction	apical plasma membrane|basolateral plasma membrane|cytoskeleton|cytosol|sarcomere	protein binding|protein binding			central_nervous_system(7)|ovary(3)|large_intestine(2)|breast(1)|skin(1)	14		Ovarian(17;0.0448)|Hepatocellular(203;0.218)		OV - Ovarian serous cystadenocarcinoma(123;4.92e-05)		ACTTACATCCCGATTGCCAGT	0.478													23	92	---	---	---	---	PASS
PLK4	10733	broad.mit.edu	37	4	128814880	128814880	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:128814880C>G	uc003ifo.2	+						PLK4_uc011cgs.1_Intron|PLK4_uc011cgt.1_Intron	NM_014264	NP_055079	O00444	PLK4_HUMAN	polo-like kinase 4						G2/M transition of mitotic cell cycle|positive regulation of centriole replication|trophoblast giant cell differentiation	centriole|cleavage furrow|cytosol|nucleolus	ATP binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity				0						TTGGACTTTTCCCCTTCAGAA	0.343													10	151	---	---	---	---	PASS
ZNF827	152485	broad.mit.edu	37	4	146686798	146686798	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:146686798C>G	uc003ikn.2	-	12	3001	c.2953G>C	c.(2953-2955)GAT>CAT	p.D985H	ZNF827_uc003ikm.2_Missense_Mutation_p.D985H|ZNF827_uc010iox.2_Missense_Mutation_p.D635H|ZNF827_uc003ikl.2_Missense_Mutation_p.D70H	NM_178835	NP_849157	Q17R98	ZN827_HUMAN	zinc finger protein 827	985					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_hematologic(180;0.151)					TGGGAGCCATCTGAATCATCT	0.517													16	290	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	4	165980916	165980916	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:165980916C>T	uc011cjl.1	+	1	617	c.617C>T	c.(616-618)GCT>GTT	p.A206V		NM_001105575	NP_001099045			tripartite motif-containing 75																		TCCAGATTAGCTGAAGAAGAG	0.423													15	52	---	---	---	---	PASS
SC4MOL	6307	broad.mit.edu	37	4	166254511	166254511	+	5'UTR	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:166254511G>C	uc003ire.2	+	2					SC4MOL_uc010irb.2_5'UTR|SC4MOL_uc003irf.2_Intron	NM_006745	NP_006736	Q15800	ERG25_HUMAN	sterol-C4-methyl oxidase-like isoform 1						cholesterol biosynthetic process|fatty acid biosynthetic process	endoplasmic reticulum membrane|integral to membrane|plasma membrane	C-4 methylsterol oxidase activity|iron ion binding				0	all_hematologic(180;0.221)	Prostate(90;0.0959)|Melanoma(52;0.18)		GBM - Glioblastoma multiforme(119;0.0875)	NADH(DB00157)	GCTGTCTGCAGAGATTTGAAA	0.328													14	59	---	---	---	---	PASS
SPATA4	132851	broad.mit.edu	37	4	177114152	177114152	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:177114152C>G	uc003iuo.1	-	3	533	c.424G>C	c.(424-426)GAA>CAA	p.E142Q		NM_144644	NP_653245	Q8NEY3	SPAT4_HUMAN	spermatogenesis associated 4	142					apoptosis|spermatogenesis						0		Breast(14;0.0011)|Prostate(90;0.0129)|Melanoma(52;0.0133)|Renal(120;0.0376)|all_hematologic(60;0.124)		all cancers(43;2.9e-20)|Epithelial(43;1.99e-17)|OV - Ovarian serous cystadenocarcinoma(60;2.58e-09)|GBM - Glioblastoma multiforme(59;0.000162)|STAD - Stomach adenocarcinoma(60;0.000543)|LUSC - Lung squamous cell carcinoma(193;0.096)		ATCAATATTTCAGGCACTCCA	0.279													8	45	---	---	---	---	PASS
SPATA4	132851	broad.mit.edu	37	4	177114705	177114705	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:177114705C>G	uc003iuo.1	-	2	356	c.247G>C	c.(247-249)GAA>CAA	p.E83Q		NM_144644	NP_653245	Q8NEY3	SPAT4_HUMAN	spermatogenesis associated 4	83					apoptosis|spermatogenesis						0		Breast(14;0.0011)|Prostate(90;0.0129)|Melanoma(52;0.0133)|Renal(120;0.0376)|all_hematologic(60;0.124)		all cancers(43;2.9e-20)|Epithelial(43;1.99e-17)|OV - Ovarian serous cystadenocarcinoma(60;2.58e-09)|GBM - Glioblastoma multiforme(59;0.000162)|STAD - Stomach adenocarcinoma(60;0.000543)|LUSC - Lung squamous cell carcinoma(193;0.096)		cagaatatttctgcaattagg	0.229													22	67	---	---	---	---	PASS
WWC2	80014	broad.mit.edu	37	4	184182541	184182541	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:184182541G>T	uc010irx.2	+	11	1947	c.1765G>T	c.(1765-1767)GAG>TAG	p.E589*	WWC2_uc003ivk.3_Nonsense_Mutation_p.E384*|WWC2_uc003ivl.3_RNA|WWC2_uc010iry.2_Nonsense_Mutation_p.E271*|WWC2_uc003ivn.3_Intron	NM_024949	NP_079225	Q6AWC2	WWC2_HUMAN	WW and C2 domain containing 2	589										ovary(2)|lung(1)	3		all_lung(41;5.28e-14)|Lung NSC(41;1.35e-13)|Colorectal(36;0.00681)|Hepatocellular(41;0.00886)|Renal(120;0.00992)|Prostate(90;0.0237)|all_hematologic(60;0.0592)|Esophageal squamous(56;0.179)|all_neural(102;0.202)		all cancers(43;3.38e-24)|Epithelial(43;1.4e-20)|OV - Ovarian serous cystadenocarcinoma(60;1.09e-09)|GBM - Glioblastoma multiforme(59;3.33e-05)|Colorectal(24;3.58e-05)|STAD - Stomach adenocarcinoma(60;4.21e-05)|COAD - Colon adenocarcinoma(29;0.000171)|LUSC - Lung squamous cell carcinoma(40;0.0145)|READ - Rectum adenocarcinoma(43;0.242)		TGAAGACTGTGAGTTGAGTAG	0.468													6	24	---	---	---	---	PASS
CEP72	55722	broad.mit.edu	37	5	637810	637810	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:637810C>T	uc003jbf.2	+	7	1155	c.1083C>T	c.(1081-1083)TCC>TCT	p.S361S	CEP72_uc011clz.1_RNA	NM_018140	NP_060610	Q9P209	CEP72_HUMAN	centrosomal protein 72 kDa	361					G2/M transition of mitotic cell cycle|gamma-tubulin complex localization|spindle organization	centrosome|cytosol				ovary(1)	1			Epithelial(17;0.000339)|all cancers(22;0.00137)|OV - Ovarian serous cystadenocarcinoma(19;0.00153)|Lung(60;0.0863)			ATGGGTCCTCCGTGCCCAAGG	0.597													67	88	---	---	---	---	PASS
FASTKD3	79072	broad.mit.edu	37	5	7867058	7867058	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:7867058C>T	uc003jeb.2	-	2	1276	c.1139G>A	c.(1138-1140)AGA>AAA	p.R380K	FASTKD3_uc011cmp.1_Missense_Mutation_p.R82K|FASTKD3_uc003jec.2_Intron|MTRR_uc010itn.1_5'Flank|MTRR_uc003jee.3_5'Flank|MTRR_uc003jed.2_5'Flank|MTRR_uc003jef.3_5'Flank|MTRR_uc003jeg.3_5'Flank|MTRR_uc010ito.2_5'Flank	NM_024091	NP_076996	Q14CZ7	FAKD3_HUMAN	FAST kinase domains 3	380					apoptosis|cellular respiration	mitochondrion	ATP binding|protein kinase activity			ovary(2)|breast(1)|pancreas(1)	4						AATCAGTTCTCTACTGCAGTA	0.438													19	139	---	---	---	---	PASS
CDH18	1016	broad.mit.edu	37	5	19473633	19473633	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:19473633C>T	uc003jgc.2	-	12	2452	c.2075G>A	c.(2074-2076)AGA>AAA	p.R692K	CDH18_uc003jgd.2_Missense_Mutation_p.R692K|CDH18_uc011cnm.1_3'UTR	NM_004934	NP_004925	Q13634	CAD18_HUMAN	cadherin 18, type 2 preproprotein	692	Cytoplasmic (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(5)|large_intestine(1)|skin(1)	7	Lung NSC(1;0.00734)|all_lung(1;0.0197)					CACTTCAGGTCTGATATCCCT	0.498													45	191	---	---	---	---	PASS
CDH12	1010	broad.mit.edu	37	5	21755941	21755941	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:21755941C>T	uc010iuc.2	-	11	2102	c.1644G>A	c.(1642-1644)GCG>GCA	p.A548A	CDH12_uc011cno.1_Silent_p.A508A|CDH12_uc003jgk.2_Silent_p.A548A|uc003jgj.2_Intron	NM_004061	NP_004052	P55289	CAD12_HUMAN	cadherin 12, type 2 preproprotein	548	Extracellular (Potential).|Cadherin 5.				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2						TTTCAATCCCCGCTGTGTTGT	0.428										HNSCC(59;0.17)			90	77	---	---	---	---	PASS
NUP155	9631	broad.mit.edu	37	5	37303458	37303458	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37303458C>G	uc003jku.1	-	28	3339	c.3221G>C	c.(3220-3222)AGA>ACA	p.R1074T	NUP155_uc003jkt.1_Missense_Mutation_p.R1015T|NUP155_uc010iuz.1_Missense_Mutation_p.R1010T	NM_153485	NP_705618	O75694	NU155_HUMAN	nucleoporin 155kDa isoform 1	1074					carbohydrate metabolic process|glucose transport|mRNA transport|nucleocytoplasmic transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	nuclear membrane|nuclear pore	protein binding|structural constituent of nuclear pore|transporter activity			ovary(1)	1	all_lung(31;0.000137)		COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			ATAACGAACTCTGTTTTGATC	0.398													11	144	---	---	---	---	PASS
EGFLAM	133584	broad.mit.edu	37	5	38407939	38407939	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:38407939C>T	uc003jlc.1	+	9	1504	c.1180C>T	c.(1180-1182)CAC>TAC	p.H394Y	EGFLAM_uc003jlb.1_Missense_Mutation_p.H394Y|EGFLAM_uc003jle.1_Missense_Mutation_p.H160Y|EGFLAM_uc003jlf.1_Intron	NM_152403	NP_689616	Q63HQ2	EGFLA_HUMAN	EGF-like, fibronectin type III and laminin G	394	Laminin G-like 1.					cell junction|proteinaceous extracellular matrix|synapse				pancreas(3)|skin(3)|ovary(1)	7	all_lung(31;0.000385)					GTTCTTTGGCCACTCCTATGT	0.343													38	102	---	---	---	---	PASS
MAST4	375449	broad.mit.edu	37	5	66427717	66427717	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:66427717G>T	uc003jut.1	+	15	1532	c.1464G>T	c.(1462-1464)ACG>ACT	p.T488T	MAST4_uc003juu.1_Silent_p.T498T|MAST4_uc011cra.1_Silent_p.T471T|MAST4_uc003juv.2_Silent_p.T483T|MAST4_uc003juw.2_Silent_p.T483T	NM_015183	NP_055998	O15021	MAST4_HUMAN	microtubule associated serine/threonine kinase	680	Protein kinase.			FAETV -> YIVKL (in Ref. 4; BAB71532).		cytoplasm	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			lung(6)|ovary(2)|kidney(2)|breast(2)|central_nervous_system(1)	13		Lung NSC(167;8.56e-06)|Prostate(74;0.00637)|Ovarian(174;0.0563)|Breast(144;0.0586)|Colorectal(97;0.245)		Lung(70;0.011)		TTGCTGAGACGGTCTTGGCCT	0.393													59	91	---	---	---	---	PASS
BDP1	55814	broad.mit.edu	37	5	70808128	70808128	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:70808128G>C	uc003kbp.1	+	18	4383	c.4120G>C	c.(4120-4122)GAA>CAA	p.E1374Q	BDP1_uc003kbo.2_Missense_Mutation_p.E1374Q	NM_018429	NP_060899	A6H8Y1	BDP1_HUMAN	transcription factor-like nuclear regulator	1374					regulation of transcription, DNA-dependent|transcription from RNA polymerase III promoter	nucleoplasm	DNA binding			skin(2)	2		Lung NSC(167;0.000422)|Prostate(74;0.00815)|Ovarian(174;0.0176)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;5.28e-56)|Epithelial(20;2.31e-50)		AAGAAATTCTGAAAAAGAAGT	0.363													9	149	---	---	---	---	PASS
UTP15	84135	broad.mit.edu	37	5	72866451	72866451	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:72866451G>A	uc003kcw.1	+	6	811	c.588G>A	c.(586-588)ACG>ACA	p.T196T	UTP15_uc011cso.1_Silent_p.T177T|UTP15_uc011csp.1_Silent_p.T6T|UTP15_uc010ize.1_Silent_p.T196T	NM_032175	NP_115551	Q8TED0	UTP15_HUMAN	UTP15, U3 small nucleolar ribonucleoprotein,	196	WD 4.				rRNA processing	cytoplasm|nucleolus					0		Lung NSC(167;0.00405)|Ovarian(174;0.0129)		OV - Ovarian serous cystadenocarcinoma(47;7.76e-55)		ATGCACGAACGAGTGAGAGTG	0.398													23	126	---	---	---	---	PASS
DMGDH	29958	broad.mit.edu	37	5	78301117	78301117	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:78301117T>A	uc003kfs.2	-	15	2370	c.2364A>T	c.(2362-2364)GAA>GAT	p.E788D		NM_013391	NP_037523	Q9UI17	M2GD_HUMAN	dimethylglycine dehydrogenase precursor	788					choline metabolic process|glycine catabolic process	mitochondrial matrix	aminomethyltransferase activity|dimethylglycine dehydrogenase activity|electron carrier activity			ovary(2)|liver(1)|skin(1)	4		all_lung(232;0.000638)|Lung NSC(167;0.00173)|Ovarian(174;0.0262)|Prostate(461;0.192)		OV - Ovarian serous cystadenocarcinoma(54;6.52e-45)|Epithelial(54;5.96e-40)|all cancers(79;3.56e-35)		ACCAGATGCTTTCATTTCCCT	0.493													14	19	---	---	---	---	PASS
SSBP2	23635	broad.mit.edu	37	5	81046795	81046795	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:81046795C>T	uc003kho.2	-						SSBP2_uc003khn.2_5'UTR|SSBP2_uc003khp.2_Intron|SSBP2_uc011ctp.1_Intron|SSBP2_uc011ctq.1_Intron|SSBP2_uc011ctr.1_Intron	NM_012446	NP_036578	P81877	SSBP2_HUMAN	single-stranded DNA binding protein 2						regulation of transcription, DNA-dependent	cytoplasm|nucleus	single-stranded DNA binding		SSBP2/JAK2(4)	haematopoietic_and_lymphoid_tissue(4)|skin(1)	5		Lung NSC(167;0.00154)|all_lung(232;0.00179)|Ovarian(174;0.0338)		OV - Ovarian serous cystadenocarcinoma(54;1.07e-41)|Epithelial(54;2.79e-35)|all cancers(79;1.18e-29)		AGCGGAGACACTTACTTCTCC	0.647													6	14	---	---	---	---	PASS
GPR98	84059	broad.mit.edu	37	5	90261225	90261225	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90261225C>G	uc003kju.2	+						GPR98_uc003kjt.2_Intron|GPR98_uc003kjw.2_Intron|GPR98_uc003kjx.2_Intron	NM_032119	NP_115495	Q8WXG9	GPR98_HUMAN	G protein-coupled receptor 98 precursor						cell communication|cell-cell adhesion|maintenance of organ identity|neuropeptide signaling pathway|photoreceptor cell maintenance	cell surface|cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(11)|central_nervous_system(3)|pancreas(2)	16		all_cancers(142;1.05e-09)|all_epithelial(76;1.81e-12)|all_lung(232;5.41e-06)|Lung NSC(167;1.72e-05)|Ovarian(174;0.00948)|Colorectal(57;0.133)|Breast(839;0.192)		OV - Ovarian serous cystadenocarcinoma(54;7.01e-30)|Epithelial(54;6.79e-25)|all cancers(79;1.88e-20)		GTATCTGTTTCTTACAGATTC	0.383													5	71	---	---	---	---	PASS
ARRDC3	57561	broad.mit.edu	37	5	90678636	90678636	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90678636C>T	uc003kjz.2	-	1	514	c.274G>A	c.(274-276)GAA>AAA	p.E92K	LOC100129716_uc003kka.3_Intron	NM_020801	NP_065852	Q96B67	ARRD3_HUMAN	arrestin domain containing 3	92					signal transduction	cytoplasm	protein binding			ovary(1)|breast(1)	2		all_cancers(142;2.22e-05)|all_epithelial(76;1.58e-07)|all_lung(232;0.000521)|Lung NSC(167;0.000548)|Ovarian(174;0.0798)|Colorectal(57;0.207)		OV - Ovarian serous cystadenocarcinoma(54;4.56e-30)|Epithelial(54;7.55e-26)|all cancers(79;3.63e-22)		TTACCTCTTTCGTGCCCAATT	0.368													15	281	---	---	---	---	PASS
GRAMD3	65983	broad.mit.edu	37	5	125822583	125822583	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:125822583C>T	uc003ktu.2	+	12	1507	c.1077C>T	c.(1075-1077)ATC>ATT	p.I359I	GRAMD3_uc011cwt.1_Silent_p.I374I|GRAMD3_uc011cwv.1_Silent_p.I367I|GRAMD3_uc011cww.1_Silent_p.I255I|GRAMD3_uc011cwx.1_RNA|GRAMD3_uc011cwy.1_Silent_p.I250I|GRAMD3_uc011cwz.1_Silent_p.I343I	NM_023927	NP_076416	Q96HH9	GRAM3_HUMAN	GRAM domain containing 3 isoform 2	359										central_nervous_system(1)	1		Prostate(80;0.0928)	KIRC - Kidney renal clear cell carcinoma(527;0.0584)|Kidney(363;0.0934)	Epithelial(69;0.0401)|OV - Ovarian serous cystadenocarcinoma(64;0.0604)|all cancers(49;0.108)		CACTAATCATCTCGACCTTCT	0.438													8	41	---	---	---	---	PASS
ADAMTS19	171019	broad.mit.edu	37	5	128990070	128990070	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:128990070G>T	uc003kvb.1	+	14	2230	c.2230G>T	c.(2230-2232)GAT>TAT	p.D744Y	ADAMTS19_uc010jdh.1_RNA	NM_133638	NP_598377	Q8TE59	ATS19_HUMAN	ADAM metallopeptidase with thrombospondin type 1	744	Cys-rich.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(5)|breast(2)|lung(1)|skin(1)	9		all_cancers(142;0.0148)|Prostate(80;0.0494)|Breast(839;0.238)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)	OV - Ovarian serous cystadenocarcinoma(64;0.222)		AAAAGTGATGGATGGAACTTC	0.358													14	123	---	---	---	---	PASS
PCDHA2	56146	broad.mit.edu	37	5	140175215	140175215	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140175215C>T	uc003lhd.2	+	1	772	c.666C>T	c.(664-666)CTC>CTT	p.L222L	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhc.1_Silent_p.L222L|PCDHA2_uc011czy.1_Silent_p.L222L	NM_018905	NP_061728	Q9Y5H9	PCDA2_HUMAN	protocadherin alpha 2 isoform 1 precursor	222	Extracellular (Potential).|Cadherin 2.				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(4)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			AACCTGAGCTCACGGGCACCG	0.428													60	325	---	---	---	---	PASS
PCDHA5	56143	broad.mit.edu	37	5	140203604	140203604	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140203604G>A	uc003lhl.2	+	1	2244	c.2244G>A	c.(2242-2244)TCG>TCA	p.S748S	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Silent_p.S748S|PCDHA5_uc003lhj.1_Silent_p.S748S	NM_018908	NP_061731	Q9Y5H7	PCDA5_HUMAN	protocadherin alpha 5 isoform 1 precursor	748	Cytoplasmic (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(1)|breast(1)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			GGAGCTGGTCGTACTCGCAGC	0.647													64	71	---	---	---	---	PASS
PCDHA5	56143	broad.mit.edu	37	5	140203689	140203689	+	Nonsense_Mutation	SNP	C	T	T	rs141975967		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140203689C>T	uc003lhl.2	+	1	2329	c.2329C>T	c.(2329-2331)CAG>TAG	p.Q777*	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Nonsense_Mutation_p.Q777*|PCDHA5_uc003lhj.1_Nonsense_Mutation_p.Q777*	NM_018908	NP_061731	Q9Y5H7	PCDA5_HUMAN	protocadherin alpha 5 isoform 1 precursor	777	Cytoplasmic (Potential).|5 X 4 AA repeats of P-X-X-P.				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(1)|breast(1)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			AAGCCTTCCTCAGGGTCCCAC	0.483													6	144	---	---	---	---	PASS
SLC25A2	83884	broad.mit.edu	37	5	140682556	140682556	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140682556T>A	uc003ljf.2	-	1	1057	c.877A>T	c.(877-879)ATG>TTG	p.M293L		NM_031947	NP_114153	Q9BXI2	ORNT2_HUMAN	solute carrier family 25 member 2	293	Solcar 3.				mitochondrial ornithine transport|urea cycle	integral to membrane|mitochondrial inner membrane	L-ornithine transmembrane transporter activity			ovary(1)	1		all_lung(500;0.000249)|Lung NSC(810;0.0011)|Ovarian(839;0.00556)|Breast(839;0.0173)|all_hematologic(541;0.152)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)	GBM - Glioblastoma multiforme(465;0.00204)	L-Ornithine(DB00129)	TTCATCATCATCTTCCTGCTG	0.458													21	105	---	---	---	---	PASS
SLC25A2	83884	broad.mit.edu	37	5	140682557	140682557	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140682557C>G	uc003ljf.2	-	1	1056	c.876G>C	c.(874-876)AAG>AAC	p.K292N		NM_031947	NP_114153	Q9BXI2	ORNT2_HUMAN	solute carrier family 25 member 2	292	Solcar 3.				mitochondrial ornithine transport|urea cycle	integral to membrane|mitochondrial inner membrane	L-ornithine transmembrane transporter activity			ovary(1)	1		all_lung(500;0.000249)|Lung NSC(810;0.0011)|Ovarian(839;0.00556)|Breast(839;0.0173)|all_hematologic(541;0.152)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)	GBM - Glioblastoma multiforme(465;0.00204)	L-Ornithine(DB00129)	TCATCATCATCTTCCTGCTGT	0.458													20	107	---	---	---	---	PASS
KIAA0141	9812	broad.mit.edu	37	5	141309176	141309176	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:141309176G>A	uc003lls.2	+	5	564	c.442G>A	c.(442-444)GAT>AAT	p.D148N	KIAA0141_uc003llt.2_Missense_Mutation_p.D148N	NM_001142603	NP_001136075	Q14154	DELE_HUMAN	hypothetical protein LOC9812 precursor	148					apoptosis|regulation of caspase activity	mitochondrion	protein binding			skin(1)	1		all_hematologic(541;0.118)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			CCCCAGCCCCGATGGCCCAGC	0.488													27	179	---	---	---	---	PASS
LARS	51520	broad.mit.edu	37	5	145537059	145537059	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:145537059G>A	uc003lnx.1	-	10	1210	c.972C>T	c.(970-972)TTC>TTT	p.F324F	LARS_uc011dbq.1_Silent_p.F278F|LARS_uc011dbr.1_Silent_p.F270F|LARS_uc011dbs.1_Silent_p.F297F	NM_020117	NP_064502	Q9P2J5	SYLC_HUMAN	leucyl-tRNA synthetase	324	Editing domain.				leucyl-tRNA aminoacylation	cytosol	ATP binding|leucine-tRNA ligase activity|protein binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)		L-Leucine(DB00149)	GGGTACAGATGAATATATCAC	0.443													25	103	---	---	---	---	PASS
ABLIM3	22885	broad.mit.edu	37	5	148617026	148617026	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:148617026G>A	uc003lpy.2	+	11	1155	c.904G>A	c.(904-906)GAG>AAG	p.E302K	ABLIM3_uc003lpz.1_Missense_Mutation_p.E302K|ABLIM3_uc003lqa.1_Intron|ABLIM3_uc003lqb.2_Intron|ABLIM3_uc003lqc.1_Missense_Mutation_p.E302K|ABLIM3_uc003lqd.1_Intron|ABLIM3_uc003lqf.2_Intron|ABLIM3_uc003lqe.1_Intron	NM_014945	NP_055760	O94929	ABLM3_HUMAN	actin binding LIM protein family, member 3	302					axon guidance|cytoskeleton organization	cytoplasm	actin binding|zinc ion binding			ovary(2)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			AGTGGATAATGAGATCCTTAA	0.443													16	239	---	---	---	---	PASS
SGCD	6444	broad.mit.edu	37	5	156022011	156022011	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156022011C>G	uc003lwd.3	+	5	925	c.449C>G	c.(448-450)TCT>TGT	p.S150C	SGCD_uc003lwa.1_Missense_Mutation_p.S151C|SGCD_uc003lwb.2_Missense_Mutation_p.S151C|SGCD_uc003lwc.3_Missense_Mutation_p.S151C	NM_001128209	NP_001121681	Q92629	SGCD_HUMAN	delta-sarcoglycan isoform 3	150	Extracellular (Potential).		S -> A (in CMD1L).		cytoskeleton organization|muscle organ development	cytoplasm|cytoskeleton|integral to membrane|sarcoglycan complex|sarcolemma					0	Renal(175;0.00488)	Medulloblastoma(196;0.0378)|all_neural(177;0.106)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)			TTGCTCTTCTCTGCAGACAAT	0.299													7	36	---	---	---	---	PASS
ATP10B	23120	broad.mit.edu	37	5	160061440	160061440	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:160061440C>G	uc003lym.1	-	12	2149	c.1302G>C	c.(1300-1302)AAG>AAC	p.K434N	ATP10B_uc003lyp.2_Missense_Mutation_p.K434N|ATP10B_uc011deg.1_Missense_Mutation_p.K478N|ATP10B_uc003lyn.2_5'UTR|ATP10B_uc003lyo.2_Missense_Mutation_p.K406N	NM_025153	NP_079429	O94823	AT10B_HUMAN	ATPase, class V, type 10B	434	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(3)|central_nervous_system(1)|pancreas(1)	5	Renal(175;0.00196)	Medulloblastoma(196;0.0377)|all_neural(177;0.121)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)			GGGTCCCCGTCTTATCGGAGA	0.498													68	205	---	---	---	---	PASS
KCNMB1	3779	broad.mit.edu	37	5	169805782	169805782	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:169805782G>T	uc003maq.1	-	4	902	c.502C>A	c.(502-504)CTG>ATG	p.L168M	KCNIP1_uc003map.2_Intron	NM_004137	NP_004128	Q16558	KCMB1_HUMAN	potassium large conductance calcium-activated	168	Helical; Name=2; (Potential).				platelet activation|synaptic transmission		calcium-activated potassium channel activity|potassium channel regulator activity			ovary(2)	2	Renal(175;0.000159)|Lung NSC(126;0.0165)|all_lung(126;0.026)	Medulloblastoma(196;0.0109)|all_neural(177;0.0146)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.175)		CCACCGGTCAGCAGGAAGGTG	0.607													76	115	---	---	---	---	PASS
NSD1	64324	broad.mit.edu	37	5	176637166	176637166	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176637166C>G	uc003mfr.3	+	5	1904	c.1766C>G	c.(1765-1767)TCT>TGT	p.S589C	NSD1_uc003mft.3_Missense_Mutation_p.S320C|NSD1_uc003mfs.1_Missense_Mutation_p.S486C|NSD1_uc011dfx.1_Missense_Mutation_p.S237C	NM_022455	NP_071900	Q96L73	NSD1_HUMAN	nuclear receptor binding SET domain protein 1	589					negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nucleus	androgen receptor binding|chromatin binding|estrogen receptor binding|histone methyltransferase activity (H3-K36 specific)|histone methyltransferase activity (H4-K20 specific)|ligand-dependent nuclear receptor binding|retinoid X receptor binding|thyroid hormone receptor binding|transcription corepressor activity|zinc ion binding			ovary(2)|kidney(1)	3	all_cancers(89;1.57e-05)|Renal(175;0.000269)|Lung NSC(126;0.00111)|all_lung(126;0.002)	all_neural(177;0.00409)|Medulloblastoma(196;0.00498)|all_hematologic(541;0.21)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)|Epithelial(233;0.198)	Kidney(146;0.235)		AATGGTGACTCTTTATTGGGC	0.448			T	NUP98	AML		Sotos Syndrome		Beckwith-Wiedemann_syndrome|Sotos_syndrome|Weaver_syndrome	HNSCC(47;0.14)			12	177	---	---	---	---	PASS
PHACTR1	221692	broad.mit.edu	37	6	13283796	13283796	+	Splice_Site	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:13283796T>A	uc010jpc.2	+	13	1982	c.1650_splice	c.e13+2	p.K550_splice	PHACTR1_uc003nah.1_Splice_Site_p.K550_splice|TBC1D7_uc003naj.2_Intron|TBC1D7_uc011dis.1_Intron|uc003nak.1_Intron	NM_030948	NP_112210	Q9C0D0	PHAR1_HUMAN	phosphatase and actin regulator 1							cell junction|cytoplasm|synapse	actin binding|protein phosphatase inhibitor activity				0	Breast(50;0.0427)|Ovarian(93;0.12)	all_hematologic(90;0.122)|Lung SC(78;0.195)	Epithelial(50;0.146)|BRCA - Breast invasive adenocarcinoma(129;0.239)			GCAGACAAAGTAAGCAGAGGG	0.637													30	159	---	---	---	---	PASS
MYLIP	29116	broad.mit.edu	37	6	16145463	16145463	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:16145463T>C	uc003nbq.2	+	6	1400	c.1163T>C	c.(1162-1164)ATG>ACG	p.M388T	MYLIP_uc003nbr.2_Missense_Mutation_p.M207T	NM_013262	NP_037394	Q8WY64	MYLIP_HUMAN	myosin regulatory light chain interacting	388	RING-type.				cellular component movement|nervous system development	cytoplasm|cytoskeleton|extrinsic to membrane	cytoskeletal protein binding|ubiquitin-protein ligase activity|zinc ion binding			pancreas(1)	1	Breast(50;0.0799)|Ovarian(93;0.103)	all_hematologic(90;0.0895)	Epithelial(50;0.241)			ATGCTGTGCATGGTGTGCTGC	0.612													62	328	---	---	---	---	PASS
NUP153	9972	broad.mit.edu	37	6	17626107	17626107	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:17626107C>G	uc003ncd.1	-	19	4033	c.3833G>C	c.(3832-3834)GGA>GCA	p.G1278A	NUP153_uc011dje.1_Missense_Mutation_p.G1309A|NUP153_uc010jpl.1_Missense_Mutation_p.G1236A	NM_005124	NP_005115	P49790	NU153_HUMAN	nucleoporin 153kDa	1278					carbohydrate metabolic process|glucose transport|interspecies interaction between organisms|mRNA transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	cytoplasm|nuclear membrane|nuclear pore|nucleolus|nucleoplasm	DNA binding|protein binding|transporter activity|zinc ion binding			lung(4)|ovary(2)|breast(2)|skin(1)	9	Breast(50;0.0259)|Ovarian(93;0.0584)	all_hematologic(90;0.125)	all cancers(50;0.0981)|Epithelial(50;0.112)			ACTGCTGGCTCCTGGACCAAA	0.443													20	104	---	---	---	---	PASS
PRL	5617	broad.mit.edu	37	6	22287673	22287673	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:22287673G>C	uc003ndp.2	-	5	1161	c.642C>G	c.(640-642)CTC>CTG	p.L214L	PRL_uc003ndo.2_Silent_p.L215L|PRL_uc003ndq.2_Silent_p.L214L	NM_000948	NP_000939	P01236	PRL_HUMAN	prolactin precursor	214					cell proliferation|cell surface receptor linked signaling pathway|female pregnancy|lactation|positive regulation of JAK-STAT cascade|regulation of multicellular organism growth	cytosol|extracellular region	hormone activity|prolactin receptor binding				0	Ovarian(93;0.163)					TCAGGAGCTTGAGATAATTGT	0.448													40	393	---	---	---	---	PASS
LRRC16A	55604	broad.mit.edu	37	6	25509902	25509902	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:25509902C>G	uc011djw.1	+	18	1790	c.1414C>G	c.(1414-1416)CAA>GAA	p.Q472E	LRRC16A_uc010jpx.2_Missense_Mutation_p.Q472E|LRRC16A_uc010jpy.2_Missense_Mutation_p.Q472E	NM_017640	NP_060110	Q5VZK9	LR16A_HUMAN	leucine rich repeat containing 16A	472					actin filament organization|blood coagulation|cell migration|lamellipodium assembly|ruffle organization|urate metabolic process	cytosol|lamellipodium|nucleus				ovary(1)|breast(1)|central_nervous_system(1)|pancreas(1)	4						AGGAGGTGCTCAAGTATTAGA	0.353													7	18	---	---	---	---	PASS
HIST1H1C	3006	broad.mit.edu	37	6	26056117	26056117	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26056117C>T	uc003nfw.2	-	1	583	c.540G>A	c.(538-540)GCG>GCA	p.A180A		NM_005319	NP_005310	P16403	H12_HUMAN	histone cluster 1, H1c	180					nucleosome assembly	nucleosome|nucleus	DNA binding			ovary(3)|skin(2)	5						TCTTGGGCTTCGCAACCTTGG	0.542													18	476	---	---	---	---	PASS
HIST1H2BD	3017	broad.mit.edu	37	6	26158626	26158626	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26158626G>C	uc003ngr.2	+	1	278	c.229G>C	c.(229-231)GAG>CAG	p.E77Q	HIST1H2BD_uc003ngs.2_Missense_Mutation_p.E77Q	NM_021063	NP_066407	P58876	H2B1D_HUMAN	histone cluster 1, H2bd	77					nucleosome assembly	nucleosome|nucleus	DNA binding			ovary(1)|pancreas(1)	2						CATCGCAGGCGAGGCTTCCCG	0.612													99	460	---	---	---	---	PASS
BTN2A2	10385	broad.mit.edu	37	6	26390390	26390390	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26390390G>C	uc003nhq.2	+	5	968	c.882G>C	c.(880-882)AAG>AAC	p.K294N	BTN2A2_uc011dkf.1_Missense_Mutation_p.K178N|BTN2A2_uc011dkg.1_Missense_Mutation_p.K200N|BTN2A2_uc003nhr.2_Missense_Mutation_p.K178N|BTN2A2_uc011dkh.1_Missense_Mutation_p.K84N|BTN2A2_uc003nhs.2_Missense_Mutation_p.K294N|BTN2A2_uc003nht.2_Missense_Mutation_p.K294N|BTN2A2_uc011dki.1_Missense_Mutation_p.K43N	NM_006995	NP_008926	Q8WVV5	BT2A2_HUMAN	butyrophilin, subfamily 2, member A2 isoform a	294	Potential.|Cytoplasmic (Potential).				negative regulation of activated T cell proliferation|negative regulation of cellular metabolic process|negative regulation of cytokine secretion	integral to membrane					0						GGGAAAAAAAGATTCTGTCAG	0.378													11	157	---	---	---	---	PASS
ZNF165	7718	broad.mit.edu	37	6	28056492	28056492	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28056492G>A	uc003nkg.2	+	5	1786	c.702G>A	c.(700-702)AAG>AAA	p.K234K	ZNF165_uc003nkh.2_Silent_p.K234K|ZNF165_uc003nki.3_Silent_p.K234K|ZSCAN12P1_uc003nkj.3_5'Flank	NM_003447	NP_003438	P49910	ZN165_HUMAN	zinc finger protein 165	234					viral reproduction	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0						GCAGGGTAAAGAGACAATGGG	0.428													57	236	---	---	---	---	PASS
TNXB	7148	broad.mit.edu	37	6	32017311	32017311	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32017311C>T	uc003nzl.2	-	28	9689	c.9487G>A	c.(9487-9489)GAG>AAG	p.E3163K	TNXB_uc003nzh.1_5'Flank	NM_019105	NP_061978	P22105	TENX_HUMAN	tenascin XB isoform 1 precursor	3210					actin cytoskeleton organization|cell adhesion|collagen metabolic process|elastic fiber assembly|signal transduction	extracellular space|intracellular|proteinaceous extracellular matrix	heparin binding|integrin binding				0						AGCGGCTCCTCAGGGGCCTCC	0.657													25	72	---	---	---	---	PASS
NOTCH4	4855	broad.mit.edu	37	6	32185863	32185863	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32185863C>T	uc003obb.2	-	9	1672	c.1533G>A	c.(1531-1533)GAG>GAA	p.E511E	NOTCH4_uc011dpu.1_RNA|NOTCH4_uc011dpv.1_RNA|NOTCH4_uc003obc.2_Silent_p.E511E	NM_004557	NP_004548	Q99466	NOTC4_HUMAN	notch4 preproprotein	511	EGF-like 12; calcium-binding (Potential).|Extracellular (Potential).				cell fate determination|embryo development|hemopoiesis|mammary gland development|negative regulation of endothelial cell differentiation|Notch receptor processing|Notch signaling pathway|patterning of blood vessels|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cell surface|cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to plasma membrane|nucleoplasm	calcium ion binding|protein heterodimerization activity|receptor activity			lung(8)|ovary(5)|breast(4)|central_nervous_system(3)|upper_aerodigestive_tract(1)|skin(1)	22						TGGTCTCCACCTCACAGAGCT	0.607													9	96	---	---	---	---	PASS
IP6K3	117283	broad.mit.edu	37	6	33694658	33694658	+	Missense_Mutation	SNP	C	T	T	rs145429872		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33694658C>T	uc010jvf.2	-	5	975	c.439G>A	c.(439-441)GAG>AAG	p.E147K	IP6K3_uc003ofb.2_Missense_Mutation_p.E147K	NM_001142883	NP_001136355	Q96PC2	IP6K3_HUMAN	inositol hexakisphosphate kinase 3	147					inositol phosphate biosynthetic process|phosphatidylinositol metabolic process|protein phosphorylation	cytoplasm	ATP binding|inositol hexakisphosphate 5-kinase activity|inositol hexakisphosphate 6-kinase activity|inositol trisphosphate 3-kinase activity				0						AGGTGGGGCTCGGACCTCAGA	0.647													43	251	---	---	---	---	PASS
UHRF1BP1	54887	broad.mit.edu	37	6	34802486	34802486	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34802486C>G	uc003oju.3	+						UHRF1BP1_uc010jvm.1_Intron|UHRF1BP1_uc010jvn.2_Intron	NM_017754	NP_060224	Q6BDS2	URFB1_HUMAN	ICBP90 binding protein 1											ovary(3)	3						ATTGTACTTTCTCTCCTTCCA	0.443													18	348	---	---	---	---	PASS
BRPF3	27154	broad.mit.edu	37	6	36193102	36193102	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:36193102G>C	uc003olv.3	+	11	3464	c.3240G>C	c.(3238-3240)GTG>GTC	p.V1080V	BRPF3_uc010jwb.2_Silent_p.V810V|BRPF3_uc011dtj.1_RNA|BRPF3_uc010jwc.2_Intron|BRPF3_uc011dtk.1_Silent_p.V746V|BRPF3_uc010jwd.2_5'UTR	NM_015695	NP_056510	Q9ULD4	BRPF3_HUMAN	bromodomain and PHD finger containing, 3	1080	PWWP.				histone H3 acetylation|platelet activation|platelet degranulation	cytosol|extracellular region|MOZ/MORF histone acetyltransferase complex	protein binding|zinc ion binding			ovary(1)|skin(1)	2						TGGAGCTGGTGTGGGCCAAGT	0.652													25	149	---	---	---	---	PASS
NFKBIE	4794	broad.mit.edu	37	6	44228205	44228205	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44228205C>T	uc003oxe.1	-	4	1205	c.1180G>A	c.(1180-1182)GCT>ACT	p.A394T	SLC35B2_uc003oxd.2_5'Flank|SLC35B2_uc011dvt.1_5'Flank|SLC35B2_uc011dvu.1_5'Flank	NM_004556	NP_004547	O00221	IKBE_HUMAN	nuclear factor of kappa light polypeptide gene	394	ANK 4.				cytoplasmic sequestering of transcription factor		protein binding			breast(2)	2	all_cancers(18;2e-05)|all_lung(25;0.00747)|Hepatocellular(11;0.00908)|Ovarian(13;0.0273)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)			TCAATGTCAGCTCCATTCCGA	0.592													56	113	---	---	---	---	PASS
CLIC5	53405	broad.mit.edu	37	6	45882036	45882036	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:45882036G>T	uc003oxv.3	-	5	1100	c.994C>A	c.(994-996)CGC>AGC	p.R332S	CLIC5_uc003oxu.3_Missense_Mutation_p.R173S|CLIC5_uc003oxw.2_RNA|CLIC5_uc003oxx.2_Missense_Mutation_p.R173S	NM_001114086	NP_001107558	Q9NZA1	CLIC5_HUMAN	chloride intracellular channel 5 isoform a	332	GST C-terminal.				female pregnancy	actin cytoskeleton|cell cortex|chloride channel complex|Golgi apparatus|Golgi apparatus|insoluble fraction|microtubule organizing center	protein binding|voltage-gated chloride channel activity			ovary(1)|skin(1)	2						AGGAACTTGCGCCGGGACCCC	0.557													43	142	---	---	---	---	PASS
TFAP2D	83741	broad.mit.edu	37	6	50712946	50712946	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:50712946T>A	uc003paf.2	+	6	1522	c.1010T>A	c.(1009-1011)ATG>AAG	p.M337K	TFAP2D_uc011dwt.1_RNA	NM_172238	NP_758438	Q7Z6R9	AP2D_HUMAN	transcription factor AP-2 beta-like 1	337	H-S-H (helix-span-helix), dimerization.						DNA binding|sequence-specific DNA binding transcription factor activity			ovary(6)|breast(1)	7	Lung NSC(77;0.0334)					AGAAAAAAGATGATCCTGGCG	0.393													24	142	---	---	---	---	PASS
PKHD1	5314	broad.mit.edu	37	6	51774231	51774231	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51774231G>C	uc003pah.1	-	40	6808	c.6532C>G	c.(6532-6534)CTA>GTA	p.L2178V	PKHD1_uc010jzn.1_Missense_Mutation_p.L203V|PKHD1_uc003pai.2_Missense_Mutation_p.L2178V	NM_138694	NP_619639	P08F94	PKHD1_HUMAN	fibrocystin isoform 1	2178	Extracellular (Potential).				cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity			lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)					CTGGATCCTAGCATCTTCTCA	0.473													98	218	---	---	---	---	PASS
DST	667	broad.mit.edu	37	6	56458656	56458656	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56458656C>T	uc003pdf.2	-	42	6202	c.6174G>A	c.(6172-6174)CAG>CAA	p.Q2058Q	DST_uc003pcz.3_Silent_p.Q1880Q|DST_uc011dxj.1_Silent_p.Q1909Q|DST_uc011dxk.1_Silent_p.Q1920Q|DST_uc003pcy.3_Silent_p.Q1554Q|DST_uc010kaa.1_RNA	NM_001144769	NP_001138241	Q03001	DYST_HUMAN	dystonin isoform 2	3966	Spectrin 2.				cell adhesion|cell cycle arrest|cell motility|hemidesmosome assembly|integrin-mediated signaling pathway|intermediate filament cytoskeleton organization|maintenance of cell polarity|microtubule cytoskeleton organization|response to wounding	actin cytoskeleton|axon|axon part|basement membrane|cell cortex|cell leading edge|cytoplasmic membrane-bounded vesicle|endoplasmic reticulum membrane|hemidesmosome|hemidesmosome|integral to membrane|intermediate filament|intermediate filament cytoskeleton|microtubule cytoskeleton|microtubule plus end|nuclear envelope|sarcomere|Z disc	actin binding|calcium ion binding|integrin binding|microtubule plus-end binding|protein binding|protein C-terminus binding|protein homodimerization activity			ovary(7)|central_nervous_system(6)|upper_aerodigestive_tract(1)	14	Lung NSC(77;0.103)		LUSC - Lung squamous cell carcinoma(124;0.0485)|Lung(124;0.0956)			AGAAACTCTTCTGCCTCTTCA	0.433													19	269	---	---	---	---	PASS
RIMS1	22999	broad.mit.edu	37	6	72968754	72968754	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:72968754G>A	uc003pga.2	+	18	3070	c.2993G>A	c.(2992-2994)CGA>CAA	p.R998Q	RIMS1_uc011dyb.1_Missense_Mutation_p.R623Q|RIMS1_uc003pgc.2_Missense_Mutation_p.R624Q|RIMS1_uc010kaq.2_Missense_Mutation_p.R471Q|RIMS1_uc011dyc.1_Missense_Mutation_p.R472Q|RIMS1_uc010kar.2_Missense_Mutation_p.R391Q|RIMS1_uc011dyd.1_Missense_Mutation_p.R457Q|RIMS1_uc003pgf.2_Missense_Mutation_p.R214Q|RIMS1_uc003pgg.2_Missense_Mutation_p.R215Q|RIMS1_uc003pgi.2_Missense_Mutation_p.R214Q|RIMS1_uc003pgh.2_Missense_Mutation_p.R214Q|RIMS1_uc003pgd.2_Missense_Mutation_p.R215Q|RIMS1_uc003pge.2_Missense_Mutation_p.R215Q|RIMS1_uc011dye.1_5'UTR|RIMS1_uc011dyf.1_5'Flank|RIMS1_uc003pgb.3_Missense_Mutation_p.R624Q|RIMS1_uc010kas.1_Missense_Mutation_p.R457Q	NM_014989	NP_055804	Q86UR5	RIMS1_HUMAN	regulating synaptic membrane exocytosis 1	998					calcium ion-dependent exocytosis|cellular membrane fusion|glutamate secretion|intracellular protein transport|protein complex assembly|regulated secretory pathway|response to stimulus|synaptic vesicle exocytosis|visual perception	cell junction|presynaptic membrane	metal ion binding|Rab GTPase binding			ovary(7)|pancreas(2)|breast(1)	10		all_epithelial(107;0.179)|all_hematologic(105;0.212)				GATGCCTCCCGAAGTCCAGTT	0.353													27	95	---	---	---	---	PASS
ELOVL4	6785	broad.mit.edu	37	6	80631373	80631373	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:80631373C>G	uc003pja.3	-	4	829	c.510G>C	c.(508-510)TGG>TGC	p.W170C	ELOVL4_uc011dyt.1_RNA	NM_022726	NP_073563	Q9GZR5	ELOV4_HUMAN	elongation of very long chain fatty acids-like	170	Helical; (Potential).				fatty acid elongation, saturated fatty acid|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process|very long-chain fatty acid biosynthetic process	integral to endoplasmic reticulum membrane	G-protein coupled photoreceptor activity|protein binding|transferase activity, transferring acyl groups other than amino-acyl groups			ovary(1)|skin(1)	2		all_cancers(76;1.83e-05)|Acute lymphoblastic leukemia(125;1.1e-05)|all_hematologic(105;0.00117)|all_epithelial(107;0.011)		BRCA - Breast invasive adenocarcinoma(397;0.0168)	Alpha-Linolenic Acid(DB00132)	TAATTCCAATCCACCACAAGG	0.373													45	178	---	---	---	---	PASS
SPACA1	81833	broad.mit.edu	37	6	88775971	88775971	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:88775971G>C	uc003pmn.2	+	7	920	c.803G>C	c.(802-804)AGA>ACA	p.R268T		NM_030960	NP_112222	Q9HBV2	SACA1_HUMAN	sperm acrosome associated 1 precursor	268	Cytoplasmic (Potential).					integral to membrane					0		all_cancers(76;8.24e-09)|Acute lymphoblastic leukemia(125;2.15e-10)|Prostate(29;4.11e-10)|all_hematologic(105;1.08e-06)|all_epithelial(107;0.00011)		BRCA - Breast invasive adenocarcinoma(108;0.11)		AGTTCTGTGAGATACAAAGAT	0.408													34	149	---	---	---	---	PASS
BACH2	60468	broad.mit.edu	37	6	90647949	90647949	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90647949G>A	uc011eab.1	-	8	2766	c.1957C>T	c.(1957-1959)CGC>TGC	p.R653C	BACH2_uc003pnw.2_Missense_Mutation_p.R653C	NM_021813	NP_068585	Q9BYV9	BACH2_HUMAN	BTB and CNC homology 1, basic leucine zipper	653	Basic motif.					nucleus	protein dimerization activity|sequence-specific DNA binding			ovary(3)|pancreas(1)|lung(1)|skin(1)	6		all_cancers(76;7.37e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.0063)		BRCA - Breast invasive adenocarcinoma(108;0.0799)		TTCTTGCTGCGCCGTCGGACA	0.448													46	162	---	---	---	---	PASS
FBXL4	26235	broad.mit.edu	37	6	99374492	99374492	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:99374492C>T	uc003ppf.1	-	3	731	c.373G>A	c.(373-375)GAC>AAC	p.D125N	FBXL4_uc003ppg.1_Missense_Mutation_p.D125N|FBXL4_uc003pph.1_5'UTR	NM_012160	NP_036292	Q9UKA2	FBXL4_HUMAN	F-box and leucine-rich repeat protein 4	125					ubiquitin-dependent protein catabolic process	cytoplasm|nucleus|ubiquitin ligase complex				skin(2)	2		all_cancers(76;1.56e-06)|Acute lymphoblastic leukemia(125;4.93e-10)|all_hematologic(75;3.55e-07)|all_epithelial(107;0.00893)|Colorectal(196;0.069)|Lung NSC(302;0.197)		BRCA - Breast invasive adenocarcinoma(108;0.0413)		TCCACATAGTCCTGGCTCTGA	0.453													6	89	---	---	---	---	PASS
GRIK2	2898	broad.mit.edu	37	6	102516299	102516299	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:102516299G>T	uc003pqp.3	+	16	2889	c.2640G>T	c.(2638-2640)CAG>CAT	p.Q880H	GRIK2_uc003pqo.3_3'UTR|GRIK2_uc010kcw.2_3'UTR	NM_021956	NP_068775	Q13002	GRIK2_HUMAN	glutamate receptor, ionotropic, kainate 2	880	Cytoplasmic (Potential).				glutamate signaling pathway|induction of programmed cell death in response to chemical stimulus|neuron apoptosis|positive regulation of synaptic transmission|regulation of short-term neuronal synaptic plasticity	cell junction|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|kainate selective glutamate receptor activity			ovary(2)|pancreas(1)|breast(1)|skin(1)	5		all_cancers(76;1.19e-07)|Acute lymphoblastic leukemia(125;6.17e-11)|all_hematologic(75;6.01e-08)|all_epithelial(87;0.0121)|Colorectal(196;0.14)		all cancers(137;0.112)|BRCA - Breast invasive adenocarcinoma(108;0.124)|GBM - Glioblastoma multiforme(226;0.206)	L-Glutamic Acid(DB00142)	ATAAGCCACAGGCCCCAGTTA	0.443													9	79	---	---	---	---	PASS
ZBTB24	9841	broad.mit.edu	37	6	109787325	109787325	+	Nonsense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:109787325G>C	uc003ptl.1	-	7	1991	c.1823C>G	c.(1822-1824)TCA>TGA	p.S608*	MICAL1_uc011eaq.1_5'Flank|ZBTB24_uc011ear.1_RNA|ZBTB24_uc010kds.1_Nonsense_Mutation_p.S552*|ZBTB24_uc010kdt.1_RNA	NM_014797	NP_055612	O43167	ZBT24_HUMAN	zinc finger and BTB domain containing 24 isoform	608					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3		all_cancers(87;0.000189)|Acute lymphoblastic leukemia(125;3.07e-08)|all_hematologic(75;3.33e-06)|all_epithelial(87;0.00686)|Lung SC(18;0.0743)|Colorectal(196;0.101)|all_lung(197;0.149)		Epithelial(106;0.0154)|all cancers(137;0.0216)|OV - Ovarian serous cystadenocarcinoma(136;0.0242)|BRCA - Breast invasive adenocarcinoma(108;0.059)		CTGTTGAGCTGAAAGAATTAA	0.488													11	195	---	---	---	---	PASS
ZBTB24	9841	broad.mit.edu	37	6	109802560	109802560	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:109802560C>G	uc003ptl.1	-	2	838	c.670G>C	c.(670-672)GAG>CAG	p.E224Q	ZBTB24_uc011ear.1_RNA|ZBTB24_uc010kds.1_Missense_Mutation_p.E224Q|ZBTB24_uc010kdt.1_RNA|ZBTB24_uc003ptm.2_Missense_Mutation_p.E224Q	NM_014797	NP_055612	O43167	ZBT24_HUMAN	zinc finger and BTB domain containing 24 isoform	224					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3		all_cancers(87;0.000189)|Acute lymphoblastic leukemia(125;3.07e-08)|all_hematologic(75;3.33e-06)|all_epithelial(87;0.00686)|Lung SC(18;0.0743)|Colorectal(196;0.101)|all_lung(197;0.149)		Epithelial(106;0.0154)|all cancers(137;0.0216)|OV - Ovarian serous cystadenocarcinoma(136;0.0242)|BRCA - Breast invasive adenocarcinoma(108;0.059)		CTACTTGGCTCACAAGTAGGC	0.453													42	780	---	---	---	---	PASS
C6orf174	387104	broad.mit.edu	37	6	127797202	127797202	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:127797202C>T	uc003qbd.2	-	6	2834	c.1969G>A	c.(1969-1971)GAG>AAG	p.E657K	C6orf174_uc003qbc.2_5'Flank	NM_001012279	NP_001012279	Q5TF21	CF174_HUMAN	hypothetical protein LOC387104 precursor	657	Potential.					integral to membrane		p.E657E(1)		breast(3)|ovary(2)|skin(1)	6				GBM - Glioblastoma multiforme(226;0.026)|all cancers(137;0.161)		CGCAGCAGCTCCGTCTCGTCT	0.642													8	79	---	---	---	---	PASS
SAMD3	154075	broad.mit.edu	37	6	130497078	130497078	+	Silent	SNP	T	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:130497078T>G	uc003qbv.2	-	9	1056	c.730A>C	c.(730-732)AGA>CGA	p.R244R	SAMD3_uc003qbx.2_Silent_p.R244R|SAMD3_uc003qbw.2_Silent_p.R244R|SAMD3_uc010kfg.1_3'UTR	NM_001017373	NP_001017373	Q8N6K7	SAMD3_HUMAN	sterile alpha motif domain containing 3 isoform	244										ovary(1)	1				GBM - Glioblastoma multiforme(226;0.00594)|OV - Ovarian serous cystadenocarcinoma(155;0.128)		CACTTATTTCTAATCACTTGC	0.338													12	111	---	---	---	---	PASS
MED23	9439	broad.mit.edu	37	6	131946133	131946133	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:131946133G>C	uc003qcs.1	-						MED23_uc003qcq.2_Intron|MED23_uc003qct.1_Intron|MED23_uc011ecb.1_Intron	NM_004830	NP_004821	Q9ULK4	MED23_HUMAN	mediator complex subunit 23 isoform a						regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	transcription factor complex	protein binding|transcription coactivator activity			ovary(1)|kidney(1)|central_nervous_system(1)	3	Breast(56;0.0753)			GBM - Glioblastoma multiforme(226;0.0115)|OV - Ovarian serous cystadenocarcinoma(155;0.0608)		GAGACTCCTGGAAAATGAGAG	0.328													12	104	---	---	---	---	PASS
TAAR1	134864	broad.mit.edu	37	6	132966255	132966255	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132966255G>C	uc003qdm.1	-	1	888	c.888C>G	c.(886-888)AAC>AAG	p.N296K		NM_138327	NP_612200	Q96RJ0	TAAR1_HUMAN	trace amine associated receptor 1	296	Helical; Name=7; (Potential).					plasma membrane					0	Breast(56;0.135)			OV - Ovarian serous cystadenocarcinoma(155;0.00616)|GBM - Glioblastoma multiforme(226;0.0154)	Amphetamine(DB00182)	TAAATGTAGAGTTCAAGTAGC	0.353													15	109	---	---	---	---	PASS
BCLAF1	9774	broad.mit.edu	37	6	136599714	136599714	+	Missense_Mutation	SNP	G	C	C	rs147983194	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:136599714G>C	uc003qgx.1	-	4	558	c.305C>G	c.(304-306)TCT>TGT	p.S102C	BCLAF1_uc003qgw.1_Missense_Mutation_p.S102C|BCLAF1_uc003qgy.1_Missense_Mutation_p.S100C|BCLAF1_uc011edc.1_RNA|BCLAF1_uc011edd.1_RNA|BCLAF1_uc011ede.1_Missense_Mutation_p.S100C	NM_014739	NP_055554	Q9NYF8	BCLF1_HUMAN	BCL2-associated transcription factor 1 isoform	102					induction of apoptosis|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleolus	DNA binding|protein binding			ovary(1)	1	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00226)|OV - Ovarian serous cystadenocarcinoma(155;0.00331)		AGGACTCCTAGAGTGCCTTCT	0.478													10	282	---	---	---	---	PASS
UTRN	7402	broad.mit.edu	37	6	144808687	144808687	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144808687C>G	uc003qkt.2	+	28	3918	c.3826C>G	c.(3826-3828)CTG>GTG	p.L1276V		NM_007124	NP_009055	P46939	UTRO_HUMAN	utrophin	1276	Spectrin 9.				muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)		ATTCCAGTCTCTGGAATCTGT	0.413													9	121	---	---	---	---	PASS
SYNE1	23345	broad.mit.edu	37	6	152577810	152577810	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152577810G>C	uc010kiw.2	-	102	19665	c.19063C>G	c.(19063-19065)CTG>GTG	p.L6355V	SYNE1_uc010kiv.2_Missense_Mutation_p.L879V|SYNE1_uc003qos.3_Missense_Mutation_p.L879V|SYNE1_uc003qot.3_Missense_Mutation_p.L6284V|SYNE1_uc003qou.3_Missense_Mutation_p.L6355V	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	6355	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)		AGTCCATCCAGCAAAGATGTA	0.458										HNSCC(10;0.0054)			36	170	---	---	---	---	PASS
SYNE1	23345	broad.mit.edu	37	6	152772190	152772190	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152772190C>G	uc010kiw.2	-	26	3780	c.3178G>C	c.(3178-3180)GAG>CAG	p.E1060Q	SYNE1_uc003qot.3_Missense_Mutation_p.E1067Q|SYNE1_uc003qou.3_Missense_Mutation_p.E1060Q|SYNE1_uc010kjb.1_Missense_Mutation_p.E1043Q|SYNE1_uc003qow.2_Missense_Mutation_p.E355Q|SYNE1_uc003qox.1_Missense_Mutation_p.E576Q	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	1060	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)		ACCCTGTGCTCTTTAATTATC	0.428										HNSCC(10;0.0054)			10	295	---	---	---	---	PASS
HEATR2	54919	broad.mit.edu	37	7	780447	780447	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:780447C>G	uc010krz.1	+						HEATR2_uc003siz.2_Intron	NM_017802	NP_060272	Q86Y56	HEAT2_HUMAN	HEAT repeat containing 2								protein binding			skin(1)	1		Ovarian(82;0.0112)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0182)|Epithelial(4;5.48e-17)|OV - Ovarian serous cystadenocarcinoma(56;1.95e-16)|all cancers(6;2.98e-14)		CCCTTCCTCTCATGCGCAGGT	0.647													69	500	---	---	---	---	PASS
NUDT1	4521	broad.mit.edu	37	7	2284336	2284336	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2284336G>A	uc003slp.1	+	3	298	c.196G>A	c.(196-198)GAG>AAG	p.E66K	FTSJ2_uc003slk.2_5'Flank|FTSJ2_uc003sll.2_5'Flank|FTSJ2_uc003slm.2_5'Flank|FTSJ2_uc003sln.2_5'Flank|FTSJ2_uc003slo.2_5'Flank|NUDT1_uc003slq.1_Missense_Mutation_p.E43K|NUDT1_uc003slr.1_Missense_Mutation_p.E43K|NUDT1_uc003sls.1_Missense_Mutation_p.E66K|NUDT1_uc003slt.1_Missense_Mutation_p.E43K|NUDT1_uc003slu.1_Missense_Mutation_p.E66K|NUDT1_uc003slv.1_Missense_Mutation_p.E43K	NM_198949	NP_945187	P36639	8ODP_HUMAN	nudix-type motif 1 isoform p22	84	Nudix box.|Nudix hydrolase.				DNA protection|DNA repair|response to oxidative stress	cytoplasm	8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity|8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity|GTPase activity|metal ion binding|protein binding				0		Ovarian(82;0.0253)|Melanoma(862;0.155)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0822)|OV - Ovarian serous cystadenocarcinoma(56;2.8e-14)|BRCA - Breast invasive adenocarcinoma(126;0.15)		GCAAGAAGGAGAGACCATCGA	0.507								Direct_reversal_of_damage|Modulation_of_nucleotide_pools					12	55	---	---	---	---	PASS
NUDT1	4521	broad.mit.edu	37	7	2284345	2284345	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2284345G>A	uc003slp.1	+	3	307	c.205G>A	c.(205-207)GAG>AAG	p.E69K	FTSJ2_uc003slk.2_5'Flank|FTSJ2_uc003sll.2_5'Flank|FTSJ2_uc003slm.2_5'Flank|FTSJ2_uc003sln.2_5'Flank|FTSJ2_uc003slo.2_5'Flank|NUDT1_uc003slq.1_Missense_Mutation_p.E46K|NUDT1_uc003slr.1_Missense_Mutation_p.E46K|NUDT1_uc003sls.1_Missense_Mutation_p.E69K|NUDT1_uc003slt.1_Missense_Mutation_p.E46K|NUDT1_uc003slu.1_Missense_Mutation_p.E69K|NUDT1_uc003slv.1_Missense_Mutation_p.E46K	NM_198949	NP_945187	P36639	8ODP_HUMAN	nudix-type motif 1 isoform p22	87	Nudix box.|Nudix hydrolase.				DNA protection|DNA repair|response to oxidative stress	cytoplasm	8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity|8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity|GTPase activity|metal ion binding|protein binding				0		Ovarian(82;0.0253)|Melanoma(862;0.155)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0822)|OV - Ovarian serous cystadenocarcinoma(56;2.8e-14)|BRCA - Breast invasive adenocarcinoma(126;0.15)		AGAGACCATCGAGGATGGGGC	0.478								Direct_reversal_of_damage|Modulation_of_nucleotide_pools					10	44	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	7	2552284	2552284	+	IGR	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2552284G>C								CHST12 (78070 upstream) : LFNG (7195 downstream)																							CCAAAGCTCAGAGGGATGGAT	0.607													17	92	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	7	2552840	2552840	+	IGR	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2552840G>A								CHST12 (78626 upstream) : LFNG (6639 downstream)																							GCTGTGGGATGAGCACATGAA	0.363													33	426	---	---	---	---	PASS
SDK1	221935	broad.mit.edu	37	7	4007005	4007005	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4007005G>A	uc003smx.2	+	10	1624	c.1485G>A	c.(1483-1485)ATG>ATA	p.M495I		NM_152744	NP_689957	Q7Z5N4	SDK1_HUMAN	sidekick 1 precursor	495	Ig-like C2-type 5.				cell adhesion	integral to membrane				large_intestine(3)|ovary(2)|skin(1)	6		all_cancers(1;0.127)|Ovarian(82;0.0177)|Myeloproliferative disorder(862;0.194)		UCEC - Uterine corpus endometrioid carcinoma (126;0.121)|OV - Ovarian serous cystadenocarcinoma(56;9.65e-15)		CTGACGGGATGACAGCCATTC	0.547													14	142	---	---	---	---	PASS
RBAK	57786	broad.mit.edu	37	7	5104735	5104735	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:5104735G>A	uc010kss.1	+	6	1972	c.1648G>A	c.(1648-1650)GAG>AAG	p.E550K	LOC389458_uc003snr.2_Intron|RBAK_uc003sns.1_Missense_Mutation_p.E550K	NM_021163	NP_066986	Q9NYW8	RBAK_HUMAN	RB-associated KRAB repressor	550	Interaction with AR.|C2H2-type 11.				negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	nucleic acid binding|zinc ion binding			ovary(3)|kidney(1)|skin(1)	5		Ovarian(82;0.0175)		UCEC - Uterine corpus endometrioid carcinoma (126;0.0916)|OV - Ovarian serous cystadenocarcinoma(56;2.44e-14)		GTTATTCAATGAGTTGTCATA	0.388													24	152	---	---	---	---	PASS
DAGLB	221955	broad.mit.edu	37	7	6464443	6464443	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6464443C>A	uc003sqa.2	-	8	1250	c.1080G>T	c.(1078-1080)GTG>GTT	p.V360V	DAGLB_uc003spz.2_5'Flank|DAGLB_uc011jwt.1_Silent_p.V174V|DAGLB_uc011jwu.1_Silent_p.V231V|DAGLB_uc003sqb.2_Silent_p.V79V|DAGLB_uc003sqc.2_Silent_p.V79V|DAGLB_uc011jwv.1_RNA|DAGLB_uc003sqd.3_Silent_p.V319V|DAGLB_uc011jww.1_RNA	NM_139179	NP_631918	Q8NCG7	DGLB_HUMAN	diacylglycerol lipase, beta isoform 1	360	Cytoplasmic (Potential).				lipid catabolic process|platelet activation	integral to membrane|plasma membrane	acylglycerol lipase activity|metal ion binding|triglyceride lipase activity			ovary(2)|central_nervous_system(1)	3		Ovarian(82;0.232)		UCEC - Uterine corpus endometrioid carcinoma (126;0.102)		GATCCAGAGCCACTAAAAACG	0.557													43	86	---	---	---	---	PASS
TRIL	9865	broad.mit.edu	37	7	28996473	28996473	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:28996473C>A	uc003szt.2	-	3	1557	c.1190G>T	c.(1189-1191)CGA>CTA	p.R397L	uc003szu.1_5'Flank	NM_014817	NP_055632	Q7L0X0	TRIL_HUMAN	TLR4 interactor with leucine rich repeats	397	Extracellular (Potential).|LRRCT.				inflammatory response|innate immune response|regulation of cytokine production involved in immune response|toll-like receptor 4 signaling pathway	lipopolysaccharide receptor complex	lipopolysaccharide binding				0						GTATTTGCCTCGCAGGGCCGG	0.667													15	122	---	---	---	---	PASS
NOD1	10392	broad.mit.edu	37	7	30491410	30491410	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30491410G>A	uc003tav.2	-	6	2146	c.1623C>T	c.(1621-1623)CTC>CTT	p.L541L		NM_006092	NP_006083	Q9Y239	NOD1_HUMAN	nucleotide-binding oligomerization domain	541					activation of MAPK activity|detection of bacterium|induction of apoptosis|inflammatory response|innate immune response|interleukin-8 biosynthetic process|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of dendritic cell antigen processing and presentation|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|protein oligomerization|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	basolateral plasma membrane|cytosol	ATP binding|CARD domain binding|caspase activator activity|peptidoglycan binding|protein homodimerization activity			ovary(1)|skin(1)	2						GGAAGAACCTGAGCAGCTCCT	0.627													17	289	---	---	---	---	PASS
NOD1	10392	broad.mit.edu	37	7	30492088	30492088	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30492088G>A	uc003tav.2	-	6	1468	c.945C>T	c.(943-945)GCC>GCT	p.A315A	NOD1_uc010kvs.2_3'UTR	NM_006092	NP_006083	Q9Y239	NOD1_HUMAN	nucleotide-binding oligomerization domain	315	NACHT.				activation of MAPK activity|detection of bacterium|induction of apoptosis|inflammatory response|innate immune response|interleukin-8 biosynthetic process|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of dendritic cell antigen processing and presentation|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|protein oligomerization|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	basolateral plasma membrane|cytosol	ATP binding|CARD domain binding|caspase activator activity|peptidoglycan binding|protein homodimerization activity			ovary(1)|skin(1)	2						TGAGCAGGTTGGCCAGCAAGA	0.662													5	64	---	---	---	---	PASS
AEBP1	165	broad.mit.edu	37	7	44152268	44152268	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:44152268C>A	uc003tkb.2	+	18	2634	c.2329C>A	c.(2329-2331)CGC>AGC	p.R777S	AEBP1_uc003tkc.3_Missense_Mutation_p.R352S|AEBP1_uc003tkd.2_Missense_Mutation_p.R27S	NM_001129	NP_001120	Q8IUX7	AEBP1_HUMAN	adipocyte enhancer binding protein 1 precursor	777	Interaction with PTEN (By similarity).				cell adhesion|muscle organ development|proteolysis|skeletal system development	cytoplasm|extracellular space|nucleus	DNA binding|metallocarboxypeptidase activity|sequence-specific DNA binding transcription factor activity|zinc ion binding				0						CGATATGGCCCGCACGCCTAC	0.657													13	33	---	---	---	---	PASS
ADCY1	107	broad.mit.edu	37	7	45699709	45699709	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:45699709G>T	uc003tne.3	+	7	1394	c.1376G>T	c.(1375-1377)GGA>GTA	p.G459V	ADCY1_uc003tnd.2_Missense_Mutation_p.G234V	NM_021116	NP_066939	Q08828	ADCY1_HUMAN	adenylate cyclase 1	459	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|synaptic transmission|transmembrane transport|water transport	integral to membrane|plasma membrane	ATP binding|calcium- and calmodulin-responsive adenylate cyclase activity|calmodulin binding|metal ion binding			ovary(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	6					Adenosine(DB00640)|Adenosine monophosphate(DB00131)|Adenosine triphosphate(DB00171)	CCGGGTTACGGACATGAGAGG	0.493													83	174	---	---	---	---	PASS
SEPT14	346288	broad.mit.edu	37	7	55872950	55872950	+	Splice_Site	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:55872950C>A	uc003tqz.2	-	9	1236	c.1119_splice	c.e9+1	p.E373_splice		NM_207366	NP_997249	Q6ZU15	SEP14_HUMAN	septin 14						cell cycle|cell division	septin complex	GTP binding|protein binding				0	Breast(14;0.214)		Lung(13;0.00024)|LUSC - Lung squamous cell carcinoma(13;0.00099)			TCAGTACTAACCTCTTTTTCA	0.343													24	74	---	---	---	---	PASS
ZNF107	51427	broad.mit.edu	37	7	64168243	64168243	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:64168243G>C	uc003ttd.2	+	7	2347	c.1561G>C	c.(1561-1563)GAG>CAG	p.E521Q	ZNF107_uc003tte.2_Missense_Mutation_p.E521Q	NM_016220	NP_057304	Q9UII5	ZN107_HUMAN	zinc finger protein 107	521					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Lung NSC(55;0.00948)|all_lung(88;0.0249)				TCATACTAAAGAGAAACTCAA	0.338													7	82	---	---	---	---	PASS
HIP1	3092	broad.mit.edu	37	7	75228554	75228554	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:75228554G>C	uc003uds.1	-	2	173	c.132C>G	c.(130-132)ATC>ATG	p.I44M		NM_005338	NP_005329	O00291	HIP1_HUMAN	huntingtin interacting protein 1	44	ENTH.				activation of caspase activity|cell differentiation|clathrin coat assembly|endocytosis|induction of apoptosis|positive regulation of receptor-mediated endocytosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	clathrin coated vesicle membrane|cytoskeleton|Golgi apparatus|membrane fraction|nucleus	actin binding|clathrin binding|phosphatidylinositol binding|structural constituent of cytoskeleton			lung(3)|pancreas(2)|ovary(1)|breast(1)|central_nervous_system(1)	8						TGGCCTTATTGATGCTGACAG	0.507			T	PDGFRB	CMML								9	211	---	---	---	---	PASS
MAGI2	9863	broad.mit.edu	37	7	77885473	77885473	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:77885473C>A	uc003ugx.2	-	10	2088	c.1834G>T	c.(1834-1836)GCC>TCC	p.A612S	MAGI2_uc003ugy.2_Missense_Mutation_p.A612S|MAGI2_uc010ldx.1_Missense_Mutation_p.A221S|MAGI2_uc010ldy.1_Missense_Mutation_p.A221S|MAGI2_uc011kgr.1_Missense_Mutation_p.A444S|MAGI2_uc011kgs.1_Missense_Mutation_p.A449S	NM_012301	NP_036433	Q86UL8	MAGI2_HUMAN	membrane associated guanylate kinase, WW and PDZ	612	PDZ 3.					cell junction|synapse|synaptosome	phosphatase binding			ovary(5)|lung(4)|breast(1)|skin(1)	11		all_cancers(73;0.0064)|all_epithelial(88;0.087)|all_neural(109;0.0936)|Medulloblastoma(109;0.166)|Melanoma(862;0.236)				AAGCCCTGGGCACCTTTCACA	0.537													7	43	---	---	---	---	PASS
GRM3	2913	broad.mit.edu	37	7	86468858	86468858	+	Silent	SNP	C	T	T	rs112184476	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:86468858C>T	uc003uid.2	+	4	3127	c.2028C>T	c.(2026-2028)GGC>GGT	p.G676G	GRM3_uc010lef.2_Intron|GRM3_uc010leg.2_Silent_p.G548G|GRM3_uc010leh.2_Silent_p.G268G	NM_000840	NP_000831	Q14832	GRM3_HUMAN	glutamate receptor, metabotropic 3 precursor	676	Cytoplasmic (Potential).				synaptic transmission	integral to plasma membrane				lung(4)|ovary(3)|central_nervous_system(2)|skin(2)|haematopoietic_and_lymphoid_tissue(1)|prostate(1)	13	Esophageal squamous(14;0.0058)|all_lung(186;0.132)|Lung NSC(181;0.142)				Acamprosate(DB00659)|Nicotine(DB00184)	TCAAGAATGGCGCTCAGAGGC	0.547													36	134	---	---	---	---	PASS
PPP1R9A	55607	broad.mit.edu	37	7	94540111	94540111	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:94540111C>G	uc003unp.2	+	2	968	c.686C>G	c.(685-687)TCA>TGA	p.S229*	PPP1R9A_uc010lfj.2_Nonsense_Mutation_p.S229*|PPP1R9A_uc011kif.1_Nonsense_Mutation_p.S229*|PPP1R9A_uc003unq.2_Nonsense_Mutation_p.S229*|PPP1R9A_uc011kig.1_Nonsense_Mutation_p.S229*	NM_017650	NP_060120	Q9ULJ8	NEB1_HUMAN	protein phosphatase 1, regulatory (inhibitor)	229						cell junction|synapse|synaptosome	actin binding			ovary(2)|haematopoietic_and_lymphoid_tissue(1)|skin(1)	4	all_cancers(62;9.12e-11)|all_epithelial(64;4.34e-09)		STAD - Stomach adenocarcinoma(171;0.0031)			AATGAATACTCAGTGACTGGG	0.433										HNSCC(28;0.073)			13	52	---	---	---	---	PASS
ASB4	51666	broad.mit.edu	37	7	95157214	95157214	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:95157214T>A	uc011kij.1	+	3	577	c.577T>A	c.(577-579)TTC>ATC	p.F193I	ASB4_uc003unx.2_Missense_Mutation_p.F193I	NM_016116	NP_057200	Q9Y574	ASB4_HUMAN	ankyrin repeat and SOCS box-containing protein 4	193	ANK 4.				intracellular signal transduction					central_nervous_system(1)	1	all_cancers(62;2.27e-10)|all_epithelial(64;2.28e-09)|Lung NSC(181;0.218)|all_lung(186;0.246)		STAD - Stomach adenocarcinoma(171;0.0151)			GCTGGTGGCCTTCTACGTGGA	0.597											OREG0018172	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	15	93	---	---	---	---	PASS
ASB4	51666	broad.mit.edu	37	7	95166990	95166990	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:95166990C>A	uc011kij.1	+	5	1200	c.1200C>A	c.(1198-1200)TGC>TGA	p.C400*		NM_016116	NP_057200	Q9Y574	ASB4_HUMAN	ankyrin repeat and SOCS box-containing protein 4	400	SOCS box.				intracellular signal transduction					central_nervous_system(1)	1	all_cancers(62;2.27e-10)|all_epithelial(64;2.28e-09)|Lung NSC(181;0.218)|all_lung(186;0.246)		STAD - Stomach adenocarcinoma(171;0.0151)			ACAACAGATGCCATAGAGCAA	0.403													36	194	---	---	---	---	PASS
SMURF1	57154	broad.mit.edu	37	7	98645447	98645447	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98645447G>C	uc003upu.1	-	11	1410	c.1090C>G	c.(1090-1092)CTG>GTG	p.L364V	SMURF1_uc003upv.1_Missense_Mutation_p.L338V|SMURF1_uc003upt.2_Missense_Mutation_p.L338V	NM_020429	NP_065162	Q9HCE7	SMUF1_HUMAN	Smad ubiquitination regulatory factor 1 isoform	364					BMP signaling pathway|cell differentiation|ectoderm development|negative regulation of BMP signaling pathway|negative regulation of transforming growth factor beta receptor signaling pathway|positive regulation of protein ubiquitination|proteasomal ubiquitin-dependent protein catabolic process|protein export from nucleus|protein localization at cell surface|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|receptor catabolic process|transforming growth factor beta receptor signaling pathway|ubiquitin-dependent SMAD protein catabolic process	cytosol|plasma membrane	activin binding|I-SMAD binding|R-SMAD binding|ubiquitin-protein ligase activity			skin(2)|ovary(1)|lung(1)	4	all_cancers(62;1.05e-08)|all_epithelial(64;4.34e-09)|Lung NSC(181;0.00902)|all_lung(186;0.0145)|Esophageal squamous(72;0.0274)		STAD - Stomach adenocarcinoma(171;0.215)|Lung(104;0.224)			TCGTCCTCCAGAGAGCCCTCA	0.582													36	484	---	---	---	---	PASS
NAPEPLD	222236	broad.mit.edu	37	7	102769078	102769078	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:102769078C>G	uc003vbc.2	-	2	474	c.146G>C	c.(145-147)AGA>ACA	p.R49T	NAPEPLD_uc003vbd.2_Missense_Mutation_p.R49T|NAPEPLD_uc011klj.1_Missense_Mutation_p.R122T|NAPEPLD_uc003vbe.2_RNA|NAPEPLD_uc003vbf.2_Missense_Mutation_p.R49T	NM_198990	NP_945341	Q6IQ20	NAPEP_HUMAN	N-acyl phosphatidylethanolamine phospholipase D	49					phospholipid catabolic process	membrane	metal ion binding			skin(1)	1						TTCTTCTAGTCTATAATCCAG	0.383													27	111	---	---	---	---	PASS
FSCN3	29999	broad.mit.edu	37	7	127235360	127235360	+	Splice_Site	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127235360G>A	uc003vmd.1	+	2	364	c.145_splice	c.e2-1	p.T49_splice	FSCN3_uc003vmc.1_Splice_Site_p.T4_splice|FSCN3_uc011kog.1_Splice_Site|FSCN3_uc011koh.1_Splice_Site|FSCN3_uc010llc.1_Splice_Site_p.T49_splice	NM_020369	NP_065102	Q9NQT6	FSCN3_HUMAN	fascin 3							actin cytoskeleton|cytoplasm	actin filament binding|protein binding, bridging			ovary(1)	1						GATGCCTCCAGACCTGGGAGA	0.557													18	142	---	---	---	---	PASS
FLNC	2318	broad.mit.edu	37	7	128478704	128478704	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128478704C>T	uc003vnz.3	+	8	1467	c.1258C>T	c.(1258-1260)CGG>TGG	p.R420W	FLNC_uc003voa.3_Missense_Mutation_p.R420W	NM_001458	NP_001449	Q14315	FLNC_HUMAN	gamma filamin isoform a	420	Filamin 2.				cell junction assembly	cytoskeleton|cytosol|plasma membrane|sarcomere	actin binding			breast(5)|large_intestine(3)|ovary(2)|central_nervous_system(1)|skin(1)	12						CCCACAGGGCCGGCGGGACAC	0.647													63	224	---	---	---	---	PASS
PLXNA4	91584	broad.mit.edu	37	7	131825488	131825488	+	Missense_Mutation	SNP	A	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:131825488A>C	uc003vra.3	-	30	5537	c.5308T>G	c.(5308-5310)TGC>GGC	p.C1770G	PLXNA4_uc003vqz.3_Missense_Mutation_p.C55G	NM_020911	NP_065962	Q9HCM2	PLXA4_HUMAN	plexin A4 isoform 1	1770	Cytoplasmic (Potential).					integral to membrane|intracellular|plasma membrane				ovary(1)	1						ACAGAGAGGCAGGCGTCTGTG	0.557													31	116	---	---	---	---	PASS
SLC13A4	26266	broad.mit.edu	37	7	135378967	135378967	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:135378967G>A	uc003vta.2	-	10	1725	c.1036C>T	c.(1036-1038)CTG>TTG	p.L346L	SLC13A4_uc003vtb.2_Silent_p.L347L	NM_012450	NP_036582	Q9UKG4	S13A4_HUMAN	solute carrier family 13 (sodium/sulfate	346						integral to plasma membrane	sodium:sulfate symporter activity				0						TTCTTGCTCAGAGAGCAGGTC	0.388													33	181	---	---	---	---	PASS
PTN	5764	broad.mit.edu	37	7	136939655	136939655	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:136939655G>A	uc003vtq.2	-	2	429	c.66C>T	c.(64-66)TTC>TTT	p.F22F	PTN_uc010lmx.2_Silent_p.F22F|PTN_uc003vtr.1_Silent_p.F22F	NM_002825	NP_002816	P21246	PTN_HUMAN	pleiotrophin	22					nervous system development|positive regulation of cell division|positive regulation of cell proliferation|transmembrane receptor protein tyrosine phosphatase signaling pathway	endoplasmic reticulum|extracellular space	growth factor activity|heparin binding|protein phosphatase inhibitor activity			upper_aerodigestive_tract(1)|pancreas(1)	2						CTGCCAGTATGAAAATGAATG	0.458													12	41	---	---	---	---	PASS
PRSS1	5644	broad.mit.edu	37	7	142459835	142459835	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142459835G>A	uc003wak.2	+	3	428	c.411G>A	c.(409-411)ACG>ACA	p.T137T	uc011krr.1_Intron|uc003vzp.2_Intron|uc011ksh.1_Intron|uc011ksi.1_Intron|uc003vzw.1_Intron|uc010loj.1_Intron|uc003wad.2_Intron|uc003wag.1_Intron|TRY6_uc011ksn.1_Intron|PRSS1_uc011ksm.1_3'UTR|PRSS1_uc003wam.2_Silent_p.T77T	NM_002769	NP_002760	P07477	TRY1_HUMAN	protease, serine, 1 preproprotein	137	Peptidase S1.		T -> M (in a colorectal cancer sample; somatic mutation).		digestion|proteolysis	extracellular space	metal ion binding|protein binding|serine-type endopeptidase activity	p.T137M(1)		large_intestine(1)|central_nervous_system(1)	2	Melanoma(164;0.047)	all_cancers(3;2.14e-49)|Acute lymphoblastic leukemia(3;7.3e-185)|all_hematologic(3;1.1e-165)	all cancers(2;0.000126)|Colorectal(2;0.000157)|Epithelial(2;0.000191)|COAD - Colon adenocarcinoma(2;0.00189)			CCACTGGCACGAAGTGCCTCA	0.552									Hereditary_Pancreatitis				16	92	---	---	---	---	PASS
OR9A2	135924	broad.mit.edu	37	7	142723727	142723727	+	Missense_Mutation	SNP	G	T	T	rs143573729	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142723727G>T	uc003wcc.1	-	1	493	c.493C>A	c.(493-495)CGC>AGC	p.R165S		NM_001001658	NP_001001658	Q8NGT5	OR9A2_HUMAN	olfactory receptor, family 9, subfamily A,	165	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	Melanoma(164;0.059)					TTTGATTTGCGGAAGGTAAAC	0.398													36	184	---	---	---	---	PASS
OR2A2	442361	broad.mit.edu	37	7	143806807	143806807	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143806807C>A	uc011ktz.1	+	1	132	c.132C>A	c.(130-132)ATC>ATA	p.I44I		NM_001005480	NP_001005480	Q6IF42	OR2A2_HUMAN	olfactory receptor, family 2, subfamily A,	44	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2	Melanoma(164;0.0783)					ATGGGGTCATCTTTGGGATTA	0.507													79	281	---	---	---	---	PASS
ZNF467	168544	broad.mit.edu	37	7	149461956	149461956	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149461956G>C	uc003wgd.2	-	5	1776	c.1635C>G	c.(1633-1635)TGC>TGG	p.C545W	ZNF467_uc003wgc.2_Intron	NM_207336	NP_997219	Q7Z7K2	ZN467_HUMAN	zinc finger protein 467	545	C2H2-type 12.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	Melanoma(164;0.165)|Ovarian(565;0.177)		OV - Ovarian serous cystadenocarcinoma(82;0.00625)			CGCACTGCGGGCAGGAGAAGG	0.711													11	59	---	---	---	---	PASS
GIMAP6	474344	broad.mit.edu	37	7	150325214	150325214	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150325214T>A	uc003whn.2	-	3	896	c.472A>T	c.(472-474)ACC>TCC	p.T158S	GIMAP6_uc003whm.2_Missense_Mutation_p.T78S	NM_024711	NP_078987	Q6P9H5	GIMA6_HUMAN	GTPase, IMAP family member 6	158							GTP binding			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3			OV - Ovarian serous cystadenocarcinoma(82;0.0145)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)		ACCAGGATGGTGTGACCCAGA	0.622													60	318	---	---	---	---	PASS
MLL3	58508	broad.mit.edu	37	7	151970887	151970887	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151970887C>G	uc003wla.2	-	7	1134	c.915G>C	c.(913-915)ATG>ATC	p.M305I		NM_170606	NP_733751	Q8NEZ4	MLL3_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 3	305					intracellular signal transduction|regulation of transcription, DNA-dependent|transcription, DNA-dependent		DNA binding|protein binding|zinc ion binding			large_intestine(27)|pancreas(13)|ovary(9)|central_nervous_system(8)|breast(3)|upper_aerodigestive_tract(1)|urinary_tract(1)|skin(1)	63	all_neural(206;0.187)	all_hematologic(28;0.0592)|Prostate(32;0.0906)	OV - Ovarian serous cystadenocarcinoma(82;0.00715)	UCEC - Uterine corpus endometrioid carcinoma (81;0.0597)|BRCA - Breast invasive adenocarcinoma(188;0.0462)		GATAATGATACATCTGGGTAC	0.433			N		medulloblastoma								12	325	---	---	---	---	PASS
HTR5A	3361	broad.mit.edu	37	7	154862633	154862633	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:154862633C>A	uc003wlu.1	+	1	88	c.24C>A	c.(22-24)ACC>ACA	p.T8T	uc011kvt.1_Intron|uc003wlt.2_Intron	NM_024012	NP_076917	P47898	5HT5A_HUMAN	5-hydroxytryptamine receptor 5A	8	Extracellular (By similarity).					integral to plasma membrane	serotonin receptor activity			ovary(2)|large_intestine(1)	3	all_neural(206;0.119)	all_hematologic(28;0.0592)	OV - Ovarian serous cystadenocarcinoma(82;0.0238)	UCEC - Uterine corpus endometrioid carcinoma (81;0.171)		TGAACCTAACCTCCTTTTCCC	0.612													44	219	---	---	---	---	PASS
MNX1	3110	broad.mit.edu	37	7	156799191	156799191	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:156799191G>C	uc003wnd.1	-	2	1137	c.834C>G	c.(832-834)CTC>CTG	p.L278L	MNX1_uc003wmz.2_Intron|MNX1_uc003wna.2_Intron|MNX1_uc010lqq.1_Silent_p.L71L|MNX1_uc003wnc.1_Silent_p.L66L|MNX1_uc010lqr.1_Intron	NM_005515	NP_005506	P50219	MNX1_HUMAN	motor neuron and pancreas homeobox 1 isoform 1	278	Homeobox.				humoral immune response|regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0	Ovarian(565;0.218)	all_hematologic(28;0.0592)	OV - Ovarian serous cystadenocarcinoma(82;0.00301)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)		CGGTGAGCATGAGCGAGGTGG	0.667									Currarino_syndrome				3	39	---	---	---	---	PASS
VIPR2	7434	broad.mit.edu	37	7	158902523	158902523	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:158902523C>T	uc003woh.2	-	3	425	c.239G>A	c.(238-240)AGC>AAC	p.S80N	VIPR2_uc010lqx.2_RNA|VIPR2_uc010lqy.2_RNA	NM_003382	NP_003373	P41587	VIPR2_HUMAN	vasoactive intestinal peptide receptor 2	80	Extracellular (Potential).				cell-cell signaling	integral to plasma membrane				lung(1)|central_nervous_system(1)	2	Ovarian(565;0.152)	all_cancers(7;1.13e-11)|all_epithelial(9;0.000545)|all_hematologic(28;0.00603)	OV - Ovarian serous cystadenocarcinoma(82;0.00231)	UCEC - Uterine corpus endometrioid carcinoma (81;0.2)|STAD - Stomach adenocarcinoma(7;0.18)		GTAAAAATTGCTGAAGACTTT	0.552													34	151	---	---	---	---	PASS
CSMD1	64478	broad.mit.edu	37	8	3224707	3224707	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:3224707C>T	uc011kwk.1	-	20	3355	c.2965G>A	c.(2965-2967)GAG>AAG	p.E989K	CSMD1_uc011kwj.1_Missense_Mutation_p.E381K|CSMD1_uc003wqe.2_Missense_Mutation_p.E145K	NM_033225	NP_150094	Q96PZ7	CSMD1_HUMAN	CUB and Sushi multiple domains 1 precursor	989	Extracellular (Potential).|CUB 6.					integral to membrane				breast(20)|large_intestine(5)	25		all_cancers(1;5.7e-41)|all_epithelial(1;2.54e-36)|Lung NSC(1;7.54e-11)|all_lung(1;3.2e-10)|Hepatocellular(1;3.78e-05)|Breast(1;0.000196)|Myeloproliferative disorder(4;0.000374)|Esophageal squamous(1;0.0157)|Ovarian(12;0.091)|Renal(68;0.144)|Colorectal(14;0.234)		all cancers(1;5.03e-41)|Epithelial(1;4.78e-31)|Lung(1;1.14e-14)|LUSC - Lung squamous cell carcinoma(1;2.34e-14)|GBM - Glioblastoma multiforme(1;4.49e-10)|Colorectal(4;1.18e-07)|OV - Ovarian serous cystadenocarcinoma(1;3.2e-07)|BRCA - Breast invasive adenocarcinoma(1;6.17e-07)|COAD - Colon adenocarcinoma(4;0.000539)|READ - Rectum adenocarcinoma(4;0.00896)|Kidney(5;0.00957)|KIRC - Kidney renal clear cell carcinoma(5;0.0689)		CTTCCATCCTCTGTGATCAGT	0.463													4	44	---	---	---	---	PASS
ERI1	90459	broad.mit.edu	37	8	8873888	8873888	+	Missense_Mutation	SNP	C	G	G	rs139484248	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:8873888C>G	uc011kwu.1	+	4	815	c.555C>G	c.(553-555)TTC>TTG	p.F185L	ERI1_uc003wsk.2_Missense_Mutation_p.F185L	NM_153332	NP_699163	Q8IV48	ERI1_HUMAN	three prime histone mRNA exonuclease 1	185	Exonuclease.				gene silencing by RNA|rRNA 3'-end processing	cytoplasm|histone pre-mRNA 3'end processing complex|nucleolus	3'-5' exonuclease activity|histone pre-mRNA stem-loop binding|metal ion binding|ribosome binding|rRNA binding				0					Adenosine monophosphate(DB00131)	TGTCTGATTTCTGCATCAGTC	0.323													15	370	---	---	---	---	PASS
TNKS	8658	broad.mit.edu	37	8	9623228	9623228	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:9623228G>C	uc003wss.2	+	24	3479	c.3474G>C	c.(3472-3474)TTG>TTC	p.L1158F	TNKS_uc011kww.1_Missense_Mutation_p.L921F	NM_003747	NP_003738	O95271	TNKS1_HUMAN	tankyrase, TRF1-interacting ankyrin-related	1158	PARP catalytic.				mitotic spindle organization|mRNA transport|negative regulation of DNA binding|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of telomere maintenance via telomerase|protein auto-ADP-ribosylation|protein localization to chromosome, telomeric region|protein poly-ADP-ribosylation|protein polyubiquitination|protein transport|spindle assembly|transmembrane transport|Wnt receptor signaling pathway	chromosome, centromeric region|Golgi membrane|microsome|nuclear chromosome, telomeric region|nuclear membrane|nuclear pore|pericentriolar material	NAD+ ADP-ribosyltransferase activity|protein binding|zinc ion binding			lung(4)|ovary(2)|kidney(1)	7				COAD - Colon adenocarcinoma(149;0.0467)		ACAAGAAGTTGAGGGAGCGGT	0.413													12	123	---	---	---	---	PASS
BLK	640	broad.mit.edu	37	8	11415529	11415529	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:11415529G>C	uc003wty.2	+	10	1592	c.1011G>C	c.(1009-1011)CTG>CTC	p.L337L	BLK_uc003wtz.2_Silent_p.L266L|BLK_uc003wua.2_5'Flank	NM_001715	NP_001706	P51451	BLK_HUMAN	B lymphoid tyrosine kinase	337	Protein kinase.				intracellular protein kinase cascade|positive regulation of insulin secretion		ATP binding|non-membrane spanning protein tyrosine kinase activity			large_intestine(1)|stomach(1)|ovary(1)	3			STAD - Stomach adenocarcinoma(15;0.00391)	COAD - Colon adenocarcinoma(149;0.207)		TCCCAAGGCTGATTGACATGT	0.378													46	159	---	---	---	---	PASS
DLC1	10395	broad.mit.edu	37	8	12960310	12960310	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:12960310G>C	uc003wwm.2	-	8	1999	c.1555C>G	c.(1555-1557)CAT>GAT	p.H519D	DLC1_uc003wwk.1_Missense_Mutation_p.H82D|DLC1_uc003wwl.1_Missense_Mutation_p.H116D|DLC1_uc011kxx.1_Missense_Mutation_p.H8D	NM_182643	NP_872584	Q96QB1	RHG07_HUMAN	deleted in liver cancer 1 isoform 1	519					actin cytoskeleton organization|activation of caspase activity|focal adhesion assembly|forebrain development|heart morphogenesis|hindbrain morphogenesis|induction of apoptosis|negative regulation of cell migration|negative regulation of cell proliferation|negative regulation of Rho protein signal transduction|negative regulation of stress fiber assembly|neural tube closure|positive regulation of protein dephosphorylation|regulation of cell shape|small GTPase mediated signal transduction	caveola|cytosol|focal adhesion|nucleus	Rho GTPase activator activity|SH2 domain binding			ovary(3)|pancreas(2)|lung(1)|kidney(1)	7						CGTTTCCGATGAGGACTAATT	0.368													51	309	---	---	---	---	PASS
NAT2	10	broad.mit.edu	37	8	18257600	18257600	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:18257600G>T	uc003wyw.1	+	2	194	c.87G>T	c.(85-87)GAG>GAT	p.E29D		NM_000015	NP_000006	P11245	ARY2_HUMAN	N-acetyltransferase 2	29					xenobiotic metabolic process	cytosol	arylamine N-acetyltransferase activity			ovary(1)|skin(1)	2				Colorectal(111;0.0531)|COAD - Colon adenocarcinoma(73;0.21)		ACATTCTTGAGCACCAGATCC	0.408									Naso-/Oropharyngeal/Laryngeal_Cancer_Familial_Clustering_of				89	241	---	---	---	---	PASS
LPL	4023	broad.mit.edu	37	8	19805770	19805770	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:19805770C>G	uc003wzk.3	+	2	538	c.168C>G	c.(166-168)CTC>CTG	p.L56L		NM_000237	NP_000228	P06858	LIPL_HUMAN	lipoprotein lipase precursor	56					fatty acid biosynthetic process|lipoprotein metabolic process|phospholipid metabolic process|positive regulation of cholesterol storage|positive regulation of sequestering of triglyceride|triglyceride catabolic process|triglyceride homeostasis|very-low-density lipoprotein particle remodeling	anchored to membrane|chylomicron|plasma membrane|very-low-density lipoprotein particle	heparin binding|lipoprotein lipase activity|phospholipase activity|receptor binding|triglyceride lipase activity			ovary(1)|central_nervous_system(1)|pancreas(1)	3				Colorectal(111;0.0577)|COAD - Colon adenocarcinoma(73;0.216)	Clofibrate(DB00636)|Gemfibrozil(DB01241)|Orlistat(DB01083)	CTTGCCACCTCATTCCCGGAG	0.478													40	317	---	---	---	---	PASS
ADAMDEC1	27299	broad.mit.edu	37	8	24255215	24255215	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:24255215C>A	uc003xdz.2	+	7	867	c.647C>A	c.(646-648)GCA>GAA	p.A216E	ADAMDEC1_uc010lub.2_Missense_Mutation_p.A137E|ADAMDEC1_uc011lab.1_Missense_Mutation_p.A137E	NM_014479	NP_055294	O15204	ADEC1_HUMAN	ADAM-like, decysin 1 isoform 1	216					integrin-mediated signaling pathway|negative regulation of cell adhesion|proteolysis	extracellular region|integral to membrane	integrin binding|metalloendopeptidase activity|zinc ion binding			skin(2)	2		Prostate(55;0.0181)		Colorectal(74;0.016)|COAD - Colon adenocarcinoma(73;0.0646)|BRCA - Breast invasive adenocarcinoma(99;0.168)		TTTCTTCGGGCACAGAAATAC	0.363													27	87	---	---	---	---	PASS
NEFM	4741	broad.mit.edu	37	8	24771781	24771781	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:24771781G>T	uc003xed.3	+	1	508	c.475G>T	c.(475-477)GCC>TCC	p.A159S	NEFM_uc011lac.1_Missense_Mutation_p.A159S|NEFM_uc010lue.2_5'Flank|uc010luc.1_3'UTR	NM_005382	NP_005373	P07197	NFM_HUMAN	neurofilament, medium polypeptide 150kDa isoform	159	Rod.|Coil 1B.					neurofilament	protein binding|structural constituent of cytoskeleton			breast(1)	1		Prostate(55;0.157)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0197)|Epithelial(17;2.44e-10)|Colorectal(74;0.0108)|COAD - Colon adenocarcinoma(73;0.0375)		CGAGCTGCGCGCCACCCTGGA	0.642													22	42	---	---	---	---	PASS
ESCO2	157570	broad.mit.edu	37	8	27634195	27634195	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27634195G>C	uc003xgg.2	+	3	453	c.370G>C	c.(370-372)GAA>CAA	p.E124Q	ESCO2_uc010luy.1_RNA|ESCO2_uc003xgh.2_Missense_Mutation_p.E124Q	NM_001017420	NP_001017420	Q56NI9	ESCO2_HUMAN	establishment of cohesion 1 homolog 2	124					cell cycle|post-translational protein acetylation|regulation of DNA replication	chromatin|nucleus	acyltransferase activity|metal ion binding			central_nervous_system(1)	1		Ovarian(32;0.000953)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0204)|KIRC - Kidney renal clear cell carcinoma(542;0.0955)|Kidney(114;0.115)|Colorectal(74;0.132)		CATTGTGACAGAAAAAATGCA	0.363									SC_Phocomelia_syndrome				54	101	---	---	---	---	PASS
ERLIN2	11160	broad.mit.edu	37	8	37607111	37607111	+	Missense_Mutation	SNP	A	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:37607111A>T	uc003xke.3	+	7	574	c.459A>T	c.(457-459)CAA>CAT	p.Q153H	LOC728024_uc010lvx.1_5'Flank	NM_007175	NP_009106	O94905	ERLN2_HUMAN	ER lipid raft associated 2 isoform 1	153	Lumenal (Potential).				ER-associated protein catabolic process	endoplasmic reticulum membrane|integral to membrane|plasma membrane	protein binding				0		Lung NSC(58;0.174)	BRCA - Breast invasive adenocarcinoma(5;6.14e-24)|LUSC - Lung squamous cell carcinoma(8;3.5e-10)			TGGCTTTGCAACAGGACCTGA	0.488													47	142	---	---	---	---	PASS
DDHD2	23259	broad.mit.edu	37	8	38111095	38111095	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:38111095C>G	uc003xlb.2	+	16	2290	c.1913C>G	c.(1912-1914)TCT>TGT	p.S638C	DDHD2_uc003xlc.2_Missense_Mutation_p.S638C|DDHD2_uc003xld.2_Missense_Mutation_p.S257C	NM_015214	NP_056029	O94830	DDHD2_HUMAN	DDHD domain containing 2 isoform 1	638	DDHD.				lipid catabolic process	centrosome	hydrolase activity|metal ion binding			large_intestine(1)|ovary(1)	2	Colorectal(12;0.000442)	all_lung(54;0.0657)|Lung NSC(58;0.175)	BRCA - Breast invasive adenocarcinoma(5;3.76e-25)|COAD - Colon adenocarcinoma(9;0.0977)			GAAGAGACCTCTGTGGCAGTT	0.428													34	201	---	---	---	---	PASS
IDO1	3620	broad.mit.edu	37	8	39782819	39782819	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:39782819G>A	uc003xnm.2	+	9	899	c.785G>A	c.(784-786)GGC>GAC	p.G262D	IDO1_uc003xnn.2_RNA	NM_002164	NP_002155	P14902	I23O1_HUMAN	indoleamine 2,3-dioxygenase 1	262					female pregnancy|tryptophan catabolic process	cytosol	electron carrier activity|heme binding|indoleamine 2,3-dioxygenase activity|tryptophan 2,3-dioxygenase activity			central_nervous_system(2)	2					L-Tryptophan(DB00150)	TTTGCAGGGGGCAGTGCAGGC	0.498													16	35	---	---	---	---	PASS
ANK1	286	broad.mit.edu	37	8	41519460	41519460	+	Splice_Site	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:41519460C>G	uc003xok.2	-	41	5563	c.5479_splice	c.e41-1	p.I1827_splice	NKX6-3_uc010lxa.1_Intron|ANK1_uc003xoh.2_Splice_Site_p.I981_splice|ANK1_uc003xoi.2_Splice_Site_p.I1827_splice|ANK1_uc003xoj.2_Splice_Site_p.I1827_splice|ANK1_uc003xol.2_Splice_Site_p.I1665_splice|ANK1_uc003xom.2_Splice_Site_p.I1868_splice|ANK1_uc011lcl.1_Splice_Site_p.I102_splice|ANK1_uc003xod.2_Splice_Site_p.I102_splice|ANK1_uc003xoc.2_Splice_Site_p.I102_splice|ANK1_uc003xof.2_Intron|MIR486_hsa-mir-486|MI0002470_5'Flank	NM_020476	NP_065209	P16157	ANK1_HUMAN	ankyrin 1 isoform 1						axon guidance|cytoskeleton organization|exocytosis|maintenance of epithelial cell apical/basal polarity|signal transduction	basolateral plasma membrane|cytosol|sarcomere|sarcoplasmic reticulum|spectrin-associated cytoskeleton	cytoskeletal adaptor activity|enzyme binding|protein binding|spectrin binding|structural constituent of cytoskeleton			ovary(3)|central_nervous_system(3)|lung(2)|breast(1)	9	Ovarian(28;0.00541)|Colorectal(14;0.0398)|Lung SC(25;0.211)	all_lung(54;0.000626)|Lung NSC(58;0.00245)|Esophageal squamous(32;0.0559)|Hepatocellular(245;0.0663)|Renal(179;0.188)	OV - Ovarian serous cystadenocarcinoma(14;0.000984)|Lung(22;0.00108)|Colorectal(10;0.00245)|LUSC - Lung squamous cell carcinoma(45;0.00392)|COAD - Colon adenocarcinoma(11;0.0264)			TGCGAATGATCTAGGAAAGGA	0.398													35	122	---	---	---	---	PASS
ANK1	286	broad.mit.edu	37	8	41521264	41521264	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:41521264G>A	uc003xok.2	-						NKX6-3_uc010lxa.1_Intron|ANK1_uc003xoh.2_Intron|ANK1_uc003xoi.2_Intron|ANK1_uc003xoj.2_Intron|ANK1_uc003xol.2_Intron|ANK1_uc003xom.2_Intron|ANK1_uc011lcl.1_Intron|ANK1_uc003xod.2_Intron|ANK1_uc003xoc.2_Intron|ANK1_uc003xof.2_Intron	NM_020476	NP_065209	P16157	ANK1_HUMAN	ankyrin 1 isoform 1						axon guidance|cytoskeleton organization|exocytosis|maintenance of epithelial cell apical/basal polarity|signal transduction	basolateral plasma membrane|cytosol|sarcomere|sarcoplasmic reticulum|spectrin-associated cytoskeleton	cytoskeletal adaptor activity|enzyme binding|protein binding|spectrin binding|structural constituent of cytoskeleton			ovary(3)|central_nervous_system(3)|lung(2)|breast(1)	9	Ovarian(28;0.00541)|Colorectal(14;0.0398)|Lung SC(25;0.211)	all_lung(54;0.000626)|Lung NSC(58;0.00245)|Esophageal squamous(32;0.0559)|Hepatocellular(245;0.0663)|Renal(179;0.188)	OV - Ovarian serous cystadenocarcinoma(14;0.000984)|Lung(22;0.00108)|Colorectal(10;0.00245)|LUSC - Lung squamous cell carcinoma(45;0.00392)|COAD - Colon adenocarcinoma(11;0.0264)			CATTCCCCTGGAATTAGAGAA	0.507													38	289	---	---	---	---	PASS
THAP1	55145	broad.mit.edu	37	8	42693375	42693375	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:42693375C>G	uc003xpk.2	-	3	609	c.372G>C	c.(370-372)CAG>CAC	p.Q124H	THAP1_uc003xpl.2_3'UTR	NM_018105	NP_060575	Q9NVV9	THAP1_HUMAN	THAP domain containing, apoptosis associated	124					cell cycle|endothelial cell proliferation|regulation of mitotic cell cycle|regulation of transcription, DNA-dependent|transcription, DNA-dependent	PML body	sequence-specific DNA binding|zinc ion binding				0	all_lung(13;3.33e-12)|Lung NSC(13;9.17e-11)|Ovarian(28;0.01)|Prostate(17;0.0119)|Lung SC(25;0.184)	all_lung(54;0.00026)|Acute lymphoblastic leukemia(644;0.000299)|Lung NSC(58;0.000992)|Hepatocellular(245;0.0524)|Renal(179;0.0822)|Esophageal squamous(32;0.129)	Lung(22;0.0377)|LUSC - Lung squamous cell carcinoma(45;0.0869)			TAACAGGGGTCTGAAGAGGCG	0.478													60	442	---	---	---	---	PASS
PXDNL	137902	broad.mit.edu	37	8	52258427	52258427	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:52258427C>A	uc003xqu.3	-	20	4083	c.3982G>T	c.(3982-3984)GAT>TAT	p.D1328Y	PXDNL_uc003xqt.3_Intron	NM_144651	NP_653252	A1KZ92	PXDNL_HUMAN	peroxidasin homolog-like precursor	1328					hydrogen peroxide catabolic process	extracellular space	heme binding|peroxidase activity			ovary(1)|pancreas(1)	2		all_cancers(86;0.107)|Lung NSC(129;0.00641)|all_epithelial(80;0.00716)|all_lung(136;0.015)				ATATCCTTATCAACAGGATAG	0.388													7	100	---	---	---	---	PASS
LYPLA1	10434	broad.mit.edu	37	8	54963582	54963582	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:54963582G>A	uc003xry.2	-	8	823	c.629C>T	c.(628-630)TCG>TTG	p.S210L	LYPLA1_uc011ldx.1_Missense_Mutation_p.S171L|LYPLA1_uc003xrz.2_Missense_Mutation_p.S189L	NM_006330	NP_006321	O75608	LYPA1_HUMAN	lysophospholipase 1	210					fatty acid metabolic process|nitric oxide metabolic process|regulation of nitric-oxide synthase activity	cytosol	lysophospholipase activity|palmitoyl-(protein) hydrolase activity			central_nervous_system(1)	1		Lung NSC(129;0.109)|all_epithelial(80;0.11)|all_lung(136;0.181)	OV - Ovarian serous cystadenocarcinoma(7;8.48e-07)|Epithelial(17;9.29e-05)|all cancers(17;0.000689)			CTGTTGACACGAACTGTGCAT	0.388													16	425	---	---	---	---	PASS
TRPA1	8989	broad.mit.edu	37	8	72975690	72975690	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:72975690C>T	uc003xza.2	-							NM_007332	NP_015628	O75762	TRPA1_HUMAN	ankyrin-like protein 1							integral to plasma membrane				ovary(4)|lung(1)|kidney(1)	6			Epithelial(68;0.223)		Menthol(DB00825)	AGAAAAGCCTCAACTCACCAA	0.264													9	75	---	---	---	---	PASS
ZFHX4	79776	broad.mit.edu	37	8	77618013	77618013	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77618013G>A	uc003yav.2	+	2	2077	c.1690G>A	c.(1690-1692)GCC>ACC	p.A564T	ZFHX4_uc003yat.1_Missense_Mutation_p.A564T|ZFHX4_uc003yau.1_Missense_Mutation_p.A564T|ZFHX4_uc003yaw.1_Missense_Mutation_p.A564T	NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	564						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)			AGACGCAAGTGCCAGTAAAGA	0.512										HNSCC(33;0.089)			35	83	---	---	---	---	PASS
ZFHX4	79776	broad.mit.edu	37	8	77763196	77763196	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77763196G>T	uc003yav.2	+	10	4291	c.3904G>T	c.(3904-3906)GAG>TAG	p.E1302*	ZFHX4_uc003yau.1_Nonsense_Mutation_p.E1347*|ZFHX4_uc003yaw.1_Nonsense_Mutation_p.E1302*	NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	1302						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)			AAAGAATGAGGAGCAGAAACC	0.403										HNSCC(33;0.089)			23	40	---	---	---	---	PASS
MTDH	92140	broad.mit.edu	37	8	98731283	98731283	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:98731283G>A	uc003yhz.2	+	10	1715	c.1387G>A	c.(1387-1389)GAA>AAA	p.E463K	MTDH_uc010mbf.2_RNA	NM_178812	NP_848927	Q86UE4	LYRIC_HUMAN	metadherin	463	Cytoplasmic (Potential).				lipopolysaccharide-mediated signaling pathway|negative regulation of apoptosis|negative regulation of transcription from RNA polymerase II promoter|positive regulation of angiogenesis|positive regulation of autophagy|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|positive regulation of protein kinase B signaling cascade	apical plasma membrane|endoplasmic reticulum membrane|integral to membrane|intercellular canaliculus|nuclear body|nuclear membrane|nucleolus|perinuclear region of cytoplasm|tight junction	NF-kappaB binding|RNA polymerase II transcription factor binding|transcription coactivator activity			liver(1)|central_nervous_system(1)	2	Breast(36;2.56e-06)		OV - Ovarian serous cystadenocarcinoma(57;0.178)			ATAGGACACAGAAGAATTAGA	0.264													16	108	---	---	---	---	PASS
LAPTM4B	55353	broad.mit.edu	37	8	98831389	98831389	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:98831389G>A	uc003yia.2	+	5	859	c.703G>A	c.(703-705)GAT>AAT	p.D235N	LAPTM4B_uc010mbg.2_Intron	NM_018407	NP_060877	Q86VI4	LAP4B_HUMAN	lysosomal associated transmembrane protein 4	288					transport	endomembrane system|integral to membrane	protein binding			skin(1)	1	Breast(36;1.59e-06)		OV - Ovarian serous cystadenocarcinoma(57;0.149)			TCCCTACAGAGATGATGTCAT	0.368													41	273	---	---	---	---	PASS
VPS13B	157680	broad.mit.edu	37	8	100133571	100133571	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:100133571G>T	uc003yiv.2	+	8	1215	c.1104G>T	c.(1102-1104)GGG>GGT	p.G368G	VPS13B_uc003yiw.2_Silent_p.G368G|VPS13B_uc003yit.2_Silent_p.G368G|VPS13B_uc003yiu.1_Silent_p.G368G|VPS13B_uc003yis.2_Silent_p.G368G|VPS13B_uc011lgy.1_Silent_p.G244G	NM_017890	NP_060360	Q7Z7G8	VP13B_HUMAN	vacuolar protein sorting 13B isoform 5	368					protein transport					ovary(7)|skin(4)|lung(3)|central_nervous_system(2)|pancreas(2)|breast(1)|kidney(1)	20	Breast(36;3.73e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.00636)			ACTTTGTTGGGAACGATCCTG	0.468													26	200	---	---	---	---	PASS
VPS13B	157680	broad.mit.edu	37	8	100733161	100733161	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:100733161G>A	uc003yiv.2	+	39	7122	c.7011G>A	c.(7009-7011)ATG>ATA	p.M2337I	VPS13B_uc003yiw.2_Missense_Mutation_p.M2312I	NM_017890	NP_060360	Q7Z7G8	VP13B_HUMAN	vacuolar protein sorting 13B isoform 5	2337					protein transport					ovary(7)|skin(4)|lung(3)|central_nervous_system(2)|pancreas(2)|breast(1)|kidney(1)	20	Breast(36;3.73e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.00636)			CAGGGATGATGTTATGGAGAT	0.373													11	180	---	---	---	---	PASS
SPAG1	6674	broad.mit.edu	37	8	101252722	101252722	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101252722C>T	uc003yjh.1	+	18	2458	c.2372C>T	c.(2371-2373)TCA>TTA	p.S791L	SPAG1_uc003yji.1_Missense_Mutation_p.S791L	NM_172218	NP_757367	Q07617	SPAG1_HUMAN	sperm associated antigen 1	791					single fertilization	cytoplasm	GTP binding|hydrolase activity			ovary(2)|central_nervous_system(1)	3	all_cancers(14;2.35e-05)|all_epithelial(15;5.2e-08)|Lung NSC(17;0.000283)|all_lung(17;0.000823)	Breast(495;0.195)	Epithelial(11;1.12e-09)|all cancers(13;1.26e-07)|OV - Ovarian serous cystadenocarcinoma(57;4.37e-05)|STAD - Stomach adenocarcinoma(118;0.0525)	KIRC - Kidney renal clear cell carcinoma(542;0.00178)|READ - Rectum adenocarcinoma(644;0.236)		AGCAGCAGGTCACCAGAAGAC	0.488													7	130	---	---	---	---	PASS
FZD6	8323	broad.mit.edu	37	8	104330835	104330835	+	Silent	SNP	A	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:104330835A>T	uc003ylh.2	+	3	479	c.195A>T	c.(193-195)GCA>GCT	p.A65A	FZD6_uc003yli.2_Silent_p.A65A|FZD6_uc003ylj.2_Silent_p.A65A|FZD6_uc011lhn.1_Silent_p.A31A|FZD6_uc011lho.1_Intron|FZD6_uc011lhp.1_Silent_p.A10A	NM_003506	NP_003497	O60353	FZD6_HUMAN	frizzled 6 isoform a precursor	65	FZ.|Extracellular (Potential).				angiogenesis|axonogenesis|cell proliferation in midbrain|establishment of planar polarity|G-protein signaling, coupled to cGMP nucleotide second messenger|gonad development|inner ear morphogenesis|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of sequence-specific DNA binding transcription factor activity|neural tube closure|non-canonical Wnt receptor signaling pathway	apical part of cell|apicolateral plasma membrane|cytoplasm|integral to plasma membrane|neuron projection membrane	G-protein coupled receptor activity|PDZ domain binding|Wnt receptor activity|Wnt-protein binding			central_nervous_system(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(57;2.86e-05)|STAD - Stomach adenocarcinoma(118;0.197)			TTCCTCTCGCAAATCTGGAAT	0.294													49	161	---	---	---	---	PASS
CSMD3	114788	broad.mit.edu	37	8	113318394	113318394	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113318394G>A	uc003ynu.2	-	51	8072	c.7913C>T	c.(7912-7914)CCA>CTA	p.P2638L	CSMD3_uc003yns.2_Missense_Mutation_p.P1840L|CSMD3_uc003ynt.2_Missense_Mutation_p.P2598L|CSMD3_uc011lhx.1_Missense_Mutation_p.P2534L	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	2638	Extracellular (Potential).|Sushi 15.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63						TCCATTTGTTGGAGCTTTAGG	0.348										HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			13	115	---	---	---	---	PASS
CSMD3	114788	broad.mit.edu	37	8	113988322	113988322	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113988322C>A	uc003ynu.2	-	7	1245	c.1086G>T	c.(1084-1086)AGG>AGT	p.R362S	CSMD3_uc003ynt.2_Missense_Mutation_p.R322S|CSMD3_uc011lhx.1_Intron	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	362	Extracellular (Potential).					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63						CAGTGGTAGTCCTGTTATGCT	0.458										HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			13	162	---	---	---	---	PASS
DERL1	79139	broad.mit.edu	37	8	124054246	124054246	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124054246G>A	uc003ypl.2	-	1	403	c.117C>T	c.(115-117)CTC>CTT	p.L39L	DERL1_uc003ypm.2_Silent_p.L39L|DERL1_uc011lif.1_Silent_p.L39L|DERL1_uc003ypn.2_Silent_p.L39L	NM_024295	NP_077271	Q9BUN8	DERL1_HUMAN	Der1-like domain family, member 1 isoform a	39	Helical; Name=1; (Potential).				endoplasmic reticulum unfolded protein response|ER-associated protein catabolic process|intracellular transport of viral proteins in host cell|retrograde protein transport, ER to cytosol	integral to endoplasmic reticulum membrane	MHC class I protein binding|receptor activity				0	Lung NSC(37;1.06e-09)|Ovarian(258;0.0205)		STAD - Stomach adenocarcinoma(47;0.00527)			GCCAGAGGAAGAGGTAGGCCG	0.652													9	39	---	---	---	---	PASS
KHDRBS3	10656	broad.mit.edu	37	8	136619236	136619236	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:136619236G>A	uc003yuv.2	+	7	1240	c.846G>A	c.(844-846)CAG>CAA	p.Q282Q	KHDRBS3_uc003yuw.2_Intron|KHDRBS3_uc010mek.2_RNA	NM_006558	NP_006549	O75525	KHDR3_HUMAN	KH domain containing, RNA binding, signal	282	Tyr-rich.				regulation of transcription, DNA-dependent|spermatogenesis|transcription, DNA-dependent	nucleus	SH3 domain binding			ovary(2)	2	all_epithelial(106;2.85e-16)|all_neural(2;2.72e-06)|Lung NSC(106;3.95e-06)|all_lung(105;1.11e-05)|Ovarian(258;0.00579)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.247)			ATGATGAACAGAGTTATGATT	0.388													42	373	---	---	---	---	PASS
FAM135B	51059	broad.mit.edu	37	8	139380153	139380153	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139380153C>G	uc003yuy.2	-	2	245	c.74G>C	c.(73-75)AGA>ACA	p.R25T	FAM135B_uc003yux.2_5'UTR|FAM135B_uc003yuz.2_RNA	NM_015912	NP_056996	Q49AJ0	F135B_HUMAN	hypothetical protein LOC51059	25										ovary(7)|skin(2)	9	all_epithelial(106;8.29e-14)|Lung NSC(106;6.88e-06)|all_lung(105;1.44e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0805)			TACTTACCCTCTCTGAAAGAG	0.323										HNSCC(54;0.14)			15	248	---	---	---	---	PASS
COL22A1	169044	broad.mit.edu	37	8	139734314	139734314	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139734314C>A	uc003yvd.2	-	26	2713	c.2266G>T	c.(2266-2268)GGG>TGG	p.G756W	COL22A1_uc011ljo.1_Missense_Mutation_p.G56W	NM_152888	NP_690848	Q8NFW1	COMA1_HUMAN	collagen, type XXII, alpha 1	756	Collagen-like 5.|Pro-rich.|Gly-rich.			GKDGPNGPPGPPGTK -> CILAAKTAPGLKQLN (in Ref. 2; AAH42075).	cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)			CCATTTGGCCCGTCCTTTCCA	0.488										HNSCC(7;0.00092)			5	10	---	---	---	---	PASS
ZNF707	286075	broad.mit.edu	37	8	144773378	144773378	+	Intron	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144773378G>T	uc003yze.3	+						ZNF707_uc010mfh.2_Intron|ZNF707_uc010mfi.2_Intron|ZNF707_uc003yzf.3_Intron|ZNF707_uc003yzh.3_5'UTR|ZNF707_uc011lkq.1_Intron	NM_173831	NP_776192	Q96C28	ZN707_HUMAN	zinc finger protein 707						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			breast(1)	1	all_cancers(97;3.74e-11)|all_epithelial(106;2.62e-09)|Lung NSC(106;0.00013)|all_lung(105;0.000374)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;5.6e-41)|Epithelial(56;1.02e-39)|all cancers(56;9.65e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.146)			GGGTGAGCACGGGCTGAGCGC	0.662													16	64	---	---	---	---	PASS
PARP10	84875	broad.mit.edu	37	8	145059165	145059165	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145059165C>T	uc003zal.3	-	5	1113	c.1005G>A	c.(1003-1005)CTG>CTA	p.L335L	PARP10_uc003zak.3_Silent_p.L41L|PARP10_uc011lku.1_Silent_p.L347L|PARP10_uc011lkv.1_RNA|PARP10_uc003zam.2_Silent_p.L335L|PARP10_uc010mfn.1_Silent_p.L250L|PARP10_uc010mfo.1_3'UTR	NM_032789	NP_116178	Q53GL7	PAR10_HUMAN	poly (ADP-ribose) polymerase family, member 10	335						Golgi apparatus|nucleolus	NAD+ ADP-ribosyltransferase activity|nucleotide binding			ovary(2)|upper_aerodigestive_tract(1)|lung(1)|breast(1)|pancreas(1)	6	all_cancers(97;8.2e-11)|all_epithelial(106;1.1e-09)|Lung NSC(106;5.89e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.31e-40)|Epithelial(56;1.16e-39)|all cancers(56;6.43e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)			GACCTGTCCTCAGAGAGGTCC	0.617													43	313	---	---	---	---	PASS
GPAA1	8733	broad.mit.edu	37	8	145140222	145140222	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145140222C>T	uc003zax.2	+	10	1401	c.1291C>T	c.(1291-1293)CTG>TTG	p.L431L		NM_003801	NP_003792	O43292	GPAA1_HUMAN	glycosylphosphatidylinositol anchor attachment	431	Helical; (Potential).				attachment of GPI anchor to protein|C-terminal protein lipidation|protein complex assembly|protein retention in ER lumen	GPI-anchor transamidase complex	tubulin binding				0	all_cancers(97;2.87e-11)|all_epithelial(106;2.16e-09)|Lung NSC(106;5.89e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;3.38e-41)|Epithelial(56;6.02e-40)|all cancers(56;2.11e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)			CGTGGCACCTCTGCTGATCTC	0.647													33	55	---	---	---	---	PASS
PPP1R16A	84988	broad.mit.edu	37	8	145726940	145726940	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145726940G>A	uc003zdd.2	+	11	2154	c.1241G>A	c.(1240-1242)CGA>CAA	p.R414Q	uc003zde.1_5'Flank|PPP1R16A_uc003zdf.2_Missense_Mutation_p.R414Q|GPT_uc011lli.1_5'Flank|GPT_uc011llj.1_5'Flank|GPT_uc003zdh.3_5'Flank	NM_032902	NP_116291	Q96I34	PP16A_HUMAN	protein phosphatase 1, regulatory (inhibitor)	414						plasma membrane	protein binding				0	all_cancers(97;5.56e-11)|all_epithelial(106;3.54e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.48e-41)|Epithelial(56;1.85e-40)|all cancers(56;3.59e-35)|BRCA - Breast invasive adenocarcinoma(115;0.0483)|Colorectal(110;0.055)			CACAATGGCCGAGTAGGGGGC	0.657													7	21	---	---	---	---	PASS
ARHGAP39	80728	broad.mit.edu	37	8	145756265	145756265	+	Intron	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145756265C>A	uc003zdt.1	-						MGC70857_uc003zdp.1_5'Flank|MGC70857_uc003zdq.1_5'Flank|MGC70857_uc003zdr.1_5'Flank|ARHGAP39_uc011llk.1_Intron|ARHGAP39_uc003zds.1_Intron	NM_025251	NP_079527	Q9C0H5	RHG39_HUMAN	KIAA1688 protein						axon guidance|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytoskeleton|cytosol|nucleus	GTPase activator activity				0						GCTGGGGACACAGCACGGGGC	0.692													19	52	---	---	---	---	PASS
TPD52L3	89882	broad.mit.edu	37	9	6328993	6328993	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:6328993C>G	uc003zjw.2	+	1	619	c.398C>G	c.(397-399)TCA>TGA	p.S133*	TPD52L3_uc003zjv.2_Intron|TPD52L3_uc003zjx.1_Intron	NM_033516	NP_277051	Q96J77	TPD55_HUMAN	protein kinase NYD-SP25 isoform 1	133							protein binding				0		Acute lymphoblastic leukemia(23;0.158)		GBM - Glioblastoma multiforme(50;0.0198)|Lung(218;0.1)		TCCAAAGTCTCAGGGGGCAAA	0.537													20	195	---	---	---	---	PASS
PTPRD	5789	broad.mit.edu	37	9	8518114	8518114	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:8518114G>T	uc003zkk.2	-	20	1988	c.1277C>A	c.(1276-1278)GCA>GAA	p.A426E	PTPRD_uc003zkp.2_Missense_Mutation_p.A426E|PTPRD_uc003zkq.2_Missense_Mutation_p.A426E|PTPRD_uc003zkr.2_Missense_Mutation_p.A420E|PTPRD_uc003zks.2_Missense_Mutation_p.A416E|PTPRD_uc003zkl.2_Missense_Mutation_p.A426E|PTPRD_uc003zkm.2_Missense_Mutation_p.A413E|PTPRD_uc003zkn.2_Missense_Mutation_p.A426E|PTPRD_uc003zko.2_Missense_Mutation_p.A423E	NM_002839	NP_002830	P23468	PTPRD_HUMAN	protein tyrosine phosphatase, receptor type, D	426	Fibronectin type-III 2.|Extracellular (Potential).				transmembrane receptor protein tyrosine phosphatase signaling pathway	integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			lung(14)|large_intestine(3)|ovary(2)|breast(2)|urinary_tract(1)	22		all_cancers(3;3.38e-95)|all_epithelial(3;2.84e-91)|all_lung(3;7.3e-56)|Lung NSC(3;1.82e-52)|Renal(3;3.42e-19)|all_hematologic(3;0.000134)|all_neural(3;0.00409)|Acute lymphoblastic leukemia(23;0.0069)|Melanoma(3;0.0121)|Myeloproliferative disorder(4;0.0122)|Medulloblastoma(3;0.0144)|Lung SC(3;0.0301)|Ovarian(56;0.0694)|Hepatocellular(3;0.0824)		all cancers(1;3.38e-12)|Epithelial(1;2.12e-09)|STAD - Stomach adenocarcinoma(1;1.29e-07)|KIRC - Kidney renal clear cell carcinoma(3;5.49e-07)|Kidney(3;6.36e-07)|GBM - Glioblastoma multiforme(50;9.05e-05)|Lung(1;0.000189)|BRCA - Breast invasive adenocarcinoma(1;0.00178)|LUSC - Lung squamous cell carcinoma(1;0.0115)|LUAD - Lung adenocarcinoma(58;0.119)		CAACATTCGTGCCTGGACATC	0.502										TSP Lung(15;0.13)			142	146	---	---	---	---	PASS
BNC2	54796	broad.mit.edu	37	9	16436263	16436263	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:16436263C>T	uc003zml.2	-	6	2069	c.1929G>A	c.(1927-1929)GAG>GAA	p.E643E	BNC2_uc011lmw.1_Silent_p.E548E|BNC2_uc003zmm.2_Silent_p.E601E|BNC2_uc003zmq.1_Silent_p.E657E|BNC2_uc003zmr.1_Silent_p.E680E|BNC2_uc003zmp.1_Silent_p.E671E|BNC2_uc010mij.1_Silent_p.E565E|BNC2_uc011lmv.1_Silent_p.E469E|BNC2_uc003zmo.1_Silent_p.E565E|BNC2_uc003zmj.2_Silent_p.E408E|BNC2_uc003zmk.2_RNA|BNC2_uc003zmi.2_Silent_p.E408E|BNC2_uc003zmn.1_Silent_p.E408E	NM_017637	NP_060107	Q6ZN30	BNC2_HUMAN	basonuclin 2	643					regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus|plasma membrane	zinc ion binding			ovary(2)|central_nervous_system(1)	3				GBM - Glioblastoma multiforme(50;9.01e-08)		TAATTTCCTTCTCAATCTTCA	0.493													27	92	---	---	---	---	PASS
DENND4C	55667	broad.mit.edu	37	9	19316466	19316466	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:19316466C>G	uc003znq.2	+	7	864	c.831C>G	c.(829-831)TGC>TGG	p.C277W	DENND4C_uc011lnc.1_5'UTR	NM_017925	NP_060395	Q5VZ89	DEN4C_HUMAN	DENN/MADD domain containing 4C	277						integral to membrane				ovary(1)|skin(1)	2						AAAAGCCGTGCAAAAATCTAC	0.328													5	117	---	---	---	---	PASS
IFNA17	3451	broad.mit.edu	37	9	21227825	21227825	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:21227825C>T	uc003zos.1	-	1	397	c.348G>A	c.(346-348)CTG>CTA	p.L116L	IFNA14_uc003zoo.1_Intron	NM_021268	NP_067091	P01571	IFN17_HUMAN	interferon, alpha 17 precursor	116					blood coagulation|regulation of type I interferon-mediated signaling pathway|response to virus|type I interferon-mediated signaling pathway	extracellular space	cytokine activity|interferon-alpha/beta receptor binding				0				Lung(24;2.13e-22)|LUSC - Lung squamous cell carcinoma(38;1.4e-13)|OV - Ovarian serous cystadenocarcinoma(39;0.116)		CCAGGTTATTCAGTTGCTGGT	0.468													31	297	---	---	---	---	PASS
APTX	54840	broad.mit.edu	37	9	32984745	32984745	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:32984745C>A	uc003zrm.2	-	5	851	c.654G>T	c.(652-654)AGG>AGT	p.R218S	APTX_uc010mjm.2_RNA|APTX_uc003zrj.2_Missense_Mutation_p.R130S|APTX_uc011lns.1_Missense_Mutation_p.R39S|APTX_uc003zrl.2_Missense_Mutation_p.R44S|APTX_uc003zrn.2_Missense_Mutation_p.R130S|APTX_uc003zro.2_Missense_Mutation_p.R218S|APTX_uc003zrp.2_Missense_Mutation_p.R130S|APTX_uc003zrq.2_Missense_Mutation_p.R130S|APTX_uc003zrr.2_Missense_Mutation_p.R164S|APTX_uc003zrs.2_Missense_Mutation_p.R218S|APTX_uc003zrt.2_Missense_Mutation_p.R130S|APTX_uc003zru.2_Missense_Mutation_p.R164S|APTX_uc003zrv.2_Missense_Mutation_p.R232S|APTX_uc003zrw.2_Missense_Mutation_p.R146S|APTX_uc003zrx.2_Missense_Mutation_p.R218S|APTX_uc003zry.2_Missense_Mutation_p.R218S|APTX_uc003zrz.2_Missense_Mutation_p.R39S|APTX_uc003zsa.1_Missense_Mutation_p.R164S|APTX_uc003zsb.1_RNA|APTX_uc003zsc.1_RNA	NM_175072	NP_778242	Q7Z2E3	APTX_HUMAN	aprataxin isoform c	232	HIT.				cell death|double-strand break repair|regulation of protein stability|response to hydrogen peroxide|single strand break repair	chromatin|nucleolus|nucleoplasm	chromatin binding|damaged DNA binding|DNA 5'-adenosine monophosphate hydrolase activity|double-stranded DNA binding|double-stranded RNA binding|phosphoglycolate phosphatase activity|phosphoprotein binding|polynucleotide 3'-phosphatase activity|protein N-terminus binding|zinc ion binding			ovary(1)	1			LUSC - Lung squamous cell carcinoma(29;0.0302)	GBM - Glioblastoma multiforme(74;0.105)		CAAGGTGTTCCCTGGCCACAG	0.512								Direct_reversal_of_damage|Editing_and_processing_nucleases					34	104	---	---	---	---	PASS
DNAI1	27019	broad.mit.edu	37	9	34490493	34490493	+	Intron	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:34490493C>A	uc003zum.2	+							NM_012144	NP_036276	Q9UI46	DNAI1_HUMAN	dynein, axonemal, intermediate chain 1						cell projection organization	cilium axoneme|cytoplasm|dynein complex|microtubule	motor activity				0	all_epithelial(49;0.244)		LUSC - Lung squamous cell carcinoma(29;0.0107)|STAD - Stomach adenocarcinoma(86;0.212)	GBM - Glioblastoma multiforme(74;0.0222)		CCGGGTAGAGCAGCCCCCACC	0.582									Kartagener_syndrome				67	325	---	---	---	---	PASS
FAM74A3	728495	broad.mit.edu	37	9	40716216	40716216	+	RNA	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:40716216T>A	uc010mmk.2	+	1		c.693T>A				NR_026801				Homo sapiens family with sequence similarity 74, member A3 (FAM74A3), non-coding RNA.											skin(1)	1				GBM - Glioblastoma multiforme(29;0.02)|Lung(182;0.0681)		AGGCTGTCGTTACTGCTGCAC	0.448													18	137	---	---	---	---	PASS
MAMDC2	256691	broad.mit.edu	37	9	72746522	72746522	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:72746522C>G	uc004ahm.2	+	7	1605	c.988C>G	c.(988-990)CAG>GAG	p.Q330E	MAMDC2_uc004ahn.2_RNA	NM_153267	NP_694999	Q7Z304	MAMC2_HUMAN	MAM domain containing 2 precursor	330						endoplasmic reticulum|membrane				central_nervous_system(1)|pancreas(1)	2						CTGCCAGAATCAGACAGGTGA	0.378													52	258	---	---	---	---	PASS
TRPM6	140803	broad.mit.edu	37	9	77455049	77455049	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:77455049G>T	uc004ajl.1	-	5	673	c.435C>A	c.(433-435)GGC>GGA	p.G145G	TRPM6_uc004ajk.1_Silent_p.G140G|TRPM6_uc010mpb.1_RNA|TRPM6_uc010mpc.1_Silent_p.G145G|TRPM6_uc010mpd.1_Silent_p.G145G|TRPM6_uc010mpe.1_Silent_p.G145G|TRPM6_uc004ajn.1_Silent_p.G145G	NM_017662	NP_060132	Q9BX84	TRPM6_HUMAN	transient receptor potential cation channel,	145	Cytoplasmic (Potential).				response to toxin	integral to membrane	ATP binding|calcium channel activity|metal ion binding|protein binding|protein serine/threonine kinase activity			lung(3)|stomach(2)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|skin(1)	8						AGTTCTGGATGCCCCCATGGA	0.398													39	164	---	---	---	---	PASS
VPS13A	23230	broad.mit.edu	37	9	79947023	79947023	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:79947023C>T	uc004akr.2	+	46	6349	c.6089C>T	c.(6088-6090)TCT>TTT	p.S2030F	VPS13A_uc004akp.3_Missense_Mutation_p.S2030F|VPS13A_uc004akq.3_Missense_Mutation_p.S2030F|VPS13A_uc004aks.2_Missense_Mutation_p.S1991F|VPS13A_uc004akt.2_Missense_Mutation_p.S370F	NM_033305	NP_150648	Q96RL7	VP13A_HUMAN	vacuolar protein sorting 13A isoform A	2030	TPR 6.				Golgi to endosome transport|protein transport	intracellular	protein binding			pancreas(3)|skin(3)|ovary(2)|large_intestine(1)|central_nervous_system(1)	10						CCATTAGGATCTTACCGGTAT	0.338													7	173	---	---	---	---	PASS
GNA14	9630	broad.mit.edu	37	9	80144091	80144091	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:80144091C>G	uc004aku.2	-	2	726	c.203G>C	c.(202-204)AGA>ACA	p.R68T		NM_004297	NP_004288	O95837	GNA14_HUMAN	G alpha 14	68					activation of phospholipase C activity by dopamine receptor signaling pathway|G-protein signaling, coupled to cAMP nucleotide second messenger|platelet activation|protein ADP-ribosylation	heterotrimeric G-protein complex	G-protein beta/gamma-subunit complex binding|G-protein-coupled receptor binding|GTP binding|GTPase activity|signal transducer activity			ovary(2)	2						GAACCCCTTTCTGTCTTCGTC	0.448													111	456	---	---	---	---	PASS
CEP78	84131	broad.mit.edu	37	9	80858453	80858453	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:80858453G>T	uc004akx.2	+	5	955	c.679G>T	c.(679-681)GCT>TCT	p.A227S	CEP78_uc004aky.3_Missense_Mutation_p.A227S|CEP78_uc010mpp.2_Missense_Mutation_p.A227S|CEP78_uc011lsp.1_Missense_Mutation_p.A140S	NM_032171	NP_115547	Q5JTW2	CEP78_HUMAN	centrosomal protein 78kDa isoform b	227					G2/M transition of mitotic cell cycle	centrosome|cytosol				ovary(1)	1						TGACTGTATGGCTGGCTTAAG	0.433													20	86	---	---	---	---	PASS
ZNF484	83744	broad.mit.edu	37	9	95610355	95610355	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95610355G>C	uc004asu.1	-	5	863	c.714C>G	c.(712-714)CTC>CTG	p.L238L	ANKRD19_uc004asr.3_Intron|ZNF484_uc011lub.1_Silent_p.L240L|ZNF484_uc010mrb.1_Silent_p.L202L|ZNF484_uc004asv.1_Silent_p.L202L	NM_031486	NP_113674	Q5JVG2	ZN484_HUMAN	zinc finger protein 484 isoform a	238	C2H2-type 1; degenerate.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						GTTGTTGAATGAGAGCTTGCT	0.388													8	184	---	---	---	---	PASS
ZNF169	169841	broad.mit.edu	37	9	97063487	97063487	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:97063487C>T	uc004aum.1	+	5	1752	c.1647C>T	c.(1645-1647)CGC>CGT	p.R549R		NM_194320	NP_919301	Q14929	ZN169_HUMAN	zinc finger protein 169	549	C2H2-type 12.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2		Acute lymphoblastic leukemia(62;0.136)				AATGTGGGCGCGGCTTTGGCT	0.552													29	133	---	---	---	---	PASS
ALG2	85365	broad.mit.edu	37	9	101980675	101980675	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:101980675C>G	uc004azf.2	-	2	862	c.792G>C	c.(790-792)CTG>CTC	p.L264L	ALG2_uc004azg.2_Silent_p.L171L	NM_033087	NP_149078	Q9H553	ALG2_HUMAN	alpha-1,3-mannosyltransferase ALG2	264					dolichol-linked oligosaccharide biosynthetic process|post-translational protein modification|protein glycosylation in endoplasmic reticulum|protein N-linked glycosylation via asparagine|response to calcium ion	endoplasmic reticulum membrane|integral to membrane|membrane fraction|nucleus|perinuclear region of cytoplasm	alpha-1,3-mannosyltransferase activity|calcium-dependent protein binding|glycolipid 3-alpha-mannosyltransferase activity|protein anchor|protein heterodimerization activity|protein N-terminus binding			ovary(2)	2		Acute lymphoblastic leukemia(62;0.0559)				CTGCCACGATCAGATGAACCC	0.468													31	289	---	---	---	---	PASS
ABCA1	19	broad.mit.edu	37	9	107584880	107584880	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:107584880G>A	uc004bcl.2	-	19	3038	c.2725C>T	c.(2725-2727)CGA>TGA	p.R909*		NM_005502	NP_005493	O95477	ABCA1_HUMAN	ATP-binding cassette, sub-family A member 1	909	ABC transporter 1.				Cdc42 protein signal transduction|cellular lipid metabolic process|cholesterol efflux|cholesterol homeostasis|cholesterol metabolic process|endosome transport|G-protein coupled receptor protein signaling pathway|high-density lipoprotein particle assembly|interleukin-1 beta secretion|intracellular cholesterol transport|lysosome organization|negative regulation of cholesterol storage|negative regulation of macrophage derived foam cell differentiation|phospholipid efflux|phospholipid homeostasis|platelet dense granule organization|positive regulation of cAMP biosynthetic process|reverse cholesterol transport	integral to plasma membrane|membrane fraction|membrane raft|phagocytic vesicle	anion transmembrane transporter activity|apolipoprotein A-I receptor activity|ATP binding|ATPase activity|cholesterol transporter activity|phospholipid transporter activity|small GTPase binding|syntaxin-13 binding			large_intestine(4)|lung(4)|ovary(4)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	17				OV - Ovarian serous cystadenocarcinoma(323;0.023)	Adenosine triphosphate(DB00171)|Glibenclamide(DB01016)	ATCCCATCTCGGTAGACTTTT	0.542													60	232	---	---	---	---	PASS
RGS3	5998	broad.mit.edu	37	9	116359128	116359128	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:116359128G>T	uc004bhq.2	+	26	3701	c.3492G>T	c.(3490-3492)CAG>CAT	p.Q1164H	RGS3_uc004bhs.2_Missense_Mutation_p.Q1054H|RGS3_uc004bht.2_Missense_Mutation_p.Q883H|RGS3_uc010muy.2_Missense_Mutation_p.Q557H|RGS3_uc004bhv.2_Missense_Mutation_p.Q485H|RGS3_uc004bhw.2_Missense_Mutation_p.Q134H|RGS3_uc011lxh.1_Missense_Mutation_p.Q474H|RGS3_uc004bhx.2_Missense_Mutation_p.Q485H|RGS3_uc004bhz.2_Missense_Mutation_p.Q506H|RGS3_uc004bia.2_Missense_Mutation_p.Q277H	NM_144488	NP_652759	P49796	RGS3_HUMAN	regulator of G-protein signalling 3 isoform 6	1164	RGS.				inactivation of MAPK activity|regulation of G-protein coupled receptor protein signaling pathway	cytosol|nucleus|plasma membrane	GTPase activator activity|signal transducer activity			ovary(1)|lung(1)|skin(1)	3						ACCTGGCACAGAAGCGCATCT	0.597													46	183	---	---	---	---	PASS
DBC1	1620	broad.mit.edu	37	9	121976431	121976431	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:121976431G>A	uc004bkc.2	-	6	1144	c.688C>T	c.(688-690)CTT>TTT	p.L230F	DBC1_uc004bkd.2_Missense_Mutation_p.L230F	NM_014618	NP_055433	O60477	DBC1_HUMAN	deleted in bladder cancer 1 precursor	230	MACPF.				cell cycle arrest|cell death	cytoplasm	protein binding			skin(3)|ovary(2)|central_nervous_system(2)|large_intestine(1)	8						ATTATCTGAAGACCTGTGTGA	0.423													5	114	---	---	---	---	PASS
BAT2L1	84726	broad.mit.edu	37	9	134350753	134350753	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134350753G>T	uc004can.3	+	15	3292	c.3237G>T	c.(3235-3237)CGG>CGT	p.R1079R	BAT2L1_uc010mzj.1_Silent_p.R662R|BAT2L1_uc004cao.3_Silent_p.R437R	NM_013318	NP_037450	Q5JSZ5	PRC2B_HUMAN	HLA-B associated transcript 2-like	1079							protein binding				0						TTCGTGGTCGGCCTGCTGGCG	0.647													8	37	---	---	---	---	PASS
NTNG2	84628	broad.mit.edu	37	9	135073852	135073852	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135073852A>G	uc004cbh.2	+	3	1489	c.713A>G	c.(712-714)GAG>GGG	p.E238G		NM_032536	NP_115925	Q96CW9	NTNG2_HUMAN	netrin G2 precursor	238	Laminin N-terminal.				axonogenesis	anchored to plasma membrane					0				OV - Ovarian serous cystadenocarcinoma(145;1.23e-05)|Epithelial(140;0.000173)		ACGCGGCTGGAGAGCGCCAAG	0.662													29	167	---	---	---	---	PASS
LARP4B	23185	broad.mit.edu	37	10	871222	871222	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:871222G>C	uc001ifs.1	-	12	1308	c.1267C>G	c.(1267-1269)CCT>GCT	p.P423A		NM_015155	NP_055970	Q92615	LAR4B_HUMAN	La ribonucleoprotein domain family, member 4B	423							nucleotide binding|RNA binding			ovary(2)|central_nervous_system(1)	3						TCTGCACTAGGAATCGCATGC	0.383													44	336	---	---	---	---	PASS
AKR1C2	1646	broad.mit.edu	37	10	5038063	5038063	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:5038063G>C	uc010qan.1	-						AKR1E2_uc001ihl.1_Intron|AKR1C3_uc001ihr.2_Intron|AKR1C2_uc009xhy.2_Intron|AKR1C2_uc001ihs.2_Intron|AKR1C2_uc001iht.2_Intron	NM_205845	NP_995317	P52895	AK1C2_HUMAN	aldo-keto reductase family 1, member C2						digestion|prostaglandin metabolic process|steroid metabolic process	cytoplasm	androsterone dehydrogenase (A-specific) activity|bile acid binding|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity				0					NADH(DB00157)|Ursodeoxycholic acid(DB01586)	TCCACCTGCAGACGAGCAAGA	0.373													10	107	---	---	---	---	PASS
ASB13	79754	broad.mit.edu	37	10	5682753	5682753	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:5682753C>T	uc001iig.2	-	6	794	c.750G>A	c.(748-750)TTG>TTA	p.L250L	ASB13_uc001iii.2_RNA|ASB13_uc001iih.2_RNA|ASB13_uc009xic.2_Silent_p.L250L	NM_024701	NP_078977	Q8WXK3	ASB13_HUMAN	ankyrin repeat and SOCS box-containing protein	250	SOCS box.				intracellular signal transduction		protein binding			ovary(1)	1				GBM - Glioblastoma multiforme(2;9.59e-09)		TGGCCTTCCTCAAGTTCACCC	0.522													54	255	---	---	---	---	PASS
MCM10	55388	broad.mit.edu	37	10	13228254	13228254	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:13228254G>A	uc001ima.2	+	9	1293	c.1192G>A	c.(1192-1194)GAG>AAG	p.E398K	MCM10_uc001imb.2_Missense_Mutation_p.E397K|MCM10_uc001imc.2_Missense_Mutation_p.E397K	NM_182751	NP_877428	Q7L590	MCM10_HUMAN	minichromosome maintenance complex component 10	398	Zinc finger-like.				cell cycle checkpoint|DNA replication|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle	nucleoplasm	metal ion binding|protein binding			ovary(2)|central_nervous_system(1)	3						GAAGAATGGAGAGCCGTGCAC	0.423													34	210	---	---	---	---	PASS
C10orf111	221060	broad.mit.edu	37	10	15138466	15138466	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:15138466G>C	uc001inw.2	-	2	632	c.358C>G	c.(358-360)CTC>GTC	p.L120V	RPP38_uc001iny.3_5'Flank|RPP38_uc009xjm.2_5'Flank|RPP38_uc001inx.3_5'Flank	NM_153244	NP_694976	Q8N326	CJ111_HUMAN	hypothetical protein LOC221060	120	Helical; (Potential).					integral to membrane					0						AAAGCGGGGAGAAGGAGGAGG	0.463													29	199	---	---	---	---	PASS
CUBN	8029	broad.mit.edu	37	10	17032462	17032462	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:17032462G>T	uc001ioo.2	-	29	4273	c.4221C>A	c.(4219-4221)TTC>TTA	p.F1407L		NM_001081	NP_001072	O60494	CUBN_HUMAN	cubilin precursor	1407	CUB 9.				cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)	ACCTGTTGGGGAACCCGGGGC	0.527													14	171	---	---	---	---	PASS
C10orf140	387640	broad.mit.edu	37	10	21804495	21804495	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:21804495G>C	uc009xkd.2	-	4	4510	c.2257C>G	c.(2257-2259)CAA>GAA	p.Q753E	uc001iqp.1_Intron	NM_207371	NP_997254	Q1XH10	DLN1_HUMAN	hypothetical protein LOC387640	672						nucleus	nucleotide binding			ovary(1)	1						CCCTGACTTTGAGCCAGTGGA	0.453													109	527	---	---	---	---	PASS
MLLT10	8028	broad.mit.edu	37	10	22002880	22002880	+	Splice_Site	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:22002880G>T	uc001iqs.2	+	15	2274	c.1926_splice	c.e15+1	p.Q642_splice	MLLT10_uc001iqt.2_Splice_Site_p.Q626_splice|MLLT10_uc001iqv.2_Splice_Site|MLLT10_uc001iqy.2_Splice_Site_p.Q626_splice|MLLT10_uc001ira.2_Splice_Site_p.Q83_splice|MLLT10_uc001irb.2_Splice_Site	NM_004641	NP_004632	P55197	AF10_HUMAN	myeloid/lymphoid or mixed-lineage leukemia						positive regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(1)|skin(1)	2						TACAACTCAGGTAAGTTGTTA	0.458			T	MLL|PICALM|CDK6	AL								32	51	---	---	---	---	PASS
KIAA1217	56243	broad.mit.edu	37	10	24831801	24831801	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:24831801C>G	uc001iru.3	+						KIAA1217_uc001irs.2_Intron|KIAA1217_uc001irt.3_Intron|KIAA1217_uc010qcy.1_Intron|KIAA1217_uc010qcz.1_Intron|KIAA1217_uc001irw.2_Intron|KIAA1217_uc001irz.2_Intron|KIAA1217_uc001irx.2_Intron|KIAA1217_uc001iry.2_Intron|KIAA1217_uc001isa.1_Intron	NM_019590	NP_062536	Q5T5P2	SKT_HUMAN	sickle tail isoform 1						embryonic skeletal system development	cytoplasm				ovary(5)|skin(2)	7						CTCCTCCGTTCTCCCTCTCAG	0.478													16	82	---	---	---	---	PASS
PRTFDC1	56952	broad.mit.edu	37	10	25226299	25226299	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:25226299G>C	uc001ise.1	-						PRTFDC1_uc010qdd.1_Intron|PRTFDC1_uc001isf.1_Intron|PRTFDC1_uc009xkm.1_Intron	NM_020200	NP_064585	Q9NRG1	PRDC1_HUMAN	phosphoribosyl transferase domain containing 1						adenine salvage|central nervous system neuron development|cerebral cortex neuron differentiation|cytolysis|dendrite morphogenesis|GMP salvage|grooming behavior|hypoxanthine metabolic process|IMP salvage|lymphocyte proliferation|positive regulation of dopamine metabolic process|purine ribonucleoside salvage|response to amphetamine|striatum development	cytosol	hypoxanthine phosphoribosyltransferase activity|magnesium ion binding|nucleotide binding|protein homodimerization activity			ovary(1)	1						GCTCAATTCTGAAAGAAGGAT	0.368													5	46	---	---	---	---	PASS
MYO3A	53904	broad.mit.edu	37	10	26313027	26313027	+	Intron	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:26313027A>G	uc001isn.2	+						MYO3A_uc009xko.1_Intron|MYO3A_uc009xkp.1_Intron|MYO3A_uc009xkq.1_Intron	NM_017433	NP_059129	Q8NEV4	MYO3A_HUMAN	myosin IIIA						protein autophosphorylation|response to stimulus|sensory perception of sound|visual perception	cytoplasm|filamentous actin|filopodium|myosin complex	actin binding|actin-dependent ATPase activity|ADP binding|ATP binding|calmodulin binding|plus-end directed microfilament motor activity|protein serine/threonine kinase activity			ovary(6)|stomach(3)|lung(3)|central_nervous_system(2)|breast(1)|skin(1)|kidney(1)|pancreas(1)	18						GTGAGTAAAAACAGTCTTTTA	0.358													31	117	---	---	---	---	PASS
ZNF438	220929	broad.mit.edu	37	10	31133898	31133898	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:31133898C>G	uc010qdz.1	-	8	2914	c.2479G>C	c.(2479-2481)GAG>CAG	p.E827Q	ZNF438_uc001ivn.2_Missense_Mutation_p.E778Q|ZNF438_uc010qdy.1_Missense_Mutation_p.E817Q|ZNF438_uc001ivo.3_Missense_Mutation_p.E391Q|ZNF438_uc009xlg.2_Missense_Mutation_p.E827Q|ZNF438_uc001ivp.3_Missense_Mutation_p.E817Q|ZNF438_uc010qea.1_Missense_Mutation_p.E827Q|ZNF438_uc010qeb.1_Missense_Mutation_p.E827Q	NM_182755	NP_877432	Q7Z4V0	ZN438_HUMAN	zinc finger protein 438 isoform a	827					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|breast(1)	2		Prostate(175;0.0587)				TCTCATTTCTCAGCTTCACTG	0.512													114	641	---	---	---	---	PASS
ANKRD30A	91074	broad.mit.edu	37	10	37454038	37454038	+	Silent	SNP	A	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:37454038A>C	uc001iza.1	+	18	1950	c.1851A>C	c.(1849-1851)TCA>TCC	p.S617S		NM_052997	NP_443723	Q9BXX3	AN30A_HUMAN	ankyrin repeat domain 30A	673						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(7)|breast(1)|skin(1)	9						TACTCCCATCAGAATCCAAAC	0.289													22	69	---	---	---	---	PASS
ZNF239	8187	broad.mit.edu	37	10	44053157	44053157	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:44053157C>T	uc001jaw.3	-	2	1024	c.371G>A	c.(370-372)GGA>GAA	p.G124E	ZNF239_uc001jax.3_Missense_Mutation_p.G124E|ZNF239_uc009xmj.2_Missense_Mutation_p.G124E|ZNF239_uc009xmk.2_Missense_Mutation_p.G124E	NM_005674	NP_005665	Q16600	ZN239_HUMAN	zinc finger protein 239	124					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|RNA binding|zinc ion binding				0						CAGTTCTTGTCCATCAGACAC	0.423													25	163	---	---	---	---	PASS
PCDH15	65217	broad.mit.edu	37	10	55569207	55569207	+	Missense_Mutation	SNP	G	A	A	rs145418788	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55569207G>A	uc010qhs.1	-	37	5013	c.4618C>T	c.(4618-4620)CCT>TCT	p.P1540S	PCDH15_uc010qhq.1_Intron|PCDH15_uc010qhr.1_Intron|PCDH15_uc010qht.1_Missense_Mutation_p.P1533S|PCDH15_uc010qhu.1_3'UTR	NM_001142769	NP_001136241	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD2-1 precursor	Error:Variant_position_missing_in_Q96QU1_after_alignment					equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				GTGTATGTAGGCTCAGCTGCT	0.398										HNSCC(58;0.16)			44	206	---	---	---	---	PASS
PCDH15	65217	broad.mit.edu	37	10	55626488	55626488	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55626488G>T	uc001jju.1	-	27	4026	c.3631C>A	c.(3631-3633)CAT>AAT	p.H1211N	PCDH15_uc010qhq.1_Missense_Mutation_p.H1216N|PCDH15_uc010qhr.1_Missense_Mutation_p.H1211N|PCDH15_uc010qhs.1_Missense_Mutation_p.H1223N|PCDH15_uc010qht.1_Missense_Mutation_p.H1218N|PCDH15_uc010qhu.1_Missense_Mutation_p.H1211N|PCDH15_uc001jjv.1_Intron|PCDH15_uc010qhv.1_Missense_Mutation_p.H1211N|PCDH15_uc010qhw.1_Missense_Mutation_p.H1174N|PCDH15_uc010qhx.1_Missense_Mutation_p.H1140N|PCDH15_uc010qhy.1_Missense_Mutation_p.H1216N|PCDH15_uc010qhz.1_Missense_Mutation_p.H1211N|PCDH15_uc010qia.1_Missense_Mutation_p.H1189N|PCDH15_uc010qib.1_Missense_Mutation_p.H1189N	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	1211	Cadherin 11.|Extracellular (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				CTCATATTATGGAAGAGCATA	0.403										HNSCC(58;0.16)			22	106	---	---	---	---	PASS
PCDH15	65217	broad.mit.edu	37	10	56138598	56138598	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:56138598C>A	uc001jju.1	-	4	657	c.262G>T	c.(262-264)GAT>TAT	p.D88Y	PCDH15_uc010qhq.1_Missense_Mutation_p.D93Y|PCDH15_uc010qhr.1_Missense_Mutation_p.D88Y|PCDH15_uc010qhs.1_Missense_Mutation_p.D93Y|PCDH15_uc010qht.1_Missense_Mutation_p.D88Y|PCDH15_uc010qhu.1_Missense_Mutation_p.D88Y|PCDH15_uc001jjv.1_Missense_Mutation_p.D66Y|PCDH15_uc010qhv.1_Missense_Mutation_p.D88Y|PCDH15_uc010qhw.1_Missense_Mutation_p.D88Y|PCDH15_uc010qhx.1_Missense_Mutation_p.D88Y|PCDH15_uc010qhy.1_Missense_Mutation_p.D93Y|PCDH15_uc010qhz.1_Missense_Mutation_p.D88Y|PCDH15_uc010qia.1_Missense_Mutation_p.D66Y|PCDH15_uc010qib.1_Missense_Mutation_p.D66Y|PCDH15_uc001jjw.2_Missense_Mutation_p.D88Y	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	88	Cadherin 1.|Extracellular (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				TTAACAGGATCCATCAACACC	0.403										HNSCC(58;0.16)			78	278	---	---	---	---	PASS
ANK3	288	broad.mit.edu	37	10	61835776	61835776	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:61835776G>A	uc001jky.2	-	37	5055	c.4863C>T	c.(4861-4863)TCC>TCT	p.S1621S	ANK3_uc001jkw.2_Intron|ANK3_uc009xpa.2_Intron|ANK3_uc001jkx.2_Intron|ANK3_uc010qih.1_Intron|ANK3_uc001jkz.3_Intron|ANK3_uc001jkv.2_Intron|ANK3_uc009xpb.1_Intron	NM_020987	NP_066267	Q12955	ANK3_HUMAN	ankyrin 3 isoform 1	1621	Ser-rich.				establishment of protein localization|signal transduction	basolateral plasma membrane|cytoplasm|cytoskeleton	protein binding			skin(9)|ovary(6)|pancreas(2)|central_nervous_system(2)	19						AGGTTCGAGAGGAAAACGTAG	0.478													26	118	---	---	---	---	PASS
RUFY2	55680	broad.mit.edu	37	10	70143566	70143566	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70143566G>A	uc001job.2	-	10	1360	c.1033C>T	c.(1033-1035)CAG>TAG	p.Q345*	RUFY2_uc001jnz.1_RNA|RUFY2_uc001joc.2_Nonsense_Mutation_p.Q276*|RUFY2_uc010qiw.1_Nonsense_Mutation_p.Q252*|RUFY2_uc001jod.1_Nonsense_Mutation_p.Q310*	NM_017987	NP_060457	Q8WXA3	RUFY2_HUMAN	RUN and FYVE domain-containing 2 isoform a	359	Potential.					nucleus	metal ion binding			ovary(1)	1						TGTCGTAACTGAGATTCATCT	0.383													14	251	---	---	---	---	PASS
TET1	80312	broad.mit.edu	37	10	70405228	70405228	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70405228G>C	uc001jok.3	+	4	3247	c.2742G>C	c.(2740-2742)GAG>GAC	p.E914D		NM_030625	NP_085128	Q8NFU7	TET1_HUMAN	CXXC finger 6	914					DNA demethylation|inner cell mass cell differentiation|negative regulation of methylation-dependent chromatin silencing|stem cell maintenance		iron ion binding|methylcytosine dioxygenase activity|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|structure-specific DNA binding|zinc ion binding			ovary(5)|lung(2)|prostate(1)|breast(1)	9						CAAAGTCAGAGAAGGATGAGG	0.458													11	192	---	---	---	---	PASS
TET1	80312	broad.mit.edu	37	10	70405706	70405706	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70405706G>C	uc001jok.3	+	4	3725	c.3220G>C	c.(3220-3222)GAG>CAG	p.E1074Q		NM_030625	NP_085128	Q8NFU7	TET1_HUMAN	CXXC finger 6	1074					DNA demethylation|inner cell mass cell differentiation|negative regulation of methylation-dependent chromatin silencing|stem cell maintenance		iron ion binding|methylcytosine dioxygenase activity|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|structure-specific DNA binding|zinc ion binding			ovary(5)|lung(2)|prostate(1)|breast(1)	9						TACCCAAATTGAGGAAGATGT	0.373													7	232	---	---	---	---	PASS
STOX1	219736	broad.mit.edu	37	10	70641797	70641797	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70641797G>A	uc001jos.2	+	2	481	c.394G>A	c.(394-396)GAT>AAT	p.D132N	STOX1_uc001jor.2_Missense_Mutation_p.D132N|STOX1_uc009xpy.2_Missense_Mutation_p.D132N|STOX1_uc001joq.2_Missense_Mutation_p.D22N	NM_001130161	NP_001123633	Q6ZVD7	STOX1_HUMAN	storkhead box 1 isoform a	132						cytoplasm|nucleolus	DNA binding			kidney(1)|skin(1)	2						TGCTATATCTGATATGAATAC	0.358													47	173	---	---	---	---	PASS
COL13A1	1305	broad.mit.edu	37	10	71678056	71678056	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:71678056G>T	uc001jpr.1	+	18	1548	c.1012G>T	c.(1012-1014)GCC>TCC	p.A338S	COL13A1_uc001jqj.1_Missense_Mutation_p.A338S|COL13A1_uc001jps.1_Missense_Mutation_p.A309S|COL13A1_uc001jpt.1_Missense_Mutation_p.A297S|COL13A1_uc001jpu.1_Missense_Mutation_p.A319S|COL13A1_uc001jpv.1_Missense_Mutation_p.A338S|COL13A1_uc001jpx.1_Missense_Mutation_p.A316S|COL13A1_uc001jpw.1_Missense_Mutation_p.A285S|COL13A1_uc001jpy.1_Missense_Mutation_p.A276S|COL13A1_uc001jpz.1_Missense_Mutation_p.A281S|COL13A1_uc001jqa.1_Missense_Mutation_p.A278S|COL13A1_uc001jqc.1_Missense_Mutation_p.A338S|COL13A1_uc001jqb.1_Missense_Mutation_p.A287S|COL13A1_uc001jql.2_Missense_Mutation_p.A338S|COL13A1_uc001jqd.1_Missense_Mutation_p.A326S|COL13A1_uc001jqe.1_Missense_Mutation_p.A321S|COL13A1_uc001jqf.1_Missense_Mutation_p.A319S|COL13A1_uc001jqg.1_Missense_Mutation_p.A316S|COL13A1_uc001jqh.1_Missense_Mutation_p.A338S|COL13A1_uc001jqi.1_Missense_Mutation_p.A338S|COL13A1_uc010qjf.1_Missense_Mutation_p.A128S|COL13A1_uc001jqk.1_Missense_Mutation_p.A176S	NM_005203	NP_005194	Q5TAT6	CODA1_HUMAN	alpha 1 type XIII collagen isoform 1	338	Extracellular (Potential).|Triple-helical region 2 (COL2).				cell differentiation|cell-cell adhesion|cell-matrix adhesion|endochondral ossification|morphogenesis of a branching structure	collagen type XIII|integral to membrane	extracellular matrix structural constituent|heparin binding|protein binding			ovary(1)	1					Atorvastatin(DB01076)|Simvastatin(DB00641)	GCCCGGAATTGCCGTGGCTGG	0.592													16	67	---	---	---	---	PASS
ZMYND17	118490	broad.mit.edu	37	10	75186492	75186492	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:75186492G>C	uc001jud.2	-						ZMYND17_uc001juc.2_Intron|ZMYND17_uc009xrh.2_Intron|ZMYND17_uc009xrg.2_Intron	NM_001024593	NP_001019764	Q4VC12	ZMY17_HUMAN	zinc finger, MYND domain containing 17								zinc ion binding			ovary(1)	1	Prostate(51;0.0119)					TTCTGCACCTGAGAGAATGAG	0.468													23	233	---	---	---	---	PASS
PLCE1	51196	broad.mit.edu	37	10	95791854	95791854	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95791854C>G	uc001kjk.2	+	2	1685	c.1051C>G	c.(1051-1053)CTG>GTG	p.L351V	PLCE1_uc010qnx.1_Missense_Mutation_p.L351V	NM_016341	NP_057425	Q9P212	PLCE1_HUMAN	phospholipase C, epsilon 1 isoform 1	351					activation of MAPK activity|activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|calcium-mediated signaling|cell proliferation|cytoskeleton organization|diacylglycerol biosynthetic process|elevation of cytosolic calcium ion concentration|epidermal growth factor receptor signaling pathway|glomerulus development|heart development|lipid catabolic process|Ras protein signal transduction|regulation of cell growth|regulation of G-protein coupled receptor protein signaling pathway|regulation of Ras protein signal transduction|regulation of smooth muscle contraction	cytosol|Golgi membrane|membrane fraction|plasma membrane	calcium ion binding|guanyl-nucleotide exchange factor activity|phosphatidylinositol phospholipase C activity|Ras GTPase binding|receptor signaling protein activity			ovary(2)|skin(1)	3		Colorectal(252;0.0458)				TGTGAGAACTCTGCCTTCTGG	0.443													9	78	---	---	---	---	PASS
CYP2C8	1558	broad.mit.edu	37	10	96824616	96824616	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96824616G>C	uc001kkb.2	-	4	678	c.583C>G	c.(583-585)CTC>GTC	p.L195V	CYP2C8_uc001kkc.2_RNA|CYP2C8_uc010qoa.1_Missense_Mutation_p.L125V|CYP2C8_uc010qob.1_Missense_Mutation_p.L109V|CYP2C8_uc010qoc.1_Missense_Mutation_p.L93V|CYP2C8_uc010qod.1_Missense_Mutation_p.L109V	NM_000770	NP_000761	P10632	CP2C8_HUMAN	cytochrome P450, family 2, subfamily C,	195					exogenous drug catabolic process|organic acid metabolic process|oxidative demethylation|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	aromatase activity|caffeine oxidase activity|electron carrier activity|heme binding|oxygen binding				0		Colorectal(252;0.0397)		all cancers(201;6.21e-05)	Aminophenazone(DB01424)|Amiodarone(DB01118)|Amodiaquine(DB00613)|Benzphetamine(DB00865)|Carbamazepine(DB00564)|Cerivastatin(DB00439)|Diclofenac(DB00586)|Fluvastatin(DB01095)|Fosphenytoin(DB01320)|Gemfibrozil(DB01241)|Ketoconazole(DB01026)|Lapatinib(DB01259)|Lovastatin(DB00227)|Midazolam(DB00683)|Montelukast(DB00471)|Nicardipine(DB00622)|Paclitaxel(DB01229)|Phenytoin(DB00252)|Pioglitazone(DB01132)|Repaglinide(DB00912)|Rifampin(DB01045)|Rosiglitazone(DB00412)|Simvastatin(DB00641)|Sitagliptin(DB01261)|Tolbutamide(DB01124)|Torasemide(DB00214)|Tretinoin(DB00755)|Trimethoprim(DB00440)|Warfarin(DB00682)|Zafirlukast(DB00549)|Zopiclone(DB01198)	ATCAGGGTGAGAAAATTCTGA	0.408													8	132	---	---	---	---	PASS
ERLIN1	10613	broad.mit.edu	37	10	101911983	101911983	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101911983C>G	uc001kqn.3	-	11	1303	c.952G>C	c.(952-954)GAT>CAT	p.D318H	ERLIN1_uc001kqm.3_Missense_Mutation_p.D83H|ERLIN1_uc001kqo.3_Missense_Mutation_p.D318H|ERLIN1_uc010qpm.1_Missense_Mutation_p.D234H	NM_006459	NP_006450	O75477	ERLN1_HUMAN	ER lipid raft associated 1	316	Lumenal (Potential).				ER-associated protein catabolic process	endoplasmic reticulum membrane|integral to membrane	protein binding				0		Colorectal(252;0.234)		Epithelial(162;3.85e-10)|all cancers(201;3.25e-08)		GTCCTAATATCTGAATATTTC	0.443													25	113	---	---	---	---	PASS
SFXN3	81855	broad.mit.edu	37	10	102799340	102799340	+	Nonstop_Mutation	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102799340T>C	uc001ksp.2	+	12	1432	c.976T>C	c.(976-978)TGA>CGA	p.*326R	SFXN3_uc001ksq.2_Nonstop_Mutation_p.*326R|SFXN3_uc010qpx.1_Nonstop_Mutation_p.*330R	NM_030971	NP_112233	Q9BWM7	SFXN3_HUMAN	sideroflexin 3	326					iron ion homeostasis	integral to membrane|mitochondrial membrane	cation transmembrane transporter activity			ovary(1)	1		Colorectal(252;0.234)		Epithelial(162;6.98e-09)|all cancers(201;3.55e-07)		CAAGGGGCTTTGAGGAGGGTC	0.542													49	205	---	---	---	---	PASS
AS3MT	57412	broad.mit.edu	37	10	104632333	104632333	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:104632333G>C	uc001kwk.2	+	4	439	c.299G>C	c.(298-300)GGA>GCA	p.G100A	AS3MT_uc001kwj.2_Missense_Mutation_p.G102A|AS3MT_uc009xxh.2_Missense_Mutation_p.G100A	NM_020682	NP_065733	Q9HBK9	AS3MT_HUMAN	arsenic (+3 oxidation state) methyltransferase	100					arsonoacetate metabolic process|toxin metabolic process	cytosol	arsenite methyltransferase activity|methylarsonite methyltransferase activity				0		Colorectal(252;0.122)|all_hematologic(284;0.152)|Breast(234;0.198)		Epithelial(162;5.87e-09)|all cancers(201;1.58e-07)|BRCA - Breast invasive adenocarcinoma(275;0.223)		CACGTGACTGGAATAGACATG	0.418													6	105	---	---	---	---	PASS
PDCD11	22984	broad.mit.edu	37	10	105163037	105163037	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105163037C>T	uc001kwy.1	+	4	484	c.397C>T	c.(397-399)CTG>TTG	p.L133L		NM_014976	NP_055791	Q14690	RRP5_HUMAN	programmed cell death 11	133	S1 motif 1.				mRNA processing|rRNA processing	nucleolus	RNA binding|transcription factor binding			ovary(2)|breast(2)|skin(2)|central_nervous_system(1)	7		Colorectal(252;0.0747)|Breast(234;0.128)		Epithelial(162;7.21e-09)|all cancers(201;1.17e-08)|BRCA - Breast invasive adenocarcinoma(275;0.208)		AGAACAACCTCTGAAGGTAAG	0.418													14	246	---	---	---	---	PASS
SORCS3	22986	broad.mit.edu	37	10	106916948	106916948	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:106916948T>A	uc001kyi.1	+	10	1762	c.1535T>A	c.(1534-1536)GTG>GAG	p.V512E		NM_014978	NP_055793	Q9UPU3	SORC3_HUMAN	VPS10 domain receptor protein SORCS 3 precursor	512	Lumenal (Potential).					integral to membrane	neuropeptide receptor activity			ovary(6)|skin(3)|central_nervous_system(1)	10		Colorectal(252;0.134)|Breast(234;0.142)|Lung NSC(174;0.191)		Epithelial(162;1.58e-07)|all cancers(201;1.02e-05)|BRCA - Breast invasive adenocarcinoma(275;0.0628)		GACGACCAGGTGAAGACATAC	0.522													28	114	---	---	---	---	PASS
BCCIP	56647	broad.mit.edu	37	10	127524684	127524684	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:127524684C>G	uc001ljb.3	+	7	809	c.786C>G	c.(784-786)CTC>CTG	p.L262L	BCCIP_uc001ljd.3_Intron|BCCIP_uc010qui.1_Intron|BCCIP_uc001ljc.3_Intron|BCCIP_uc010quj.1_Intron	NM_078468	NP_510868	Q9P287	BCCIP_HUMAN	BRCA2 and CDKN1A-interacting protein isoform	262					cell cycle|DNA repair|neuroendocrine cell differentiation|regulation of cyclin-dependent protein kinase activity	nuclear cyclin-dependent protein kinase holoenzyme complex	kinase regulator activity|protein binding			ovary(1)|breast(1)	2		all_lung(145;0.00751)|Lung NSC(174;0.0115)|Colorectal(57;0.0846)|all_neural(114;0.0936)				AGGCAATTCTCAAGTTCAACT	0.423													14	275	---	---	---	---	PASS
TSPAN32	10077	broad.mit.edu	37	11	2337820	2337820	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:2337820C>G	uc001lvy.1	+	8	779	c.642C>G	c.(640-642)CTC>CTG	p.L214L	TSPAN32_uc010qxk.1_3'UTR|TSPAN32_uc009ydl.1_Intron|TSPAN32_uc001lvz.1_Silent_p.L184L|TSPAN32_uc001lwb.1_Silent_p.L184L|TSPAN32_uc001lwc.1_Silent_p.L159L|TSPAN32_uc001lwd.1_Silent_p.L146L	NM_139022	NP_620591	Q96QS1	TSN32_HUMAN	tumor-suppressing subtransferable candidate 6	214	Helical; (Potential).				cell-cell signaling	integral to membrane				central_nervous_system(1)	1		all_epithelial(84;4.89e-05)|Breast(177;0.000962)|Medulloblastoma(188;0.00106)|Ovarian(85;0.0014)|all_neural(188;0.00791)|Lung NSC(207;0.209)		BRCA - Breast invasive adenocarcinoma(625;0.000533)|LUSC - Lung squamous cell carcinoma(625;0.082)|Lung(200;0.153)		CCGCCTTGCTCTTCAGCTCCT	0.672													9	81	---	---	---	---	PASS
OR51A4	401666	broad.mit.edu	37	11	4967563	4967563	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4967563G>T	uc010qys.1	-	1	768	c.768C>A	c.(766-768)ATC>ATA	p.I256I		NM_001005329	NP_001005329	Q8NGJ6	O51A4_HUMAN	olfactory receptor, family 51, subfamily A,	256	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(1)	3		Medulloblastoma(188;0.0075)|all_neural(188;0.0577)|Breast(177;0.086)		Epithelial(150;3.22e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0284)|LUSC - Lung squamous cell carcinoma(625;0.19)		CCAGGTTGATGATGGGCAGGT	0.483													24	153	---	---	---	---	PASS
OR51I2	390064	broad.mit.edu	37	11	5474948	5474948	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5474948C>A	uc010qzf.1	+	1	230	c.230C>A	c.(229-231)ACA>AAA	p.T77K	HBG2_uc001mak.1_Intron|HBE1_uc001mam.1_Intron|OR51B5_uc001maq.1_Intron	NM_001004754	NP_001004754	Q9H344	O51I2_HUMAN	olfactory receptor, family 51, subfamily I,	77	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(2)	4		Medulloblastoma(188;0.0075)|all_neural(188;0.0572)|Breast(177;0.0675)		Epithelial(150;1.09e-10)|BRCA - Breast invasive adenocarcinoma(625;0.135)		TCCATGGCCACACTGCCCACT	0.507													39	144	---	---	---	---	PASS
UBQLNL	143630	broad.mit.edu	37	11	5536292	5536292	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5536292C>T	uc001maz.3	-	1	1665	c.1380G>A	c.(1378-1380)CTG>CTA	p.L460L	HBG2_uc001mak.1_Intron	NM_145053	NP_659490	Q8IYU4	UBQLN_HUMAN	ubiquilin-like	460										large_intestine(2)|skin(1)	3		Medulloblastoma(188;0.00225)|Breast(177;0.0155)|all_neural(188;0.0212)		Epithelial(150;1.92e-09)|BRCA - Breast invasive adenocarcinoma(625;0.136)		GGAATGTGGGCAGCTGCTGCC	0.502													32	164	---	---	---	---	PASS
UBQLNL	143630	broad.mit.edu	37	11	5537009	5537009	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5537009G>A	uc001maz.3	-	1	948	c.663C>T	c.(661-663)ATC>ATT	p.I221I	HBG2_uc001mak.1_Intron	NM_145053	NP_659490	Q8IYU4	UBQLN_HUMAN	ubiquilin-like	221										large_intestine(2)|skin(1)	3		Medulloblastoma(188;0.00225)|Breast(177;0.0155)|all_neural(188;0.0212)		Epithelial(150;1.92e-09)|BRCA - Breast invasive adenocarcinoma(625;0.136)		TCTGCAATAGGATCTCAGAAT	0.453													17	363	---	---	---	---	PASS
OR52W1	120787	broad.mit.edu	37	11	6221263	6221263	+	Silent	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6221263T>C	uc010qzz.1	+	1	810	c.810T>C	c.(808-810)GGT>GGC	p.G270G		NM_001005178	NP_001005178	Q6IF63	O52W1_HUMAN	olfactory receptor, family 52, subfamily W,	270	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0		Medulloblastoma(188;0.00776)|all_neural(188;0.0652)|Breast(177;0.114)		Epithelial(150;2.13e-08)|BRCA - Breast invasive adenocarcinoma(625;0.135)		ACCGCTTTGGTCATCACACTG	0.542													175	707	---	---	---	---	PASS
CNGA4	1262	broad.mit.edu	37	11	6260661	6260661	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6260661G>T	uc001mco.2	+	2	217	c.110G>T	c.(109-111)TGG>TTG	p.W37L	CNGA4_uc010raa.1_5'UTR|CNGA4_uc001mcn.2_5'UTR	NM_001037329	NP_001032406	Q8IV77	CNGA4_HUMAN	cyclic nucleotide gated channel alpha 4	37	Helical; Name=H1; (Potential).				response to stimulus|sensory perception of smell		cAMP binding			skin(1)	1		Medulloblastoma(188;0.00263)|all_neural(188;0.026)|Breast(177;0.029)		Epithelial(150;2.04e-08)|BRCA - Breast invasive adenocarcinoma(625;0.135)		TACTACTGGTGGCTGAACACA	0.493													100	511	---	---	---	---	PASS
SYT9	143425	broad.mit.edu	37	11	7334650	7334650	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:7334650C>T	uc001mfe.2	+	3	759	c.522C>T	c.(520-522)CTC>CTT	p.L174L	SYT9_uc001mfd.2_RNA|SYT9_uc009yfi.2_Intron	NM_175733	NP_783860	Q86SS6	SYT9_HUMAN	synaptotagmin IX	174	Cytoplasmic (Potential).					cell junction|integral to membrane|synaptic vesicle membrane	metal ion binding|transporter activity			ovary(2)|large_intestine(1)	3				Epithelial(150;1.34e-07)|LUSC - Lung squamous cell carcinoma(625;0.0949)		GAAGACAACTCAACTTGTCAA	0.393													18	69	---	---	---	---	PASS
KCNJ11	3767	broad.mit.edu	37	11	17409310	17409310	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17409310C>A	uc001mna.2	-	1	897	c.329G>T	c.(328-330)TGT>TTT	p.C110F	KCNJ11_uc001mnb.3_Missense_Mutation_p.C23F	NM_000525	NP_000516	B4DWI4	B4DWI4_HUMAN	potassium inwardly-rectifying channel J11	110						integral to membrane	ATP-activated inward rectifier potassium channel activity			ovary(1)	1				READ - Rectum adenocarcinoma(2;0.0276)|Colorectal(2;0.0633)		GCTGGTGACACAGGGCTCAGC	0.612													13	61	---	---	---	---	PASS
MRGPRX1	259249	broad.mit.edu	37	11	18955535	18955535	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:18955535C>A	uc001mpg.2	-	1	1015	c.797G>T	c.(796-798)AGT>ATT	p.S266I		NM_147199	NP_671732	Q96LB2	MRGX1_HUMAN	MAS-related GPR, member X1	266	Helical; Name=7; (Potential).				acute-phase response	integral to membrane|plasma membrane	G-protein coupled receptor activity			pancreas(2)|central_nervous_system(1)	3						GGGGTTGGCACTGCTGTTAAG	0.468													35	137	---	---	---	---	PASS
SLC17A6	57084	broad.mit.edu	37	11	22399019	22399019	+	Nonsense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22399019T>A	uc001mqk.2	+	12	1895	c.1482T>A	c.(1480-1482)TAT>TAA	p.Y494*		NM_020346	NP_065079	Q9P2U8	VGLU2_HUMAN	solute carrier family 17 (sodium-dependent	494	Helical; (Potential).				sodium ion transport	cell junction|integral to membrane|synaptic vesicle membrane|synaptosome	L-glutamate transmembrane transporter activity|symporter activity			ovary(3)|breast(1)	4						TTATATTTTATGCAATATTTG	0.438													22	81	---	---	---	---	PASS
FANCF	2188	broad.mit.edu	37	11	22646528	22646528	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22646528G>C	uc001mql.1	-	1	860	c.829C>G	c.(829-831)CTG>GTG	p.L277V		NM_022725	NP_073562	Q9NPI8	FANCF_HUMAN	Fanconi anemia, complementation group F	277					DNA repair	nucleoplasm	protein binding			skin(1)	1						TCTGTTAGCAGACCCAGATAG	0.537			N|F			AML|leukemia		Direct_reversal_of_damage|Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia		OREG0020844	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	13	165	---	---	---	---	PASS
C11orf41	25758	broad.mit.edu	37	11	33566811	33566811	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:33566811G>A	uc001mup.3	+	2	2523	c.2399G>A	c.(2398-2400)CGA>CAA	p.R800Q	C11orf41_uc001mun.1_Missense_Mutation_p.R800Q	NM_012194	NP_036326	Q6ZVL6	CK041_HUMAN	hypothetical protein LOC25758	794						integral to membrane				ovary(2)	2						CCACCATTGCGAGCAGAAAAC	0.582													19	95	---	---	---	---	PASS
TRAF6	7189	broad.mit.edu	37	11	36514132	36514132	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:36514132C>T	uc001mwr.1	-	7	1065	c.725G>A	c.(724-726)TGC>TAC	p.C242Y	TRAF6_uc001mws.1_Missense_Mutation_p.C242Y	NM_145803	NP_665802	Q9Y4K3	TRAF6_HUMAN	TNF receptor-associated factor 6	242	Interaction with TAX1BP1.|TRAF-type 2.				activation of MAPK activity|activation of NF-kappaB-inducing kinase activity|anti-apoptosis|apoptosis|induction of apoptosis by extracellular signals|innate immune response|JNK cascade|membrane protein intracellular domain proteolysis|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|ossification|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-2 production|positive regulation of JUN kinase activity|positive regulation of NF-kappaB transcription factor activity|positive regulation of osteoclast differentiation|positive regulation of T cell cytokine production|protein autoubiquitination|protein K63-linked ubiquitination|response to interleukin-1|stress-activated MAPK cascade|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	CD40 receptor complex|cell cortex|cytosol|endosome membrane|internal side of plasma membrane|nuclear membrane	histone deacetylase binding|mitogen-activated protein kinase kinase kinase binding|protein kinase B binding|protein N-terminus binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1	all_lung(20;0.211)	all_hematologic(20;0.107)				ACTGAATGTGCATGGAATTGG	0.303													7	185	---	---	---	---	PASS
KBTBD4	55709	broad.mit.edu	37	11	47595120	47595120	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47595120C>A	uc001nfx.2	-	4	1090	c.919G>T	c.(919-921)GAC>TAC	p.D307Y	NDUFS3_uc001nft.3_Intron|KBTBD4_uc001nfw.1_Missense_Mutation_p.D332Y|KBTBD4_uc001nfz.2_Missense_Mutation_p.D323Y|KBTBD4_uc001nfy.2_Missense_Mutation_p.D307Y	NM_016506	NP_057590	Q9NVX7	KBTB4_HUMAN	kelch repeat and BTB (POZ) domain containing 4	307	Kelch 2.									ovary(1)|central_nervous_system(1)	2						CACTCCCAGTCAACGGTGGCA	0.592													37	103	---	---	---	---	PASS
OR4C3	256144	broad.mit.edu	37	11	48347278	48347278	+	Silent	SNP	C	G	G	rs146173332	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48347278C>G	uc010rhv.1	+	1	786	c.786C>G	c.(784-786)CTC>CTG	p.L262L		NM_001004702	NP_001004702	Q8NH37	OR4C3_HUMAN	olfactory receptor, family 4, subfamily C,	235	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1						GCAAAGCCCTCTCCACCTGTG	0.448													33	248	---	---	---	---	PASS
OR4A5	81318	broad.mit.edu	37	11	51412240	51412240	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:51412240G>A	uc001nhi.1	-	1	156	c.156C>T	c.(154-156)TCC>TCT	p.S52S		NM_001005272	NP_001005272	Q8NH83	OR4A5_HUMAN	olfactory receptor, family 4, subfamily A,	52	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3		all_lung(304;0.236)				GGGAACCCAAGGAAGGGCTGG	0.428													11	80	---	---	---	---	PASS
OR5I1	10798	broad.mit.edu	37	11	55703274	55703274	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55703274G>T	uc010ris.1	-	1	603	c.603C>A	c.(601-603)CTC>CTA	p.L201L		NM_006637	NP_006628	Q13606	OR5I1_HUMAN	olfactory receptor, family 5, subfamily I,	201	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1						CGTATGTGGAGAGGAGCCACT	0.383													11	48	---	---	---	---	PASS
OR8J3	81168	broad.mit.edu	37	11	55904716	55904716	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55904716G>A	uc010riz.1	-	1	479	c.479C>T	c.(478-480)TCA>TTA	p.S160L		NM_001004064	NP_001004064	Q8NGG0	OR8J3_HUMAN	olfactory receptor, family 8, subfamily J,	160	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2	Esophageal squamous(21;0.00693)					TATACAAGGTGAAACCACAAT	0.428													26	150	---	---	---	---	PASS
OR8J1	219477	broad.mit.edu	37	11	56128355	56128355	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56128355G>A	uc010rjh.1	+	1	633	c.633G>A	c.(631-633)TTG>TTA	p.L211L		NM_001005205	NP_001005205	Q8NGP2	OR8J1_HUMAN	olfactory receptor, family 8, subfamily J,	211	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00448)					TTGGTTCCTTGATTATAGTTC	0.323													9	104	---	---	---	---	PASS
OR9G9	504191	broad.mit.edu	37	11	56467891	56467891	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56467891G>A	uc010rjn.1	+	1	28	c.28G>A	c.(28-30)GAG>AAG	p.E10K		NM_001013358	NP_001013376	P0C7N8	OR9G9_HUMAN	olfactory receptor, family 9, subfamily G,	10	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						TACAGTGACTGAGTTTATACT	0.473													18	120	---	---	---	---	PASS
MS4A1	931	broad.mit.edu	37	11	60229890	60229890	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60229890G>A	uc001npp.2	+	3	459	c.43G>A	c.(43-45)GAG>AAG	p.E15K	MS4A1_uc009ymy.1_Missense_Mutation_p.E15K|MS4A1_uc001npq.2_Missense_Mutation_p.E15K|MS4A1_uc009yna.2_Missense_Mutation_p.E15K|MS4A1_uc009ymz.2_Missense_Mutation_p.E15K|MS4A1_uc010rlc.1_Missense_Mutation_p.E15K	NM_152866	NP_690605	P11836	CD20_HUMAN	membrane-spanning 4-domains, subfamily A, member	15	Cytoplasmic (Potential).				B cell activation|immune response	integral to plasma membrane				ovary(3)|lung(2)	5					Ibritumomab(DB00078)|Rituximab(DB00073)|Tositumomab(DB00081)	TTTCCCGGCAGAGCCAATGAA	0.438													10	156	---	---	---	---	PASS
PRPF19	27339	broad.mit.edu	37	11	60673830	60673830	+	Intron	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60673830A>G	uc001nqf.2	-							NM_014502	NP_055317	Q9UMS4	PRP19_HUMAN	PRP19/PSO4 pre-mRNA processing factor 19						DNA repair|protein polyubiquitination|spliceosome assembly	catalytic step 2 spliceosome|nuclear speck|spindle|ubiquitin ligase complex	DNA binding|identical protein binding|ubiquitin-ubiquitin ligase activity			ovary(1)	1						CGCAGCCAACACTCACTGGAG	0.726													6	9	---	---	---	---	PASS
SLC22A8	9376	broad.mit.edu	37	11	62782428	62782428	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62782428C>T	uc001nwo.2	-	2	139	c.3G>A	c.(1-3)ATG>ATA	p.M1I	SLC22A8_uc001nwp.2_Missense_Mutation_p.M1I|SLC22A8_uc009yom.2_Intron|SLC22A8_uc010rmm.1_Intron|SLC22A8_uc009yon.2_Missense_Mutation_p.M1I	NM_004254	NP_004245	Q8TCC7	S22A8_HUMAN	solute carrier family 22 member 8	1	Cytoplasmic (Potential).				response to toxin	basolateral plasma membrane|integral to plasma membrane|membrane fraction	inorganic anion exchanger activity|organic anion transmembrane transporter activity			skin(2)|ovary(1)	3						CCGAGAAGGTCATGGCACTGG	0.572													31	185	---	---	---	---	PASS
FLRT1	23769	broad.mit.edu	37	11	63884157	63884157	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63884157C>T	uc001nyi.1	+	2	759	c.418C>T	c.(418-420)CGC>TGC	p.R140C	MACROD1_uc001nyh.2_Intron	NM_013280	NP_037412	Q9NZU1	FLRT1_HUMAN	fibronectin leucine rich transmembrane protein	112	LRR 3.|Extracellular (Potential).				cell adhesion	integral to plasma membrane|proteinaceous extracellular matrix	protein binding, bridging|receptor signaling protein activity				0						CAACAATGTGCGCACCATTGC	0.602													19	126	---	---	---	---	PASS
FKBP2	2286	broad.mit.edu	37	11	64009984	64009984	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64009984G>A	uc001nyy.2	+	2	321	c.125G>A	c.(124-126)TGT>TAT	p.C42Y	FKBP2_uc010rnh.1_Missense_Mutation_p.C42Y|FKBP2_uc001nyz.2_Missense_Mutation_p.C42Y	NM_004470	NP_004461	P26885	FKBP2_HUMAN	FK506 binding protein 2, 13kDa precursor	42					protein folding	endoplasmic reticulum membrane	FK506 binding|peptidyl-prolyl cis-trans isomerase activity|protein binding				0						GTGGACCACTGTCCCATCAAA	0.567													15	257	---	---	---	---	PASS
NAALADL1	10004	broad.mit.edu	37	11	64822077	64822077	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64822077C>T	uc001ocn.2	-	5	753	c.737G>A	c.(736-738)CGA>CAA	p.R246Q	NAALADL1_uc010rnw.1_5'UTR	NM_005468	NP_005459	Q9UQQ1	NALDL_HUMAN	N-acetylated alpha-linked acidic	246	Extracellular (Potential).				proteolysis	apical plasma membrane|integral to membrane	carboxypeptidase activity|dipeptidase activity|metal ion binding|metallopeptidase activity				0						GTAGGAGCCTCGCTCCACTCC	0.597											OREG0032001	type=REGULATORY REGION|TFbs=RELA|Dataset=RELA (p65) ChIP-PET Binding Sites|EvidenceSubtype=Chromatin immunoprecipitation with paired-end diTag sequencing (ChIP-PET)	11	76	---	---	---	---	PASS
PCNXL3	399909	broad.mit.edu	37	11	65397112	65397112	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65397112C>T	uc001oey.2	+	26	4122	c.4122C>T	c.(4120-4122)TTC>TTT	p.F1374F	PCNXL3_uc001oez.2_Silent_p.F261F	NM_032223	NP_115599	Q9H6A9	PCX3_HUMAN	pecanex-like 3	1374						integral to membrane					0						GTGACTGCTTCGTCCTGGCCT	0.612													9	29	---	---	---	---	PASS
FOSL1	8061	broad.mit.edu	37	11	65664331	65664331	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65664331G>A	uc001ogg.1	-	2	433	c.246C>T	c.(244-246)GTC>GTT	p.V82V	FOSL1_uc010ros.1_Intron	NM_005438	NP_005429	P15407	FOSL1_HUMAN	FOS-like antigen 1	82					cellular defense response|chemotaxis|positive regulation of cell proliferation|response to virus|transcription from RNA polymerase II promoter	nucleus	protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0				READ - Rectum adenocarcinoma(159;0.168)		GGGCCCGGATGACTCCTGGCC	0.642													28	167	---	---	---	---	PASS
TSGA10IP	254187	broad.mit.edu	37	11	65714963	65714963	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65714963G>A	uc001ogk.1	+	5	699	c.667G>A	c.(667-669)GAG>AAG	p.E223K	TSGA10IP_uc009yqw.1_RNA|TSGA10IP_uc009yqx.1_Intron	NM_152762	NP_689975	Q3SY00	T10IP_HUMAN	testis specific, 10 interacting protein	223											0						CCTGGGTGCTGAGGAGGCCGA	0.652													19	112	---	---	---	---	PASS
CST6	1474	broad.mit.edu	37	11	65779526	65779526	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65779526C>G	uc001ogr.2	+	1	65	c.11C>G	c.(10-12)TCG>TGG	p.S4W	CST6_uc001ogq.1_RNA|CST6_uc001ogs.1_5'Flank	NM_001323	NP_001314	Q15828	CYTM_HUMAN	cystatin M precursor	4					anatomical structure morphogenesis	extracellular region	cysteine-type endopeptidase inhibitor activity			ovary(1)	1						ATGGCGCGTTCGAACCTCCCG	0.746													7	14	---	---	---	---	PASS
NPAS4	266743	broad.mit.edu	37	11	66191327	66191327	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66191327C>T	uc001ohx.1	+	7	1142	c.966C>T	c.(964-966)CTC>CTT	p.L322L	NPAS4_uc010rpc.1_Silent_p.L112L	NM_178864	NP_849195	Q8IUM7	NPAS4_HUMAN	neuronal PAS domain protein 4	322					transcription, DNA-dependent		DNA binding|signal transducer activity				0						CCTGGAGCCTCCGCCAGCAGT	0.547													17	283	---	---	---	---	PASS
ALDH3B2	222	broad.mit.edu	37	11	67434384	67434384	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67434384G>C	uc001omr.2	-	3	462	c.23C>G	c.(22-24)ACG>AGG	p.T8R	ALDH3B2_uc001oms.2_Missense_Mutation_p.T8R|ALDH3B2_uc009ysa.1_Missense_Mutation_p.T8R	NM_000695	NP_000686	P48448	AL3B2_HUMAN	aldehyde dehydrogenase 3B2	8					alcohol metabolic process|cellular aldehyde metabolic process|lipid metabolic process		3-chloroallyl aldehyde dehydrogenase activity|aldehyde dehydrogenase			lung(1)|kidney(1)	2					NADH(DB00157)	CACCAGGTTCGTGGACCGTGG	0.642													7	200	---	---	---	---	PASS
SHANK2	22941	broad.mit.edu	37	11	70319419	70319419	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70319419G>A	uc001oqc.2	-	22	5183	c.5105C>T	c.(5104-5106)TCA>TTA	p.S1702L	SHANK2_uc010rqn.1_Missense_Mutation_p.S1114L|SHANK2_uc001opz.2_Missense_Mutation_p.S1107L|uc009ysn.1_Intron|SHANK2_uc001opy.2_Missense_Mutation_p.S38L	NM_012309	NP_036441	Q9UPX8	SHAN2_HUMAN	SH3 and multiple ankyrin repeat domains 2	1323					intracellular signal transduction	cell junction|cytoplasm|postsynaptic density|postsynaptic membrane	GKAP/Homer scaffold activity|ionotropic glutamate receptor binding|SH3 domain binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(11;4.72e-09)|STAD - Stomach adenocarcinoma(18;0.071)			TCTTGTTCCTGAGGTCCTGCT	0.642													9	153	---	---	---	---	PASS
POLD3	10714	broad.mit.edu	37	11	74351706	74351706	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:74351706G>T	uc001ovf.1	+	12	1371	c.1296G>T	c.(1294-1296)GTG>GTT	p.V432V	POLD3_uc009yua.1_Silent_p.V326V	NM_006591	NP_006582	Q15054	DPOD3_HUMAN	DNA-directed DNA polymerase delta 3	432					base-excision repair|DNA strand elongation involved in DNA replication|DNA synthesis involved in DNA repair|mismatch repair|nucleotide-excision repair, DNA gap filling|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication|transcription-coupled nucleotide-excision repair	delta DNA polymerase complex|nucleoplasm	DNA-directed DNA polymerase activity|protein binding			kidney(2)|ovary(1)	3	Breast(11;3.21e-06)					CCATGACTGTGAAAAAAGAAC	0.498													28	166	---	---	---	---	PASS
POLD3	10714	broad.mit.edu	37	11	74351707	74351707	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:74351707A>G	uc001ovf.1	+	12	1372	c.1297A>G	c.(1297-1299)AAA>GAA	p.K433E	POLD3_uc009yua.1_Missense_Mutation_p.K327E	NM_006591	NP_006582	Q15054	DPOD3_HUMAN	DNA-directed DNA polymerase delta 3	433					base-excision repair|DNA strand elongation involved in DNA replication|DNA synthesis involved in DNA repair|mismatch repair|nucleotide-excision repair, DNA gap filling|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication|transcription-coupled nucleotide-excision repair	delta DNA polymerase complex|nucleoplasm	DNA-directed DNA polymerase activity|protein binding			kidney(2)|ovary(1)	3	Breast(11;3.21e-06)					CATGACTGTGAAAAAAGAACC	0.493													27	162	---	---	---	---	PASS
RAB38	23682	broad.mit.edu	37	11	87908475	87908475	+	Missense_Mutation	SNP	G	C	C	rs61749248		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:87908475G>C	uc001pcj.1	-	1	125	c.78C>G	c.(76-78)ATC>ATG	p.I26M	hsa-mir-3166|MI0014196_5'Flank	NM_022337	NP_071732	P57729	RAB38_HUMAN	RAB38	26					protein transport|small GTPase mediated signal transduction	melanosome|plasma membrane	GTP binding|GTPase activity	p.I26I(1)		upper_aerodigestive_tract(1)|large_intestine(1)	2		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.0123)				CGTAGCGCTTGATGATACTGG	0.632													16	136	---	---	---	---	PASS
TYR	7299	broad.mit.edu	37	11	88911287	88911287	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:88911287C>T	uc001pcs.2	+	1	248	c.166C>T	c.(166-168)CAG>TAG	p.Q56*		NM_000372	NP_000363	P14679	TYRO_HUMAN	tyrosinase precursor	56	Lumenal, melanosome (Potential).				eye pigment biosynthetic process|melanin biosynthetic process from tyrosine|visual perception	Golgi-associated vesicle|integral to membrane|lysosome|melanosome membrane|perinuclear region of cytoplasm	copper ion binding|monophenol monooxygenase activity|protein heterodimerization activity|protein homodimerization activity			ovary(2)|central_nervous_system(1)	3		Acute lymphoblastic leukemia(157;2.33e-05)|all_hematologic(158;0.0033)			Azelaic Acid(DB00548)|Mimosine(DB01055)|NADH(DB00157)	AGGTTCCTGTCAGAATATCCT	0.547									Oculocutaneous_Albinism				16	72	---	---	---	---	PASS
TYR	7299	broad.mit.edu	37	11	88911641	88911641	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:88911641G>A	uc001pcs.2	+	1	602	c.520G>A	c.(520-522)GAC>AAC	p.D174N		NM_000372	NP_000363	P14679	TYRO_HUMAN	tyrosinase precursor	174	Lumenal, melanosome (Potential).				eye pigment biosynthetic process|melanin biosynthetic process from tyrosine|visual perception	Golgi-associated vesicle|integral to membrane|lysosome|melanosome membrane|perinuclear region of cytoplasm	copper ion binding|monophenol monooxygenase activity|protein heterodimerization activity|protein homodimerization activity			ovary(2)|central_nervous_system(1)	3		Acute lymphoblastic leukemia(157;2.33e-05)|all_hematologic(158;0.0033)			Azelaic Acid(DB00548)|Mimosine(DB01055)|NADH(DB00157)	CAATATTTATGACCTCTTTGT	0.423									Oculocutaneous_Albinism				57	306	---	---	---	---	PASS
GPR83	10888	broad.mit.edu	37	11	94113828	94113828	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:94113828G>T	uc001pet.2	-	4	931	c.759C>A	c.(757-759)CTC>CTA	p.L253L		NM_016540	NP_057624	Q9NYM4	GPR83_HUMAN	G protein-coupled receptor 83 precursor	253	Helical; Name=5; (Potential).					integral to membrane|plasma membrane	neuropeptide Y receptor activity			central_nervous_system(2)|ovary(1)	3		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.0123)				CAGAGATGATGAGGAGGGGCA	0.562													24	110	---	---	---	---	PASS
GRIA4	2893	broad.mit.edu	37	11	105769141	105769141	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:105769141G>C	uc001pix.2	+	7	1319	c.873G>C	c.(871-873)GAG>GAC	p.E291D	GRIA4_uc001piu.1_Missense_Mutation_p.E291D|GRIA4_uc001piw.2_Missense_Mutation_p.E291D|GRIA4_uc009yxk.1_Missense_Mutation_p.E291D	NM_000829	NP_000820	P48058	GRIA4_HUMAN	glutamate receptor, ionotrophic, AMPA 4 isoform	291	Extracellular (Potential).				glutamate signaling pathway|synaptic transmission	cell junction|endocytic vesicle membrane|integral to membrane|postsynaptic membrane	alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|extracellular-glutamate-gated ion channel activity			ovary(3)|skin(3)|lung(1)|central_nervous_system(1)	8		Melanoma(852;0.000902)|Acute lymphoblastic leukemia(157;0.000994)|all_hematologic(158;0.0017)|Breast(348;0.0323)		BRCA - Breast invasive adenocarcinoma(274;0.000147)|Epithelial(105;0.0291)|all cancers(92;0.0899)	L-Glutamic Acid(DB00142)	CAGGATCTGAGACTCCTCCAA	0.313													4	34	---	---	---	---	PASS
ZW10	9183	broad.mit.edu	37	11	113628514	113628514	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113628514C>T	uc001poe.2	-	7	832	c.795G>A	c.(793-795)GTG>GTA	p.V265V	ZW10_uc009yyv.2_RNA	NM_004724	NP_004715	O43264	ZW10_HUMAN	centromere/kinetochore protein zw10	265	Interaction with RINT1.				cell division|ER to Golgi vesicle-mediated transport|establishment of mitotic spindle orientation|meiosis|mitotic cell cycle checkpoint|mitotic metaphase plate congression|mitotic prometaphase|protein complex assembly|protein localization to kinetochore|protein transport|regulation of exit from mitosis	condensed chromosome kinetochore|cytosol|endoplasmic reticulum membrane|kinetochore microtubule|nucleus|spindle pole	centromeric DNA binding|protein binding			central_nervous_system(1)|skin(1)	2		all_cancers(61;3.84e-16)|all_epithelial(67;1e-09)|Melanoma(852;1.46e-05)|all_hematologic(158;0.000237)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0101)|all_neural(223;0.0281)|Prostate(24;0.0421)|Medulloblastoma(222;0.0425)		BRCA - Breast invasive adenocarcinoma(274;2.94e-06)|Epithelial(105;0.000103)|all cancers(92;0.000786)		GGCTTTCTATCACAGCATGAA	0.378													10	96	---	---	---	---	PASS
DSCAML1	57453	broad.mit.edu	37	11	117314735	117314735	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:117314735C>T	uc001prh.1	-	21	3911	c.3909G>A	c.(3907-3909)ACG>ACA	p.T1303T		NM_020693	NP_065744	Q8TD84	DSCL1_HUMAN	Down syndrome cell adhesion molecule like 1	1243	Extracellular (Potential).|Fibronectin type-III 4.				axonogenesis|brain development|cell fate determination|dorsal/ventral pattern formation|embryonic skeletal system morphogenesis|homophilic cell adhesion	cell surface|integral to membrane|plasma membrane	protein homodimerization activity			ovary(3)|large_intestine(2)|skin(2)|upper_aerodigestive_tract(1)	8	all_hematologic(175;0.0487)	Breast(348;0.0424)|Medulloblastoma(222;0.0523)|all_hematologic(192;0.232)		BRCA - Breast invasive adenocarcinoma(274;9.12e-06)|Epithelial(105;0.00172)		GCTCTGGACTCGTCTCGTACT	0.642													11	97	---	---	---	---	PASS
AMICA1	120425	broad.mit.edu	37	11	118074365	118074365	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118074365G>C	uc001psk.2	-	6	724	c.550C>G	c.(550-552)CGT>GGT	p.R184G	AMICA1_uc001psg.2_5'UTR|AMICA1_uc001psh.2_Missense_Mutation_p.R145G|AMICA1_uc009yzw.1_RNA|AMICA1_uc001psi.2_Missense_Mutation_p.R174G|AMICA1_uc001psj.2_Missense_Mutation_p.R173G|AMICA1_uc010rxw.1_Missense_Mutation_p.R145G|AMICA1_uc010rxx.1_Missense_Mutation_p.R184G|AMICA1_uc001psl.1_Missense_Mutation_p.R140G	NM_001098526	NP_001091996	Q86YT9	JAML1_HUMAN	adhesion molecule, interacts with CXADR antigen	184	Ig-like V-type 2.|Extracellular (Potential).				blood coagulation|cell adhesion|leukocyte migration|regulation of immune response	cell junction|integral to membrane				ovary(1)	1	all_hematologic(175;0.046)	Medulloblastoma(222;0.0425)|Breast(348;0.181)|all_hematologic(192;0.196)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;3.4e-05)		TGGTAGTAACGAAATACAATC	0.502													28	170	---	---	---	---	PASS
TREH	11181	broad.mit.edu	37	11	118530458	118530458	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118530458C>A	uc001pty.1	-	11	1363	c.1318G>T	c.(1318-1320)GAG>TAG	p.E440*	TREH_uc009zaj.1_Nonsense_Mutation_p.E409*|TREH_uc001ptz.1_Nonsense_Mutation_p.E317*	NM_007180	NP_009111	O43280	TREA_HUMAN	trehalase precursor	440					polysaccharide digestion|trehalose catabolic process	anchored to plasma membrane	alpha,alpha-trehalase activity			pancreas(1)	1	all_hematologic(175;0.0839)	Medulloblastoma(222;0.0425)|all_hematologic(192;0.0564)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;3.16e-05)		GCCCTCACCTCCAGGTATTTC	0.627											OREG0021385	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	3	15	---	---	---	---	PASS
PVRL1	5818	broad.mit.edu	37	11	119535588	119535588	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:119535588C>T	uc001pwv.2	-	6	1595	c.1423G>A	c.(1423-1425)GAG>AAG	p.E475K	PVRL1_uc001pwu.1_Intron	NM_002855	NP_002846	Q15223	PVRL1_HUMAN	poliovirus receptor-related 1 isoform 1	475	Cytoplasmic (Potential).				adherens junction organization|cell junction assembly|entry of virus into host cell|heterophilic cell-cell adhesion|homophilic cell adhesion|immune response	cell-cell adherens junction|extracellular region|integral to membrane	cell adhesion molecule binding|coreceptor activity|protein homodimerization activity				0		Breast(348;0.037)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;4.29e-05)		TGACGGGCCTCGGCCTCATCC	0.622													7	44	---	---	---	---	PASS
OR10G9	219870	broad.mit.edu	37	11	123893842	123893842	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123893842C>T	uc010sad.1	+	1	123	c.123C>T	c.(121-123)CTC>CTT	p.L41L		NM_001001953	NP_001001953	Q8NGN4	O10G9_HUMAN	olfactory receptor, family 10, subfamily G,	41	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0399)		TGGGGAACCTCCTCATCCTGC	0.567													7	190	---	---	---	---	PASS
OR10G7	390265	broad.mit.edu	37	11	123909586	123909586	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123909586G>A	uc001pzq.1	-	1	123	c.123C>T	c.(121-123)CTC>CTT	p.L41L		NM_001004463	NP_001004463	Q8NGN6	O10G7_HUMAN	olfactory receptor, family 10, subfamily G,	41	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0521)		GCAGGATGAGGAGGTTCCCCA	0.572													22	178	---	---	---	---	PASS
C11orf61	79684	broad.mit.edu	37	11	124637776	124637776	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124637776C>T	uc001qba.1	-	4	999	c.976G>A	c.(976-978)GAG>AAG	p.E326K	C11orf61_uc001qaz.1_Missense_Mutation_p.E274K|C11orf61_uc010sap.1_Missense_Mutation_p.E46K|C11orf61_uc001qay.1_Missense_Mutation_p.E96K	NM_024631	NP_078907	Q6P1R3	CK061_HUMAN	hypothetical protein LOC79684	326											0	all_hematologic(175;0.215)	Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|Breast(109;0.171)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;1.63e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0079)		CGGATATCCTCTTTCCAACGG	0.458													11	188	---	---	---	---	PASS
ETS1	2113	broad.mit.edu	37	11	128350330	128350330	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:128350330C>A	uc010sbs.1	-	6	1063	c.747G>T	c.(745-747)CAG>CAT	p.Q249H	ETS1_uc001qej.2_Missense_Mutation_p.Q293H|ETS1_uc009zch.2_Missense_Mutation_p.Q33H|ETS1_uc009zcg.2_Missense_Mutation_p.Q249H	NM_005238	NP_005229	P14921	ETS1_HUMAN	v-ets erythroblastosis virus E26 oncogene	249					cell motility|immune response|induction of apoptosis|negative regulation of cell cycle|negative regulation of cell cycle|negative regulation of cell proliferation|PML body organization|positive regulation of cellular component movement|positive regulation of erythrocyte differentiation|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|response to antibiotic|transcription from RNA polymerase II promoter	nucleus|nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|sequence-specific DNA binding transcription factor activity|transcription factor binding			lung(4)|central_nervous_system(1)|pleura(1)	6	all_hematologic(175;0.0537)	Lung NSC(97;0.000542)|all_lung(97;0.000665)|Breast(109;0.00765)|all_neural(223;0.0351)|Medulloblastoma(222;0.0425)		BRCA - Breast invasive adenocarcinoma(274;1.47e-05)|OV - Ovarian serous cystadenocarcinoma(99;0.0174)|LUSC - Lung squamous cell carcinoma(976;0.0815)|Lung(307;0.0833)		CAAAAGAGTCCTGGCCCCCGA	0.512													18	75	---	---	---	---	PASS
IGSF9B	22997	broad.mit.edu	37	11	133789895	133789895	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:133789895G>A	uc001qgx.3	-	18	3956	c.3725C>T	c.(3724-3726)CCG>CTG	p.P1242L		NM_014987	NP_055802	Q9UPX0	TUTLB_HUMAN	immunoglobulin superfamily, member 9B	1242	Pro-rich.|Cytoplasmic (Potential).					integral to membrane|plasma membrane					0	all_hematologic(175;0.127)	all_cancers(12;1.58e-21)|all_epithelial(12;5.17e-16)|all_lung(97;1.6e-05)|Lung NSC(97;3.86e-05)|Breast(109;0.000126)|Medulloblastoma(222;0.0245)|all_neural(223;0.0505)|Esophageal squamous(93;0.0559)		Epithelial(10;7.19e-10)|BRCA - Breast invasive adenocarcinoma(10;9.69e-09)|all cancers(11;1.23e-08)|OV - Ovarian serous cystadenocarcinoma(99;0.00328)|Lung(977;0.221)		GACTGCAGCCGGCGGCTGCAG	0.701													7	49	---	---	---	---	PASS
WNK1	65125	broad.mit.edu	37	12	989042	989042	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:989042C>G	uc001qio.3	+	11	3184	c.2677C>G	c.(2677-2679)CCT>GCT	p.P893A	WNK1_uc001qip.3_Intron|WNK1_uc001qir.3_Intron	NM_018979	NP_061852	Q9H4A3	WNK1_HUMAN	WNK lysine deficient protein kinase 1	893					intracellular protein kinase cascade|ion transport|neuron development	cytoplasm	ATP binding|protein binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			stomach(6)|breast(6)|ovary(5)|lung(4)|large_intestine(1)|central_nervous_system(1)	23	all_cancers(10;0.00611)|all_epithelial(11;0.00825)|all_lung(10;0.0331)|Ovarian(42;0.0512)|Lung NSC(10;0.0632)		Epithelial(1;1.74e-08)|all cancers(1;7.04e-08)|OV - Ovarian serous cystadenocarcinoma(31;0.000423)|BRCA - Breast invasive adenocarcinoma(9;0.0149)|Colorectal(1;0.0197)			AACTGTGGTTCCTAGTCAGCT	0.547													8	262	---	---	---	---	PASS
KCNA5	3741	broad.mit.edu	37	12	5153935	5153935	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:5153935G>A	uc001qni.2	+	1	851	c.622G>A	c.(622-624)GAG>AAG	p.E208K		NM_002234	NP_002225	P22460	KCNA5_HUMAN	potassium voltage-gated channel, shaker-related	208						Golgi apparatus|voltage-gated potassium channel complex	delayed rectifier potassium channel activity			ovary(2)|breast(2)	4						GCTGGGGGACGAGGCCATGGA	0.617													8	168	---	---	---	---	PASS
A2ML1	144568	broad.mit.edu	37	12	9001306	9001306	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9001306C>T	uc001quz.3	+						A2ML1_uc001qva.1_Intron|A2ML1_uc010sgm.1_Intron	NM_144670	NP_653271	A8K2U0	A2ML1_HUMAN	alpha-2-macroglobulin-like 1 precursor							extracellular space	endopeptidase inhibitor activity			ovary(2)|skin(1)	3						CTCTCCCCCTCTTGTCCCAGG	0.443													15	305	---	---	---	---	PASS
A2ML1	144568	broad.mit.edu	37	12	9020498	9020498	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9020498G>A	uc001quz.3	+	30	3876	c.3778G>A	c.(3778-3780)GAG>AAG	p.E1260K	A2ML1_uc001qva.1_Missense_Mutation_p.E840K|A2ML1_uc010sgm.1_Missense_Mutation_p.E760K|A2ML1_uc001qvb.1_RNA	NM_144670	NP_653271	A8K2U0	A2ML1_HUMAN	alpha-2-macroglobulin-like 1 precursor	1104						extracellular space	endopeptidase inhibitor activity			ovary(2)|skin(1)	3						CATGCCATCTGAGGAGATCAA	0.443													29	200	---	---	---	---	PASS
CLEC1B	51266	broad.mit.edu	37	12	10151638	10151638	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10151638G>T	uc001qwu.2	-	1	262	c.62C>A	c.(61-63)TCC>TAC	p.S21Y	CLEC1B_uc009zhd.2_Missense_Mutation_p.S21Y	NM_016509	NP_057593	Q9P126	CLC1B_HUMAN	C-type lectin domain family 1, member B isoform	21	Cytoplasmic (Potential).				cell surface receptor linked signaling pathway|defense response	integral to plasma membrane	protein binding|sugar binding|transmembrane receptor activity				0						ATTCTTACCGGAGATGAGAGC	0.333													50	383	---	---	---	---	PASS
KLRA1	10748	broad.mit.edu	37	12	10746462	10746462	+	RNA	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10746462G>A	uc010shf.1	-	5		c.951C>T			KLRA1_uc010shg.1_RNA|KLRA1_uc009zho.2_RNA|KLRA1_uc009zhn.2_RNA	NM_006611				Homo sapiens Ly-49L (LY49L) mRNA, complete cds.												0						TGTAAAATACGAGTTCATCTT	0.373													7	114	---	---	---	---	PASS
TAS2R10	50839	broad.mit.edu	37	12	10978130	10978130	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10978130T>C	uc001qyy.1	-	1	739	c.739A>G	c.(739-741)ATA>GTA	p.I247V		NM_023921	NP_076410	Q9NYW0	T2R10_HUMAN	taste receptor, type 2, member 10	247	Helical; Name=6; (Potential).				sensory perception of taste	integral to membrane	taste receptor activity				0						AAACATGATATTTCTATGGCC	0.378													88	219	---	---	---	---	PASS
ATF7IP	55729	broad.mit.edu	37	12	14650913	14650913	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14650913A>G	uc001rbw.2	+	15	3877	c.3719A>G	c.(3718-3720)TAC>TGC	p.Y1240C	ATF7IP_uc001rbx.2_Missense_Mutation_p.Y1239C|ATF7IP_uc001rby.3_Missense_Mutation_p.Y1240C|ATF7IP_uc001rca.2_Missense_Mutation_p.Y1240C	NM_018179	NP_060649	Q6VMQ6	MCAF1_HUMAN	activating transcription factor 7 interacting	1240	Interaction with MBD1.|Fibronectin type-III.				DNA methylation|interspecies interaction between organisms|positive regulation of transcription, DNA-dependent|regulation of RNA polymerase II transcriptional preinitiation complex assembly|transcription, DNA-dependent		protein binding			lung(3)|ovary(1)|skin(1)	5						AGCAAATACTACTTTGCAGTA	0.468													148	364	---	---	---	---	PASS
ARNTL2	56938	broad.mit.edu	37	12	27540214	27540214	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:27540214C>T	uc001rht.1	+	7	636	c.618C>T	c.(616-618)TTC>TTT	p.F206F	ARNTL2_uc001rhw.2_Silent_p.F169F|ARNTL2_uc010sjp.1_Silent_p.F169F|ARNTL2_uc001rhu.1_Silent_p.F192F|ARNTL2_uc009zji.1_Silent_p.F172F|ARNTL2_uc001rhv.1_Silent_p.F158F	NM_020183	NP_064568	Q8WYA1	BMAL2_HUMAN	aryl hydrocarbon receptor nuclear	206	PAS 1.				circadian rhythm|entrainment of circadian clock|regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|signal transducer activity			ovary(1)|skin(1)	2	Colorectal(261;0.0847)|Lung SC(9;0.184)					AAATTCTCTTCGTTTCTAAGT	0.284													30	134	---	---	---	---	PASS
DDX11	1663	broad.mit.edu	37	12	31236998	31236998	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31236998G>A	uc001rjt.1	+						DDX11_uc010sjw.1_Intron|DDX11_uc010sjx.1_Intron|DDX11_uc001rjr.1_Intron|DDX11_uc001rjs.1_Intron|DDX11_uc001rju.1_Intron|DDX11_uc001rjv.1_Intron|DDX11_uc001rjw.1_Intron	NM_152438	NP_689651	Q96FC9	DDX11_HUMAN	DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11						G2/M transition of mitotic cell cycle|interspecies interaction between organisms|mitotic sister chromatid segregation|positive regulation of cell proliferation|S phase of mitotic cell cycle|sister chromatid cohesion	midbody|nuclear chromatin|nucleolus|spindle pole	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding|RNA binding			breast(3)	3	all_cancers(9;1.77e-11)|all_lung(12;6.21e-11)|all_epithelial(9;6.49e-11)|Lung NSC(12;1.06e-08)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Lung SC(12;0.0592)|Esophageal squamous(101;0.233)					GACTAAAGGTGAGACCTGGGG	0.597										Multiple Myeloma(12;0.14)			51	272	---	---	---	---	PASS
FGD4	121512	broad.mit.edu	37	12	32772696	32772696	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32772696G>A	uc001rkz.2	+	11	1880	c.1403G>A	c.(1402-1404)CGA>CAA	p.R468Q	FGD4_uc001rlc.2_Missense_Mutation_p.R553Q|FGD4_uc001rky.2_Missense_Mutation_p.R220Q|FGD4_uc001rla.2_Missense_Mutation_p.R124Q|FGD4_uc010ske.1_Missense_Mutation_p.R580Q|FGD4_uc001rlb.1_RNA	NM_139241	NP_640334	Q96M96	FGD4_HUMAN	FYVE, RhoGEF and PH domain containing 4	468	PH 1.				actin cytoskeleton organization|apoptosis|filopodium assembly|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Cdc42 GTPase activity|regulation of cell shape|small GTPase mediated signal transduction	cytoskeleton|cytosol|filopodium|Golgi apparatus|lamellipodium|ruffle	metal ion binding|Rho guanyl-nucleotide exchange factor activity|small GTPase binding			ovary(2)|central_nervous_system(1)	3	Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.204)					TTCACAGTTCGAACCAGGGTT	0.408													44	239	---	---	---	---	PASS
ALG10B	144245	broad.mit.edu	37	12	38714227	38714227	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:38714227G>C	uc001rln.3	+	3	773	c.634G>C	c.(634-636)GAG>CAG	p.E212Q	ALG10B_uc001rlo.3_Missense_Mutation_p.E182Q|ALG10B_uc010skk.1_Missense_Mutation_p.E152Q	NM_001013620	NP_001013642	Q5I7T1	AG10B_HUMAN	asparagine-linked glycosylation 10 homolog B	212	Cytoplasmic (Potential).				dolichol-linked oligosaccharide biosynthetic process|post-translational protein modification|protein N-linked glycosylation via asparagine	endoplasmic reticulum membrane|integral to membrane|plasma membrane	dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase activity			ovary(2)|skin(1)	3	Esophageal squamous(101;0.187)	Lung NSC(34;0.204)|all_lung(34;0.235)				TTGGAAAACTGAGCTACAAAA	0.388													23	377	---	---	---	---	PASS
LRRK2	120892	broad.mit.edu	37	12	40629431	40629431	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:40629431G>A	uc001rmg.3	+	4	472	c.351G>A	c.(349-351)TTG>TTA	p.L117L		NM_198578	NP_940980	Q5S007	LRRK2_HUMAN	leucine-rich repeat kinase 2	117					activation of MAPKK activity|determination of adult lifespan|exploration behavior|intracellular distribution of mitochondria|negative regulation of branching morphogenesis of a nerve|negative regulation of dendritic spine morphogenesis|negative regulation of neuroblast proliferation|negative regulation of neuron maturation|neuromuscular junction development|neuron death|peptidyl-serine phosphorylation|positive regulation of autophagy|positive regulation of dopamine receptor signaling pathway|positive regulation of programmed cell death|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein phosphorylation|positive regulation of protein ubiquitination|protein autophosphorylation|regulation of kidney size|regulation of locomotion|regulation of membrane potential|response to oxidative stress|small GTPase mediated signal transduction|tangential migration from the subventricular zone to the olfactory bulb	external side of mitochondrial outer membrane	ATP binding|GTP binding|GTP-dependent protein kinase activity|GTPase activator activity|MAP kinase kinase activity|protein homodimerization activity|tubulin binding			ovary(12)|stomach(5)|upper_aerodigestive_tract(2)|lung(2)|large_intestine(1)|urinary_tract(1)|pancreas(1)	24	all_cancers(12;0.00108)|Breast(8;0.218)	Lung NSC(34;0.0942)|all_lung(34;0.11)				ACTCCAGATTGATTCTTAAAA	0.308													6	99	---	---	---	---	PASS
LRRK2	120892	broad.mit.edu	37	12	40753184	40753184	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:40753184G>A	uc001rmg.3	+	47	7087	c.6966G>A	c.(6964-6966)AAG>AAA	p.K2322K	LRRK2_uc009zjw.2_Silent_p.K1160K|LRRK2_uc001rmi.2_Silent_p.K1155K	NM_198578	NP_940980	Q5S007	LRRK2_HUMAN	leucine-rich repeat kinase 2	2322					activation of MAPKK activity|determination of adult lifespan|exploration behavior|intracellular distribution of mitochondria|negative regulation of branching morphogenesis of a nerve|negative regulation of dendritic spine morphogenesis|negative regulation of neuroblast proliferation|negative regulation of neuron maturation|neuromuscular junction development|neuron death|peptidyl-serine phosphorylation|positive regulation of autophagy|positive regulation of dopamine receptor signaling pathway|positive regulation of programmed cell death|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein phosphorylation|positive regulation of protein ubiquitination|protein autophosphorylation|regulation of kidney size|regulation of locomotion|regulation of membrane potential|response to oxidative stress|small GTPase mediated signal transduction|tangential migration from the subventricular zone to the olfactory bulb	external side of mitochondrial outer membrane	ATP binding|GTP binding|GTP-dependent protein kinase activity|GTPase activator activity|MAP kinase kinase activity|protein homodimerization activity|tubulin binding			ovary(12)|stomach(5)|upper_aerodigestive_tract(2)|lung(2)|large_intestine(1)|urinary_tract(1)|pancreas(1)	24	all_cancers(12;0.00108)|Breast(8;0.218)	Lung NSC(34;0.0942)|all_lung(34;0.11)				GTGGCACAAAGATTTTCTCCT	0.328													20	127	---	---	---	---	PASS
ADAMTS20	80070	broad.mit.edu	37	12	43825197	43825197	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:43825197C>A	uc010skx.1	-	22	3199	c.3199G>T	c.(3199-3201)GAA>TAA	p.E1067*	ADAMTS20_uc001rno.1_Nonsense_Mutation_p.E221*|ADAMTS20_uc001rnp.1_Nonsense_Mutation_p.E221*	NM_025003	NP_079279	P59510	ATS20_HUMAN	a disintegrin-like and metalloprotease with	1067	TSP type-1 5.					proteinaceous extracellular matrix	zinc ion binding			central_nervous_system(5)|ovary(4)|lung(3)|large_intestine(2)|skin(2)|urinary_tract(1)|kidney(1)|pancreas(1)	19	all_cancers(12;2.6e-05)|Lung SC(27;0.184)	Lung NSC(34;0.0569)|all_lung(34;0.129)		GBM - Glioblastoma multiforme(48;0.0473)		CTCAGAGATTCAGGTTTGGTA	0.428													28	133	---	---	---	---	PASS
CCDC65	85478	broad.mit.edu	37	12	49298764	49298764	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49298764G>A	uc001rso.2	+	2	395	c.168G>A	c.(166-168)CTG>CTA	p.L56L		NM_033124	NP_149115	Q8IXS2	CCD65_HUMAN	coiled-coil domain containing 65	56										ovary(1)|skin(1)	2						ACAGTGCTCTGAACCTTAATA	0.438													9	123	---	---	---	---	PASS
MLL2	8085	broad.mit.edu	37	12	49434859	49434859	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49434859C>T	uc001rta.3	-	31	6694	c.6694G>A	c.(6694-6696)GGC>AGC	p.G2232S		NM_003482	NP_003473	O14686	MLL2_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 2	2232	Pro-rich.				chromatin silencing|histone H3-K4 methylation|oocyte growth|positive regulation of cell proliferation|positive regulation of estrogen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|response to estrogen stimulus|transcription, DNA-dependent	histone methyltransferase complex	histone-lysine N-methyltransferase activity|protein binding|transcription regulatory region DNA binding|zinc ion binding			kidney(16)|central_nervous_system(12)|lung(4)|skin(4)|ovary(3)|pancreas(2)	41						CTGGGGGTGCCAGGTGGGGTA	0.672			N|F|Mis		medulloblastoma|renal					HNSCC(34;0.089)			58	70	---	---	---	---	PASS
KRT6B	3854	broad.mit.edu	37	12	52845454	52845454	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52845454C>G	uc001sak.2	-	1	457	c.409G>C	c.(409-411)GAG>CAG	p.E137Q		NM_005555	NP_005546	P04259	K2C6B_HUMAN	keratin 6B	137	Head.				ectoderm development	keratin filament	structural constituent of cytoskeleton			ovary(2)	2				BRCA - Breast invasive adenocarcinoma(357;0.083)		ACAGTGACCTCTTGGATGCCT	0.642													41	160	---	---	---	---	PASS
SPRYD3	84926	broad.mit.edu	37	12	53460234	53460234	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53460234G>A	uc001sbt.1	-	10	1079	c.1058C>T	c.(1057-1059)TCT>TTT	p.S353F		NM_032840	NP_116229	Q8NCJ5	SPRY3_HUMAN	SPRY domain containing 3	353										central_nervous_system(1)	1						GGCAGTCGGAGACAGGATCAC	0.463											OREG0021856	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	6	123	---	---	---	---	PASS
HOXC11	3227	broad.mit.edu	37	12	54367306	54367306	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54367306C>A	uc001sem.2	+	1	397	c.281C>A	c.(280-282)GCG>GAG	p.A94E		NM_014212	NP_055027	O43248	HXC11_HUMAN	homeobox C11	94					endoderm development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1						TCCTGCTATGCGGCGGCCGAC	0.647			T	NUP98	AML								67	239	---	---	---	---	PASS
HOXC9	3225	broad.mit.edu	37	12	54396286	54396286	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54396286C>T	uc001sep.2	+	3	709	c.611C>T	c.(610-612)ACG>ATG	p.T204M	HOXC9_uc001seq.2_Missense_Mutation_p.T204M	NM_006897	NP_008828	P31274	HXC9_HUMAN	homeobox C9	204	Homeobox.				multicellular organismal development	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			large_intestine(1)|pancreas(1)|skin(1)	3						AAGTACCAGACGCTGGAACTG	0.572													49	260	---	---	---	---	PASS
NCKAP1L	3071	broad.mit.edu	37	12	54917745	54917745	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54917745C>T	uc001sgc.3	+						NCKAP1L_uc010sox.1_Intron|NCKAP1L_uc010soy.1_Intron	NM_005337	NP_005328	P55160	NCKPL_HUMAN	NCK-associated protein 1-like						actin polymerization-dependent cell motility|B cell homeostasis|B cell receptor signaling pathway|cortical actin cytoskeleton organization|erythrocyte development|maintenance of cell polarity|myeloid cell homeostasis|negative regulation of apoptosis|negative regulation of interleukin-17 production|negative regulation of interleukin-6 production|negative regulation of myosin-light-chain-phosphatase activity|neutrophil chemotaxis|positive regulation of actin filament polymerization|positive regulation of B cell differentiation|positive regulation of B cell proliferation|positive regulation of CD4-positive, alpha-beta T cell differentiation|positive regulation of CD8-positive, alpha-beta T cell differentiation|positive regulation of cell adhesion mediated by integrin|positive regulation of erythrocyte differentiation|positive regulation of gamma-delta T cell differentiation|positive regulation of neutrophil chemotaxis|positive regulation of phagocytosis, engulfment|positive regulation of T cell proliferation|protein complex assembly|response to drug|T cell homeostasis	cytosol|integral to plasma membrane|membrane fraction|SCAR complex	protein complex binding|protein kinase activator activity|Rac GTPase activator activity			ovary(3)|central_nervous_system(1)	4						CAACAGGTATCACTCTTTCCT	0.443													20	158	---	---	---	---	PASS
ERBB3	2065	broad.mit.edu	37	12	56489459	56489459	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56489459C>G	uc001sjh.2	+	17	2117	c.1924C>G	c.(1924-1926)CTG>GTG	p.L642V	ERBB3_uc009zoj.2_Intron|ERBB3_uc010sqb.1_Translation_Start_Site|ERBB3_uc010sqc.1_Missense_Mutation_p.L583V|ERBB3_uc009zok.2_Missense_Mutation_p.L84V|ERBB3_uc001sjk.2_5'Flank	NM_001982	NP_001973	P21860	ERBB3_HUMAN	erbB-3 isoform 1 precursor	642	Extracellular (Potential).				cranial nerve development|heart development|negative regulation of cell adhesion|negative regulation of neuron apoptosis|negative regulation of secretion|negative regulation of signal transduction|neuron apoptosis|phosphatidylinositol 3-kinase cascade|positive regulation of phosphatidylinositol 3-kinase cascade|regulation of cell proliferation|Schwann cell differentiation|transmembrane receptor protein tyrosine kinase signaling pathway|wound healing	basolateral plasma membrane|extracellular space|integral to plasma membrane|receptor complex	ATP binding|growth factor binding|protein heterodimerization activity|protein homodimerization activity|protein tyrosine kinase activator activity|receptor signaling protein tyrosine kinase activity|transmembrane receptor protein tyrosine kinase activity			lung(3)|central_nervous_system(2)|stomach(1)|ovary(1)|skin(1)	8			OV - Ovarian serous cystadenocarcinoma(18;0.112)			CAAAACCCATCTGACAATGGC	0.433													53	216	---	---	---	---	PASS
LRP1	4035	broad.mit.edu	37	12	57588394	57588394	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57588394C>T	uc001snd.2	+	50	8569	c.8103C>T	c.(8101-8103)TTC>TTT	p.F2701F		NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	2701	LDL-receptor class A 15.|Extracellular (Potential).				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)	TGAATTACTTCGCCTGCCCTA	0.632													31	179	---	---	---	---	PASS
CTDSP2	10106	broad.mit.edu	37	12	58223277	58223277	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:58223277G>C	uc001sqm.2	-	2	696	c.167C>G	c.(166-168)TCC>TGC	p.S56C	CTDSP2_uc009zqf.2_5'UTR|CTDSP2_uc009zqg.2_Intron	NM_005730	NP_005721	O14595	CTDS2_HUMAN	nuclear LIM interactor-interacting factor 2	56					protein dephosphorylation	nucleus|soluble fraction	CTD phosphatase activity|metal ion binding			central_nervous_system(1)	1	all_neural(12;0.00559)|Glioma(12;0.0143)|Melanoma(17;0.122)					GAGCTCAGTGGAGGAACTTGA	0.522													79	442	---	---	---	---	PASS
SRGAP1	57522	broad.mit.edu	37	12	64436626	64436626	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:64436626G>A	uc010ssp.1	+	5	602	c.546G>A	c.(544-546)CTG>CTA	p.L182L	SRGAP1_uc001srt.2_Silent_p.L182L|SRGAP1_uc001srv.2_Silent_p.L142L	NM_020762	NP_065813	Q7Z6B7	SRGP1_HUMAN	SLIT-ROBO Rho GTPase activating protein 1	182					axon guidance	cytosol				ovary(2)|central_nervous_system(2)	4			GBM - Glioblastoma multiforme(3;0.000139)|BRCA - Breast invasive adenocarcinoma(9;0.225)	GBM - Glioblastoma multiforme(28;0.0608)		AGAGCAAGCTGAAAGAGGCCG	0.438													6	115	---	---	---	---	PASS
IRAK3	11213	broad.mit.edu	37	12	66641781	66641781	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:66641781G>A	uc001sth.2	+	12	1723	c.1621G>A	c.(1621-1623)GAA>AAA	p.E541K	IRAK3_uc010ssy.1_Missense_Mutation_p.E480K	NM_007199	NP_009130	Q9Y616	IRAK3_HUMAN	interleukin-1 receptor-associated kinase 3	541					interleukin-1-mediated signaling pathway|MyD88-dependent toll-like receptor signaling pathway|negative regulation of innate immune response|negative regulation of interleukin-12 production|negative regulation of interleukin-6 production|negative regulation of macrophage cytokine production|negative regulation of MAP kinase activity|negative regulation of NF-kappaB transcription factor activity|negative regulation of protein catabolic process|negative regulation of protein complex disassembly|negative regulation of toll-like receptor signaling pathway|negative regulation of tumor necrosis factor production|positive regulation of macrophage tolerance induction|positive regulation of NF-kappaB transcription factor activity|response to exogenous dsRNA|response to lipopolysaccharide|response to peptidoglycan	cytoplasm|nucleus	ATP binding|magnesium ion binding|protein heterodimerization activity|protein homodimerization activity|protein serine/threonine kinase activity			lung(3)|ovary(2)|breast(2)|central_nervous_system(1)	8				GBM - Glioblastoma multiforme(28;0.0203)		TTCTTGTGAAGAAAGTTGGTT	0.443													19	384	---	---	---	---	PASS
MDM1	56890	broad.mit.edu	37	12	68719288	68719288	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:68719288G>C	uc001stz.2	-	4	702	c.566C>G	c.(565-567)TCT>TGT	p.S189C	MDM1_uc010stc.1_Intron|MDM1_uc009zqv.1_5'UTR|MDM1_uc001sua.3_3'UTR|MDM1_uc010std.1_3'UTR	NM_017440	NP_059136	Q8TC05	MDM1_HUMAN	mouse Mdm1 nuclear protein homolog isoform 1	189						nucleus				ovary(3)|skin(2)	5			Lung(24;0.000131)|LUAD - Lung adenocarcinoma(15;0.00107)|STAD - Stomach adenocarcinoma(21;0.018)	GBM - Glioblastoma multiforme(7;0.000174)		TTGATATTCAGAATTTCTCAA	0.368													56	302	---	---	---	---	PASS
KCNMB4	27345	broad.mit.edu	37	12	70794109	70794109	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:70794109C>T	uc001svx.2	+	2	910	c.457C>T	c.(457-459)CAT>TAT	p.H153Y		NM_014505	NP_055320	Q86W47	KCMB4_HUMAN	calcium-activated potassium channel beta 4	153	Extracellular (Potential).				detection of calcium ion|platelet activation|regulation of action potential in neuron|regulation of neurotransmitter secretion|regulation of vasoconstriction|synaptic transmission	voltage-gated potassium channel complex	calcium-activated potassium channel activity|protein binding				0	Renal(347;0.236)		Lung(24;0.000636)|OV - Ovarian serous cystadenocarcinoma(12;0.00243)|STAD - Stomach adenocarcinoma(21;0.0118)			TTTTAATCAACATCAAAGGTA	0.358													42	263	---	---	---	---	PASS
PTPRR	5801	broad.mit.edu	37	12	71155346	71155346	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:71155346C>G	uc001swi.1	-	4	948	c.532G>C	c.(532-534)GAT>CAT	p.D178H	PTPRR_uc010stq.1_Missense_Mutation_p.D66H	NM_002849	NP_002840	Q15256	PTPRR_HUMAN	protein tyrosine phosphatase, receptor type, R	178	Extracellular (Potential).				in utero embryonic development	cell surface|Golgi apparatus|integral to membrane|nucleus|perinuclear region of cytoplasm|plasma membrane	protein kinase binding|transmembrane receptor protein tyrosine phosphatase activity			skin(2)|ovary(1)	3			GBM - Glioblastoma multiforme(2;5.67e-07)|Lung(24;0.00283)|OV - Ovarian serous cystadenocarcinoma(12;0.00578)|LUSC - Lung squamous cell carcinoma(43;0.132)	COAD - Colon adenocarcinoma(1;0.136)		GGCAGAGCATCAGAAATTCCT	0.353													38	244	---	---	---	---	PASS
GLIPR1L2	144321	broad.mit.edu	37	12	75804346	75804346	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:75804346G>A	uc001sxr.1	+	2	375	c.367G>A	c.(367-369)GGC>AGC	p.G123S	GLIPR1L2_uc001sxp.1_Missense_Mutation_p.G123S|GLIPR1L2_uc001sxq.1_Missense_Mutation_p.G16S	NM_152436	NP_689649	Q4G1C9	GRPL2_HUMAN	GLI pathogenesis-related 1 like 2	123						integral to membrane				ovary(1)	1						TATGTGGGTCGGCCCTGAAAA	0.353													42	102	---	---	---	---	PASS
NAV3	89795	broad.mit.edu	37	12	78400273	78400273	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:78400273C>T	uc001syp.2	+	8	1128	c.955C>T	c.(955-957)CCT>TCT	p.P319S	NAV3_uc001syo.2_Missense_Mutation_p.P319S	NM_014903	NP_055718	Q8IVL0	NAV3_HUMAN	neuron navigator 3	319						nuclear outer membrane	ATP binding|nucleoside-triphosphatase activity			large_intestine(6)|ovary(5)|lung(2)|breast(1)|skin(1)|kidney(1)|pancreas(1)	17						TGGGCAGCCTCCTGCCTCTGC	0.507										HNSCC(70;0.22)			16	90	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	12	80647250	80647250	+	IGR	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:80647250C>T								PPP1R12A (318015 upstream) : PTPRQ (190876 downstream)																							AATTAGGCCTCGTAATGGACA	0.284													10	85	---	---	---	---	PASS
PPFIA2	8499	broad.mit.edu	37	12	81675160	81675160	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:81675160G>C	uc001szo.1	-	27	3249	c.3088C>G	c.(3088-3090)CCC>GCC	p.P1030A	PPFIA2_uc010sue.1_Intron|PPFIA2_uc010sug.1_RNA|PPFIA2_uc010suh.1_RNA|PPFIA2_uc010sui.1_RNA|PPFIA2_uc010suj.1_RNA|PPFIA2_uc009zsi.1_RNA|PPFIA2_uc010suf.1_RNA|PPFIA2_uc009zsh.2_RNA	NM_003625	NP_003616	B7Z663	B7Z663_HUMAN	PTPRF interacting protein alpha 2	929										ovary(3)|lung(2)|pancreas(1)	6						CCCAAGCTGGGAAGCCATTCA	0.393													6	151	---	---	---	---	PASS
NEDD1	121441	broad.mit.edu	37	12	97313913	97313913	+	Intron	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:97313913G>T	uc001teu.3	+						NEDD1_uc001tev.3_Intron|NEDD1_uc010svc.1_Intron|NEDD1_uc001tew.2_Intron|NEDD1_uc001tex.2_Intron	NM_152905	NP_690869	Q8NHV4	NEDD1_HUMAN	neural precursor cell expressed, developmentally						cell division|G2/M transition of mitotic cell cycle|mitosis	cytosol					0						GGTACAGTATGAGTTTATTCA	0.318													41	101	---	---	---	---	PASS
UHRF1BP1L	23074	broad.mit.edu	37	12	100452393	100452393	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100452393C>T	uc001tgq.2	-	14	2891	c.2662G>A	c.(2662-2664)GAA>AAA	p.E888K	UHRF1BP1L_uc001tgp.2_Missense_Mutation_p.E538K	NM_015054	NP_055869	A0JNW5	UH1BL_HUMAN	UHRF1 (ICBP90) binding protein 1-like isoform a	888										ovary(2)	2						CTCACACTTTCAGAAACAGGA	0.363													13	144	---	---	---	---	PASS
SCYL2	55681	broad.mit.edu	37	12	100732771	100732771	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100732771C>A	uc001thn.2	+	18	2661	c.2611C>A	c.(2611-2613)CCT>ACT	p.P871T		NM_017988	NP_060458	Q6P3W7	SCYL2_HUMAN	SCY1-like 2 protein	871	Necessary for interaction with AP2 complex and clathrin, interaction with clathrin is necessary for its targeting to the TGN and endosomal membranes.				endosome to lysosome transport|negative regulation of canonical Wnt receptor signaling pathway|positive regulation of clathrin-mediated endocytosis|positive regulation of receptor internalization	clathrin-coated vesicle|endosome membrane|Golgi apparatus|perinuclear region of cytoplasm	ATP binding|protein kinase activity|receptor binding			lung(3)|ovary(2)|skin(1)	6						GTTTGTACCTCCTCAAGGTTC	0.433													26	439	---	---	---	---	PASS
SCYL2	55681	broad.mit.edu	37	12	100732772	100732772	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100732772C>T	uc001thn.2	+	18	2662	c.2612C>T	c.(2611-2613)CCT>CTT	p.P871L		NM_017988	NP_060458	Q6P3W7	SCYL2_HUMAN	SCY1-like 2 protein	871	Necessary for interaction with AP2 complex and clathrin, interaction with clathrin is necessary for its targeting to the TGN and endosomal membranes.				endosome to lysosome transport|negative regulation of canonical Wnt receptor signaling pathway|positive regulation of clathrin-mediated endocytosis|positive regulation of receptor internalization	clathrin-coated vesicle|endosome membrane|Golgi apparatus|perinuclear region of cytoplasm	ATP binding|protein kinase activity|receptor binding			lung(3)|ovary(2)|skin(1)	6						TTTGTACCTCCTCAAGGTTCT	0.428													24	434	---	---	---	---	PASS
NR1H4	9971	broad.mit.edu	37	12	100897181	100897181	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100897181C>T	uc001tht.1	+	1	44	c.16C>T	c.(16-18)CAG>TAG	p.Q6*	NR1H4_uc001thp.1_Intron|NR1H4_uc001thq.1_Intron|NR1H4_uc010svj.1_Intron|NR1H4_uc001thr.1_Intron|NR1H4_uc010svk.1_Intron|NR1H4_uc001ths.1_Nonsense_Mutation_p.Q6*	NM_005123	NP_005114	Q96RI1	NR1H4_HUMAN	nuclear receptor subfamily 1, group H, member 4	6					bile acid metabolic process|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|thyroid hormone receptor activity|transcription coactivator activity|transcription corepressor activity|zinc ion binding			ovary(1)|lung(1)|skin(1)	3						AATGCAGTTTCAGGGGTTAGA	0.428													9	30	---	---	---	---	PASS
NR1H4	9971	broad.mit.edu	37	12	100930283	100930283	+	Intron	SNP	A	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100930283A>T	uc001tht.1	+						NR1H4_uc001thp.1_Intron|NR1H4_uc001thq.1_Intron|NR1H4_uc010svj.1_Splice_Site|NR1H4_uc001thr.1_Intron|NR1H4_uc010svk.1_Intron|NR1H4_uc001ths.1_Intron	NM_005123	NP_005114	Q96RI1	NR1H4_HUMAN	nuclear receptor subfamily 1, group H, member 4						bile acid metabolic process|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|thyroid hormone receptor activity|transcription coactivator activity|transcription corepressor activity|zinc ion binding			ovary(1)|lung(1)|skin(1)	3						TTTTCTTGCCAGTGTAGGAGA	0.348													14	29	---	---	---	---	PASS
SLC5A8	160728	broad.mit.edu	37	12	101587418	101587418	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101587418C>A	uc001thz.3	-	5	1067	c.677G>T	c.(676-678)AGA>ATA	p.R226I		NM_145913	NP_666018	Q8N695	SC5A8_HUMAN	solute carrier family 5 (iodide transporter),	226	Extracellular (Potential).				apoptosis|sodium ion transport	apical plasma membrane|integral to membrane	monocarboxylic acid transmembrane transporter activity|passive transmembrane transporter activity|symporter activity				0						GAAATTTAATCTTCCACCATC	0.353													77	191	---	---	---	---	PASS
UTP20	27340	broad.mit.edu	37	12	101684541	101684541	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101684541C>A	uc001tia.1	+	8	922	c.766C>A	c.(766-768)CCA>ACA	p.P256T	UTP20_uc009ztz.1_Missense_Mutation_p.P256T	NM_014503	NP_055318	O75691	UTP20_HUMAN	down-regulated in metastasis	256					endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|negative regulation of cell proliferation	90S preribosome|cytoplasm|nucleolus|nucleoplasm|preribosome, small subunit precursor|small-subunit processome	protein binding			ovary(2)|breast(2)	4						AAAGCTAGGACCAGTCACTGA	0.373													16	144	---	---	---	---	PASS
UTP20	27340	broad.mit.edu	37	12	101685877	101685877	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101685877G>C	uc001tia.1	+	10	1324	c.1168G>C	c.(1168-1170)GAA>CAA	p.E390Q		NM_014503	NP_055318	O75691	UTP20_HUMAN	down-regulated in metastasis	390					endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|negative regulation of cell proliferation	90S preribosome|cytoplasm|nucleolus|nucleoplasm|preribosome, small subunit precursor|small-subunit processome	protein binding			ovary(2)|breast(2)	4						AGAAACCATAGAAAAAGTAat	0.239													7	195	---	---	---	---	PASS
MYBPC1	4604	broad.mit.edu	37	12	101988866	101988866	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101988866G>T	uc001tii.2	+	1	120	c.18G>T	c.(16-18)AAG>AAT	p.K6N	MYBPC1_uc001tif.1_Missense_Mutation_p.K6N|MYBPC1_uc001tig.2_Missense_Mutation_p.K6N|MYBPC1_uc010svq.1_Missense_Mutation_p.K6N|MYBPC1_uc001tih.2_Missense_Mutation_p.K6N|MYBPC1_uc001tij.2_Missense_Mutation_p.K6N|MYBPC1_uc010svr.1_Missense_Mutation_p.K6N|MYBPC1_uc010svs.1_Missense_Mutation_p.K6N|MYBPC1_uc010svt.1_Missense_Mutation_p.K6N|MYBPC1_uc010svu.1_Missense_Mutation_p.K6N|MYBPC1_uc001tik.2_Missense_Mutation_p.K6N	NM_206820	NP_996556	Q00872	MYPC1_HUMAN	myosin binding protein C, slow type isoform 3	6					cell adhesion|muscle filament sliding	cytosol|myofibril|myosin filament	actin binding|structural constituent of muscle|titin binding			ovary(2)|liver(1)|skin(1)	4						AACCCACTAAGAAAGAGGGTA	0.373													7	78	---	---	---	---	PASS
C12orf42	374470	broad.mit.edu	37	12	103695942	103695942	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:103695942G>A	uc001tjt.2	-	6	1115	c.1027C>T	c.(1027-1029)CAT>TAT	p.H343Y	C12orf42_uc001tjs.2_Intron|C12orf42_uc009zuf.1_Missense_Mutation_p.H343Y|C12orf42_uc001tju.2_Missense_Mutation_p.H248Y	NM_198521	NP_940923	Q96LP6	CL042_HUMAN	hypothetical protein LOC374470	343										ovary(1)|central_nervous_system(1)	2						CAAACCGTATGGAAACGCCGG	0.572													58	165	---	---	---	---	PASS
TXNRD1	7296	broad.mit.edu	37	12	104721446	104721446	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104721446C>G	uc010swk.1	+	13	1561	c.1539C>G	c.(1537-1539)GTC>GTG	p.V513V	TXNRD1_uc010swl.1_Silent_p.V363V|TXNRD1_uc010swm.1_Silent_p.V415V|TXNRD1_uc010swn.1_Silent_p.V363V|TXNRD1_uc010swo.1_Silent_p.V363V|TXNRD1_uc010swp.1_Silent_p.V325V|TXNRD1_uc010swq.1_Silent_p.V413V|TXNRD1_uc001tku.2_RNA|TXNRD1_uc009zun.2_Silent_p.V429V	NM_001093771	NP_001087240	Q16881	TRXR1_HUMAN	thioredoxin reductase 1 isoform 3	513					cell redox homeostasis|cellular lipid metabolic process|electron transport chain|nucleobase, nucleoside and nucleotide interconversion|signal transduction|transport	cytosol|nucleolus	electron carrier activity|flavin adenine dinucleotide binding|NADP binding|protein disulfide oxidoreductase activity|thioredoxin-disulfide reductase activity				0						GTTCCACTGTCAAGGTGAGTG	0.478													13	85	---	---	---	---	PASS
RIC8B	55188	broad.mit.edu	37	12	107236590	107236590	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:107236590G>C	uc001tlx.2	+	5	1185	c.1060G>C	c.(1060-1062)GAC>CAC	p.D354H	RIC8B_uc001tlw.2_Missense_Mutation_p.D354H|RIC8B_uc001tly.2_Missense_Mutation_p.D314H|RIC8B_uc001tlz.2_RNA|RIC8B_uc009zur.2_RNA	NM_018157	NP_060627	Q9NVN3	RIC8B_HUMAN	resistance to inhibitors of cholinesterase 8	354					regulation of G-protein coupled receptor protein signaling pathway	cell cortex|cytosol|plasma membrane	G-protein alpha-subunit binding|guanyl-nucleotide exchange factor activity			ovary(1)	1						GAAGAGAATAGACAAGGTAAG	0.358													9	86	---	---	---	---	PASS
RPH3A	22895	broad.mit.edu	37	12	113314523	113314523	+	Silent	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:113314523A>G	uc010syl.1	+	13	1385	c.1023A>G	c.(1021-1023)GCA>GCG	p.A341A	RPH3A_uc001ttz.2_Silent_p.A341A|RPH3A_uc001tty.2_Silent_p.A337A|RPH3A_uc009zwe.1_Silent_p.A337A|RPH3A_uc010sym.1_Silent_p.A292A|RPH3A_uc001tua.2_Silent_p.A101A	NM_001143854	NP_001137326	Q9Y2J0	RP3A_HUMAN	rabphilin 3A homolog isoform 1	341	Pro-rich.				intracellular protein transport	cell junction|synaptic vesicle	Rab GTPase binding|transporter activity|zinc ion binding			ovary(3)|central_nervous_system(2)|skin(2)	7				BRCA - Breast invasive adenocarcinoma(302;0.00453)		GCTACCCAGCAGTTGGAGCCA	0.667													26	111	---	---	---	---	PASS
TBX5	6910	broad.mit.edu	37	12	114841587	114841587	+	Silent	SNP	C	T	T	rs149030937		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:114841587C>T	uc001tvo.2	-	2	612	c.117G>A	c.(115-117)CCG>CCA	p.P39P	TBX5_uc001tvp.2_Silent_p.P39P|TBX5_uc001tvq.2_Intron|TBX5_uc010syv.1_Silent_p.P39P	NM_181486	NP_852259	Q99593	TBX5_HUMAN	T-box 5 isoform 1	39				GFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFT QQ -> ALAGAHLWSLTQKTCLRFEPRARSGPPASPPGRPR SRLHPA (in Ref. 1; CAA70592).	cardiac left ventricle formation|cell migration involved in coronary vasculogenesis|cell-cell signaling|embryonic arm morphogenesis|induction of apoptosis|negative regulation of cardiac muscle cell proliferation|negative regulation of cell migration|negative regulation of epithelial to mesenchymal transition|pericardium development|positive regulation of cardioblast differentiation|positive regulation of transcription from RNA polymerase II promoter|ventricular septum development	cytoplasm|nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription factor binding			ovary(6)|pancreas(1)|skin(1)	8	Medulloblastoma(191;0.163)|all_neural(191;0.178)			BRCA - Breast invasive adenocarcinoma(302;0.0893)		GCGGGGACGACGGGGACTTGC	0.647													32	168	---	---	---	---	PASS
FBXO21	23014	broad.mit.edu	37	12	117595836	117595836	+	Silent	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:117595836T>A	uc001twk.2	-	10	1419	c.1380A>T	c.(1378-1380)CTA>CTT	p.L460L	FBXO21_uc001twj.2_Silent_p.L453L|FBXO21_uc009zwq.2_Silent_p.L393L|FBXO21_uc001twl.1_Silent_p.L73L	NM_033624	NP_296373	O94952	FBX21_HUMAN	F-box only protein 21 isoform 1	460					ubiquitin-dependent protein catabolic process	ubiquitin ligase complex	ubiquitin-protein ligase activity			kidney(1)	1	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)			BRCA - Breast invasive adenocarcinoma(302;0.0291)		GCCCCGGGTCTAGGGTTTGGA	0.527													239	548	---	---	---	---	PASS
KSR2	283455	broad.mit.edu	37	12	117963025	117963025	+	Splice_Site	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:117963025C>T	uc001two.2	-	14	1820	c.1765_splice	c.e14-1	p.N589_splice		NM_173598	NP_775869	Q6VAB6	KSR2_HUMAN	kinase suppressor of ras 2						intracellular signal transduction	cytoplasm|membrane	ATP binding|metal ion binding|protein serine/threonine kinase activity			lung(10)|central_nervous_system(2)|stomach(1)|large_intestine(1)|breast(1)	15	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)					CCTCTTCATTCTGTGGCCGGA	0.612													3	43	---	---	---	---	PASS
SCARB1	949	broad.mit.edu	37	12	125299563	125299563	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:125299563C>T	uc001ugo.3	-	3	635	c.382G>A	c.(382-384)GGC>AGC	p.G128S	SCARB1_uc001ugn.3_Missense_Mutation_p.G128S|SCARB1_uc001ugm.3_Missense_Mutation_p.G128S|SCARB1_uc010tbd.1_Missense_Mutation_p.G128S|SCARB1_uc010tbe.1_Missense_Mutation_p.G87S|SCARB1_uc001ugp.3_Missense_Mutation_p.G128S	NM_005505	NP_005496	Q8WTV0	SCRB1_HUMAN	scavenger receptor class B, member 1 isoform 1	128	Extracellular (Potential).				adhesion to symbiont|cell adhesion|cholesterol efflux|cholesterol homeostasis|cholesterol import|detection of lipopolysaccharide|high-density lipoprotein particle clearance|high-density lipoprotein particle remodeling|lipopolysaccharide transport|lipoprotein metabolic process|positive regulation of cholesterol storage|positive regulation of endothelial cell migration|positive regulation of nitric-oxide synthase activity|recognition of apoptotic cell|reverse cholesterol transport|triglyceride homeostasis|wound healing	caveola	1-phosphatidylinositol binding|apolipoprotein A-I binding|high-density lipoprotein particle receptor activity|lipopolysaccharide receptor activity|low-density lipoprotein particle binding|phosphatidylserine binding|transporter activity			kidney(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000116)|Epithelial(86;0.000415)|all cancers(50;0.00395)	Phosphatidylserine(DB00144)	CTCTCCGAGCCGTGGGACTTG	0.602													30	92	---	---	---	---	PASS
DHX37	57647	broad.mit.edu	37	12	125470744	125470744	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:125470744C>T	uc001ugy.2	-	2	273	c.174G>A	c.(172-174)AAG>AAA	p.K58K		NM_032656	NP_116045	Q8IY37	DHX37_HUMAN	DEAH (Asp-Glu-Ala-His) box polypeptide 37	58							ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding			skin(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;8.05e-05)|Epithelial(86;0.000486)|all cancers(50;0.00653)		GGGCTTTGGTCTTCTTTTTCT	0.483													17	364	---	---	---	---	PASS
ANKLE2	23141	broad.mit.edu	37	12	133327418	133327418	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:133327418C>T	uc001ukx.2	-	3	725	c.658G>A	c.(658-660)GAA>AAA	p.E220K	ANKLE2_uc001uky.3_Missense_Mutation_p.E158K	NM_015114	NP_055929	Q86XL3	ANKL2_HUMAN	ankyrin repeat and LEM domain containing 2	220						cytoplasm|integral to membrane|nuclear envelope					0	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0176)|Lung NSC(355;0.204)		OV - Ovarian serous cystadenocarcinoma(86;2.3e-08)|Epithelial(86;1.56e-07)|all cancers(50;4.94e-06)		TTTTTATTTTCATAAACATAG	0.413													28	192	---	---	---	---	PASS
PARP4	143	broad.mit.edu	37	13	25008870	25008870	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25008870G>A	uc001upl.2	-	31	4515	c.4409C>T	c.(4408-4410)TCT>TTT	p.S1470F		NM_006437	NP_006428	Q9UKK3	PARP4_HUMAN	poly (ADP-ribose) polymerase family, member 4	1470					cell death|DNA repair|inflammatory response|protein ADP-ribosylation|response to drug|transport	cytoplasm|nucleus|ribonucleoprotein complex|spindle microtubule	DNA binding|enzyme binding|NAD+ ADP-ribosyltransferase activity			ovary(3)|skin(1)	4		all_epithelial(30;7.67e-16)|Lung SC(185;0.0225)|Breast(139;0.052)		all cancers(112;0.000127)|Epithelial(112;0.000778)|Kidney(163;0.039)|OV - Ovarian serous cystadenocarcinoma(117;0.0578)|KIRC - Kidney renal clear cell carcinoma(186;0.135)|Lung(94;0.195)		GGCAGTCAAAGAGGCTGCGGA	0.493													8	48	---	---	---	---	PASS
MYCBP2	23077	broad.mit.edu	37	13	77636830	77636830	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:77636830G>A	uc001vkf.2	-	75	12652	c.12561C>T	c.(12559-12561)CTC>CTT	p.L4187L	MYCBP2_uc010aev.2_Silent_p.L3591L|MYCBP2_uc001vke.2_Silent_p.L804L	NM_015057	NP_055872	O75592	MYCB2_HUMAN	MYC binding protein 2	4187					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ligase activity|protein binding|zinc ion binding			ovary(4)|breast(4)|skin(3)|lung(2)|pancreas(1)	14		Breast(118;0.212)|Acute lymphoblastic leukemia(28;0.22)		GBM - Glioblastoma multiforme(99;0.109)		GAGCAAGCCAGAGCTGTTGAA	0.458													6	89	---	---	---	---	PASS
NDFIP2	54602	broad.mit.edu	37	13	80117783	80117783	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:80117783G>T	uc001vlf.2	+	5	886	c.806G>T	c.(805-807)GGC>GTC	p.G269V	NDFIP2_uc010tib.1_Missense_Mutation_p.G249V|NDFIP2_uc001vlg.2_Intron	NM_019080	NP_061953	Q9NV92	NFIP2_HUMAN	Nedd4 family interacting protein 2 isoform 1	269	Helical; (Potential).				negative regulation of gene expression|negative regulation of protein transport|negative regulation of transporter activity|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of protein ubiquitination	endoplasmic reticulum|Golgi membrane|integral to membrane|mitochondrion|multivesicular body membrane|perinuclear region of cytoplasm	signal transducer activity|WW domain binding			ovary(1)	1		Acute lymphoblastic leukemia(28;0.205)		GBM - Glioblastoma multiforme(99;0.0196)		TGCGGATTTGGCCTTTCCTTG	0.383													58	150	---	---	---	---	PASS
SLITRK5	26050	broad.mit.edu	37	13	88329220	88329220	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:88329220C>G	uc001vln.2	+	2	1796	c.1577C>G	c.(1576-1578)TCT>TGT	p.S526C	SLITRK5_uc010tic.1_Missense_Mutation_p.S285C	NM_015567	NP_056382	O94991	SLIK5_HUMAN	SLIT and NTRK-like family, member 5 precursor	526	Extracellular (Potential).|LRR 11.					integral to membrane				ovary(2)|pancreas(2)|central_nervous_system(1)	5	all_neural(89;0.101)|Medulloblastoma(90;0.163)					GGCGTCTTCTCTGGCTTGACC	0.527													21	252	---	---	---	---	PASS
UGGT2	55757	broad.mit.edu	37	13	96592233	96592233	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:96592233G>C	uc001vmt.2	-	16	1960	c.1790C>G	c.(1789-1791)TCT>TGT	p.S597C		NM_020121	NP_064506	Q9NYU1	UGGG2_HUMAN	UDP-glucose ceramide glucosyltransferase-like 2	597					post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine	endoplasmic reticulum lumen|ER-Golgi intermediate compartment	UDP-glucose:glycoprotein glucosyltransferase activity			ovary(2)|central_nervous_system(1)	3						ATCATATTTAGAATGAATTCC	0.214													7	67	---	---	---	---	PASS
OXGR1	27199	broad.mit.edu	37	13	97639159	97639159	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:97639159G>A	uc001vmx.1	-	4	1099	c.855C>T	c.(853-855)ATC>ATT	p.I285I	OXGR1_uc010afr.1_Silent_p.I285I	NM_080818	NP_543008	Q96P68	OXGR1_HUMAN	oxoglutarate (alpha-ketoglutarate) receptor 1	285	Helical; Name=7; (Potential).					integral to membrane|plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			ovary(1)|skin(1)	2	all_neural(89;0.0982)|Medulloblastoma(90;0.163)		BRCA - Breast invasive adenocarcinoma(86;0.186)			GTCTAGAAACGATGTAAGCTT	0.433													32	169	---	---	---	---	PASS
FARP1	10160	broad.mit.edu	37	13	99092981	99092981	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:99092981C>T	uc001vnj.2	+	24	3023	c.2687C>T	c.(2686-2688)TCG>TTG	p.S896L	FARP1_uc001vnh.2_Missense_Mutation_p.S927L	NM_005766	NP_005757	Q9Y4F1	FARP1_HUMAN	FERM, RhoGEF, and pleckstrin domain protein 1	896					regulation of Rho protein signal transduction	cytoplasm|cytoskeleton|extrinsic to membrane	cytoskeletal protein binding|Rho guanyl-nucleotide exchange factor activity			breast(2)	2	all_neural(89;0.0982)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)		BRCA - Breast invasive adenocarcinoma(86;0.233)			CTGAGCGCCTCGCGCACATCG	0.627													8	160	---	---	---	---	PASS
GRTP1	79774	broad.mit.edu	37	13	114005155	114005155	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:114005155G>A	uc001vtn.2	-						GRTP1_uc010tkb.1_Intron|GRTP1_uc010tkc.1_Intron	NM_024719	NP_078995	Q5TC63	GRTP1_HUMAN	growth hormone regulated TBC protein 1							intracellular	Rab GTPase activator activity				0	Lung NSC(43;0.0161)|all_neural(89;0.0337)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)|Lung SC(71;0.218)	all_cancers(25;0.0314)|all_epithelial(44;0.011)|all_lung(25;0.0271)|Lung NSC(25;0.0978)|Breast(118;0.188)	all cancers(43;0.025)|GBM - Glioblastoma multiforme(44;0.206)|Epithelial(84;0.246)			AGAGGGTCCCGAGGCTCACCT	0.602													22	385	---	---	---	---	PASS
TMCO3	55002	broad.mit.edu	37	13	114193756	114193756	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:114193756G>A	uc001vtu.3	+	10	1985	c.1624G>A	c.(1624-1626)GAG>AAG	p.E542K		NM_017905	NP_060375	Q6UWJ1	TMCO3_HUMAN	transmembrane and coiled-coil domains 3	542						integral to membrane	solute:hydrogen antiporter activity				0	Lung NSC(43;0.0161)|all_neural(89;0.0337)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)|Lung SC(71;0.218)	all_cancers(25;0.0145)|all_epithelial(44;0.00286)|all_lung(25;0.0273)|Breast(118;0.0411)|Lung NSC(25;0.0983)	all cancers(43;0.0317)			CGTGGTCACCGAGGAGATCGC	0.577													30	153	---	---	---	---	PASS
PARP2	10038	broad.mit.edu	37	14	20825306	20825306	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20825306G>A	uc001vxc.2	+	14	1493	c.1465G>A	c.(1465-1467)GAG>AAG	p.E489K	PARP2_uc001vxd.2_Missense_Mutation_p.E476K|PARP2_uc001vxb.1_Missense_Mutation_p.E489K|PARP2_uc010tle.1_Missense_Mutation_p.E239K	NM_005484	NP_005475	Q9UGN5	PARP2_HUMAN	poly (ADP-ribose) polymerase family, member 2	489	PARP catalytic.				protein ADP-ribosylation	nucleolus|nucleoplasm	DNA binding|NAD+ ADP-ribosyltransferase activity			ovary(1)|pancreas(1)	2	all_cancers(95;0.00092)	all_lung(585;0.235)	Epithelial(56;5.34e-07)|all cancers(55;3.7e-06)	GBM - Glioblastoma multiforme(265;0.00888)|READ - Rectum adenocarcinoma(17;0.0649)		GCTCTTATCAGAGGTGAGACA	0.423								Direct_reversal_of_damage|PARP_enzymes_that_bind_to_DNA					33	92	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	14	22573951	22573951	+	Intron	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:22573951G>T	uc001wbw.2	+						uc010aiv.1_Intron|uc010tmi.1_Intron|uc010tmj.1_Intron|uc010aja.1_Intron|uc010tmk.1_Intron|uc010tmo.1_Intron|uc001wco.2_Intron|uc010aje.1_Intron|uc001wcp.2_Intron|uc001wcr.1_Intron|uc001wcs.1_Intron|uc010ajf.1_Intron|uc010ajg.1_Intron|uc001wcx.3_Intron|uc001wdb.2_Missense_Mutation_p.W57C					SubName: Full=Alpha-chain C region; Flags: Fragment;																		CCTTACACTGGTACAGATGGG	0.448													10	11	---	---	---	---	PASS
NOVA1	4857	broad.mit.edu	37	14	26917321	26917321	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:26917321C>A	uc001wpy.2	-	5	1686	c.1368G>T	c.(1366-1368)CAG>CAT	p.Q456H	NOVA1_uc001wpz.2_Missense_Mutation_p.Q432H|NOVA1_uc001wqa.2_Missense_Mutation_p.Q334H	NM_002515	NP_002506	P51513	NOVA1_HUMAN	neuro-oncological ventral antigen 1 isoform 1	459	KH 3.				locomotory behavior|RNA splicing|synaptic transmission	nucleus	RNA binding			skin(2)|upper_aerodigestive_tract(1)|breast(1)|liver(1)	5				GBM - Glioblastoma multiforme(265;0.0135)		TTTTGGAGATCTGTATCCTTG	0.428													31	44	---	---	---	---	PASS
AKAP6	9472	broad.mit.edu	37	14	33014486	33014486	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:33014486C>G	uc001wrq.2	+	4	797	c.627C>G	c.(625-627)ATC>ATG	p.I209M	AKAP6_uc010aml.2_Missense_Mutation_p.I206M	NM_004274	NP_004265	Q13023	AKAP6_HUMAN	A-kinase anchor protein 6	209					protein targeting	calcium channel complex|nuclear membrane|sarcoplasmic reticulum	protein kinase A binding|receptor binding			breast(6)|ovary(5)|lung(4)|skin(3)|large_intestine(2)|pancreas(1)	21	Breast(36;0.0388)|Prostate(35;0.15)		LUAD - Lung adenocarcinoma(48;0.00107)|Lung(238;0.00677)|STAD - Stomach adenocarcinoma(7;0.116)	GBM - Glioblastoma multiforme(265;0.019)		AATTAACCATCAAATGTTCTC	0.423													36	164	---	---	---	---	PASS
AKAP6	9472	broad.mit.edu	37	14	33014756	33014756	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:33014756C>T	uc001wrq.2	+	4	1067	c.897C>T	c.(895-897)CTC>CTT	p.L299L	AKAP6_uc010aml.2_Silent_p.L296L	NM_004274	NP_004265	Q13023	AKAP6_HUMAN	A-kinase anchor protein 6	299					protein targeting	calcium channel complex|nuclear membrane|sarcoplasmic reticulum	protein kinase A binding|receptor binding			breast(6)|ovary(5)|lung(4)|skin(3)|large_intestine(2)|pancreas(1)	21	Breast(36;0.0388)|Prostate(35;0.15)		LUAD - Lung adenocarcinoma(48;0.00107)|Lung(238;0.00677)|STAD - Stomach adenocarcinoma(7;0.116)	GBM - Glioblastoma multiforme(265;0.019)		AAGTATCTCTCTCAGTAGACG	0.478													6	141	---	---	---	---	PASS
BAZ1A	11177	broad.mit.edu	37	14	35262092	35262092	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:35262092C>T	uc001wsk.2	-	12	1967	c.1399G>A	c.(1399-1401)GAA>AAA	p.E467K	BAZ1A_uc001wsl.2_Missense_Mutation_p.E467K	NM_013448	NP_038476	Q9NRL2	BAZ1A_HUMAN	bromodomain adjacent to zinc finger domain, 1A	467	DDT.				chromatin remodeling|regulation of transcription, DNA-dependent|transcription, DNA-dependent	ACF complex	zinc ion binding			lung(2)|central_nervous_system(2)|ovary(1)|breast(1)|skin(1)	7	Breast(36;0.0388)|Hepatocellular(127;0.158)		LUAD - Lung adenocarcinoma(48;7.23e-05)|Lung(238;0.00019)|Epithelial(34;0.0793)|all cancers(34;0.175)	GBM - Glioblastoma multiforme(112;0.0659)		AGTGGGCCTTCACTGTCATTT	0.378													27	90	---	---	---	---	PASS
LRFN5	145581	broad.mit.edu	37	14	42356068	42356068	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:42356068G>T	uc001wvm.2	+	3	1438	c.240G>T	c.(238-240)CTG>CTT	p.L80L	LRFN5_uc010ana.2_Silent_p.L80L	NM_152447	NP_689660	Q96NI6	LRFN5_HUMAN	leucine rich repeat and fibronectin type III	80	Extracellular (Potential).|LRR 2.					integral to membrane				ovary(5)|pancreas(2)|central_nervous_system(1)	8			LUAD - Lung adenocarcinoma(50;0.0223)|Lung(238;0.0728)	GBM - Glioblastoma multiforme(112;0.00847)		TGGTGGACCTGACTCTATCCA	0.378										HNSCC(30;0.082)			31	59	---	---	---	---	PASS
NID2	22795	broad.mit.edu	37	14	52526897	52526897	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52526897C>G	uc001wzo.2	-	3	946	c.712G>C	c.(712-714)GAA>CAA	p.E238Q	NID2_uc010tqs.1_Missense_Mutation_p.E238Q|NID2_uc010tqt.1_Missense_Mutation_p.E238Q|NID2_uc001wzp.2_Missense_Mutation_p.E238Q	NM_007361	NP_031387	Q14112	NID2_HUMAN	nidogen 2 precursor	238	NIDO.					basement membrane	calcium ion binding|collagen binding			pancreas(2)|breast(2)|ovary(1)|liver(1)|skin(1)	7	Breast(41;0.0639)|all_epithelial(31;0.123)					TATGGTCCTTCTGACTTCAGA	0.473													8	84	---	---	---	---	PASS
PLEKHG3	26030	broad.mit.edu	37	14	65198834	65198834	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:65198834C>T	uc001xho.1	+	10	1416	c.1147C>T	c.(1147-1149)CGG>TGG	p.R383W	PLEKHG3_uc001xhn.1_Missense_Mutation_p.R327W|PLEKHG3_uc001xhp.2_Missense_Mutation_p.R383W|PLEKHG3_uc010aqh.1_Translation_Start_Site	NM_015549	NP_056364	A1L390	PKHG3_HUMAN	pleckstrin homology domain containing, family G,	383	PH.				regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			skin(1)	1				all cancers(60;0.00802)|OV - Ovarian serous cystadenocarcinoma(108;0.0109)|BRCA - Breast invasive adenocarcinoma(234;0.0485)		GGAGGAGAAACGGAACTGGAC	0.557													14	152	---	---	---	---	PASS
MPP5	64398	broad.mit.edu	37	14	67787014	67787014	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:67787014G>A	uc001xjc.2	+	12	1903	c.1437G>A	c.(1435-1437)AAG>AAA	p.K479K	MPP5_uc001xjd.2_Silent_p.K445K|ATP6V1D_uc001xje.2_Intron	NM_022474	NP_071919	Q8N3R9	MPP5_HUMAN	membrane protein, palmitoylated 5	479	Guanylate kinase-like.				tight junction assembly	cytoplasm|endomembrane system|tight junction	protein domain specific binding			ovary(1)	1				all cancers(60;0.000388)|OV - Ovarian serous cystadenocarcinoma(108;0.00762)|BRCA - Breast invasive adenocarcinoma(234;0.0106)		CAAATAGGAAGAGACCTATCA	0.413													32	129	---	---	---	---	PASS
MAP3K9	4293	broad.mit.edu	37	14	71227771	71227771	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:71227771C>T	uc001xmm.2	-	3	949	c.949G>A	c.(949-951)GCA>ACA	p.A317T	MAP3K9_uc010ttk.1_Missense_Mutation_p.A54T|MAP3K9_uc001xmk.2_Missense_Mutation_p.A11T|MAP3K9_uc001xml.2_Missense_Mutation_p.A317T	NM_033141	NP_149132	P80192	M3K9_HUMAN	mitogen-activated protein kinase kinase kinase	317	Protein kinase.				activation of JUN kinase activity|protein autophosphorylation		ATP binding|JUN kinase kinase kinase activity|MAP kinase kinase activity|protein homodimerization activity			stomach(2)|lung(1)|central_nervous_system(1)|skin(1)	5				all cancers(60;0.00779)|BRCA - Breast invasive adenocarcinoma(234;0.00884)|OV - Ovarian serous cystadenocarcinoma(108;0.08)		ACTTCGGGTGCCATCCAAGCA	0.552													43	90	---	---	---	---	PASS
C14orf4	64207	broad.mit.edu	37	14	77492740	77492740	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77492740G>T	uc001xsy.2	-	1	2295	c.1396C>A	c.(1396-1398)CAC>AAC	p.H466N		NM_024496	NP_078772	Q9H1B7	I2BPL_HUMAN	chromosome 14 open reading frame 4	466						nucleus					0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.00347)|KIRC - Kidney renal clear cell carcinoma(182;0.0878)		CCGGAGCCGTGCTTCTTTTCG	0.627													5	59	---	---	---	---	PASS
C14orf174	161394	broad.mit.edu	37	14	77845400	77845400	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77845400C>G	uc001xtq.1	+	1	1639	c.1639C>G	c.(1639-1641)CCA>GCA	p.P547A	TMED8_uc010ast.1_5'Flank|TMED8_uc001xto.1_5'Flank	NM_001010860	NP_001010860	Q9P1V8	SAM15_HUMAN	hypothetical protein LOC161394	547	SAM.										0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0278)		TAATTGGGATCCAGAGGAAGT	0.423													26	146	---	---	---	---	PASS
TSHR	7253	broad.mit.edu	37	14	81610460	81610460	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:81610460G>C	uc001xvd.1	+	10	2214	c.2058G>C	c.(2056-2058)CAG>CAC	p.Q686H		NM_000369	NP_000360	P16473	TSHR_HUMAN	thyroid stimulating hormone receptor isoform 1	686	Cytoplasmic (Potential).				cell-cell signaling|positive regulation of cell proliferation	integral to plasma membrane	protein binding|thyroid-stimulating hormone receptor activity			thyroid(289)|ovary(5)|lung(3)|kidney(1)|skin(1)	299				BRCA - Breast invasive adenocarcinoma(234;0.0402)	Thyrotropin Alfa(DB00024)	AGGCCTTCCAGAGGGATGTGT	0.478			Mis		toxic thyroid adenoma	thyroid  adenoma	Hereditary nonautoimmune hyperthyroidism; subclinical hypothyroidism 						25	383	---	---	---	---	PASS
CPSF2	53981	broad.mit.edu	37	14	92624038	92624038	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:92624038C>T	uc001yah.1	+	13	1868	c.1631C>T	c.(1630-1632)TCT>TTT	p.S544F		NM_017437	NP_059133	Q9P2I0	CPSF2_HUMAN	cleavage and polyadenylation specific factor 2	544					histone mRNA 3'-end processing|mRNA export from nucleus|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	mRNA cleavage and polyadenylation specificity factor complex	hydrolase activity|protein binding|RNA binding			ovary(2)	2		all_cancers(154;0.0766)		COAD - Colon adenocarcinoma(157;0.222)		GAAGGACGCTCTGATGGGGAT	0.393													11	43	---	---	---	---	PASS
DICER1	23405	broad.mit.edu	37	14	95557681	95557681	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95557681C>T	uc001ydw.2	-	26	5568	c.5386G>A	c.(5386-5388)GAA>AAA	p.E1796K	DICER1_uc010avh.1_Missense_Mutation_p.E694K|DICER1_uc001ydv.2_Missense_Mutation_p.E1786K|DICER1_uc001ydx.2_Missense_Mutation_p.E1796K	NM_030621	NP_085124	Q9UPY3	DICER_HUMAN	dicer1	1796	RNase III 2.				negative regulation of Schwann cell proliferation|negative regulation of transcription from RNA polymerase II promoter|nerve development|neuron projection morphogenesis|peripheral nervous system myelin formation|positive regulation of myelination|positive regulation of Schwann cell differentiation|pre-miRNA processing|production of siRNA involved in RNA interference|targeting of mRNA for destruction involved in RNA interference	cytosol|RNA-induced silencing complex	ATP binding|ATP-dependent helicase activity|double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity			skin(2)|ovary(1)|pancreas(1)|lung(1)	5		all_cancers(154;0.0621)|all_epithelial(191;0.223)		Epithelial(152;0.211)|COAD - Colon adenocarcinoma(157;0.215)		TCTTTCTCTTCATCCTCCTCA	0.438			Mis F|N			pleuropulmonary blastoma			DICER_1_syndrome_|Familial_Multinodular_Goiter_				21	266	---	---	---	---	PASS
SETD3	84193	broad.mit.edu	37	14	99872906	99872906	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:99872906C>T	uc001ygc.2	-	9	1041	c.871G>A	c.(871-873)GAA>AAA	p.E291K		NM_032233	NP_115609	Q86TU7	SETD3_HUMAN	SET domain containing 3 isoform a	291	SET.				peptidyl-lysine dimethylation|peptidyl-lysine monomethylation|peptidyl-lysine trimethylation|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	histone methyltransferase activity (H3-K36 specific)|transcription coactivator activity				0		all_cancers(154;0.224)|all_epithelial(191;0.0644)|Melanoma(154;0.0866)				CGGTCATCTTCCAGGTTGTAA	0.532													20	78	---	---	---	---	PASS
OR4M2	390538	broad.mit.edu	37	15	22368834	22368834	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22368834G>T	uc010tzu.1	+	1	259	c.259G>T	c.(259-261)GTG>TTG	p.V87L	LOC727924_uc001yua.2_RNA|LOC727924_uc001yub.1_Intron|OR4N4_uc001yuc.1_Intron	NM_001004719	NP_001004719	Q8NGB6	OR4M2_HUMAN	olfactory receptor, family 4, subfamily M,	87	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		all_cancers(20;1.94e-20)|all_epithelial(15;3.94e-18)|Lung NSC(15;8.53e-15)|all_lung(15;2.87e-14)|Breast(32;0.00519)|Colorectal(260;0.101)	GBM - Glioblastoma multiforme(6;0.124)	all cancers(64;1.64e-11)|Epithelial(43;5.81e-10)|BRCA - Breast invasive adenocarcinoma(123;0.000255)|Kidney(6;0.00736)|KIRC - Kidney renal clear cell carcinoma(6;0.0135)|GBM - Glioblastoma multiforme(186;0.0963)		AGACTTCTTTGTGGAGAGGAA	0.438													138	652	---	---	---	---	PASS
TUBGCP5	114791	broad.mit.edu	37	15	22840318	22840318	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22840318G>A	uc001yur.3	+	4	514	c.384G>A	c.(382-384)GAG>GAA	p.E128E	TUBGCP5_uc001yuq.2_Silent_p.E128E	NM_052903	NP_443135	Q96RT8	GCP5_HUMAN	tubulin, gamma complex associated protein 5	128					G2/M transition of mitotic cell cycle|microtubule nucleation	centrosome|cytosol|gamma-tubulin ring complex|microtubule|spindle pole	microtubule binding			skin(1)	1		all_cancers(20;2.26e-25)|all_epithelial(15;2.1e-22)|Lung NSC(15;3.36e-17)|all_lung(15;1.04e-16)|Breast(32;0.000776)|Colorectal(260;0.0488)		all cancers(64;2.86e-06)|Epithelial(43;2.63e-05)|BRCA - Breast invasive adenocarcinoma(123;0.000949)		GTTATGTGGAGACACCAAGAA	0.328													20	149	---	---	---	---	PASS
SNORD116-4	100033416	broad.mit.edu	37	15	25335078	25335078	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25335078G>A	uc001yxh.1	+						SNORD116-4_uc001yxm.1_Intron|IPW_uc001yxn.3_RNA|SNORD116-28_uc001yxy.2_Intron|IPW_uc001yyb.3_Intron|uc001yyd.2_Intron|SNORD116-22_uc001yyg.1_RNA|SNORD116-23_uc001yyh.2_5'Flank					Homo sapiens clone kid4 SNURF-SNRPN mRNA, downstream untranslated exons, alternatively spliced.												0						CTGGATCGATGATGACTTCCA	0.458													20	386	---	---	---	---	PASS
SNORD115-13	100033450	broad.mit.edu	37	15	25440076	25440076	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25440076G>A	uc001yzf.1	+						SNORD115-14_uc001yzj.1_RNA|PAR4_uc001yzk.1_5'Flank|PAR4_uc010ayo.1_5'Flank					Homo sapiens clone Rt-11 SNURF-SNRPN mRNA, downstream untranslated exons, alternatively spliced.												0						TTGGGTCGATGATGAGAAACT	0.522													68	809	---	---	---	---	PASS
OCA2	4948	broad.mit.edu	37	15	28273169	28273169	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28273169G>A	uc001zbh.3	-	4	473	c.363C>T	c.(361-363)ATC>ATT	p.I121I	OCA2_uc010ayv.2_Silent_p.I121I	NM_000275	NP_000266	Q04671	P_HUMAN	oculocutaneous albinism II	121	Cytoplasmic (Potential).				eye pigment biosynthetic process	endoplasmic reticulum membrane|endosome membrane|integral to membrane|lysosomal membrane|melanosome membrane	arsenite transmembrane transporter activity|citrate transmembrane transporter activity|L-tyrosine transmembrane transporter activity|protein binding			ovary(3)|breast(1)|pancreas(1)	5		all_lung(180;2.93e-12)|Breast(32;0.000315)|Colorectal(260;0.234)		all cancers(64;5.03e-07)|Epithelial(43;2.13e-06)|BRCA - Breast invasive adenocarcinoma(123;0.045)		CTTCAGCAGTGATGAACTCTG	0.507									Oculocutaneous_Albinism				56	477	---	---	---	---	PASS
HERC2	8924	broad.mit.edu	37	15	28380616	28380616	+	Intron	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28380616C>A	uc001zbj.2	-							NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2						DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)		AATTTTTTCACATCATACCTT	0.393													61	216	---	---	---	---	PASS
HERC2	8924	broad.mit.edu	37	15	28380617	28380617	+	Intron	SNP	A	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28380617A>T	uc001zbj.2	-							NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2						DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)		ATTTTTTCACATCATACCTTC	0.398													63	218	---	---	---	---	PASS
HERC2	8924	broad.mit.edu	37	15	28460911	28460911	+	Silent	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28460911C>G	uc001zbj.2	-	39	6172	c.6066G>C	c.(6064-6066)CGG>CGC	p.R2022R		NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2	2022					DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)		TGCACCAGCTCCGGTGTTGCT	0.562													11	105	---	---	---	---	PASS
EXD1	161829	broad.mit.edu	37	15	41476221	41476221	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41476221G>C	uc001znk.2	-	10	1644	c.1453C>G	c.(1453-1455)CCT>GCT	p.P485A	EXD1_uc001znj.2_Missense_Mutation_p.P283A|EXD1_uc010ucv.1_Missense_Mutation_p.P543A	NM_152596	NP_689809	Q8NHP7	EXD1_HUMAN	exonuclease 3'-5' domain containing 1	485					nucleobase, nucleoside, nucleotide and nucleic acid metabolic process	intracellular	3'-5' exonuclease activity|nucleic acid binding			ovary(1)	1						TTTCTGATAGGATAAAAAGTG	0.443													11	266	---	---	---	---	PASS
RPAP1	26015	broad.mit.edu	37	15	41822154	41822154	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41822154G>A	uc001zod.2	-	8	1091	c.967C>T	c.(967-969)CAG>TAG	p.Q323*		NM_015540	NP_056355	Q9BWH6	RPAP1_HUMAN	RNA polymerase II associated protein 1	323						nucleus	DNA binding|DNA-directed RNA polymerase activity			large_intestine(1)	1		all_cancers(109;6.59e-20)|all_epithelial(112;7.67e-17)|Lung NSC(122;5.34e-11)|all_lung(180;4.17e-10)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.173)		OV - Ovarian serous cystadenocarcinoma(18;2.84e-17)|GBM - Glioblastoma multiforme(113;1.68e-06)|Colorectal(105;0.0163)|BRCA - Breast invasive adenocarcinoma(123;0.117)		CATTCTTTCTGAGGGGTCACG	0.592													6	97	---	---	---	---	PASS
JMJD7-PLA2G4B	8681	broad.mit.edu	37	15	42137191	42137191	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42137191G>A	uc010bco.2	+	13	1263	c.1162G>A	c.(1162-1164)GAG>AAG	p.E388K	JMJD7-PLA2G4B_uc001zoo.3_Missense_Mutation_p.E619K|JMJD7-PLA2G4B_uc010bcn.2_Missense_Mutation_p.E619K|JMJD7-PLA2G4B_uc001zoq.3_Missense_Mutation_p.E89K|JMJD7-PLA2G4B_uc001zor.1_Missense_Mutation_p.E89K	NM_001114633	NP_001108105	P0C869	PA24B_HUMAN	phospholipase A2, group IVB	388	PLA2c.				arachidonic acid metabolic process|calcium-mediated signaling|glycerophospholipid catabolic process|inflammatory response|parturition	cytosol|early endosome membrane|extracellular region|mitochondrial membrane	calcium ion binding|calcium-dependent phospholipase A2 activity|calcium-dependent phospholipid binding|lysophospholipase activity			large_intestine(1)	1						GGAGCTGGCCGAGCGTGCCCG	0.572													5	21	---	---	---	---	PASS
TRIM69	140691	broad.mit.edu	37	15	45047286	45047286	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45047286C>G	uc001zuf.2	+	3	1090	c.195C>G	c.(193-195)ATC>ATG	p.I65M	TRIM69_uc001zui.1_Intron|TRIM69_uc010bdy.1_Intron|TRIM69_uc001zug.1_Missense_Mutation_p.I65M|TRIM69_uc001zuh.1_Intron	NM_182985	NP_892030	Q86WT6	TRI69_HUMAN	tripartite motif-containing 69 isoform a	65	Necessary for nuclear localization (By similarity).|RING-type.				apoptosis	nuclear speck	zinc ion binding				0		all_cancers(109;2.47e-13)|all_epithelial(112;2.84e-11)|Lung NSC(122;2.23e-07)|all_lung(180;1.81e-06)|Melanoma(134;0.0122)		all cancers(107;5.5e-19)|GBM - Glioblastoma multiforme(94;1.07e-06)|Colorectal(105;0.138)|COAD - Colon adenocarcinoma(120;0.141)		AAGCCTGTATCCAAGACTTTT	0.448													15	296	---	---	---	---	PASS
DUOXA2	405753	broad.mit.edu	37	15	45408348	45408348	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45408348G>A	uc001zuo.2	+	3	512	c.232G>A	c.(232-234)GTG>ATG	p.V78M	DUOX2_uc010bea.2_5'Flank|DUOX2_uc001zun.2_5'Flank|DUOXA2_uc010beb.2_RNA	NM_207581	NP_997464	Q1HG44	DOXA2_HUMAN	dual oxidase activator 2	78	Extracellular (Potential).				protein transport	endoplasmic reticulum membrane|integral to membrane					0		all_cancers(109;5.7e-11)|all_epithelial(112;4.65e-09)|Lung NSC(122;3.55e-06)|all_lung(180;2.56e-05)|Melanoma(134;0.027)		all cancers(107;2.88e-18)|GBM - Glioblastoma multiforme(94;3.95e-07)|COAD - Colon adenocarcinoma(120;0.0652)|Colorectal(133;0.0659)		AGAATGGTTCGTGGGTACAGT	0.557													18	675	---	---	---	---	PASS
CEP152	22995	broad.mit.edu	37	15	49090251	49090251	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:49090251G>A	uc001zwy.2	-						CEP152_uc001zwz.2_Intron|CEP152_uc001zxa.1_Intron	NM_014985	NP_055800	O94986	CE152_HUMAN	centrosomal protein 152kDa						centrosome duplication|G2/M transition of mitotic cell cycle	centrosome|cytosol	protein kinase binding			lung(2)	2		all_lung(180;0.0428)		all cancers(107;1.08e-07)|GBM - Glioblastoma multiforme(94;2.32e-06)		TGCTGCAACTGAGTCAAAAGG	0.483													5	58	---	---	---	---	PASS
SECISBP2L	9728	broad.mit.edu	37	15	49284821	49284821	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:49284821T>A	uc001zxe.1	-	18	3060	c.2926A>T	c.(2926-2928)ATC>TTC	p.I976F	SECISBP2L_uc001zxd.1_Missense_Mutation_p.I931F	NM_014701	NP_055516	Q93073	SBP2L_HUMAN	SECIS binding protein 2-like	976										breast(1)|skin(1)	2						GTGCTGGTGATGGAGGAATTC	0.393													33	120	---	---	---	---	PASS
SECISBP2L	9728	broad.mit.edu	37	15	49284823	49284823	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:49284823G>A	uc001zxe.1	-	18	3058	c.2924C>T	c.(2923-2925)TCC>TTC	p.S975F	SECISBP2L_uc001zxd.1_Missense_Mutation_p.S930F	NM_014701	NP_055516	Q93073	SBP2L_HUMAN	SECIS binding protein 2-like	975										breast(1)|skin(1)	2						GCTGGTGATGGAGGAATTCAA	0.393													33	121	---	---	---	---	PASS
DMXL2	23312	broad.mit.edu	37	15	51828946	51828946	+	Silent	SNP	C	A	A	rs148694560		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:51828946C>A	uc002abf.2	-	12	1956	c.1731G>T	c.(1729-1731)ACG>ACT	p.T577T	DMXL2_uc010ufy.1_Silent_p.T577T|DMXL2_uc010bfa.2_Silent_p.T577T	NM_015263	NP_056078	Q8TDJ6	DMXL2_HUMAN	Dmx-like 2	577						cell junction|synaptic vesicle membrane	Rab GTPase binding			ovary(6)|skin(3)	9				all cancers(107;0.00494)		GGTGTAACAGCGTGTGGTGAG	0.458													48	147	---	---	---	---	PASS
UNC13C	440279	broad.mit.edu	37	15	54306253	54306253	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:54306253C>G	uc002ack.2	+	1	1153	c.1153C>G	c.(1153-1155)CAA>GAA	p.Q385E		NM_001080534	NP_001074003	Q8NB66	UN13C_HUMAN	unc-13 homolog C	385					exocytosis|intracellular signal transduction	cell junction|cytoplasm|presynaptic membrane	metal ion binding			ovary(5)|pancreas(2)	7				GBM - Glioblastoma multiforme(80;0.0789)|all cancers(107;0.124)		TGAAACCCCTCAACAAAGGGA	0.383													6	94	---	---	---	---	PASS
RNF111	54778	broad.mit.edu	37	15	59373224	59373224	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59373224C>G	uc002afv.2	+	8	2317	c.2038C>G	c.(2038-2040)CAA>GAA	p.Q680E	RNF111_uc002afs.2_Missense_Mutation_p.Q680E|RNF111_uc002aft.2_Missense_Mutation_p.Q680E|RNF111_uc002afu.2_Missense_Mutation_p.Q679E|RNF111_uc002afw.2_Missense_Mutation_p.Q680E|RNF111_uc002afx.2_Missense_Mutation_p.Q206E	NM_017610	NP_060080	Q6ZNA4	RN111_HUMAN	ring finger protein 111	680	Pro-rich.				multicellular organismal development|positive regulation of transcription, DNA-dependent	cytoplasm|nucleus	protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(2)	2				all cancers(107;0.194)		GCCTCCGCCTCAAGTGGATTA	0.488													35	324	---	---	---	---	PASS
VPS13C	54832	broad.mit.edu	37	15	62173948	62173948	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:62173948G>A	uc002agz.2	-	70	9778	c.9704C>T	c.(9703-9705)TCA>TTA	p.S3235L	VPS13C_uc002aha.2_Missense_Mutation_p.S3192L|VPS13C_uc002ahb.1_Missense_Mutation_p.S3235L|VPS13C_uc002ahc.1_Missense_Mutation_p.S3192L	NM_020821	NP_065872	Q709C8	VP13C_HUMAN	vacuolar protein sorting 13C protein isoform 2A	3235					protein localization					ovary(2)	2						TATTTTACCTGAATCTAAAGC	0.299													6	58	---	---	---	---	PASS
LACTB	114294	broad.mit.edu	37	15	63433984	63433984	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63433984G>C	uc002alw.2	+	6	1663	c.1624G>C	c.(1624-1626)GAT>CAT	p.D542H		NM_032857	NP_116246	P83111	LACTB_HUMAN	lactamase, beta isoform a	542						mitochondrion	hydrolase activity				0						CCTTGAATTTGATAAAGACAG	0.353													9	114	---	---	---	---	PASS
IQCH	64799	broad.mit.edu	37	15	67571822	67571822	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:67571822C>T	uc002aqo.1	+	4	406	c.359C>T	c.(358-360)TCA>TTA	p.S120L	IQCH_uc010ujv.1_5'UTR|IQCH_uc002aqn.1_Intron|IQCH_uc002aqq.1_Intron|IQCH_uc002aqp.1_Intron|IQCH_uc002aqm.2_Missense_Mutation_p.S120L	NM_001031715	NP_001026885	Q86VS3	IQCH_HUMAN	IQ motif containing H isoform 1	120										skin(3)|ovary(1)	4				Colorectal(3;0.0856)		CAGCACAGTTCATCTCTGCCT	0.274													28	123	---	---	---	---	PASS
ISLR	3671	broad.mit.edu	37	15	74467562	74467562	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:74467562C>T	uc002axg.1	+	2	645	c.363C>T	c.(361-363)CTC>CTT	p.L121L	ISLR_uc002axh.1_Silent_p.L121L	NM_005545	NP_005536	O14498	ISLR_HUMAN	immunoglobulin superfamily containing	121	LRR 3.				cell adhesion	extracellular region				large_intestine(1)|ovary(1)|central_nervous_system(1)|skin(1)	4						TGCACAACCTCAGTGCCCTCC	0.622													20	160	---	---	---	---	PASS
MAN2C1	4123	broad.mit.edu	37	15	75654069	75654069	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75654069G>A	uc002baf.2	-						MAN2C1_uc002bag.2_Intron|MAN2C1_uc002bah.2_Intron|MAN2C1_uc010bkk.2_Intron|MAN2C1_uc010umi.1_Intron|MAN2C1_uc010umj.1_Intron	NM_006715	NP_006706	Q9NTJ4	MA2C1_HUMAN	mannosidase, alpha, class 2C, member 1						mannose metabolic process		alpha-mannosidase activity|carbohydrate binding|protein binding|zinc ion binding				0						GAACTGTGGAGAAAGAGGATC	0.617													28	200	---	---	---	---	PASS
CSPG4	1464	broad.mit.edu	37	15	75974642	75974642	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75974642G>C	uc002baw.2	-	8	5035	c.4942C>G	c.(4942-4944)CAG>GAG	p.Q1648E		NM_001897	NP_001888	Q6UVK1	CSPG4_HUMAN	chondroitin sulfate proteoglycan 4 precursor	1648	Extracellular (Potential).|Cysteine-containing.|Neurite growth inhibition (By similarity).|CSPG 11.				angiogenesis|cell differentiation|intracellular signal transduction|positive regulation of peptidyl-tyrosine phosphorylation|tissue remodeling	apical plasma membrane|cell surface|integral to plasma membrane|intracellular|lamellipodium membrane	protein kinase binding|signal transducer activity			ovary(2)|pancreas(1)	3						ACCTCTGCCTGAGTGAAGTTC	0.652													22	235	---	---	---	---	PASS
ETFA	2108	broad.mit.edu	37	15	76576104	76576104	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:76576104C>A	uc002bbt.2	-	8	808	c.727G>T	c.(727-729)GCT>TCT	p.A243S	ETFA_uc010bkq.1_Missense_Mutation_p.A194S|ETFA_uc002bbu.1_Missense_Mutation_p.A243S	NM_000126	NP_000117	P13804	ETFA_HUMAN	electron transfer flavoprotein, alpha	243					respiratory electron transport chain|transport	mitochondrial matrix	electron carrier activity|flavin adenine dinucleotide binding|oxidoreductase activity				0						TTACCTGCAGCATGTAGTTGA	0.318													6	83	---	---	---	---	PASS
ADAMTS7	11173	broad.mit.edu	37	15	79063573	79063573	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:79063573C>T	uc002bej.3	-	16	2660	c.2449G>A	c.(2449-2451)GAG>AAG	p.E817K	ADAMTS7_uc010und.1_Intron|ADAMTS7_uc002bek.1_3'UTR	NM_014272	NP_055087	Q9UKP4	ATS7_HUMAN	ADAM metallopeptidase with thrombospondin type 1	817					proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding				0						GGCGGGACCTCGTCGTGGCCA	0.667													5	38	---	---	---	---	PASS
ALPK3	57538	broad.mit.edu	37	15	85383195	85383195	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:85383195G>A	uc002ble.2	+	5	1458	c.1291G>A	c.(1291-1293)GGG>AGG	p.G431R		NM_020778	NP_065829	Q96L96	ALPK3_HUMAN	alpha-kinase 3	431					heart development	nucleus	ATP binding|protein serine/threonine kinase activity			stomach(3)|ovary(3)|lung(2)|skin(2)|central_nervous_system(1)|breast(1)	12			BRCA - Breast invasive adenocarcinoma(143;0.0587)			GCGATTGAGCGGGGCTCAAGC	0.677													5	71	---	---	---	---	PASS
AKAP13	11214	broad.mit.edu	37	15	86284642	86284642	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:86284642G>C	uc002blv.1	+	35	8144	c.7974G>C	c.(7972-7974)CAG>CAC	p.Q2658H	AKAP13_uc002blu.1_Missense_Mutation_p.Q2662H|AKAP13_uc002blw.1_Missense_Mutation_p.Q1123H|AKAP13_uc002blx.1_Missense_Mutation_p.Q903H	NM_007200	NP_009131	Q12802	AKP13_HUMAN	A-kinase anchor protein 13 isoform 2	2658	Interaction with ESR1.|Potential.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|membrane|membrane fraction|nucleus	cAMP-dependent protein kinase activity|metal ion binding|protein binding|Rho guanyl-nucleotide exchange factor activity|signal transducer activity			central_nervous_system(3)|kidney(2)|urinary_tract(1)|liver(1)|skin(1)|ovary(1)	9						GTGCTGCCCAGAAACAGCTTG	0.627													23	144	---	---	---	---	PASS
C15orf42	90381	broad.mit.edu	37	15	90138667	90138667	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:90138667G>T	uc002boe.2	+	7	1725	c.1725G>T	c.(1723-1725)ATG>ATT	p.M575I		NM_152259	NP_689472	Q7Z2Z1	TICRR_HUMAN	leucine-rich repeat kinase 1	575					cell cycle|DNA repair|DNA replication|formation of translation preinitiation complex|G2/M transition checkpoint|mitotic cell cycle DNA replication checkpoint|regulation of DNA-dependent DNA replication initiation|response to ionizing radiation	nucleus	chromatin binding|protein binding			ovary(4)|central_nervous_system(2)|skin(1)	7	Lung NSC(78;0.0237)|all_lung(78;0.0478)		BRCA - Breast invasive adenocarcinoma(143;0.128)			TGAATACCATGTGCCGTTCCT	0.488													40	112	---	---	---	---	PASS
PLIN1	5346	broad.mit.edu	37	15	90210935	90210935	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:90210935G>A	uc010upx.1	-	7	971	c.861C>T	c.(859-861)CTC>CTT	p.L287L	PLIN1_uc002boh.2_Silent_p.L287L	NM_001145311	NP_001138783	O60240	PLIN1_HUMAN	perilipin 1	287					triglyceride catabolic process	lipid particle	lipid binding			central_nervous_system(1)|skin(1)	2						GGGCGGCTGCGAGGCTGTGCA	0.423													3	26	---	---	---	---	PASS
AP3S2	10239	broad.mit.edu	37	15	90378816	90378816	+	Silent	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:90378816T>C	uc002boq.3	-	6	949	c.513A>G	c.(511-513)CCA>CCG	p.P171P	AP3S2_uc002bos.3_Silent_p.P372P|AP3S2_uc010bns.2_RNA|AP3S2_uc002bor.3_RNA|AP3S2_uc010bnt.2_RNA	NM_005829	NP_005820	P59780	AP3S2_HUMAN	adaptor-related protein complex 3, sigma 2	171					intracellular protein transport|vesicle-mediated transport	cytoplasmic vesicle membrane|Golgi apparatus|membrane coat	protein transporter activity				0	Lung NSC(78;0.0181)|all_lung(78;0.0384)		BRCA - Breast invasive adenocarcinoma(143;0.0107)|KIRC - Kidney renal clear cell carcinoma(17;0.0286)|Kidney(142;0.0514)|STAD - Stomach adenocarcinoma(125;0.223)			GAGGAATCTCTGGCAGGTTGA	0.483													148	330	---	---	---	---	PASS
CRTC3	64784	broad.mit.edu	37	15	91181992	91181992	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91181992C>G	uc002bpp.2	+	13	1599	c.1493C>G	c.(1492-1494)CCA>CGA	p.P498R	CRTC3_uc002bpo.2_Missense_Mutation_p.P498R	NM_022769	NP_073606	Q6UUV7	CRTC3_HUMAN	transducer of regulated CREB protein 3 isoform	498					interspecies interaction between organisms|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus			CRTC3/MAML2(26)	salivary_gland(26)|ovary(1)	27	Melanoma(11;0.00551)|Lung NSC(78;0.0931)|all_lung(78;0.163)		BRCA - Breast invasive adenocarcinoma(143;0.0745)			AACTTCTTCCCAGATGTGGGT	0.522			T	MAML2	salivary gland mucoepidermoid								27	345	---	---	---	---	PASS
C15orf32	145858	broad.mit.edu	37	15	93015580	93015580	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:93015580C>A	uc002brc.1	+	1	674	c.202C>A	c.(202-204)CAC>AAC	p.H68N	C15orf32_uc010bod.1_RNA	NM_153040	NP_694585	Q32M92	CO032_HUMAN	hypothetical protein LOC145858	68								p.H68Y(1)		ovary(1)	1	Lung NSC(78;0.0893)|all_lung(78;0.125)		BRCA - Breast invasive adenocarcinoma(143;0.0493)|OV - Ovarian serous cystadenocarcinoma(32;0.125)			TGGGGTGTTGCAcccatttta	0.333													79	214	---	---	---	---	PASS
MEF2A	4205	broad.mit.edu	37	15	100214787	100214787	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:100214787C>T	uc010urw.1	+	5	945	c.586C>T	c.(586-588)CCT>TCT	p.P196S	MEF2A_uc010urv.1_Missense_Mutation_p.P126S|MEF2A_uc010bos.2_Missense_Mutation_p.P194S|MEF2A_uc002bvf.2_Missense_Mutation_p.P196S|MEF2A_uc002bve.2_Missense_Mutation_p.P194S|MEF2A_uc002bvg.2_Missense_Mutation_p.P194S|MEF2A_uc002bvi.2_Missense_Mutation_p.P194S|MEF2A_uc010bot.2_Missense_Mutation_p.P126S	NM_005587	NP_005578	Q02078	MEF2A_HUMAN	myocyte enhancer factor 2A isoform 1	196					apoptosis|BMK cascade|cardiac conduction|cellular response to calcium ion|dendrite morphogenesis|innate immune response|mitochondrial genome maintenance|mitochondrion distribution|muscle organ development|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|positive regulation of muscle cell differentiation|positive regulation of transcription from RNA polymerase II promoter|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway|ventricular cardiac myofibril development	nuclear chromatin|nucleoplasm	activating transcription factor binding|histone acetyltransferase binding|histone deacetylase binding|protein heterodimerization activity|RNA polymerase II regulatory region sequence-specific DNA binding|sequence-specific DNA binding RNA polymerase II transcription factor activity|SMAD binding			ovary(1)	1	Lung NSC(78;0.00335)|all_lung(78;0.00659)|Melanoma(26;0.00778)|Medulloblastoma(229;0.163)		OV - Ovarian serous cystadenocarcinoma(32;0.00085)			TCCTGGAGCTCCTCAGAGACC	0.433													52	307	---	---	---	---	PASS
BAIAP3	8938	broad.mit.edu	37	16	1398482	1398482	+	Nonstop_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1398482G>C	uc002clk.1	+	34	3563	c.3563G>C	c.(3562-3564)TGA>TCA	p.*1188S	BAIAP3_uc002clj.2_Nonstop_Mutation_p.*1170S|BAIAP3_uc010uuz.1_Nonstop_Mutation_p.*1153S|BAIAP3_uc010uva.1_Nonstop_Mutation_p.*1125S|BAIAP3_uc010uvc.1_Nonstop_Mutation_p.*1117S	NM_003933	NP_003924	O94812	BAIP3_HUMAN	BAI1-associated protein 3	1188					G-protein coupled receptor protein signaling pathway|neurotransmitter secretion		protein C-terminus binding			pancreas(1)	1		Hepatocellular(780;0.0893)				GCGGACCCCTGAGTCCATCAG	0.642													4	33	---	---	---	---	PASS
C16orf91	283951	broad.mit.edu	37	16	1470348	1470348	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1470348C>T	uc002clr.2	-	2	319	c.298G>A	c.(298-300)GAG>AAG	p.E100K	C16orf91_uc010uvd.1_Missense_Mutation_p.E257K	NM_001010878	NP_001010878	Q4G0I0	CSMT1_HUMAN	hypothetical protein LOC283951	100	Cytoplasmic (Potential).					integral to membrane					0						TGGTCCGCCTCGCTCTCCTCC	0.612													74	308	---	---	---	---	PASS
CRAMP1L	57585	broad.mit.edu	37	16	1706267	1706267	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1706267G>C	uc010uvh.1	+	9	1509	c.1509G>C	c.(1507-1509)TTG>TTC	p.L503F	CRAMP1L_uc002cmf.2_Intron	NM_020825	NP_065876	Q96RY5	CRML_HUMAN	Crm, cramped-like	503				L -> S (in Ref. 4; BAA92664).		nucleus	DNA binding				0						CCCTAAGCTTGAGCAGCCCGG	0.697													6	35	---	---	---	---	PASS
PDILT	204474	broad.mit.edu	37	16	20395969	20395969	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20395969T>A	uc002dhc.1	-	3	630	c.407A>T	c.(406-408)AAA>ATA	p.K136I		NM_174924	NP_777584	Q8N807	PDILT_HUMAN	protein disulfide isomerase-like, testis	136					cell differentiation|cell redox homeostasis|multicellular organismal development|spermatogenesis	endoplasmic reticulum	isomerase activity			large_intestine(1)	1						ACCATTACCTTTGCAGCTGAT	0.313													27	395	---	---	---	---	PASS
ACSM2B	348158	broad.mit.edu	37	16	20554476	20554476	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20554476C>T	uc002dhj.3	-	12	1600	c.1390G>A	c.(1390-1392)GAT>AAT	p.D464N	ACSM2B_uc002dhk.3_Missense_Mutation_p.D464N|ACSM2B_uc010bwf.1_Missense_Mutation_p.D464N	NM_182617	NP_872423	Q68CK6	ACS2B_HUMAN	acyl-CoA synthetase medium-chain family member	464					fatty acid metabolic process|xenobiotic metabolic process	mitochondrial matrix	ATP binding|butyrate-CoA ligase activity|CoA-ligase activity|metal ion binding			skin(3)|ovary(1)|central_nervous_system(1)	5						TTAATGATATCATCTGCCCGT	0.507													71	782	---	---	---	---	PASS
ACSM3	6296	broad.mit.edu	37	16	20788787	20788787	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20788787G>C	uc002dhr.2	+	4	710	c.523G>C	c.(523-525)GAT>CAT	p.D175H	ACSM3_uc002dhq.2_Missense_Mutation_p.D175H|ACSM3_uc010vba.1_Missense_Mutation_p.D167H	NM_005622	NP_005613	Q53FZ2	ACSM3_HUMAN	SA hypertension-associated homolog isoform 1	175					regulation of blood pressure	mitochondrial matrix	ATP binding|butyrate-CoA ligase activity|metal ion binding			ovary(1)	1						TATCACCAATGATGTTTTAGC	0.453													27	110	---	---	---	---	PASS
OTOA	146183	broad.mit.edu	37	16	21693107	21693107	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21693107G>C	uc002djh.2	+	5	229	c.228G>C	c.(226-228)CTG>CTC	p.L76L	uc002diq.3_Intron|OTOA_uc010vbj.1_5'Flank	NM_144672	NP_653273	Q7RTW8	OTOAN_HUMAN	otoancorin isoform 1	76					sensory perception of sound	anchored to membrane|apical plasma membrane|proteinaceous extracellular matrix				ovary(1)|central_nervous_system(1)|skin(1)	3				GBM - Glioblastoma multiforme(48;0.0414)		TGGCCTATCTGAATTCCCGGA	0.512													9	139	---	---	---	---	PASS
SCNN1G	6340	broad.mit.edu	37	16	23226587	23226587	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23226587G>T	uc002dlm.1	+	13	1886	c.1747G>T	c.(1747-1749)GAA>TAA	p.E583*		NM_001039	NP_001030	P51170	SCNNG_HUMAN	sodium channel, nonvoltage-gated 1, gamma	583	Cytoplasmic (By similarity).				excretion|sensory perception of taste	apical plasma membrane|integral to plasma membrane	ligand-gated sodium channel activity|WW domain binding			ovary(2)|skin(2)|large_intestine(1)|pancreas(1)	6				GBM - Glioblastoma multiforme(48;0.0366)	Amiloride(DB00594)|Triamterene(DB00384)	CCCATGTCCAGAAGCTCCCCG	0.572													9	218	---	---	---	---	PASS
ARHGAP17	55114	broad.mit.edu	37	16	24980063	24980063	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24980063C>G	uc002dnb.2	-	5	396	c.303G>C	c.(301-303)GAG>GAC	p.E101D	ARHGAP17_uc002dnc.2_Missense_Mutation_p.E101D|ARHGAP17_uc010vcf.1_Intron|ARHGAP17_uc002dnf.2_Missense_Mutation_p.E9D|ARHGAP17_uc002dng.1_Missense_Mutation_p.E101D	NM_001006634	NP_001006635	Q68EM7	RHG17_HUMAN	nadrin isoform 1	101	BAR.				regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|tight junction	GTPase activator activity|SH3 domain binding				0				GBM - Glioblastoma multiforme(48;0.0407)		CCAGCTGATTCTCAGCATCTC	0.517													26	161	---	---	---	---	PASS
HS3ST4	9951	broad.mit.edu	37	16	26147491	26147491	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:26147491C>A	uc002dof.2	+	2	1685	c.1293C>A	c.(1291-1293)TTC>TTA	p.F431L		NM_006040	NP_006031	Q9Y661	HS3S4_HUMAN	heparan sulfate D-glucosaminyl	431	Lumenal (Potential).				heparan sulfate proteoglycan metabolic process	extracellular region|Golgi membrane|integral to membrane	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity			large_intestine(1)|breast(1)	2				GBM - Glioblastoma multiforme(48;0.0988)		TGAGGAAATTCTACAAACCCT	0.488													5	39	---	---	---	---	PASS
JMJD5	79831	broad.mit.edu	37	16	27221444	27221444	+	5'UTR	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:27221444G>A	uc002doh.2	+	2					JMJD5_uc010bxv.2_5'UTR|JMJD5_uc010vcn.1_Silent_p.P38P|JMJD5_uc010bxw.2_5'UTR	NM_024773	NP_079049	Q8N371	KDM8_HUMAN	jumonji domain containing 5 isoform 2						G2/M transition of mitotic cell cycle|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	chromatin binding|histone demethylase activity (H3-K36 specific)|metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			ovary(2)|upper_aerodigestive_tract(1)	3						GTGGTGGCCCGATGGCTGGAG	0.617													53	359	---	---	---	---	PASS
ATP2A1	487	broad.mit.edu	37	16	28915031	28915031	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28915031C>T	uc002dro.1	+						uc010vct.1_Intron|ATP2A1_uc002drn.1_3'UTR|ATP2A1_uc002drp.1_3'UTR	NM_173201	NP_775293	O14983	AT2A1_HUMAN	ATPase, Ca++ transporting, fast twitch 1 isoform						apoptosis in response to endoplasmic reticulum stress|apoptotic mitochondrial changes|ATP biosynthetic process|calcium ion import|elevation of endoplasmic reticulum calcium ion concentration|elevation of mitochondrial calcium ion concentration|maintenance of mitochondrion location|negative regulation of striated muscle contraction|platelet activation|positive regulation of fast-twitch skeletal muscle fiber contraction|reduction of endoplasmic reticulum calcium ion concentration|relaxation of skeletal muscle|response to endoplasmic reticulum stress	endoplasmic reticulum membrane|ER-Golgi intermediate compartment|H zone|I band|microsome|perinuclear region of cytoplasm|platelet dense tubular network membrane|sarcoplasmic reticulum|sarcoplasmic reticulum membrane	ATP binding|ATP binding|calcium ion binding|calcium ion binding|calcium-transporting ATPase activity|protein homodimerization activity			ovary(2)|central_nervous_system(1)|pancreas(1)	4						GATAACTGTTCCCCCTCCTCC	0.642													63	736	---	---	---	---	PASS
KIF22	3835	broad.mit.edu	37	16	29809906	29809906	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29809906C>G	uc002dts.3	+						uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|KIF22_uc010vdv.1_Intron|KIF22_uc010vdw.1_Intron|KIF22_uc010bzf.2_Intron	NM_007317	NP_015556	Q14807	KIF22_HUMAN	kinesin family member 22						blood coagulation|DNA repair|microtubule-based movement|mitosis	cytosol|kinetochore|microtubule|nucleus	ATP binding|DNA binding|microtubule motor activity|protein binding				0						TCTCCACTCTCTTCCCAGGGA	0.587													13	262	---	---	---	---	PASS
ZNF689	115509	broad.mit.edu	37	16	30616764	30616764	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30616764G>A	uc002dyx.2	-	3	644	c.324C>T	c.(322-324)AGC>AGT	p.S108S	ZNF689_uc010bzy.2_5'UTR	NM_138447	NP_612456	Q96CS4	ZN689_HUMAN	zinc finger protein HIT-39	108					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0			Colorectal(24;0.198)			TTCTGGTTCTGCTTTCTATAG	0.478													15	310	---	---	---	---	PASS
SRCAP	10847	broad.mit.edu	37	16	30721048	30721048	+	Missense_Mutation	SNP	A	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30721048A>T	uc002dze.1	+	7	1233	c.848A>T	c.(847-849)GAT>GTT	p.D283V	SRCAP_uc002dzf.2_RNA|SRCAP_uc002dzg.1_Missense_Mutation_p.D140V|SRCAP_uc010bzz.1_5'Flank|SNORA30_uc002dzh.1_5'Flank	NM_006662	NP_006653	Q6ZRS2	SRCAP_HUMAN	Snf2-related CBP activator protein	283					interspecies interaction between organisms|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	Golgi apparatus|nucleus|protein complex	ATP binding|DNA binding|helicase activity|histone acetyltransferase activity|transcription coactivator activity			ovary(3)|skin(1)	4			Colorectal(24;0.198)			TCTCGCCTGGATGATGAAGGT	0.562													28	199	---	---	---	---	PASS
MYST1	84148	broad.mit.edu	37	16	31131554	31131554	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31131554G>C	uc002eay.2	+	2	277	c.259G>C	c.(259-261)GAG>CAG	p.E87Q	MYST1_uc002eax.2_Missense_Mutation_p.E87Q	NM_032188	NP_115564	Q9H7Z6	MYST1_HUMAN	MYST histone acetyltransferase 1 isoform 1	87	Chromo.				histone H4-K16 acetylation|myeloid cell differentiation|negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	MLL1 complex|MSL complex	histone acetyltransferase activity|metal ion binding|methylated histone residue binding|transcription factor binding			ovary(1)	1						GGAGGGCCGAGAGGAATTCTA	0.542													14	315	---	---	---	---	PASS
TGFB1I1	7041	broad.mit.edu	37	16	31488639	31488639	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31488639C>T	uc002ecd.1	+	11	1154	c.1128C>T	c.(1126-1128)TTC>TTT	p.F376F	TGFB1I1_uc002ece.1_Silent_p.F359F|TGFB1I1_uc010caq.1_Silent_p.F215F	NM_001042454	NP_001035919	O43294	TGFI1_HUMAN	transforming growth factor beta 1 induced	376	LIM zinc-binding 3.				androgen receptor signaling pathway|cell adhesion|negative regulation of cell proliferation|negative regulation of transforming growth factor beta receptor signaling pathway|positive regulation of epithelial to mesenchymal transition|positive regulation of transcription, DNA-dependent|positive regulation of transforming growth factor beta receptor signaling pathway|transcription from RNA polymerase II promoter|ubiquitin-dependent SMAD protein catabolic process|Wnt receptor signaling pathway	cytoplasm|cytoskeleton|focal adhesion|nuclear matrix	androgen receptor binding|I-SMAD binding|Roundabout binding|transcription coactivator activity|zinc ion binding				0						AGGAATGCTTCGCGCCCTTCT	0.662													13	46	---	---	---	---	PASS
ZNF267	10308	broad.mit.edu	37	16	31927420	31927420	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31927420C>G	uc002ecs.3	+	4	2059	c.1850C>G	c.(1849-1851)TCA>TGA	p.S617*		NM_003414	NP_003405	Q14586	ZN267_HUMAN	zinc finger protein 267	617	C2H2-type 11.				multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|breast(1)|skin(1)	4						AGTTATAGTTCAGATGTTATT	0.418													8	91	---	---	---	---	PASS
ABCC12	94160	broad.mit.edu	37	16	48149494	48149494	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:48149494C>G	uc002efc.1	-	13	2167	c.1821G>C	c.(1819-1821)CAG>CAC	p.Q607H	ABCC12_uc002eey.1_RNA|ABCC12_uc002eez.1_RNA|ABCC12_uc002efa.1_RNA|ABCC12_uc002efb.1_RNA|ABCC12_uc002efd.1_RNA	NM_033226	NP_150229	Q96J65	MRP9_HUMAN	ATP-binding cassette protein C12	607	ABC transporter 1.					integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(2)|skin(1)	3		all_cancers(37;0.0474)|all_lung(18;0.047)				TCCTCTGCCTCTGCCCCCCAG	0.642													14	61	---	---	---	---	PASS
ABCC11	85320	broad.mit.edu	37	16	48204038	48204038	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:48204038C>T	uc002eff.1	-	27	4219	c.3869G>A	c.(3868-3870)AGG>AAG	p.R1290K	ABCC11_uc002efg.1_Missense_Mutation_p.R1290K|ABCC11_uc002efh.1_Intron|ABCC11_uc010cbg.1_RNA	NM_033151	NP_149163	Q96J66	ABCCB_HUMAN	ATP-binding cassette, sub-family C, member 11	1290	ABC transporter 2.|Cytoplasmic (Potential).					integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(3)|skin(2)|central_nervous_system(1)	6		all_cancers(37;0.127)|all_lung(18;0.132)|Breast(268;0.166)				AAGCACAGCCCTGGCAATGCA	0.572									Cerumen_Type				60	201	---	---	---	---	PASS
ZNF423	23090	broad.mit.edu	37	16	49669853	49669853	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:49669853G>C	uc002efs.2	-	5	3508	c.3210C>G	c.(3208-3210)CTC>CTG	p.L1070L	ZNF423_uc010vgn.1_Silent_p.L953L	NM_015069	NP_055884	Q2M1K9	ZN423_HUMAN	zinc finger protein 423	1070	C2H2-type 25; degenerate.				cell differentiation|negative regulation of transcription, DNA-dependent|nervous system development|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(1)|lung(1)|kidney(1)|pancreas(1)	4		all_cancers(37;0.0155)				GGAACTCCTTGAGGCACAGGG	0.657													13	56	---	---	---	---	PASS
RPGRIP1L	23322	broad.mit.edu	37	16	53671722	53671722	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:53671722C>G	uc002ehp.2	-	21	3169	c.3105G>C	c.(3103-3105)GAG>GAC	p.E1035D	RPGRIP1L_uc002eho.3_Missense_Mutation_p.E1001D|RPGRIP1L_uc010vgy.1_Missense_Mutation_p.E1035D|RPGRIP1L_uc010cbx.2_Missense_Mutation_p.E1001D|RPGRIP1L_uc010vgz.1_Missense_Mutation_p.E1035D	NM_015272	NP_056087	Q68CZ1	FTM_HUMAN	RPGRIP1-like isoform a	1035					negative regulation of G-protein coupled receptor protein signaling pathway	cell-cell junction|centrosome|cilium axoneme|microtubule basal body	thromboxane A2 receptor binding			ovary(1)	1		all_cancers(37;0.0973)				GCTGCATTTTCTCAGTATTCT	0.363													18	212	---	---	---	---	PASS
IRX3	79191	broad.mit.edu	37	16	54319207	54319207	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:54319207G>C	uc002eht.1	-	2	1002	c.586C>G	c.(586-588)CGC>GGC	p.R196G		NM_024336	NP_077312	P78415	IRX3_HUMAN	iroquois homeobox 3	196					multicellular organismal development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0						GTGCGGCTGCGAGGCGCCCAA	0.517													10	67	---	---	---	---	PASS
CAPNS2	84290	broad.mit.edu	37	16	55601347	55601347	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:55601347G>C	uc002eid.1	+	1	764	c.679G>C	c.(679-681)GAT>CAT	p.D227H	LPCAT2_uc002eie.3_Intron|LPCAT2_uc002eic.2_Intron	NM_032330	NP_115706	Q96L46	CPNS2_HUMAN	calpain small subunit 2	227	EF-hand 4.					cytoplasm|plasma membrane	calcium ion binding				0						CAAGTCTCTGGATAGAGATAG	0.463													42	226	---	---	---	---	PASS
TEPP	374739	broad.mit.edu	37	16	58010447	58010447	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:58010447C>T	uc002emw.3	+	1	109	c.72C>T	c.(70-72)TTC>TTT	p.F24F	TEPP_uc002emv.3_Silent_p.F24F	NM_199456	NP_955535	Q6URK8	TEPP_HUMAN	testis/prostate/placenta-expressed protein	24						extracellular region				kidney(1)|central_nervous_system(1)|skin(1)	3						CACCTCCCTTCCTCTTCTGCC	0.512													26	221	---	---	---	---	PASS
KIAA0895L	653319	broad.mit.edu	37	16	67214260	67214260	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67214260G>C	uc002ert.2	-	2	1029	c.254C>G	c.(253-255)TCT>TGT	p.S85C	KIAA0895L_uc002err.2_5'Flank|KIAA0895L_uc002ers.2_5'Flank|KIAA0895L_uc002eru.2_Missense_Mutation_p.S85C|EXOC3L_uc002erv.1_RNA	NM_001040715	NP_001035805	Q68EN5	K895L_HUMAN	hypothetical protein LOC653319	85											0						ACTATTTACAGAGTAGGTGCT	0.697													4	56	---	---	---	---	PASS
RLTPR	146206	broad.mit.edu	37	16	67688560	67688560	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67688560G>T	uc002etn.2	+	31	3667	c.3547G>T	c.(3547-3549)GAG>TAG	p.E1183*	RLTPR_uc010vjr.1_Nonsense_Mutation_p.E1147*	NM_001013838	NP_001013860	Q6F5E8	LR16C_HUMAN	RGD motif, leucine rich repeats, tropomodulin	1183										breast(1)	1		Acute lymphoblastic leukemia(13;3.23e-05)|all_hematologic(13;0.00251)|Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0146)|Epithelial(162;0.0481)|all cancers(182;0.232)		GCTGCCTGCCGAGGAGGAGGC	0.652													10	92	---	---	---	---	PASS
PDPR	55066	broad.mit.edu	37	16	70187417	70187417	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70187417A>G	uc002eyf.1	+	18	3133	c.2176A>G	c.(2176-2178)ATA>GTA	p.I726V	CLEC18C_uc002exy.2_Intron|PDPR_uc010vlr.1_Missense_Mutation_p.I626V|PDPR_uc002eyg.1_Intron|PDPR_uc002eyh.2_Missense_Mutation_p.I71V|PDPR_uc010vls.1_Missense_Mutation_p.I71V	NM_017990	NP_060460	Q8NCN5	PDPR_HUMAN	pyruvate dehydrogenase phosphatase regulatory	726					glycine catabolic process|pyruvate metabolic process|regulation of acetyl-CoA biosynthetic process from pyruvate	mitochondrial matrix	aminomethyltransferase activity|oxidoreductase activity			breast(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.124)		GGGTCAGGATATAAATAACCT	0.488													11	69	---	---	---	---	PASS
VAT1L	57687	broad.mit.edu	37	16	77850897	77850897	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:77850897G>C	uc002ffg.1	+	2	410	c.313G>C	c.(313-315)GAG>CAG	p.E105Q		NM_020927	NP_065978	Q9HCJ6	VAT1L_HUMAN	vesicle amine transport protein 1 homolog (T.	105							oxidoreductase activity|zinc ion binding			central_nervous_system(1)	1						GCCAGGATTTGAGTGTTCTGG	0.428													20	297	---	---	---	---	PASS
CDT1	81620	broad.mit.edu	37	16	88870964	88870964	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88870964C>T	uc002flu.2	+	2	294	c.240C>T	c.(238-240)CCC>CCT	p.P80P		NM_030928	NP_112190	Q9H211	CDT1_HUMAN	chromatin licensing and DNA replication factor	80					DNA replication|DNA replication checkpoint|M/G1 transition of mitotic cell cycle|regulation of DNA-dependent DNA replication initiation|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle	cytosol|nucleoplasm	DNA binding|protein binding			central_nervous_system(1)	1				BRCA - Breast invasive adenocarcinoma(80;0.0476)		TTTCCAGCCCCAGTACCCCCG	0.637													40	103	---	---	---	---	PASS
GALNS	2588	broad.mit.edu	37	16	88909127	88909127	+	Silent	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88909127A>G	uc002fly.3	-	2	320	c.231T>C	c.(229-231)CCT>CCC	p.P77P	GALNS_uc010cid.2_Silent_p.P83P|GALNS_uc002flz.3_Intron	NM_000512	NP_000503	P34059	GALNS_HUMAN	galactosamine (N-acetyl)-6-sulfate sulfatase	77			P -> R (in MPS4A; severe form).			lysosome	metal ion binding|N-acetylgalactosamine-4-sulfatase activity|N-acetylgalactosamine-6-sulfatase activity			large_intestine(2)	2				BRCA - Breast invasive adenocarcinoma(80;0.0496)	Hyaluronidase(DB00070)	GCGAGCACAGAGGGTTGGCAG	0.637													16	37	---	---	---	---	PASS
ANKRD11	29123	broad.mit.edu	37	16	89348549	89348549	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89348549C>T	uc002fmx.1	-	9	4862	c.4401G>A	c.(4399-4401)GAG>GAA	p.E1467E	ANKRD11_uc002fmy.1_Silent_p.E1467E|ANKRD11_uc002fnc.1_Silent_p.E1467E|ANKRD11_uc002fna.1_5'Flank|ANKRD11_uc002fnb.1_Silent_p.E1424E	NM_013275	NP_037407	Q6UB99	ANR11_HUMAN	ankyrin repeat domain 11	1467	Lys-rich.					nucleus				ovary(4)|large_intestine(1)|central_nervous_system(1)	6		all_hematologic(23;0.00824)|Colorectal(91;0.0475)		Epithelial(1;5.33e-11)|all cancers(4;2.6e-09)|OV - Ovarian serous cystadenocarcinoma(4;2.29e-07)|BRCA - Breast invasive adenocarcinoma(80;0.0142)		ctctccatttctccctgtgtt	0.388													8	169	---	---	---	---	PASS
ANKRD11	29123	broad.mit.edu	37	16	89348736	89348736	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89348736G>A	uc002fmx.1	-	9	4675	c.4214C>T	c.(4213-4215)TCT>TTT	p.S1405F	ANKRD11_uc002fmy.1_Missense_Mutation_p.S1405F|ANKRD11_uc002fnc.1_Missense_Mutation_p.S1405F|ANKRD11_uc002fna.1_5'Flank|ANKRD11_uc002fnb.1_Missense_Mutation_p.S1362F	NM_013275	NP_037407	Q6UB99	ANR11_HUMAN	ankyrin repeat domain 11	1405	Lys-rich.					nucleus				ovary(4)|large_intestine(1)|central_nervous_system(1)	6		all_hematologic(23;0.00824)|Colorectal(91;0.0475)		Epithelial(1;5.33e-11)|all cancers(4;2.6e-09)|OV - Ovarian serous cystadenocarcinoma(4;2.29e-07)|BRCA - Breast invasive adenocarcinoma(80;0.0142)		CATGTTGTAAGAAACTCCGTA	0.443													17	445	---	---	---	---	PASS
CPNE7	27132	broad.mit.edu	37	16	89655134	89655134	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89655134C>T	uc002fnp.2	+	12	1334	c.1204C>T	c.(1204-1206)CTG>TTG	p.L402L	CPNE7_uc002fnq.2_Silent_p.L327L	NM_014427	NP_055242	Q9UBL6	CPNE7_HUMAN	copine 7 isoform b	402	VWFA.				lipid metabolic process		transporter activity				0		all_hematologic(23;0.0748)		all cancers(4;3.63e-08)|OV - Ovarian serous cystadenocarcinoma(4;1.7e-06)|BRCA - Breast invasive adenocarcinoma(80;0.0147)		CAGCTGCTCCCTGCACTACAT	0.647													10	80	---	---	---	---	PASS
OR1E1	8387	broad.mit.edu	37	17	3300801	3300801	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3300801T>C	uc002fvj.1	-	1	904	c.904A>G	c.(904-906)AGC>GGC	p.S302G		NM_003553	NP_003544	P30953	OR1E1_HUMAN	olfactory receptor, family 1, subfamily E,	302	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						ATGACTCTGCTCAGGGCTCCC	0.413													59	92	---	---	---	---	PASS
SHPK	23729	broad.mit.edu	37	17	3514080	3514080	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3514080C>T	uc002fvz.1	-	7	1314	c.1211G>A	c.(1210-1212)CGA>CAA	p.R404Q	TRPV1_uc010vru.1_5'Flank	NM_013276	NP_037408	Q9UHJ6	SHPK_HUMAN	carbohydrate kinase-like	404					carbohydrate metabolic process	cytoplasm	ATP binding|sedoheptulokinase activity			ovary(1)	1				COAD - Colon adenocarcinoma(5;0.0828)		AACAATGCCTCGGCACAGAGC	0.637													21	437	---	---	---	---	PASS
ZNF594	84622	broad.mit.edu	37	17	5087217	5087217	+	Nonsense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:5087217G>C	uc010cla.1	-	2	491	c.335C>G	c.(334-336)TCA>TGA	p.S112*		NM_032530	NP_115919	Q96JF6	ZN594_HUMAN	zinc finger protein 594	112					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|skin(1)	3						AGTTAATCCTGACTTCTGTTT	0.358													6	102	---	---	---	---	PASS
MYH8	4626	broad.mit.edu	37	17	10297613	10297613	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10297613G>T	uc002gmm.2	-	35	5214	c.5119C>A	c.(5119-5121)CAG>AAG	p.Q1707K	uc002gml.1_Intron	NM_002472	NP_002463	P13535	MYH8_HUMAN	myosin, heavy chain 8, skeletal muscle,	1707	Potential.				muscle filament sliding	cytosol|muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			skin(6)|ovary(3)|breast(2)	11						AGGAGCTCCTGTTCGGCGATT	0.567									Trismus-Pseudocamptodactyly_Syndrome_with_Cardiac_Myxoma_and_Freckling				76	118	---	---	---	---	PASS
LRRC48	83450	broad.mit.edu	37	17	17900878	17900878	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:17900878G>A	uc010vxd.1	+	10	1308	c.929G>A	c.(928-930)CGT>CAT	p.R310H	LRRC48_uc002gsa.2_Missense_Mutation_p.R310H|LRRC48_uc010vxc.1_Missense_Mutation_p.R310H|LRRC48_uc002gsb.2_Missense_Mutation_p.R310H|LRRC48_uc010vxe.1_RNA	NM_001130090	NP_001123562	Q9H069	LRC48_HUMAN	leucine rich repeat containing 48 isoform a	310						cytoplasm				pancreas(1)	1	all_neural(463;0.228)					GAATGTGTCCGTGAGGCCATC	0.517													7	49	---	---	---	---	PASS
EFCAB5	374786	broad.mit.edu	37	17	28380316	28380316	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:28380316G>A	uc002het.2	+	10	1536	c.1344G>A	c.(1342-1344)TGG>TGA	p.W448*	EFCAB5_uc010wbi.1_Nonsense_Mutation_p.W191*|EFCAB5_uc010wbj.1_Nonsense_Mutation_p.W392*|EFCAB5_uc010wbk.1_Nonsense_Mutation_p.W105*|EFCAB5_uc010csd.2_RNA|EFCAB5_uc010cse.2_Nonsense_Mutation_p.W327*|EFCAB5_uc010csf.2_Nonsense_Mutation_p.W327*	NM_198529	NP_940931	A4FU69	EFCB5_HUMAN	EF-hand calcium binding domain 5 isoform a	448							calcium ion binding			ovary(1)|skin(1)	2						CTGAGTTGTGGGGAGACATGG	0.338													46	285	---	---	---	---	PASS
SUZ12	23512	broad.mit.edu	37	17	30320965	30320965	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30320965A>G	uc002hgs.2	+	12	1597	c.1375A>G	c.(1375-1377)AAA>GAA	p.K459E	SUZ12_uc002hgt.2_Missense_Mutation_p.K436E	NM_015355	NP_056170	Q15022	SUZ12_HUMAN	joined to JAZF1	459	C2H2-type.				negative regulation of cell differentiation|transcription, DNA-dependent	ESC/E(Z) complex	histone methyltransferase activity|methylated histone residue binding|zinc ion binding		JAZF1/SUZ12(131)	soft_tissue(98)|endometrium(33)	131		Myeloproliferative disorder(56;0.0255)|all_hematologic(16;0.041)|Ovarian(249;0.182)|Breast(31;0.231)				GAACTGCCGCAAACTTTATAG	0.313			T	JAZF1	endometrial stromal tumours								31	111	---	---	---	---	PASS
LRRC37B	114659	broad.mit.edu	37	17	30348235	30348235	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30348235G>C	uc002hgu.2	+	1	81	c.70G>C	c.(70-72)GAG>CAG	p.E24Q	LRRC37B_uc010wbx.1_Intron|LRRC37B_uc010csu.2_Missense_Mutation_p.E24Q	NM_052888	NP_443120	Q96QE4	LR37B_HUMAN	leucine rich repeat containing 37B precursor	24				FWGPWPLLTWQLLSLLVKE -> ITAMAPPYVATIVFTSQG (in Ref. 1; CAC44536).		integral to membrane				upper_aerodigestive_tract(1)|ovary(1)	2		Myeloproliferative disorder(56;0.0255)|all_hematologic(16;0.111)|Ovarian(249;0.182)|Breast(31;0.244)				ACTAGTCAAGGAGGCTCAGCC	0.592													22	342	---	---	---	---	PASS
MYO1D	4642	broad.mit.edu	37	17	30986349	30986349	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30986349C>T	uc002hho.1	-	17	2141	c.2129G>A	c.(2128-2130)CGG>CAG	p.R710Q	MYO1D_uc002hhp.1_Missense_Mutation_p.R710Q	NM_015194	NP_056009	O94832	MYO1D_HUMAN	myosin ID	710	IQ 1.					myosin complex	actin binding|ATP binding|calmodulin binding			large_intestine(1)|ovary(1)|central_nervous_system(1)	3			BRCA - Breast invasive adenocarcinoma(9;0.0362)			CAGGGTGCCCCGCCACACCTT	0.483											OREG0024311	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	23	81	---	---	---	---	PASS
ACCN1	40	broad.mit.edu	37	17	31438962	31438962	+	Nonsense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:31438962C>A	uc002hhu.2	-	2	953	c.679G>T	c.(679-681)GAG>TAG	p.E227*	ACCN1_uc002hht.2_Nonsense_Mutation_p.E278*	NM_001094	NP_001085	Q16515	ACCN1_HUMAN	amiloride-sensitive cation channel 1, neuronal	227	Extracellular (By similarity).				central nervous system development|peripheral nervous system development|synaptic transmission	integral to plasma membrane	ligand-gated sodium channel activity|protein binding			ovary(2)|large_intestine(1)|central_nervous_system(1)	4		Breast(31;0.042)|Ovarian(249;0.202)		UCEC - Uterine corpus endometrioid carcinoma (308;0.13)|BRCA - Breast invasive adenocarcinoma(366;0.215)	Amiloride(DB00594)	GGCAGGTACTCATCCTGCTGA	0.587													14	294	---	---	---	---	PASS
GGNBP2	79893	broad.mit.edu	37	17	34912988	34912988	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:34912988G>C	uc002hnb.2	+	4	489	c.240G>C	c.(238-240)CTG>CTC	p.L80L	GGNBP2_uc002hna.2_Silent_p.L80L	NM_024835	NP_079111	Q9H3C7	GGNB2_HUMAN	zinc finger protein 403	80					cell differentiation|multicellular organismal development|spermatogenesis	cytoplasmic membrane-bounded vesicle				ovary(2)	2		Breast(25;0.00957)|Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0193)		GCGAAGTCCTGAGTGCACTTT	0.483													69	331	---	---	---	---	PASS
KRT23	25984	broad.mit.edu	37	17	39084790	39084790	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39084790C>T	uc002hvm.1	-	5	1295	c.706G>A	c.(706-708)GAT>AAT	p.D236N	KRT23_uc010wfl.1_Missense_Mutation_p.D99N|KRT23_uc010cxf.1_Missense_Mutation_p.D23N|KRT23_uc010cxg.2_Missense_Mutation_p.D236N|KRT23_uc002hvn.1_Missense_Mutation_p.D236N	NM_015515	NP_056330	Q9C075	K1C23_HUMAN	keratin 23	236	Rod.|Linker 12.					intermediate filament	structural molecule activity			ovary(1)	1		Breast(137;0.000301)|Ovarian(249;0.15)				TTAATCAGATCTTCCCTGGGA	0.393													113	449	---	---	---	---	PASS
KCNH4	23415	broad.mit.edu	37	17	40317581	40317581	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40317581C>T	uc002hzb.2	-	11	2304	c.1971G>A	c.(1969-1971)CTG>CTA	p.L657L		NM_012285	NP_036417	Q9UQ05	KCNH4_HUMAN	potassium voltage-gated channel, subfamily H,	657	Cytoplasmic (Potential).|cNMP.				regulation of transcription, DNA-dependent	voltage-gated potassium channel complex	two-component sensor activity|voltage-gated potassium channel activity			large_intestine(1)	1		all_cancers(22;1.24e-06)|all_epithelial(22;4.33e-05)|Breast(137;0.000143)		BRCA - Breast invasive adenocarcinoma(366;0.126)		CTCGGCTGCTCAGCTGCTGCA	0.637													32	156	---	---	---	---	PASS
KCNH4	23415	broad.mit.edu	37	17	40318427	40318427	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40318427G>C	uc002hzb.2	-	10	2061	c.1728C>G	c.(1726-1728)TTC>TTG	p.F576L		NM_012285	NP_036417	Q9UQ05	KCNH4_HUMAN	potassium voltage-gated channel, subfamily H,	576	Cytoplasmic (Potential).|cNMP.				regulation of transcription, DNA-dependent	voltage-gated potassium channel complex	two-component sensor activity|voltage-gated potassium channel activity			large_intestine(1)	1		all_cancers(22;1.24e-06)|all_epithelial(22;4.33e-05)|Breast(137;0.000143)		BRCA - Breast invasive adenocarcinoma(366;0.126)		CCGGAGCGCAGAACGAGGTCT	0.627													13	102	---	---	---	---	PASS
FAM134C	162427	broad.mit.edu	37	17	40733896	40733896	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40733896C>T	uc002ial.2	-	9	1439	c.1336G>A	c.(1336-1338)GAC>AAC	p.D446N	FAM134C_uc010wgq.1_Missense_Mutation_p.D246N|FAM134C_uc002iam.1_Missense_Mutation_p.D246N|FAM134C_uc010cyk.1_Missense_Mutation_p.D349N	NM_178126	NP_835227	Q86VR2	F134C_HUMAN	hypothetical protein LOC162427	446						integral to membrane				upper_aerodigestive_tract(1)|ovary(1)	2		Breast(137;0.00116)		BRCA - Breast invasive adenocarcinoma(366;0.134)		AGTTCAAAGTCATCCCCCTCA	0.592													31	120	---	---	---	---	PASS
GFAP	2670	broad.mit.edu	37	17	42987579	42987579	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42987579G>C	uc002ihq.2	-						GFAP_uc002ihr.2_Silent_p.L407L	NM_002055	NP_002046	P14136	GFAP_HUMAN	glial fibrillary acidic protein isoform 1							cytoplasm|intermediate filament	structural constituent of cytoskeleton			ovary(1)|pancreas(1)	2		Prostate(33;0.0959)				TGAGGCTTTTGAGATATCTTG	0.483													18	528	---	---	---	---	PASS
LRRC46	90506	broad.mit.edu	37	17	45914174	45914174	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45914174G>A	uc002ima.2	+	8	910	c.654G>A	c.(652-654)ACG>ACA	p.T218T	LRRC46_uc002imb.2_Silent_p.T171T	NM_033413	NP_219481	Q96FV0	LRC46_HUMAN	leucine rich repeat containing 46	218	Potential.									ovary(1)	1						GGCAACAGACGGCCCTGACAG	0.682													7	150	---	---	---	---	PASS
HOXB8	3218	broad.mit.edu	37	17	46690586	46690586	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:46690586G>T	uc002inw.2	-	2	945	c.710C>A	c.(709-711)GCG>GAG	p.A237E	HOXB7_uc002inv.2_5'Flank	NM_024016	NP_076921	P17481	HXB8_HUMAN	homeobox B8	237						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0						GCCCTTCTGCGCGTCGCCCTC	0.443													55	227	---	---	---	---	PASS
SGCA	6442	broad.mit.edu	37	17	48243412	48243412	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48243412C>A	uc002iqi.2	+	1	47	c.11C>A	c.(10-12)ACA>AAA	p.T4K	SGCA_uc010wmh.1_5'UTR|SGCA_uc002iqj.2_Missense_Mutation_p.T4K|SGCA_uc010wmi.1_RNA	NM_000023	NP_000014	Q16586	SGCA_HUMAN	sarcoglycan, alpha isoform 1 precursor	4					muscle contraction|muscle organ development	cytoplasm|cytoskeleton|integral to membrane|sarcoglycan complex|sarcolemma	calcium ion binding			ovary(2)	2						ATGGCTGAGACACTCTTCTGG	0.483													83	472	---	---	---	---	PASS
CACNA1G	8913	broad.mit.edu	37	17	48669396	48669396	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48669396C>A	uc002irk.1	+	13	3225	c.2853C>A	c.(2851-2853)GGC>GGA	p.G951G	CACNA1G_uc002iri.1_Silent_p.G951G|CACNA1G_uc002irj.1_Silent_p.G951G|CACNA1G_uc002irl.1_Silent_p.G951G|CACNA1G_uc002irm.1_Silent_p.G951G|CACNA1G_uc002irn.1_Silent_p.G951G|CACNA1G_uc002iro.1_Silent_p.G951G|CACNA1G_uc002irp.1_Silent_p.G951G|CACNA1G_uc002irq.1_Silent_p.G951G|CACNA1G_uc002irr.1_Silent_p.G951G|CACNA1G_uc002irs.1_Silent_p.G951G|CACNA1G_uc002irt.1_Silent_p.G951G|CACNA1G_uc002irv.1_Silent_p.G951G|CACNA1G_uc002irw.1_Silent_p.G951G|CACNA1G_uc002iru.1_Silent_p.G951G|CACNA1G_uc002irx.1_Silent_p.G864G|CACNA1G_uc002iry.1_Silent_p.G864G|CACNA1G_uc002irz.1_Silent_p.G864G|CACNA1G_uc002isa.1_Silent_p.G864G|CACNA1G_uc002isb.1_Silent_p.G864G|CACNA1G_uc002isc.1_Silent_p.G864G|CACNA1G_uc002isd.1_Silent_p.G864G|CACNA1G_uc002ise.1_Silent_p.G864G|CACNA1G_uc002isf.1_Silent_p.G864G|CACNA1G_uc002isg.1_Silent_p.G864G|CACNA1G_uc002ish.1_Silent_p.G864G|CACNA1G_uc002isi.1_Silent_p.G864G	NM_018896	NP_061496	O43497	CAC1G_HUMAN	voltage-dependent calcium channel alpha 1G	951	II.|Helical; Name=S6 of repeat II; (Potential).				axon guidance	voltage-gated calcium channel complex	low voltage-gated calcium channel activity			breast(1)	1	Breast(11;6.7e-17)		BRCA - Breast invasive adenocarcinoma(22;7.52e-09)		Ethosuximide(DB00593)|Flunarizine(DB04841)|Levetiracetam(DB01202)|Mibefradil(DB01388)|Pimozide(DB01100)|Trimethadione(DB00347)|Verapamil(DB00661)|Zonisamide(DB00909)	TGACCTTCGGCAACTACGTGC	0.577													24	136	---	---	---	---	PASS
SFRS1	6426	broad.mit.edu	37	17	56084302	56084302	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56084302C>T	uc002ivi.2	-						SFRS1_uc002ivj.2_Intron	NM_006924	NP_008855	Q07955	SRSF1_HUMAN	splicing factor, arginine/serine-rich 1 isoform						mRNA 3'-end processing|mRNA export from nucleus|nuclear mRNA 5'-splice site recognition|termination of RNA polymerase II transcription	catalytic step 2 spliceosome|cytoplasm|nuclear speck	nucleotide binding|RNA binding				0		Colorectal(1115;0.0691)		LUAD - Lung adenocarcinoma(1115;0.247)		CATGCCGCCTCACCGCGGGTC	0.602													17	300	---	---	---	---	PASS
RNF43	54894	broad.mit.edu	37	17	56434896	56434896	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56434896C>T	uc002iwf.2	-	8	4197	c.2241G>A	c.(2239-2241)TGG>TGA	p.W747*	RNF43_uc010wnv.1_Nonsense_Mutation_p.W706*|RNF43_uc002iwh.3_Nonsense_Mutation_p.W747*|RNF43_uc002iwg.3_Nonsense_Mutation_p.W747*|RNF43_uc010dcw.2_Nonsense_Mutation_p.W620*	NM_017763	NP_060233	Q68DV7	RNF43_HUMAN	ring finger protein 43 precursor	747	Pro-rich.|Cytoplasmic (Potential).					endoplasmic reticulum membrane|integral to membrane|nuclear envelope	ligase activity|protein binding|zinc ion binding			ovary(1)	1	Medulloblastoma(34;0.127)|all_neural(34;0.237)					TGTCAGAACTCCATTCAGAAG	0.617													82	313	---	---	---	---	PASS
C17orf71	55181	broad.mit.edu	37	17	57290419	57290419	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57290419G>T	uc002ixi.2	+	3	2277	c.2235G>T	c.(2233-2235)GAG>GAT	p.E745D		NM_018149	NP_060619	Q8ND04	SMG8_HUMAN	SMG8 protein	745					nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|regulation of protein kinase activity		protein binding				0	all_neural(34;0.0837)|Medulloblastoma(34;0.0922)					CCACAGTTGAGTATCTCCCAG	0.448													49	272	---	---	---	---	PASS
ARSG	22901	broad.mit.edu	37	17	66381253	66381253	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66381253C>T	uc002jhc.2	+	9	1827	c.1031C>T	c.(1030-1032)CCA>CTA	p.P344L	ARSG_uc002jhb.1_Missense_Mutation_p.P180L	NM_014960	NP_055775	Q96EG1	ARSG_HUMAN	Arylsulfatase G precursor	344					sulfur compound metabolic process	endoplasmic reticulum|extracellular space|lysosome	arylsulfatase activity|metal ion binding			ovary(1)	1			BRCA - Breast invasive adenocarcinoma(8;5.34e-07)|LUSC - Lung squamous cell carcinoma(166;0.24)			CACCGGGTCCCAGCACTGGCT	0.562													28	264	---	---	---	---	PASS
DNAI2	64446	broad.mit.edu	37	17	72310317	72310317	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:72310317G>A	uc002jkf.2	+	13	1879	c.1780G>A	c.(1780-1782)GAA>AAA	p.E594K	DNAI2_uc002jkg.2_RNA|DNAI2_uc010dfp.2_RNA|DNAI2_uc002jki.2_RNA	NM_023036	NP_075462	Q9GZS0	DNAI2_HUMAN	dynein, axonemal, intermediate polypeptide 2	594					cilium assembly	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	microtubule motor activity			ovary(2)|central_nervous_system(1)	3						agcagcgggggaagaagggga	0.358									Kartagener_syndrome				86	79	---	---	---	---	PASS
SFRS2	6427	broad.mit.edu	37	17	74732373	74732373	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74732373G>C	uc002jsv.2	-	2	706	c.536C>G	c.(535-537)TCT>TGT	p.S179C	SFRS2_uc002jsw.1_RNA|SFRS2_uc002jsx.1_RNA|SFRS2_uc002jsy.3_Missense_Mutation_p.S179C|SFRS2_uc010wtg.1_Missense_Mutation_p.S167C|MFSD11_uc002jsz.1_RNA|MFSD11_uc002jta.2_5'UTR|MFSD11_uc002jtb.2_5'Flank|MFSD11_uc010dha.2_5'Flank|MFSD11_uc002jtc.2_5'Flank|MFSD11_uc002jtd.3_5'Flank|MFSD11_uc010dhb.2_5'Flank|MFSD11_uc002jte.2_5'Flank	NM_003016	NP_003007	Q01130	SRSF2_HUMAN	splicing factor, arginine/serine-rich 2	179	Arg/Ser-rich (RS domain).				mRNA 3'-end processing|mRNA export from nucleus|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	nuclear speck	nucleotide binding|protein binding|RNA binding|transcription corepressor activity				0						CCGCGAACGAGATCTGGAGAC	0.612													66	246	---	---	---	---	PASS
SFRS2	6427	broad.mit.edu	37	17	74733066	74733066	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74733066G>A	uc002jsv.2	-	1	347	c.177C>T	c.(175-177)TTC>TTT	p.F59F	SFRS2_uc002jsw.1_5'Flank|SFRS2_uc002jsx.1_RNA|SFRS2_uc002jsy.3_Silent_p.F59F|SFRS2_uc010wtg.1_Silent_p.F59F|MFSD11_uc002jsz.1_RNA|MFSD11_uc002jta.2_5'UTR|MIR636_hsa-mir-636|MI0003651_5'Flank|MFSD11_uc002jtb.2_5'Flank|MFSD11_uc010dha.2_5'Flank|MFSD11_uc002jtc.2_5'Flank|MFSD11_uc002jtd.3_5'Flank|MFSD11_uc010dhb.2_5'Flank|MFSD11_uc002jte.2_5'Flank	NM_003016	NP_003007	Q01130	SRSF2_HUMAN	splicing factor, arginine/serine-rich 2	59	RRM.				mRNA 3'-end processing|mRNA export from nucleus|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	nuclear speck	nucleotide binding|protein binding|RNA binding|transcription corepressor activity				0						GAAAGCGAACGAAGGCGAAGC	0.682													24	54	---	---	---	---	PASS
EMILIN2	84034	broad.mit.edu	37	18	2909706	2909706	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2909706C>T	uc002kln.2	+	7	2872	c.2713C>T	c.(2713-2715)CTG>TTG	p.L905L		NM_032048	NP_114437	Q9BXX0	EMIL2_HUMAN	elastin microfibril interfacer 2 precursor	905	C1q.				cell adhesion	collagen	extracellular matrix constituent conferring elasticity|protein binding			skin(2)|ovary(1)	3				READ - Rectum adenocarcinoma(2;0.1)		GGTGCCTTCTCTGGTGTCTTT	0.567													18	199	---	---	---	---	PASS
ZNF519	162655	broad.mit.edu	37	18	14105884	14105884	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:14105884C>T	uc002kst.1	-	3	808	c.655G>A	c.(655-657)GAC>AAC	p.D219N	ZNF519_uc002ksq.1_Intron|ZNF519_uc002ksr.1_Intron|ZNF519_uc010dlm.1_Intron	NM_145287	NP_660330	Q8TB69	ZN519_HUMAN	zinc finger protein 519	219					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						GAGAATGGGTCAGAAGTTTCA	0.303													6	113	---	---	---	---	PASS
ABHD3	171586	broad.mit.edu	37	18	19283711	19283711	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:19283711G>A	uc002ktl.2	-						ABHD3_uc002ktm.2_Intron|ABHD3_uc010xao.1_Intron|MIB1_uc002ktp.2_5'Flank|ABHD3_uc002kto.2_Intron	NM_138340	NP_612213	Q8WU67	ABHD3_HUMAN	alpha/beta hydrolase domain containing protein							integral to membrane	carboxylesterase activity			central_nervous_system(1)	1						TGGGGTTTCTGAAGGGAAAAG	0.562													5	85	---	---	---	---	PASS
MEP1B	4225	broad.mit.edu	37	18	29770096	29770096	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29770096G>T	uc002kxj.3	+	1	110	c.63G>T	c.(61-63)TTG>TTT	p.L21F		NM_005925	NP_005916	Q16820	MEP1B_HUMAN	meprin A beta precursor	21					digestion|proteolysis	extracellular space|integral to plasma membrane	metalloendopeptidase activity|zinc ion binding			ovary(2)	2						TTTCTGGCTTGGTAAGGAAAC	0.318													5	35	---	---	---	---	PASS
ASXL3	80816	broad.mit.edu	37	18	31318747	31318747	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:31318747C>G	uc010dmg.1	+	11	1434	c.1379C>G	c.(1378-1380)ACT>AGT	p.T460S	ASXL3_uc002kxq.2_Missense_Mutation_p.T167S	NM_030632	NP_085135	Q9C0F0	ASXL3_HUMAN	additional sex combs like 3	460					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	metal ion binding			ovary(2)|pancreas(1)	3						GAGGTAGAGACTAGTATCTGT	0.388													13	85	---	---	---	---	PASS
SETBP1	26040	broad.mit.edu	37	18	42532367	42532367	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:42532367G>T	uc010dni.2	+	4	3358	c.3062G>T	c.(3061-3063)AGG>ATG	p.R1021M		NM_015559	NP_056374	Q9Y6X0	SETBP_HUMAN	SET binding protein 1 isoform a	1021	A.T hook 2.					nucleus	DNA binding			upper_aerodigestive_tract(2)|large_intestine(1)	3				Colorectal(1;0.0622)|COAD - Colon adenocarcinoma(74;0.201)		AAGCGTGGTAGGCCTGCAAAA	0.438									Schinzel-Giedion_syndrome				42	133	---	---	---	---	PASS
C18orf54	162681	broad.mit.edu	37	18	51886933	51886933	+	5'UTR	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:51886933T>C	uc002lfn.3	+	2					C18orf54_uc002lfo.3_5'UTR	NM_173529	NP_775800	Q8IYD9	CR054_HUMAN	hypothetical protein LOC162681 precursor							extracellular region				ovary(1)|skin(1)	2				Colorectal(16;0.0206)|READ - Rectum adenocarcinoma(59;0.186)		CAATCCACTTTGAAGAAGCCA	0.363													19	127	---	---	---	---	PASS
TCF4	6925	broad.mit.edu	37	18	53131296	53131296	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:53131296G>C	uc002lfz.2	-						TCF4_uc002lfy.2_Intron|TCF4_uc010xdx.1_Intron|TCF4_uc010dph.1_Intron|TCF4_uc010xdy.1_Intron|TCF4_uc002lga.2_Intron|TCF4_uc010dpi.2_Intron|TCF4_uc002lgc.3_Intron	NM_003199	NP_003190	P15884	ITF2_HUMAN	transcription factor 4 isoform b						positive regulation of neuron differentiation|protein-DNA complex assembly|transcription initiation from RNA polymerase II promoter	transcription factor complex	E-box binding|protein C-terminus binding|protein heterodimerization activity|RNA polymerase II core promoter proximal region sequence-specific DNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|sequence-specific DNA binding RNA polymerase recruiting transcription factor activity|TFIIB-class binding transcription factor activity|TFIIB-class transcription factor binding			ovary(1)|lung(1)	2				Colorectal(16;0.00108)|READ - Rectum adenocarcinoma(59;0.0649)|COAD - Colon adenocarcinoma(17;0.0718)		GAAAAGATTAGATATACTTAC	0.363													33	210	---	---	---	---	PASS
LMAN1	3998	broad.mit.edu	37	18	56998750	56998750	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:56998750A>G	uc002lhz.2	-	12	1428	c.1396T>C	c.(1396-1398)TGC>CGC	p.C466R		NM_005570	NP_005561	P49257	LMAN1_HUMAN	lectin, mannose-binding, 1 precursor	466	Lumenal (Potential).				blood coagulation|ER to Golgi vesicle-mediated transport|post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine|protein transport	endoplasmic reticulum membrane|ER to Golgi transport vesicle membrane|ER-Golgi intermediate compartment membrane|Golgi membrane|integral to membrane	mannose binding|metal ion binding|unfolded protein binding			skin(1)	1		Colorectal(73;0.0946)			Antihemophilic Factor(DB00025)	AGTTCTGGGCATTTCGGCTTT	0.328													22	86	---	---	---	---	PASS
CDH19	28513	broad.mit.edu	37	18	64172297	64172297	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:64172297C>T	uc002lkc.1	-	12	2209	c.2071G>A	c.(2071-2073)GAC>AAC	p.D691N	CDH19_uc010dql.1_RNA|CDH19_uc010xey.1_3'UTR	NM_021153	NP_066976	Q9H159	CAD19_HUMAN	cadherin 19, type 2 preproprotein	691	Cytoplasmic (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(1)|skin(1)	2		Esophageal squamous(42;0.0132)				ATGGCACTGTCGGGGCCAACT	0.493													26	175	---	---	---	---	PASS
CDH19	28513	broad.mit.edu	37	18	64172298	64172298	+	Silent	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:64172298G>C	uc002lkc.1	-	12	2208	c.2070C>G	c.(2068-2070)CCC>CCG	p.P690P	CDH19_uc010dql.1_RNA|CDH19_uc010xey.1_3'UTR	NM_021153	NP_066976	Q9H159	CAD19_HUMAN	cadherin 19, type 2 preproprotein	690	Cytoplasmic (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(1)|skin(1)	2		Esophageal squamous(42;0.0132)				TGGCACTGTCGGGGCCAACTT	0.498													25	175	---	---	---	---	PASS
DOK6	220164	broad.mit.edu	37	18	67344978	67344978	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:67344978G>T	uc002lkl.2	+	4	488	c.298G>T	c.(298-300)GCC>TCC	p.A100S		NM_152721	NP_689934	Q6PKX4	DOK6_HUMAN	docking protein 6	100	PH.						insulin receptor binding			upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	3		Colorectal(73;0.083)|Esophageal squamous(42;0.131)				AGAGCTGGAGGCCGAGGAGTG	0.537													22	144	---	---	---	---	PASS
ZNF236	7776	broad.mit.edu	37	18	74587461	74587461	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74587461C>G	uc002lmi.2	+	6	873	c.675C>G	c.(673-675)TTC>TTG	p.F225L	ZNF236_uc002lmj.2_RNA|ZNF236_uc002lmk.1_Missense_Mutation_p.F225L	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	225	C2H2-type 7.				cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)		AAAGGCCGTTCAAATGTAGTG	0.418											OREG0025069	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	28	129	---	---	---	---	PASS
HCN2	610	broad.mit.edu	37	19	613497	613497	+	Intron	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:613497G>T	uc002lpe.2	+							NM_001194	NP_001185	Q9UL51	HCN2_HUMAN	hyperpolarization activated cyclic						cell-cell signaling|muscle contraction	voltage-gated potassium channel complex	cAMP binding|protein binding|sodium channel activity|voltage-gated potassium channel activity				0		all_epithelial(18;2.78e-22)|Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;3.55e-06)|all_lung(49;5.41e-06)|Breast(49;4.08e-05)|Hepatocellular(1079;0.137)|Renal(1328;0.228)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		GGGTGAGCTTGAGGGGGGCGC	0.502													15	117	---	---	---	---	PASS
C19orf21	126353	broad.mit.edu	37	19	758596	758596	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:758596G>A	uc002lpo.2	+	2	1733	c.1650G>A	c.(1648-1650)GAG>GAA	p.E550E		NM_173481	NP_775752	Q8IVT2	CS021_HUMAN	hypothetical protein LOC126353	550	Potential.									upper_aerodigestive_tract(1)	1		Acute lymphoblastic leukemia(61;4.36e-14)|all_hematologic(61;4.84e-09)|Lung NSC(49;0.000145)|all_lung(49;0.000236)|Breast(49;0.0014)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		TGGAAAGGGAGAGGGAGAGTG	0.627													13	275	---	---	---	---	PASS
C19orf36	113177	broad.mit.edu	37	19	2097681	2097681	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2097681C>T	uc002luw.1	+						C19orf36_uc002lux.1_Intron|C19orf36_uc010xgw.1_Intron	NM_001039846	NP_001034935	Q1ZYL8	IZUM4_HUMAN	hypothetical protein LOC113177 isoform 3							extracellular region					0		Ovarian(11;1.78e-06)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		GCGGGGACCTCCCCTAAGTAG	0.672													4	18	---	---	---	---	PASS
SH3GL1	6455	broad.mit.edu	37	19	4361705	4361705	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4361705G>C	uc002maj.2	-	10	1105	c.999C>G	c.(997-999)ATC>ATG	p.I333M	SH3GL1_uc002mak.2_Missense_Mutation_p.I269M|SH3GL1_uc010xig.1_Missense_Mutation_p.I285M	NM_003025	NP_003016	Q99961	SH3G1_HUMAN	SH3-domain GRB2-like 1	333	SH3.				central nervous system development|endocytosis|signal transduction	early endosome membrane	lipid binding|protein binding			ovary(2)	2				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0152)|STAD - Stomach adenocarcinoma(1328;0.182)		TGGTCAGCGTGATGACGTCGC	0.657			T	MLL	AL								17	114	---	---	---	---	PASS
MUC16	94025	broad.mit.edu	37	19	9020762	9020762	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9020762C>T	uc002mkp.2	-							NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16						cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57						TCTAAGGTCTCACCTGAGAGA	0.537													7	192	---	---	---	---	PASS
MUC16	94025	broad.mit.edu	37	19	9070578	9070578	+	Missense_Mutation	SNP	G	C	C	rs141378906	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9070578G>C	uc002mkp.2	-	3	17072	c.16868C>G	c.(16867-16869)CCC>CGC	p.P5623R		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	5625	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57						TTCCACAGGGGGAGTTGTCAT	0.537													43	56	---	---	---	---	PASS
ZNF559	84527	broad.mit.edu	37	19	9452522	9452522	+	Missense_Mutation	SNP	C	G	G	rs145348538		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9452522C>G	uc002mlg.2	+	7	1042	c.395C>G	c.(394-396)TCT>TGT	p.S132C	ZNF559_uc002mlf.2_5'UTR|ZNF559_uc010dwl.1_5'UTR|ZNF559_uc010xkn.1_Missense_Mutation_p.S124C|ZNF559_uc010dwm.1_3'UTR|ZNF559_uc002mle.3_Missense_Mutation_p.S196C|ZNF559_uc010dwk.1_5'UTR|ZNF559_uc002mld.2_3'UTR|ZNF559_uc010dwo.1_Intron|ZNF177_uc002mli.2_Intron|ZNF177_uc002mlj.2_Intron	NM_032497	NP_115886	Q9BR84	ZN559_HUMAN	zinc finger protein 559	132	C2H2-type 2; degenerate.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1						AGAAAACCCTCTATCTTTACT	0.388													30	167	---	---	---	---	PASS
OLFM2	93145	broad.mit.edu	37	19	9965213	9965213	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9965213G>A	uc002mmp.2	-	6	1042	c.1014C>T	c.(1012-1014)ACC>ACT	p.T338T	OLFM2_uc002mmo.2_Silent_p.T260T	NM_058164	NP_477512	O95897	NOE2_HUMAN	olfactomedin 2 precursor	338	Olfactomedin-like.					extracellular region				large_intestine(1)|skin(1)	2						CGTTCTGGTTGGTGGTGTACA	0.662													34	135	---	---	---	---	PASS
KEAP1	9817	broad.mit.edu	37	19	10600447	10600447	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10600447G>A	uc002moq.1	-	4	1564	c.1408C>T	c.(1408-1410)CGT>TGT	p.R470C	KEAP1_uc002mop.1_Missense_Mutation_p.R188C|KEAP1_uc002mor.1_Missense_Mutation_p.R470C	NM_012289	NP_036421	Q14145	KEAP1_HUMAN	kelch-like ECH-associated protein 1	470	Kelch 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	centrosome|midbody|nucleus	protein binding			lung(12)|breast(3)|ovary(1)|pancreas(1)	17			OV - Ovarian serous cystadenocarcinoma(20;2.71e-09)|Epithelial(33;2.32e-06)|all cancers(31;1.42e-05)			TAAAGGAGACGATTGAGGACA	0.557													26	84	---	---	---	---	PASS
KEAP1	9817	broad.mit.edu	37	19	10602619	10602619	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10602619C>T	uc002moq.1	-	3	1115	c.959G>A	c.(958-960)CGG>CAG	p.R320Q	KEAP1_uc002mop.1_Missense_Mutation_p.R38Q|KEAP1_uc002mor.1_Missense_Mutation_p.R320Q	NM_012289	NP_036421	Q14145	KEAP1_HUMAN	kelch-like ECH-associated protein 1	320					regulation of transcription, DNA-dependent|transcription, DNA-dependent	centrosome|midbody|nucleus	protein binding			lung(12)|breast(3)|ovary(1)|pancreas(1)	17			OV - Ovarian serous cystadenocarcinoma(20;2.71e-09)|Epithelial(33;2.32e-06)|all cancers(31;1.42e-05)			CTTGGGCGCCCGGCAGGGCAT	0.642													20	83	---	---	---	---	PASS
PGLYRP2	114770	broad.mit.edu	37	19	15579564	15579564	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15579564C>T	uc002nbf.3	-							NM_052890	NP_443122	Q96PD5	PGRP2_HUMAN	peptidoglycan recognition protein 2 precursor						defense response to Gram-positive bacterium|detection of bacterium|innate immune response|peptide amidation|peptidoglycan catabolic process	extracellular region|intracellular|membrane	N-acetylmuramoyl-L-alanine amidase activity|peptidoglycan receptor activity|zinc ion binding			ovary(3)	3						GCTTAACAGTCTGGAAAAAGA	0.582													33	237	---	---	---	---	PASS
CYP4F3	4051	broad.mit.edu	37	19	15760021	15760021	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15760021G>T	uc002nbj.2	+	6	627	c.577G>T	c.(577-579)GAG>TAG	p.E193*	CYP4F3_uc010xok.1_Nonsense_Mutation_p.E193*|CYP4F3_uc010xol.1_Nonsense_Mutation_p.E193*|CYP4F3_uc010xom.1_Nonsense_Mutation_p.E44*|CYP4F3_uc002nbk.2_Nonsense_Mutation_p.E193*|CYP4F3_uc010xon.1_5'Flank	NM_000896	NP_000887	Q08477	CP4F3_HUMAN	cytochrome P450, family 4, subfamily F,	193					leukotriene metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	electron carrier activity|heme binding|leukotriene-B4 20-monooxygenase activity|oxygen binding			ovary(3)	3						GGACATGTTTGAGCACATCAG	0.572													78	162	---	---	---	---	PASS
SIN3B	23309	broad.mit.edu	37	19	16973243	16973243	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16973243G>C	uc002ney.1	+	9	1153	c.1139G>C	c.(1138-1140)AGA>ACA	p.R380T	SIN3B_uc002nex.2_Missense_Mutation_p.R312T|SIN3B_uc002nez.1_Missense_Mutation_p.R380T|SIN3B_uc010xpi.1_5'Flank	NM_015260	NP_056075	O75182	SIN3B_HUMAN	SIN3 homolog B, transcription regulator	380	Interaction with NCOR1 (By similarity).				cellular lipid metabolic process|transcription, DNA-dependent	nucleoplasm	protein binding			ovary(2)	2						ATGAGCGACAGATCCGGGGAC	0.522													22	182	---	---	---	---	PASS
UNC13A	23025	broad.mit.edu	37	19	17732678	17732678	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17732678C>T	uc002nhd.2	-	36	4469	c.4469G>A	c.(4468-4470)GGG>GAG	p.G1490E		NM_001080421	NP_001073890	Q9UPW8	UN13A_HUMAN	unc-13 homolog A	1402	MHD2.				exocytosis|intracellular signal transduction	cell junction|cytoplasm|presynaptic membrane	metal ion binding			ovary(3)	3						CAAGAGGTTCCCCTGCAGAGA	0.532													28	221	---	---	---	---	PASS
KIAA1683	80726	broad.mit.edu	37	19	18377278	18377278	+	Missense_Mutation	SNP	T	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:18377278T>C	uc002nin.2	-	3	1288	c.1072A>G	c.(1072-1074)ACG>GCG	p.T358A	KIAA1683_uc010ebn.2_Missense_Mutation_p.T358A|KIAA1683_uc010xqe.1_Missense_Mutation_p.T312A	NM_025249	NP_079525	Q9H0B3	K1683_HUMAN	KIAA1683 isoform b	358	Thr-rich.					mitochondrion				ovary(2)	2						GTGGTCATCGTGGACGCTGGA	0.552													49	243	---	---	---	---	PASS
ZNF493	284443	broad.mit.edu	37	19	21606071	21606071	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:21606071C>T	uc002npx.2	+	2	506	c.226C>T	c.(226-228)CAT>TAT	p.H76Y	ZNF493_uc002npw.2_Missense_Mutation_p.H204Y|ZNF493_uc002npy.2_Missense_Mutation_p.H76Y	NM_175910	NP_787106	Q6ZR52	ZN493_HUMAN	zinc finger protein 493 isoform 1	76	C2H2-type 2.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1						TAAAAGAATTCATATTAGAGA	0.348													10	131	---	---	---	---	PASS
ZNF429	353088	broad.mit.edu	37	19	21720462	21720462	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:21720462C>T	uc002nqd.1	+	4	1744	c.1607C>T	c.(1606-1608)CCT>CTT	p.P536L	ZNF429_uc010ecu.1_Intron	NM_001001415	NP_001001415	Q86V71	ZN429_HUMAN	zinc finger protein 429	536					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2						GGAGAGAAACCTTACAAATGT	0.368													7	104	---	---	---	---	PASS
ZNF43	7594	broad.mit.edu	37	19	21992534	21992534	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:21992534C>T	uc002nqj.2	-	4	435	c.305G>A	c.(304-306)AGA>AAA	p.R102K	ZNF43_uc010ecv.2_Missense_Mutation_p.R96K|ZNF43_uc002nql.2_Missense_Mutation_p.R96K|ZNF43_uc002nqm.2_Missense_Mutation_p.R96K|ZNF43_uc002nqk.2_Missense_Mutation_p.R32K	NM_003423	NP_003414	P17038	ZNF43_HUMAN	zinc finger protein 43	102					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			large_intestine(1)|ovary(1)	2		Renal(1328;0.000219)|Hepatocellular(1079;0.121)		GBM - Glioblastoma multiforme(1328;5.97e-05)|STAD - Stomach adenocarcinoma(1328;0.0127)		TTTATATCTTCTCAGTGTCGC	0.313													29	158	---	---	---	---	PASS
ZNF208	7757	broad.mit.edu	37	19	22155700	22155700	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22155700C>T	uc002nqp.2	-	5	1985	c.1836G>A	c.(1834-1836)AAG>AAA	p.K612K	ZNF208_uc002nqo.1_Intron	NM_007153	NP_009084			zinc finger protein 208											ovary(5)|skin(2)	7		all_lung(12;0.0961)|Lung NSC(12;0.103)				TATGAATTCTCTTATGTTCCA	0.368													19	106	---	---	---	---	PASS
ZNF676	163223	broad.mit.edu	37	19	22363232	22363232	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22363232G>T	uc002nqs.1	-	3	1605	c.1287C>A	c.(1285-1287)GCC>GCA	p.A429A		NM_001001411	NP_001001411	Q8N7Q3	ZN676_HUMAN	zinc finger protein 676	429	C2H2-type 10.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Lung NSC(12;0.0207)|all_lung(12;0.0214)|all_epithelial(12;0.114)				ACCAGCTGAAGGCTTTGCCAC	0.443													60	169	---	---	---	---	PASS
ZNF676	163223	broad.mit.edu	37	19	22363386	22363386	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22363386G>A	uc002nqs.1	-	3	1451	c.1133C>T	c.(1132-1134)TCA>TTA	p.S378L		NM_001001411	NP_001001411	Q8N7Q3	ZN676_HUMAN	zinc finger protein 676	378	C2H2-type 8.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Lung NSC(12;0.0207)|all_lung(12;0.0214)|all_epithelial(12;0.114)				ATTAAGGGTTGAGACCTTACT	0.393													9	174	---	---	---	---	PASS
ZNF98	148198	broad.mit.edu	37	19	22574587	22574587	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22574587G>A	uc002nqt.2	-	4	1572	c.1450C>T	c.(1450-1452)CAT>TAT	p.H484Y		NM_001098626	NP_001092096	A6NK75	ZNF98_HUMAN	zinc finger protein 98	484	C2H2-type 11.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|skin(1)	2		all_cancers(12;0.0536)|all_lung(12;0.00187)|Lung NSC(12;0.0019)|all_epithelial(12;0.00542)|Hepatocellular(1079;0.244)				TCTCCAGTATGAATTACCTTA	0.378													21	172	---	---	---	---	PASS
ZNF536	9745	broad.mit.edu	37	19	31039095	31039095	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:31039095C>T	uc002nsu.1	+	4	2707	c.2569C>T	c.(2569-2571)CAG>TAG	p.Q857*	ZNF536_uc010edd.1_Nonsense_Mutation_p.Q857*	NM_014717	NP_055532	O15090	ZN536_HUMAN	zinc finger protein 536	857					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(7)|large_intestine(2)|skin(2)	11	Esophageal squamous(110;0.0834)					CCCTGCATCTCAGCAGTGGAC	0.577													24	280	---	---	---	---	PASS
SCN1B	6324	broad.mit.edu	37	19	35524651	35524651	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35524651G>A	uc002nxp.2	+						SCN1B_uc002nxo.1_Silent_p.S152S|SCN1B_uc010xsg.1_Intron	NM_001037	NP_001028	Q07699	SCN1B_HUMAN	sodium channel, voltage-gated, type I, beta						axon guidance|synaptic transmission	integral to membrane	voltage-gated sodium channel activity			ovary(1)|central_nervous_system(1)	2	all_lung(56;2.66e-08)|Lung NSC(56;4.13e-08)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0849)			AAGGTGAGTCGGGTGCTGCCT	0.592													36	238	---	---	---	---	PASS
CD22	933	broad.mit.edu	37	19	35837110	35837110	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35837110C>G	uc010edt.2	+	13	2461	c.2384C>G	c.(2383-2385)ACT>AGT	p.T795S	CD22_uc010xst.1_Missense_Mutation_p.T623S|CD22_uc010edu.2_Missense_Mutation_p.T707S|CD22_uc010edv.2_3'UTR|CD22_uc002nzb.3_Missense_Mutation_p.T618S|CD22_uc010edx.2_RNA	NM_001771	NP_001762	P20273	CD22_HUMAN	CD22 molecule precursor	795	Cytoplasmic (Potential).|ITIM motif 2.				cell adhesion		protein binding|sugar binding			ovary(5)|lung(3)|breast(1)	9	all_lung(56;9.78e-09)|Lung NSC(56;1.46e-08)|Esophageal squamous(110;0.162)		Epithelial(14;5.83e-19)|OV - Ovarian serous cystadenocarcinoma(14;3.19e-18)|all cancers(14;3.41e-16)|LUSC - Lung squamous cell carcinoma(66;0.0417)		OspA lipoprotein(DB00045)	GACACGGTCACTTATTCAGCA	0.602													10	276	---	---	---	---	PASS
ETV2	2116	broad.mit.edu	37	19	36135685	36135685	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36135685C>T	uc002oas.2	+	6	1483	c.1044C>T	c.(1042-1044)TTC>TTT	p.F348F	ETV2_uc002oar.2_Silent_p.F320F|ETV2_uc002oat.2_Silent_p.F227F|ETV2_uc002oau.2_Silent_p.F133F	NM_014209	NP_055024	O00321	ETV2_HUMAN	ets variant gene 2	319							sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0	all_lung(56;2.22e-07)|Lung NSC(56;3.47e-07)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0515)			CGTACCGCTTCGGGGGCCGCG	0.627													4	26	---	---	---	---	PASS
TMEM149	79713	broad.mit.edu	37	19	36230531	36230531	+	Intron	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36230531G>C	uc002obc.2	-						TMEM149_uc002obb.2_Intron|TMEM149_uc002obd.3_Intron|TMEM149_uc010xsy.1_Intron|TMEM149_uc010eej.2_Intron	NM_024660	NP_078936	Q9H665	IGFR1_HUMAN	transmembrane protein 149 precursor							integral to membrane|plasma membrane	protein binding|receptor activity				0	all_lung(56;3.33e-07)|Lung NSC(56;5.02e-07)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0515)			GACAGTTCTGGAAGAAAGGGG	0.617													27	194	---	---	---	---	PASS
ALKBH6	84964	broad.mit.edu	37	19	36501816	36501816	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36501816G>C	uc002oct.2	-	5	416	c.316C>G	c.(316-318)CTG>GTG	p.L106V	C19orf46_uc002ocr.1_5'Flank|C19orf46_uc002ocs.1_5'Flank|C19orf46_uc002ocq.1_5'Flank|C19orf46_uc010een.1_5'Flank|ALKBH6_uc002ocv.1_Missense_Mutation_p.L134V|ALKBH6_uc002ocx.1_Missense_Mutation_p.L37V|ALKBH6_uc002ocw.1_Missense_Mutation_p.L134V|ALKBH6_uc010eeo.1_Missense_Mutation_p.L106V|ALKBH6_uc010eep.1_Missense_Mutation_p.L134V	NM_032878	NP_116267	Q3KRA9	ALKB6_HUMAN	alkB, alkylation repair homolog 6 isoform 2	106	Fe2OG dioxygenase.					cytoplasm|nucleus	metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen				0	all_lung(56;1.35e-06)|Lung NSC(56;2.15e-06)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.06)			TCCCCAGGCAGATACTGGTTC	0.617													12	219	---	---	---	---	PASS
ZNF527	84503	broad.mit.edu	37	19	37880588	37880588	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37880588G>T	uc010efk.1	+	5	1748	c.1637G>T	c.(1636-1638)AGA>ATA	p.R546I	ZNF527_uc002ogf.3_Missense_Mutation_p.R514I|ZNF527_uc010xtq.1_RNA	NM_032453	NP_115829	Q8NB42	ZN527_HUMAN	zinc finger protein 527	546	C2H2-type 10.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2			COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)			CAACATCAAAGAATTCATACT	0.403													11	161	---	---	---	---	PASS
EIF3K	27335	broad.mit.edu	37	19	39116687	39116687	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39116687G>A	uc002oiz.1	+	4	486	c.299G>A	c.(298-300)CGA>CAA	p.R100Q	EIF3K_uc010xuh.1_Missense_Mutation_p.R100Q|EIF3K_uc010xui.1_Missense_Mutation_p.R13Q	NM_013234	NP_037366	Q9UBQ5	EIF3K_HUMAN	eukaryotic translation initiation factor 3,	100					regulation of translational initiation	cytosol|eukaryotic translation initiation factor 3 complex|nucleus	protein binding|ribosome binding|translation initiation factor activity			ovary(1)|central_nervous_system(1)	2	all_cancers(60;6.42e-06)|Ovarian(47;0.103)		Lung(45;0.000751)|LUSC - Lung squamous cell carcinoma(53;0.00272)			CGGCCAATCCGACAGATTTTG	0.587													50	341	---	---	---	---	PASS
PSG8	440533	broad.mit.edu	37	19	43268417	43268417	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43268417G>T	uc002ouo.2	-	2	179	c.81C>A	c.(79-81)TTC>TTA	p.F27L	PSG3_uc002ouf.2_Intron|PSG1_uc002oug.1_Intron|PSG8_uc002oui.2_Intron|PSG8_uc002ouh.2_Missense_Mutation_p.F27L|PSG8_uc010ein.2_Intron|PSG8_uc002ouj.3_Translation_Start_Site|PSG8_uc002ouk.3_Intron|PSG8_uc002oul.3_Missense_Mutation_p.F27L|PSG8_uc002oum.3_Missense_Mutation_p.F27L|PSG1_uc002oun.2_Intron|PSG8_uc002oup.3_Missense_Mutation_p.F27L	NM_182707	NP_874366	Q9UQ74	PSG8_HUMAN	pregnancy specific beta-1-glycoprotein 8 isoform	27						extracellular region					0		Prostate(69;0.00899)				GTGGGTTCCAGAAGTTTAAAA	0.488													40	372	---	---	---	---	PASS
CADM4	199731	broad.mit.edu	37	19	44128312	44128312	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44128312G>A	uc002oxc.1	-	8	1060	c.1011C>T	c.(1009-1011)ATC>ATT	p.I337I		NM_145296	NP_660339	Q8NFZ8	CADM4_HUMAN	cell adhesion molecule 4 precursor	337	Helical; (Potential).				cell adhesion	integral to membrane					0		Prostate(69;0.0199)				GCACACATATGATCAGAAACA	0.612													42	202	---	---	---	---	PASS
ZNF227	7770	broad.mit.edu	37	19	44739709	44739709	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44739709G>A	uc002oyu.2	+	6	1331	c.1126G>A	c.(1126-1128)GAA>AAA	p.E376K	ZNF227_uc010xwu.1_Missense_Mutation_p.E325K|ZNF227_uc002oyv.2_Missense_Mutation_p.E376K|ZNF227_uc010xwv.1_Missense_Mutation_p.E325K|ZNF227_uc010xww.1_Missense_Mutation_p.E297K|ZNF227_uc002oyw.2_Missense_Mutation_p.E348K|ZNF227_uc010ejh.2_Missense_Mutation_p.E369K|ZNF235_uc002oyx.1_Intron	NM_182490	NP_872296	Q86WZ6	ZN227_HUMAN	zinc finger protein 227	376					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Prostate(69;0.0435)				AGTCCACACTGAAGAAAAACC	0.438													21	108	---	---	---	---	PASS
SIX5	147912	broad.mit.edu	37	19	46269050	46269050	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46269050G>A	uc002pdb.2	-	3	2324	c.1929C>T	c.(1927-1929)CTC>CTT	p.L643L	SIX5_uc002pdc.2_3'UTR	NM_175875	NP_787071	Q8N196	SIX5_HUMAN	SIX homeobox 5	643						cytoplasm|nucleus	protein binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1		Ovarian(192;0.0308)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.00783)|GBM - Glioblastoma multiforme(486;0.0802)|Epithelial(262;0.235)		AGTTGGGCAGGAGGCCAGGGG	0.687													6	108	---	---	---	---	PASS
GYS1	2997	broad.mit.edu	37	19	49489218	49489218	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49489218G>A	uc002plp.2	-	4	808	c.567C>T	c.(565-567)TGC>TGT	p.C189C	GYS1_uc010xzy.1_Intron|GYS1_uc010emm.2_Silent_p.C125C|GYS1_uc010xzz.1_Silent_p.C109C|GYS1_uc010yaa.1_RNA	NM_002103	NP_002094	P13807	GYS1_HUMAN	glycogen synthase 1 (muscle) isoform 1	189					glucose metabolic process|glycogen biosynthetic process	cytosol	glycogen (starch) synthase activity|protein binding			ovary(2)	2		all_lung(116;4.89e-05)|Lung NSC(112;8.3e-05)|all_epithelial(76;8.64e-05)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.000164)|all cancers(93;0.000226)|GBM - Glioblastoma multiforme(486;0.00561)|Epithelial(262;0.0286)		CACGACACAGGCAGAGTCCAA	0.607													24	110	---	---	---	---	PASS
SIGLEC10	89790	broad.mit.edu	37	19	51920330	51920330	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:51920330C>T	uc002pwo.2	-						SIGLEC10_uc002pwp.2_Intron|SIGLEC10_uc002pwq.2_Intron|SIGLEC10_uc002pwr.2_Intron|SIGLEC10_uc010ycy.1_Intron|SIGLEC10_uc010ycz.1_Intron|SIGLEC10_uc010eow.2_Intron|SIGLEC10_uc002pws.1_Intron	NM_033130	NP_149121	Q96LC7	SIG10_HUMAN	sialic acid binding Ig-like lectin 10 precursor						cell adhesion	extracellular region|integral to membrane|plasma membrane	sugar binding			skin(1)	1		all_neural(266;0.0199)		GBM - Glioblastoma multiforme(134;0.000668)|OV - Ovarian serous cystadenocarcinoma(262;0.0101)		CCACCCCATTCCATACCTGTT	0.527													21	187	---	---	---	---	PASS
SIGLEC6	946	broad.mit.edu	37	19	52033942	52033942	+	Silent	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52033942A>G	uc002pwy.2	-	3	861	c.699T>C	c.(697-699)AAT>AAC	p.N233N	SIGLEC6_uc002pwz.2_Silent_p.N233N|SIGLEC6_uc002pxa.2_Silent_p.N233N|SIGLEC6_uc010ydb.1_Silent_p.N186N|SIGLEC6_uc010ydc.1_Silent_p.N222N|SIGLEC6_uc010eoz.1_Silent_p.N211N|SIGLEC6_uc010epb.1_Silent_p.N186N|SIGLEC6_uc010epa.1_Silent_p.N222N	NM_001245	NP_001236	O43699	SIGL6_HUMAN	sialic acid binding Ig-like lectin 6 isoform 1	233	Extracellular (Potential).				cell adhesion|cell-cell signaling	cytoplasm|extracellular region|integral to plasma membrane|membrane fraction|nucleus				ovary(1)	1		all_neural(266;0.0199)		GBM - Glioblastoma multiforme(134;0.00115)|OV - Ovarian serous cystadenocarcinoma(262;0.0165)		CACAGGAGACATTGAGCTGGA	0.627													78	209	---	---	---	---	PASS
ZNF816A	125893	broad.mit.edu	37	19	53454331	53454331	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53454331C>G	uc002qal.1	-	5	998	c.697G>C	c.(697-699)GAG>CAG	p.E233Q	ZNF321_uc010eqj.2_Intron|ZNF321_uc002qak.1_Intron|ZNF816A_uc002qam.1_Missense_Mutation_p.E217Q	NM_001031665	NP_001026835	Q0VGE8	ZN816_HUMAN	zinc finger protein 816A	233	C2H2-type 1.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.0313)		TTGCCACACTCATTACTTTGG	0.353													24	187	---	---	---	---	PASS
ZNF665	79788	broad.mit.edu	37	19	53668754	53668754	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53668754C>A	uc010eqm.1	-	4	1089	c.989G>T	c.(988-990)CGC>CTC	p.R330L		NM_024733	NP_079009	Q9H7R5	ZN665_HUMAN	zinc finger protein 665	265	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2				GBM - Glioblastoma multiforme(134;0.0196)		CAGGCTTGAGCGAACACTAAA	0.428													10	260	---	---	---	---	PASS
ZNF665	79788	broad.mit.edu	37	19	53669024	53669024	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53669024C>T	uc010eqm.1	-	4	819	c.719G>A	c.(718-720)GGA>GAA	p.G240E		NM_024733	NP_079009	Q9H7R5	ZN665_HUMAN	zinc finger protein 665	175	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2				GBM - Glioblastoma multiforme(134;0.0196)		GAAGACCTTTCCACATTCATT	0.403													52	258	---	---	---	---	PASS
TMC4	147798	broad.mit.edu	37	19	54665951	54665951	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54665951C>T	uc010erf.2	-	11	1723	c.1591G>A	c.(1591-1593)GAG>AAG	p.E531K	LENG1_uc002qdm.2_5'Flank|TMC4_uc002qdn.2_Missense_Mutation_p.E245K|TMC4_uc002qdo.2_Missense_Mutation_p.E525K	NM_001145303	NP_001138775	Q7Z404	TMC4_HUMAN	transmembrane channel-like 4 isoform 1	531	Extracellular (Potential).					integral to membrane				pancreas(1)	1	all_cancers(19;0.0065)|all_epithelial(19;0.00348)|all_lung(19;0.0175)|Lung NSC(19;0.0325)|Ovarian(34;0.19)					CCCAGCACCTCGTCGGGCACC	0.652													15	51	---	---	---	---	PASS
LILRA2	11027	broad.mit.edu	37	19	55085814	55085814	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55085814C>T	uc002qgg.3	+	3	206	c.117C>T	c.(115-117)ATC>ATT	p.I39I	LILRA2_uc010ern.2_Silent_p.I39I|LILRA2_uc002qgf.2_Silent_p.I39I|LILRA2_uc010yfe.1_Silent_p.I39I|LILRA2_uc010yff.1_Silent_p.I27I|LILRA2_uc010ero.2_Silent_p.I27I|LILRA2_uc010yfg.1_Silent_p.I39I	NM_001130917	NP_001124389	Q8N149	LIRA2_HUMAN	leukocyte immunoglobulin-like receptor,	39	Extracellular (Potential).|Ig-like C2-type 1.				defense response	integral to membrane	antigen binding|receptor activity			ovary(1)	1				GBM - Glioblastoma multiforme(193;0.0963)		GCTCTGTGATCATCCAGGGAA	0.542													39	313	---	---	---	---	PASS
ZSCAN5B	342933	broad.mit.edu	37	19	56702224	56702224	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56702224G>A	uc010ygh.1	-	3	721	c.721C>T	c.(721-723)CAG>TAG	p.Q241*		NM_001080456	NP_001073925	A6NJL1	ZSA5B_HUMAN	zinc finger and SCAN domain containing 5B	241					viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|skin(1)	2						TTTGGAAGCTGAGGCTCTGGG	0.557													11	275	---	---	---	---	PASS
ZNF583	147949	broad.mit.edu	37	19	56935138	56935138	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56935138C>T	uc010ygl.1	+	5	1276	c.1111C>T	c.(1111-1113)CAG>TAG	p.Q371*	ZNF583_uc002qnc.2_Nonsense_Mutation_p.Q371*|ZNF583_uc010ygm.1_Nonsense_Mutation_p.Q371*	NM_001159860	NP_001153332	Q96ND8	ZN583_HUMAN	zinc finger protein 583	371	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|Ovarian(87;0.243)		GBM - Glioblastoma multiforme(193;0.0564)		AATTGTACATCAGAGAATTCA	0.428													9	161	---	---	---	---	PASS
ZSCAN4	201516	broad.mit.edu	37	19	58190285	58190285	+	3'UTR	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58190285G>C	uc002qpu.2	+	5						NM_152677	NP_689890	Q8NAM6	ZSCA4_HUMAN	zinc finger and SCAN domain containing 4						telomere maintenance via telomere lengthening|viral reproduction	nuclear chromosome, telomeric region	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)		CTGCTGGTCTGATAATGTGTA	0.299													12	169	---	---	---	---	PASS
TGM6	343641	broad.mit.edu	37	20	2411116	2411116	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:2411116C>G	uc002wfy.1	+	11	1764	c.1703C>G	c.(1702-1704)TCT>TGT	p.S568C	TGM6_uc010gal.1_Missense_Mutation_p.S568C	NM_198994	NP_945345	O95932	TGM3L_HUMAN	transglutaminase 6	568					cell death|peptide cross-linking		acyltransferase activity|metal ion binding|protein-glutamine gamma-glutamyltransferase activity			ovary(3)|skin(1)	4					L-Glutamine(DB00130)	ATTACAATATCTTACTCTAAG	0.468													9	273	---	---	---	---	PASS
BTBD3	22903	broad.mit.edu	37	20	11899807	11899807	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:11899807C>T	uc002wnz.2	+	2	759	c.400C>T	c.(400-402)CGG>TGG	p.R134W	BTBD3_uc002wny.2_Missense_Mutation_p.R73W|BTBD3_uc002woa.2_Missense_Mutation_p.R73W|BTBD3_uc010zrf.1_Intron|BTBD3_uc010zrg.1_5'Flank|BTBD3_uc010zrh.1_5'Flank	NM_014962	NP_055777	Q9Y2F9	BTBD3_HUMAN	BTB/POZ domain containing protein 3 isoform a	134	BTB.									ovary(2)|central_nervous_system(1)	3						TGGGACTCAACGGTTGCCAGG	0.453													7	60	---	---	---	---	PASS
ESF1	51575	broad.mit.edu	37	20	13755921	13755921	+	Intron	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:13755921G>A	uc002woj.2	-						ESF1_uc002wok.1_Intron	NM_016649	NP_057733	Q9H501	ESF1_HUMAN	ABT1-associated protein						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus|nucleoplasm				ovary(1)	1						TGTAATCTGAGAAATGAGAAG	0.338													43	214	---	---	---	---	PASS
CRNKL1	51340	broad.mit.edu	37	20	20033046	20033046	+	Nonsense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:20033046G>A	uc002wrs.2	-	2	456	c.424C>T	c.(424-426)CAG>TAG	p.Q142*	C20orf26_uc010gcw.1_5'Flank|C20orf26_uc010zse.1_5'Flank|C20orf26_uc002wru.2_5'Flank|CRNKL1_uc002wrt.1_Nonsense_Mutation_p.Q130*	NM_016652	NP_057736	Q9BZJ0	CRNL1_HUMAN	crooked neck-like 1 protein	142					spliceosome assembly	catalytic step 2 spliceosome|cytoplasm|nuclear speck	RNA binding			ovary(2)|large_intestine(1)	3						AATCGGCTCTGAGAGCTCACC	0.592													13	173	---	---	---	---	PASS
XRN2	22803	broad.mit.edu	37	20	21314742	21314742	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:21314742C>T	uc002wsf.1	+	13	1247	c.1152C>T	c.(1150-1152)GTC>GTT	p.V384V	XRN2_uc002wsg.1_Silent_p.V308V|XRN2_uc010zsk.1_Silent_p.V330V	NM_012255	NP_036387	Q9H0D6	XRN2_HUMAN	5'-3' exoribonuclease 2	384					cell growth|DNA catabolic process, exonucleolytic|mRNA processing|regulation of transcription, DNA-dependent|RNA catabolic process|spermatogenesis|transcription termination, DNA-dependent	nucleolus	5'-3' exoribonuclease activity|nucleic acid binding|protein binding|zinc ion binding			skin(1)	1						GTGGTTATGTCAATCTGCAAA	0.313													17	173	---	---	---	---	PASS
NKX2-2	4821	broad.mit.edu	37	20	21492991	21492991	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:21492991C>A	uc002wsi.2	-	2	749	c.392G>T	c.(391-393)CGG>CTG	p.R131L		NM_002509	NP_002500	O95096	NKX22_HUMAN	NK2 transcription factor related, locus 2	131	Homeobox.				brain development|positive regulation of sequence-specific DNA binding transcription factor activity	nucleus	chromatin binding|core promoter proximal region DNA binding|transcription coactivator activity			pancreas(1)|skin(1)	2						AAGCACTCGCCGCTTTCGCTT	0.687													13	24	---	---	---	---	PASS
DEFB118	117285	broad.mit.edu	37	20	29960654	29960654	+	Intron	SNP	A	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:29960654A>T	uc002wvr.2	+							NM_054112	NP_473453	Q96PH6	DB118_HUMAN	beta-defensin 118 precursor						cell-matrix adhesion|defense response to bacterium|innate immune response|spermatogenesis	extracellular region				ovary(3)|pancreas(1)	4	all_hematologic(12;0.158)		Colorectal(19;0.00254)|COAD - Colon adenocarcinoma(19;0.0347)			TCCTTTTATTATTCAGCCTAT	0.378													93	39	---	---	---	---	PASS
CDK5RAP1	51654	broad.mit.edu	37	20	31967306	31967306	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31967306G>T	uc010gek.2	-	9	1234	c.1110C>A	c.(1108-1110)ATC>ATA	p.I370I	CDK5RAP1_uc002wyy.2_Silent_p.I266I|CDK5RAP1_uc002wyz.2_Silent_p.I356I|CDK5RAP1_uc002wza.2_Silent_p.I356I|CDK5RAP1_uc010gel.2_Silent_p.I265I|CDK5RAP1_uc010gem.2_Intron|CDK5RAP1_uc002wzc.1_Silent_p.I356I	NM_016408	NP_057492	Q96SZ6	CK5P1_HUMAN	CDK5 regulatory subunit associated protein 1	370					brain development|negative regulation of cyclin-dependent protein kinase activity|regulation of neuron differentiation|tRNA modification	cytoplasm	4 iron, 4 sulfur cluster binding|metal ion binding|neuronal Cdc2-like kinase binding|transferase activity			ovary(2)|skin(2)|lung(1)	5						AGGTAAAACGGATCCTCATTT	0.468													11	69	---	---	---	---	PASS
NDRG3	57446	broad.mit.edu	37	20	35350132	35350132	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35350132C>T	uc002xfw.2	-	2	89	c.7G>A	c.(7-9)GAA>AAA	p.E3K	NDRG3_uc002xfx.2_Missense_Mutation_p.E3K|NDRG3_uc010zvq.1_5'UTR|NDRG3_uc010zvr.1_5'UTR	NM_032013	NP_114402	Q9UGV2	NDRG3_HUMAN	N-myc downstream regulated gene 3 isoform a	3					cell differentiation|negative regulation of cell growth|spermatogenesis	cytoplasm				ovary(1)	1		Myeloproliferative disorder(115;0.00878)				TCCTGAAGTTCATCCATGAGG	0.363													8	126	---	---	---	---	PASS
RALGAPB	57148	broad.mit.edu	37	20	37153584	37153584	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:37153584G>C	uc002xiw.2	+	11	2040	c.1783G>C	c.(1783-1785)GAC>CAC	p.D595H	RALGAPB_uc010zvz.1_3'UTR|RALGAPB_uc002xix.2_Missense_Mutation_p.D595H|RALGAPB_uc002xiy.1_Missense_Mutation_p.D595H|RALGAPB_uc002xiz.2_Missense_Mutation_p.D373H|RALGAPB_uc002xja.1_Missense_Mutation_p.D322H	NM_020336	NP_065069	Q86X10	RLGPB_HUMAN	Ral GTPase activating protein, beta subunit	595					activation of Ral GTPase activity	intracellular	protein heterodimerization activity|Ral GTPase activator activity			pancreas(1)|skin(1)	2						CATTTTGCCTGACAGGTAAGC	0.423													33	450	---	---	---	---	PASS
RALGAPB	57148	broad.mit.edu	37	20	37154046	37154046	+	Splice_Site	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:37154046G>A	uc002xiw.2	+	12	2045	c.1788_splice	c.e12-1	p.R596_splice	RALGAPB_uc002xix.2_Splice_Site_p.R596_splice|RALGAPB_uc002xiy.1_Splice_Site_p.R596_splice|RALGAPB_uc002xiz.2_Splice_Site_p.R374_splice|RALGAPB_uc002xja.1_Splice_Site_p.R323_splice	NM_020336	NP_065069	Q86X10	RLGPB_HUMAN	Ral GTPase activating protein, beta subunit						activation of Ral GTPase activity	intracellular	protein heterodimerization activity|Ral GTPase activator activity			pancreas(1)|skin(1)	2						TTTTTTGGCAGAGAACTCTCA	0.343													13	204	---	---	---	---	PASS
TOP1	7150	broad.mit.edu	37	20	39704838	39704838	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:39704838C>G	uc002xjl.2	+	4	429	c.183C>G	c.(181-183)CAC>CAG	p.H61Q	TOP1_uc010gge.1_RNA	NM_003286	NP_003277	P11387	TOP1_HUMAN	DNA topoisomerase I	61	Lys-rich.				DNA topological change|interspecies interaction between organisms|phosphorylation|programmed cell death|response to drug	chromosome|nucleolus|nucleoplasm	ATP binding|chromatin DNA binding|DNA topoisomerase (ATP-hydrolyzing) activity|DNA topoisomerase type I activity|protein binding			breast(3)|ovary(2)|central_nervous_system(1)|kidney(1)	7		Myeloproliferative disorder(115;0.00878)			Irinotecan(DB00762)|Lucanthone(DB04967)|Topotecan(DB01030)	aaaagaaacacaaagagaagg	0.204			T	NUP98	AML*								17	155	---	---	---	---	PASS
HNF4A	3172	broad.mit.edu	37	20	43057096	43057096	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43057096G>A	uc002xma.2	+	9	1340	c.1251G>A	c.(1249-1251)ATG>ATA	p.M417I	HNF4A_uc002xlu.2_Missense_Mutation_p.M395I|HNF4A_uc002xlv.2_Missense_Mutation_p.M395I|HNF4A_uc002xlz.2_Missense_Mutation_p.M417I|HNF4A_uc010ggq.2_Missense_Mutation_p.M410I	NM_000457	NP_000448	P41235	HNF4A_HUMAN	hepatocyte nuclear factor 4 alpha isoform b	417					blood coagulation|endocrine pancreas development|glucose homeostasis|negative regulation of cell growth|negative regulation of cell proliferation|ornithine metabolic process|phospholipid homeostasis|positive regulation of cholesterol homeostasis|regulation of growth hormone receptor signaling pathway|regulation of insulin secretion|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|response to glucose stimulus|triglyceride homeostasis|xenobiotic metabolic process	cytoplasm	activating transcription factor binding|protein homodimerization activity|receptor binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|steroid hormone receptor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(1)|lung(1)|skin(1)	3		Myeloproliferative disorder(115;0.0122)	COAD - Colon adenocarcinoma(18;0.00189)			ACGGACAGATGTGTGAGTGGC	0.572													10	73	---	---	---	---	PASS
NCOA3	8202	broad.mit.edu	37	20	46266425	46266425	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:46266425C>T	uc002xtk.2	+	13	2615	c.2410C>T	c.(2410-2412)CTT>TTT	p.L804F	NCOA3_uc010ght.1_Missense_Mutation_p.L814F|NCOA3_uc002xtl.2_Missense_Mutation_p.L804F|NCOA3_uc002xtm.2_Missense_Mutation_p.L804F|NCOA3_uc002xtn.2_Missense_Mutation_p.L804F|NCOA3_uc010zyc.1_Missense_Mutation_p.L599F	NM_181659	NP_858045	Q9Y6Q9	NCOA3_HUMAN	nuclear receptor coactivator 3 isoform a	804					androgen receptor signaling pathway|cellular lipid metabolic process|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nucleoplasm	androgen receptor binding|histone acetyltransferase activity|ligand-dependent nuclear receptor binding|protein N-terminus binding|signal transducer activity|thyroid hormone receptor binding			ovary(3)|lung(1)|skin(1)	5						AGATGCTATTCTTGGTGATCT	0.358													12	322	---	---	---	---	PASS
ZNFX1	57169	broad.mit.edu	37	20	47874027	47874027	+	Missense_Mutation	SNP	A	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47874027A>C	uc002xui.2	-	8	2838	c.2591T>G	c.(2590-2592)CTT>CGT	p.L864R		NM_021035	NP_066363	Q9P2E3	ZNFX1_HUMAN	zinc finger, NFX1-type containing 1	864							metal ion binding			ovary(2)	2			BRCA - Breast invasive adenocarcinoma(12;0.00173)|COAD - Colon adenocarcinoma(4;0.14)|Colorectal(8;0.166)			CATGGCCAGAAGCATTTTAGC	0.557													31	139	---	---	---	---	PASS
CASS4	57091	broad.mit.edu	37	20	55026901	55026901	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:55026901G>A	uc002xxp.2	+	6	894	c.669G>A	c.(667-669)GTG>GTA	p.V223V	CASS4_uc002xxq.3_Silent_p.V223V|CASS4_uc002xxr.2_Silent_p.V223V|CASS4_uc010zze.1_Silent_p.V169V|CASS4_uc010gio.2_Intron	NM_001164116	NP_001157588	Q9NQ75	CASS4_HUMAN	HEF-like protein isoform a	223					cell adhesion	cytoplasm|cytoskeleton|focal adhesion	two-component sensor activity			ovary(2)|skin(1)	3						TGATATCAGTGACTACCTTAA	0.493													25	113	---	---	---	---	PASS
DIDO1	11083	broad.mit.edu	37	20	61512009	61512009	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61512009G>A	uc002ydr.1	-	16	5563	c.5299C>T	c.(5299-5301)CAC>TAC	p.H1767Y	DIDO1_uc002yds.1_Missense_Mutation_p.H1767Y	NM_033081	NP_149072	Q9BTC0	DIDO1_HUMAN	death inducer-obliterator 1 isoform c	1767	Pro-rich.				apoptosis|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(3)|skin(3)	6	Breast(26;5.68e-08)					TTGGGGCCGTGAAGCCCTGAC	0.642													17	290	---	---	---	---	PASS
DIDO1	11083	broad.mit.edu	37	20	61512017	61512017	+	Nonsense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61512017G>T	uc002ydr.1	-	16	5555	c.5291C>A	c.(5290-5292)TCA>TAA	p.S1764*	DIDO1_uc002yds.1_Nonsense_Mutation_p.S1764*	NM_033081	NP_149072	Q9BTC0	DIDO1_HUMAN	death inducer-obliterator 1 isoform c	1764	Pro-rich.				apoptosis|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(3)|skin(3)	6	Breast(26;5.68e-08)					GTGAAGCCCTGACATCCCCAA	0.652													18	277	---	---	---	---	PASS
DIDO1	11083	broad.mit.edu	37	20	61512069	61512069	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61512069G>C	uc002ydr.1	-	16	5503	c.5239C>G	c.(5239-5241)CAG>GAG	p.Q1747E	DIDO1_uc002yds.1_Missense_Mutation_p.Q1747E	NM_033081	NP_149072	Q9BTC0	DIDO1_HUMAN	death inducer-obliterator 1 isoform c	1747	Pro-rich.				apoptosis|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(3)|skin(3)	6	Breast(26;5.68e-08)					AACGGGGGCTGAGAGCCCCCC	0.682													13	282	---	---	---	---	PASS
DIDO1	11083	broad.mit.edu	37	20	61512895	61512895	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61512895G>A	uc002ydr.1	-	16	4677	c.4413C>T	c.(4411-4413)TCC>TCT	p.S1471S	DIDO1_uc002yds.1_Silent_p.S1471S	NM_033081	NP_149072	Q9BTC0	DIDO1_HUMAN	death inducer-obliterator 1 isoform c	1471					apoptosis|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(3)|skin(3)	6	Breast(26;5.68e-08)					GCTCCACCAGGGAGGGCGTCG	0.592													16	323	---	---	---	---	PASS
DIDO1	11083	broad.mit.edu	37	20	61512896	61512896	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61512896G>A	uc002ydr.1	-	16	4676	c.4412C>T	c.(4411-4413)TCC>TTC	p.S1471F	DIDO1_uc002yds.1_Missense_Mutation_p.S1471F	NM_033081	NP_149072	Q9BTC0	DIDO1_HUMAN	death inducer-obliterator 1 isoform c	1471					apoptosis|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(3)|skin(3)	6	Breast(26;5.68e-08)					CTCCACCAGGGAGGGCGTCGC	0.587													16	318	---	---	---	---	PASS
RTEL1	51750	broad.mit.edu	37	20	62323092	62323092	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62323092C>T	uc002yfu.1	+						RTEL1_uc011abc.1_Intron|RTEL1_uc002yft.1_Intron|RTEL1_uc011abd.1_Intron|RTEL1_uc011abe.1_Intron|RTEL1_uc002yfw.2_Intron|RTEL1_uc002yfx.1_Intron	NM_016434	NP_057518	Q9NZ71	RTEL1_HUMAN	regulator of telomere elongation helicase 1						DNA repair|regulation of double-strand break repair via homologous recombination|telomere maintenance	nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|iron-sulfur cluster binding|metal ion binding				0	all_cancers(38;6.47e-12)|all_epithelial(29;3.75e-13)		Epithelial(9;1.25e-09)|all cancers(9;5.13e-09)|BRCA - Breast invasive adenocarcinoma(10;7.26e-05)|OV - Ovarian serous cystadenocarcinoma(5;0.00223)|Colorectal(105;0.107)			GTGTCCTCCTCAGGCCCACAG	0.627													10	338	---	---	---	---	PASS
RTEL1	51750	broad.mit.edu	37	20	62325852	62325852	+	Intron	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62325852C>G	uc002yfu.1	+						RTEL1_uc011abc.1_Intron|RTEL1_uc002yft.1_Intron|RTEL1_uc011abd.1_Intron|RTEL1_uc011abe.1_Intron|RTEL1_uc002yfw.2_Intron|RTEL1_uc002yfx.1_Intron|TNFRSF6B_uc002yfy.2_5'Flank|TNFRSF6B_uc002yfz.2_5'Flank	NM_016434	NP_057518	Q9NZ71	RTEL1_HUMAN	regulator of telomere elongation helicase 1						DNA repair|regulation of double-strand break repair via homologous recombination|telomere maintenance	nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|iron-sulfur cluster binding|metal ion binding				0	all_cancers(38;6.47e-12)|all_epithelial(29;3.75e-13)		Epithelial(9;1.25e-09)|all cancers(9;5.13e-09)|BRCA - Breast invasive adenocarcinoma(10;7.26e-05)|OV - Ovarian serous cystadenocarcinoma(5;0.00223)|Colorectal(105;0.107)			GTAGCTGACTCCTGAACCGTG	0.657													8	176	---	---	---	---	PASS
C20orf135	140701	broad.mit.edu	37	20	62493290	62493290	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62493290C>A	uc002ygx.1	+	1	725	c.397C>A	c.(397-399)CGC>AGC	p.R133S		NM_080622	NP_542189	Q9H3Z7	ABHGB_HUMAN	hypothetical protein LOC140701	133							hydrolase activity				0	all_cancers(38;1.77e-12)|all_epithelial(29;3.12e-14)|Lung NSC(23;5.92e-10)|all_lung(23;2.08e-09)					GGGCCAAGAGCGCCTCGTGGA	0.711													8	35	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	21	10862965	10862965	+	IGR	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:10862965C>T								None (None upstream) : TPTE (43778 downstream)																							AGGCCAGAGTCACCATAACCA	0.527													27	804	---	---	---	---	PASS
NRIP1	8204	broad.mit.edu	37	21	16338048	16338048	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:16338048C>T	uc002yjx.2	-	4	3064	c.2466G>A	c.(2464-2466)TTG>TTA	p.L822L		NM_003489	NP_003480	P48552	NRIP1_HUMAN	nuclear receptor interacting protein 1	822	Repression domain 3.|LXXLL motif 8.				androgen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		androgen receptor binding|estrogen receptor binding|glucocorticoid receptor binding|transcription coactivator activity|transcription corepressor activity				0				Epithelial(23;1.19e-05)|all cancers(11;4.64e-05)|COAD - Colon adenocarcinoma(22;0.000232)|Colorectal(24;0.0006)|OV - Ovarian serous cystadenocarcinoma(11;0.00418)|Lung(58;0.199)|LUSC - Lung squamous cell carcinoma(23;0.24)		TTTGTCTTAGCAATCGACTTA	0.423													57	125	---	---	---	---	PASS
KRTAP13-2	337959	broad.mit.edu	37	21	31744142	31744142	+	Silent	SNP	C	A	A	rs145274953		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:31744142C>A	uc002ynz.3	-	1	416	c.390G>T	c.(388-390)CTG>CTT	p.L130L		NM_181621	NP_853652	Q52LG2	KR132_HUMAN	keratin associated protein 13-2	130						intermediate filament					0						TTCCATAACCCAGGGATCTGA	0.582													19	80	---	---	---	---	PASS
KRTAP19-5	337972	broad.mit.edu	37	21	31874417	31874417	+	5'Flank	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:31874417G>T	uc011ada.1	-							NM_181611	NP_853642	Q3LI72	KR195_HUMAN	keratin associated protein 19-5							intermediate filament	protein binding				0						ATGGTGTCAGGAGTGGTGAGT	0.537													61	162	---	---	---	---	PASS
SLC37A1	54020	broad.mit.edu	37	21	43983979	43983979	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:43983979G>T	uc002zbi.2	+	14	1539	c.1127G>T	c.(1126-1128)GGA>GTA	p.G376V	SLC37A1_uc002zbj.2_Missense_Mutation_p.G376V	NM_018964	NP_061837	P57057	GLPT_HUMAN	solute carrier family 37 member 1	376	Helical; (Potential).				carbohydrate transport|transmembrane transport	integral to membrane					0						GACGTGGGCGGAATCTTTGGT	0.488													26	117	---	---	---	---	PASS
WDR4	10785	broad.mit.edu	37	21	44293671	44293671	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44293671G>C	uc002zci.2	-	3	359	c.286C>G	c.(286-288)CTG>GTG	p.L96V	WDR4_uc002zck.1_Missense_Mutation_p.L96V|WDR4_uc002zcl.1_Intron|WDR4_uc010gpg.1_Missense_Mutation_p.L96V|WDR4_uc011aew.1_5'UTR|WDR4_uc010gph.1_Intron	NM_033661	NP_387510	P57081	WDR4_HUMAN	WD repeat domain 4 protein	96	WD 1.				tRNA modification	cytoplasm|nucleoplasm	protein binding			ovary(1)	1				Colorectal(79;0.0165)|Lung(125;0.0484)|STAD - Stomach adenocarcinoma(101;0.0624)|COAD - Colon adenocarcinoma(84;0.128)|LUSC - Lung squamous cell carcinoma(216;0.244)		CTGACACTCAGACATTGCCAT	0.448													84	622	---	---	---	---	PASS
ITGB2	3689	broad.mit.edu	37	21	46321448	46321448	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:46321448C>G	uc002zgd.2	-	5	744	c.700G>C	c.(700-702)GAG>CAG	p.E234Q	ITGB2_uc002zge.2_Missense_Mutation_p.E234Q|ITGB2_uc002zgf.3_Missense_Mutation_p.E234Q|ITGB2_uc011afl.1_Missense_Mutation_p.E156Q|ITGB2_uc010gpw.2_Missense_Mutation_p.E177Q|ITGB2_uc002zgg.2_Missense_Mutation_p.E234Q	NM_001127491	NP_001120963	P05107	ITB2_HUMAN	integrin, beta 2 precursor	234	Extracellular (Potential).|VWFA.				apoptosis|blood coagulation|cell-cell signaling|cell-matrix adhesion|inflammatory response|integrin-mediated signaling pathway|leukocyte cell-cell adhesion|multicellular organismal development|neutrophil chemotaxis|regulation of cell shape|regulation of immune response|regulation of peptidyl-tyrosine phosphorylation	integrin complex	glycoprotein binding|protein kinase binding|receptor activity			ovary(4)|central_nervous_system(3)|breast(2)	9				Colorectal(79;0.0669)	Simvastatin(DB00641)	AGCCCACCCTCGGGTGCATCC	0.647													10	110	---	---	---	---	PASS
CDC45	8318	broad.mit.edu	37	22	19483524	19483524	+	Missense_Mutation	SNP	A	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19483524A>G	uc002zpr.2	+	7	639	c.563A>G	c.(562-564)TAC>TGC	p.Y188C	CDC45_uc011agz.1_Missense_Mutation_p.Y183C|CDC45_uc011aha.1_Missense_Mutation_p.Y220C|CDC45_uc002zps.2_Missense_Mutation_p.Y188C|CDC45_uc002zpt.2_Missense_Mutation_p.Y142C	NM_003504	NP_003495	O75419	CDC45_HUMAN	CDC45-like	188					DNA replication checkpoint|DNA strand elongation involved in DNA replication|DNA-dependent DNA replication initiation|M/G1 transition of mitotic cell cycle|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle	centrosome|nucleoplasm	protein binding			lung(1)	1						CTCTTTGACTACGAGCAGTAT	0.388													107	362	---	---	---	---	PASS
CCDC116	164592	broad.mit.edu	37	22	21990876	21990876	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21990876C>T	uc002zve.2	+	5	1452	c.1359C>T	c.(1357-1359)TTC>TTT	p.F453F		NM_152612	NP_689825	Q8IYX3	CC116_HUMAN	coiled-coil domain containing 116	453										ovary(1)|skin(1)	2	Colorectal(54;0.105)					AGTACGAGTTCGAAAAGGACC	0.562													28	226	---	---	---	---	PASS
LOC96610	96610	broad.mit.edu	37	22	22516975	22516975	+	Intron	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:22516975C>A	uc011aim.1	+						uc011ain.1_RNA					Parts of antibodies, mostly variable regions.												0						GATCGCTTCTCAGGCTCCAGC	0.552													5	68	---	---	---	---	PASS
CABIN1	23523	broad.mit.edu	37	22	24483605	24483605	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:24483605C>G	uc002zzi.1	+	23	3591	c.3464C>G	c.(3463-3465)TCA>TGA	p.S1155*	CABIN1_uc002zzj.1_Nonsense_Mutation_p.S1105*|CABIN1_uc002zzl.1_Nonsense_Mutation_p.S1155*	NM_012295	NP_036427	Q9Y6J0	CABIN_HUMAN	calcineurin binding protein 1	1155					cell surface receptor linked signaling pathway|chromatin modification	nucleus	protein phosphatase inhibitor activity			ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	5						GCCTTGCACTCATTCGCCTCA	0.587													46	277	---	---	---	---	PASS
MYO18B	84700	broad.mit.edu	37	22	26219576	26219576	+	Nonsense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26219576C>T	uc003abz.1	+	13	2876	c.2626C>T	c.(2626-2628)CGA>TGA	p.R876*	MYO18B_uc003aca.1_Nonsense_Mutation_p.R757*|MYO18B_uc010guy.1_Nonsense_Mutation_p.R757*|MYO18B_uc010guz.1_Nonsense_Mutation_p.R757*|MYO18B_uc011aka.1_Nonsense_Mutation_p.R30*|MYO18B_uc011akb.1_Nonsense_Mutation_p.R389*	NM_032608	NP_115997	Q8IUG5	MY18B_HUMAN	myosin XVIIIB	876	Myosin head-like.					nucleus|sarcomere|unconventional myosin complex	actin binding|ATP binding|motor activity			ovary(5)|central_nervous_system(3)|large_intestine(2)|breast(2)	12						GCACCACCTTCGACAGATCAT	0.572													24	694	---	---	---	---	PASS
NIPSNAP1	8508	broad.mit.edu	37	22	29957616	29957616	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:29957616C>A	uc003afx.3	-	6	531	c.458G>T	c.(457-459)AGG>ATG	p.R153M	NIPSNAP1_uc011akp.1_Missense_Mutation_p.R133M	NM_003634	NP_003625	Q9BPW8	NIPS1_HUMAN	nipsnap homolog 1	153								p.?(1)		skin(1)	1						GCTCCGCTCCCTTCGGAACTC	0.567													107	245	---	---	---	---	PASS
MTP18	51537	broad.mit.edu	37	22	30823381	30823381	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:30823381C>A	uc003ahw.1	+	3	567	c.419C>A	c.(418-420)CCC>CAC	p.P140H	SEC14L2_uc010gvw.1_Intron|MTP18_uc010gvx.1_Intron|MTP18_uc003ahv.1_Missense_Mutation_p.P302H|MTP18_uc010gvy.1_Intron|MTP18_uc003ahx.1_Intron	NM_016498	NP_057582	Q9UDX5	MTFP1_HUMAN	mitochondrial protein 18 kDa isoform a	140	Helical; (Potential).				apoptosis|carbon utilization	integral to membrane|mitochondrial inner membrane	carbonate dehydratase activity|zinc ion binding				0						ATTATCCACCCCATTGACAGG	0.577													143	369	---	---	---	---	PASS
OSBP2	23762	broad.mit.edu	37	22	31302239	31302239	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:31302239G>A	uc003aiy.1	+	14	2768	c.2664G>A	c.(2662-2664)CTG>CTA	p.L888L	OSBP2_uc011ala.1_Silent_p.L722L|OSBP2_uc010gwc.1_Silent_p.L715L|OSBP2_uc011alb.1_3'UTR|OSBP2_uc003aiz.1_Silent_p.L887L|OSBP2_uc003aja.1_Silent_p.L521L|OSBP2_uc011alc.1_Silent_p.L631L|OSBP2_uc003ajb.2_Silent_p.L433L|OSBP2_uc011ald.1_Silent_p.L432L|OSBP2_uc010gwd.1_3'UTR	NM_030758	NP_110385	Q969R2	OSBP2_HUMAN	oxysterol binding protein 2 isoform a	888					lipid transport	membrane	lipid binding			breast(1)|skin(1)	2						TGGATCCGCTGACCGGGGAGA	0.622													26	229	---	---	---	---	PASS
DEPDC5	9681	broad.mit.edu	37	22	32218747	32218747	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:32218747C>T	uc003als.2	+	24	2217	c.2075C>T	c.(2074-2076)TCT>TTT	p.S692F	DEPDC5_uc011als.1_Intron|DEPDC5_uc011alu.1_Missense_Mutation_p.S692F|DEPDC5_uc011alv.1_Intron|DEPDC5_uc003alt.2_Missense_Mutation_p.S692F|DEPDC5_uc003alu.2_Missense_Mutation_p.S132F|DEPDC5_uc003alv.2_Intron|DEPDC5_uc011alw.1_Missense_Mutation_p.S13F|DEPDC5_uc011alt.1_Intron	NM_014662	NP_055477	O75140	DEPD5_HUMAN	DEP domain containing 5 isoform 1	692					intracellular signal transduction					ovary(4)|central_nervous_system(3)|pancreas(1)	8						GAGGAGCTTTCTGTCGGCCTG	0.527													17	97	---	---	---	---	PASS
MYH9	4627	broad.mit.edu	37	22	36688126	36688126	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:36688126C>T	uc003apg.2	-	31	4481	c.4250G>A	c.(4249-4251)CGG>CAG	p.R1417Q		NM_002473	NP_002464	P35579	MYH9_HUMAN	myosin, heavy polypeptide 9, non-muscle	1417	Potential.				actin cytoskeleton reorganization|actin filament-based movement|angiogenesis|axon guidance|blood vessel endothelial cell migration|cytokinesis|integrin-mediated signaling pathway|leukocyte migration|membrane protein ectodomain proteolysis|monocyte differentiation|platelet formation|protein transport|regulation of cell shape	actomyosin contractile ring|cleavage furrow|cytosol|myosin complex|nucleus|ruffle|stress fiber|uropod	actin filament binding|actin-dependent ATPase activity|ADP binding|ATP binding|calmodulin binding|microfilament motor activity|protein anchor|protein homodimerization activity			breast(3)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|lung(1)|skin(1)|kidney(1)|pancreas(1)	11						CTGCTGCAGCCGCGTCTTGGT	0.622			T	ALK	ALCL		Deafness|autosomal dominant 17|Epstein syndrome|Fechtner syndrome|May-Hegglin anomaly|Sebastian syndrome		Hereditary_Macrothrombocytopenia_MYH9-associated				10	213	---	---	---	---	PASS
MYH9	4627	broad.mit.edu	37	22	36710282	36710282	+	Missense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:36710282C>G	uc003apg.2	-	13	1693	c.1462G>C	c.(1462-1464)GAG>CAG	p.E488Q	MYH9_uc003aph.1_Missense_Mutation_p.E352Q	NM_002473	NP_002464	P35579	MYH9_HUMAN	myosin, heavy polypeptide 9, non-muscle	488	Myosin head-like.				actin cytoskeleton reorganization|actin filament-based movement|angiogenesis|axon guidance|blood vessel endothelial cell migration|cytokinesis|integrin-mediated signaling pathway|leukocyte migration|membrane protein ectodomain proteolysis|monocyte differentiation|platelet formation|protein transport|regulation of cell shape	actomyosin contractile ring|cleavage furrow|cytosol|myosin complex|nucleus|ruffle|stress fiber|uropod	actin filament binding|actin-dependent ATPase activity|ADP binding|ATP binding|calmodulin binding|microfilament motor activity|protein anchor|protein homodimerization activity			breast(3)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|lung(1)|skin(1)|kidney(1)|pancreas(1)	11						TCCTCCTGCTCCAGGATGAAC	0.527			T	ALK	ALCL		Deafness|autosomal dominant 17|Epstein syndrome|Fechtner syndrome|May-Hegglin anomaly|Sebastian syndrome		Hereditary_Macrothrombocytopenia_MYH9-associated				12	268	---	---	---	---	PASS
TRIOBP	11078	broad.mit.edu	37	22	38111832	38111832	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38111832G>A	uc003atr.2	+	6	790	c.519G>A	c.(517-519)ATG>ATA	p.M173I	TRIOBP_uc003atu.2_Missense_Mutation_p.M1I|TRIOBP_uc003atq.1_Missense_Mutation_p.M173I|TRIOBP_uc003ats.1_Missense_Mutation_p.M1I	NM_001039141	NP_001034230	Q9H2D6	TARA_HUMAN	TRIO and F-actin binding protein isoform 6	173					actin modification|barbed-end actin filament capping	actin cytoskeleton|cytoplasm|nucleus	actin binding|GTP-Rho binding|myosin II binding|protein binding|ubiquitin protein ligase binding			central_nervous_system(1)	1	Melanoma(58;0.0574)					TCGCAGTGATGATCCCGAGGA	0.642													20	94	---	---	---	---	PASS
KCNJ4	3761	broad.mit.edu	37	22	38823646	38823646	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38823646G>T	uc003avs.1	-	2	589	c.492C>A	c.(490-492)GAC>GAA	p.D164E	KCNJ4_uc003avt.1_Missense_Mutation_p.D164E	NM_004981	NP_004972	P48050	IRK4_HUMAN	potassium inwardly-rectifying channel J4	164	Helical; Name=M2; (By similarity).	Role in the control of polyamine-mediated channel gating and in the blocking by intracellular magnesium (By similarity).			synaptic transmission	basolateral plasma membrane|voltage-gated potassium channel complex	inward rectifier potassium channel activity|PDZ domain binding				0	Melanoma(58;0.0286)					TCATGAAGGAGTCGATGACGC	0.632													48	93	---	---	---	---	PASS
GTPBP1	9567	broad.mit.edu	37	22	39112737	39112737	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:39112737G>A	uc003awg.2	+	4	720	c.566G>A	c.(565-567)CGA>CAA	p.R189Q		NM_004286	NP_004277	O00178	GTPB1_HUMAN	GTP binding protein 1	189					immune response|positive regulation of mRNA catabolic process|signal transduction	cytoplasmic exosome (RNase complex)|cytosol	GTP binding|GTPase activity			ovary(1)	1	Melanoma(58;0.04)					GACAATGGCCGAGGCTTTGCC	0.562													20	107	---	---	---	---	PASS
CBX7	23492	broad.mit.edu	37	22	39530740	39530740	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:39530740G>T	uc003axb.2	-	5	353	c.264C>A	c.(262-264)GAC>GAA	p.D88E	CBX7_uc003axc.2_Intron	NM_175709	NP_783640	O95931	CBX7_HUMAN	chromobox homolog 7	88					chromatin modification|negative regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nuclear chromatin|PcG protein complex				ovary(1)	1	Melanoma(58;0.04)					AGCTCCGCAGGTCCATGCTGT	0.697													6	6	---	---	---	---	PASS
SGSM3	27352	broad.mit.edu	37	22	40802122	40802122	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:40802122C>T	uc003ayu.1	+	9	1064	c.855C>T	c.(853-855)TTC>TTT	p.F285F	SGSM3_uc010gyc.1_Silent_p.F285F|SGSM3_uc011aos.1_Silent_p.F218F|SGSM3_uc011aot.1_Silent_p.F222F|SGSM3_uc010gyd.1_Silent_p.F285F	NM_015705	NP_056520	Q96HU1	SGSM3_HUMAN	small G protein signaling modulator 3	285	Rab-GAP TBC.				cell cycle arrest|Rap protein signal transduction	cytoplasm	Rab GTPase activator activity|Rab GTPase binding			ovary(2)	2						TCACGGCCTTCGCCAGCGTGG	0.617													12	270	---	---	---	---	PASS
XPNPEP3	63929	broad.mit.edu	37	22	41265114	41265114	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41265114G>C	uc003azh.2	+	2	268	c.176G>C	c.(175-177)AGA>ACA	p.R59T	XPNPEP3_uc011aox.1_Missense_Mutation_p.R59T|XPNPEP3_uc003azi.2_5'UTR|XPNPEP3_uc011aoy.1_RNA|XPNPEP3_uc010gyh.1_RNA	NM_022098	NP_071381	Q9NQH7	XPP3_HUMAN	X-prolyl aminopeptidase (aminopeptidase P) 3,	59					cellular process	mitochondrion	aminopeptidase activity|manganese ion binding|metallopeptidase activity				0						CACCTCCTCAGACCAGGTAAG	0.398													9	275	---	---	---	---	PASS
XPNPEP3	63929	broad.mit.edu	37	22	41265120	41265120	+	Splice_Site	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41265120G>T	uc003azh.2	+	2	273	c.181_splice	c.e2+1	p.G61_splice	XPNPEP3_uc011aox.1_Splice_Site_p.G61_splice|XPNPEP3_uc003azi.2_Splice_Site|XPNPEP3_uc011aoy.1_Splice_Site|XPNPEP3_uc010gyh.1_Splice_Site	NM_022098	NP_071381	Q9NQH7	XPP3_HUMAN	X-prolyl aminopeptidase (aminopeptidase P) 3,						cellular process	mitochondrion	aminopeptidase activity|manganese ion binding|metallopeptidase activity				0						CTCAGACCAGGTAAGGCCTTT	0.388													8	263	---	---	---	---	PASS
XPNPEP3	63929	broad.mit.edu	37	22	41322407	41322407	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41322407G>C	uc003azh.2	+	10	1584	c.1492G>C	c.(1492-1494)GAC>CAC	p.D498H	XPNPEP3_uc003azi.2_Missense_Mutation_p.D419H|XPNPEP3_uc011aoy.1_RNA	NM_022098	NP_071381	Q9NQH7	XPP3_HUMAN	X-prolyl aminopeptidase (aminopeptidase P) 3,	498					cellular process	mitochondrion	aminopeptidase activity|manganese ion binding|metallopeptidase activity				0						AGAGATGAATGACATTGAACA	0.507													16	416	---	---	---	---	PASS
XPNPEP3	63929	broad.mit.edu	37	22	41322413	41322413	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41322413G>A	uc003azh.2	+	10	1590	c.1498G>A	c.(1498-1500)GAA>AAA	p.E500K	XPNPEP3_uc003azi.2_Missense_Mutation_p.E421K|XPNPEP3_uc011aoy.1_RNA	NM_022098	NP_071381	Q9NQH7	XPP3_HUMAN	X-prolyl aminopeptidase (aminopeptidase P) 3,	500					cellular process	mitochondrion	aminopeptidase activity|manganese ion binding|metallopeptidase activity				0						GAATGACATTGAACAGATATG	0.507													15	411	---	---	---	---	PASS
EP300	2033	broad.mit.edu	37	22	41574082	41574082	+	Missense_Mutation	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41574082G>T	uc003azl.3	+	31	6762	c.6367G>T	c.(6367-6369)GGG>TGG	p.G2123W		NM_001429	NP_001420	Q09472	EP300_HUMAN	E1A binding protein p300	2123	Interaction with HTLV-1 Tax.|Interaction with NCOA2.				apoptosis|cell cycle|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|histone H4 acetylation|interspecies interaction between organisms|N-terminal peptidyl-lysine acetylation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|regulation of androgen receptor signaling pathway|response to estrogen stimulus|response to hypoxia	centrosome|histone acetyltransferase complex	androgen receptor binding|beta-catenin binding|DNA binding|histone acetyltransferase activity|RNA polymerase II activating transcription factor binding|transcription coactivator activity|zinc ion binding			haematopoietic_and_lymphoid_tissue(22)|large_intestine(13)|breast(9)|central_nervous_system(5)|upper_aerodigestive_tract(4)|pancreas(4)|lung(3)|ovary(2)|stomach(1)|skin(1)	64						AGGTCAGCAGGGGGTCCACTC	0.622			T| N|F|Mis|O	MLL|RUNXBP2	colorectal|breast|pancreatic|AML|ALL|DLBCL				Rubinstein-Taybi_syndrome				41	144	---	---	---	---	PASS
SREBF2	6721	broad.mit.edu	37	22	42293048	42293048	+	Intron	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:42293048C>T	uc003bbi.2	+						WBP2NL_uc011ape.1_Intron|LOC339674_uc003bba.1_Intron|SREBF2_uc003bbj.2_Intron	NM_004599	NP_004590	Q12772	SRBP2_HUMAN	sterol regulatory element-binding transcription						cholesterol metabolic process	ER to Golgi transport vesicle membrane|Golgi membrane|nucleus|SREBP-SCAP-Insig complex	protein C-terminus binding			breast(2)|ovary(1)|central_nervous_system(1)	4						CCTTTCTTTTCTTCCTAGTGA	0.483													6	41	---	---	---	---	PASS
PHF21B	112885	broad.mit.edu	37	22	45312239	45312239	+	Missense_Mutation	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:45312239G>A	uc003bfn.2	-	4	636	c.485C>T	c.(484-486)GCC>GTC	p.A162V	PHF21B_uc003bfm.2_5'UTR|PHF21B_uc011aqk.1_Missense_Mutation_p.A150V|PHF21B_uc011aql.1_Missense_Mutation_p.A162V|PHF21B_uc011aqm.1_Missense_Mutation_p.A150V	NM_138415	NP_612424	Q96EK2	PF21B_HUMAN	PHD finger protein 21B isoform 1	162							zinc ion binding			ovary(2)|skin(1)	3		all_neural(38;0.00802)|Glioma(61;0.0353)|Ovarian(80;0.0731)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0203)		GGGGGCCATGGCGGCGGCATT	0.682													21	52	---	---	---	---	PASS
PLXNB2	23654	broad.mit.edu	37	22	50718176	50718176	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50718176G>A	uc003bkv.3	-	27	4378	c.4272C>T	c.(4270-4272)CTC>CTT	p.L1424L	PLXNB2_uc003bkt.1_Silent_p.L216L|PLXNB2_uc003bku.1_Silent_p.L409L	NM_012401	NP_036533	O15031	PLXB2_HUMAN	plexin B2 precursor	1424	Cytoplasmic (Potential).				regulation of small GTPase mediated signal transduction	integral to membrane|intracellular	GTPase activator activity|protein binding|receptor activity			ovary(4)|central_nervous_system(1)|skin(1)	6		all_cancers(38;5.78e-13)|all_epithelial(38;1.71e-11)|all_lung(38;3.89e-05)|Breast(42;0.000523)|Lung NSC(38;0.000992)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		BRCA - Breast invasive adenocarcinoma(115;0.205)|LUAD - Lung adenocarcinoma(64;0.247)		TGGCCTTGAAGAGCTTGTACA	0.632													46	592	---	---	---	---	PASS
PPP2R3B	28227	broad.mit.edu	37	X	322173	322173	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:322173C>T	uc004cpg.2	-	2	678	c.477G>A	c.(475-477)AGG>AGA	p.R159R	PPP2R3B_uc011mha.1_5'UTR	NM_013239	NP_037371	Q9Y5P8	P2R3B_HUMAN	protein phosphatase 2, regulatory subunit B'',	159					cell cycle arrest|protein dephosphorylation	nucleus|protein phosphatase type 2A complex	calcium ion binding|protein phosphatase type 2A regulator activity|protein serine/threonine phosphatase activity				0		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)				CCATGGTGGCCCTCTCGTGGG	0.647													22	95	---	---	---	---	PASS
P2RY8	286530	broad.mit.edu	37	X	1584849	1584849	+	Silent	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1584849C>A	uc004cpz.2	-	2	851	c.603G>T	c.(601-603)CTG>CTT	p.L201L		NM_178129	NP_835230	Q86VZ1	P2RY8_HUMAN	G-protein coupled purinergic receptor P2Y8	201	Helical; Name=5; (Potential).					integral to membrane|plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			lung(5)	5		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)				GGATGAGGAACAGCAGGATGA	0.632			T	CRLF2	B-ALL|Downs associated ALL								17	64	---	---	---	---	PASS
PRKX	5613	broad.mit.edu	37	X	3573384	3573384	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:3573384G>A	uc010nde.2	-	3	772	c.405C>T	c.(403-405)TTC>TTT	p.F135F		NM_005044	NP_005035	P51817	PRKX_HUMAN	protein kinase, X-linked	135	Protein kinase.						ATP binding|cAMP-dependent protein kinase activity			skin(2)|lung(1)	3		all_lung(23;0.000396)|Lung NSC(23;0.00123)				GCAGGTAGCTGAAGAGCTCGC	0.612													44	49	---	---	---	---	PASS
MSL3	10943	broad.mit.edu	37	X	11780326	11780326	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:11780326G>C	uc004cuw.2	+	6	648	c.543G>C	c.(541-543)AAG>AAC	p.K181N	MSL3_uc004cuv.1_Missense_Mutation_p.K181N|MSL3_uc004cux.2_Missense_Mutation_p.K122N|MSL3_uc011mig.1_Missense_Mutation_p.K32N|MSL3_uc011mih.1_Missense_Mutation_p.K169N|MSL3_uc004cuy.2_Missense_Mutation_p.K15N|MSL3_uc011mii.1_Missense_Mutation_p.K15N	NM_078629	NP_523353	Q8N5Y2	MS3L1_HUMAN	male-specific lethal 3-like 1 isoform a	181					histone H4-K16 acetylation|multicellular organismal development|transcription from RNA polymerase II promoter	MSL complex	DNA binding|methylated histone residue binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1						AAGTTCTGAAGAAGCAGCTGG	0.348													5	111	---	---	---	---	PASS
GRPR	2925	broad.mit.edu	37	X	16170735	16170735	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:16170735C>T	uc004cxj.2	+	3	1775	c.1122C>T	c.(1120-1122)ATC>ATT	p.I374I		NM_005314	NP_005305	P30550	GRPR_HUMAN	gastrin-releasing peptide receptor	374	Cytoplasmic (Potential).				cell proliferation	integral to plasma membrane	bombesin receptor activity			ovary(3)|lung(1)	4	Hepatocellular(33;0.183)					TTAGCCTCATCAATGGAAACA	0.532													70	100	---	---	---	---	PASS
HUWE1	10075	broad.mit.edu	37	X	53634648	53634648	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53634648C>T	uc004dsp.2	-	25	2734	c.2332G>A	c.(2332-2334)GAA>AAA	p.E778K		NM_031407	NP_113584	Q7Z6Z7	HUWE1_HUMAN	HECT, UBA and WWE domain containing 1	778					base-excision repair|cell differentiation|histone ubiquitination|protein monoubiquitination|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	DNA binding|protein binding|ubiquitin-protein ligase activity			ovary(8)|large_intestine(4)|breast(4)|kidney(1)	17						AGAATAGATTCCACAAATTTC	0.403													5	10	---	---	---	---	PASS
ITIH5L	347365	broad.mit.edu	37	X	54814948	54814948	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54814948C>T	uc004dtj.2	-	5	781	c.751G>A	c.(751-753)GAT>AAT	p.D251N		NM_198510	NP_940912	Q6UXX5	ITH5L_HUMAN	inter-alpha (globulin) inhibitor H5-like	251					hyaluronan metabolic process	extracellular region	serine-type endopeptidase inhibitor activity			lung(2)|skin(2)|ovary(1)|breast(1)	6						ATGACCACATCGTACTGAACC	0.577													6	76	---	---	---	---	PASS
ARHGEF9	23229	broad.mit.edu	37	X	62885838	62885838	+	Silent	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:62885838G>A	uc004dvl.2	-	7	1823	c.984C>T	c.(982-984)ATC>ATT	p.I328I	ARHGEF9_uc004dvj.1_Silent_p.I217I|ARHGEF9_uc004dvk.1_Intron|ARHGEF9_uc011mos.1_Silent_p.I307I|ARHGEF9_uc004dvm.1_Silent_p.I307I|ARHGEF9_uc011mot.1_Silent_p.I275I|ARHGEF9_uc004dvn.2_Silent_p.I335I	NM_015185	NP_056000	O43307	ARHG9_HUMAN	Cdc42 guanine exchange factor 9	328	PH.				apoptosis|induction of apoptosis by extracellular signals|ion transmembrane transport|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|synaptic transmission	cytosol	Rho guanyl-nucleotide exchange factor activity			ovary(5)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	8						AGGGCTGGTAGATCCAGGCCA	0.592													5	37	---	---	---	---	PASS
APOOL	139322	broad.mit.edu	37	X	84306418	84306418	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:84306418G>T	uc004eem.2	+	3	158	c.144G>T	c.(142-144)CCG>CCT	p.P48P	APOOL_uc010nmp.2_Intron	NM_198450	NP_940852	Q6UXV4	APOOL_HUMAN	apolipoprotein O-like precursor	48						extracellular region					0						CTGCACCACCGCTCCAGTCTA	0.443													22	21	---	---	---	---	PASS
PCDH11X	27328	broad.mit.edu	37	X	91873448	91873448	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:91873448C>T	uc004efk.1	+	7	4398	c.3553C>T	c.(3553-3555)CAC>TAC	p.H1185Y	PCDH11X_uc004efl.1_Missense_Mutation_p.H1175Y|PCDH11X_uc004efo.1_Missense_Mutation_p.H1148Y|PCDH11X_uc010nmv.1_3'UTR|PCDH11X_uc004efm.1_Missense_Mutation_p.H1177Y|PCDH11X_uc004efn.1_Missense_Mutation_p.H1167Y	NM_032968	NP_116750	Q9BZA7	PC11X_HUMAN	protocadherin 11 X-linked isoform c	1185	Cytoplasmic (Potential).				homophilic cell adhesion	integral to plasma membrane	calcium ion binding			large_intestine(2)	2						TACTCAGCACCACAGCCCACG	0.592													39	149	---	---	---	---	PASS
RPA4	29935	broad.mit.edu	37	X	96139863	96139863	+	Nonsense_Mutation	SNP	C	G	G			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:96139863C>G	uc004efv.3	+	1	852	c.554C>G	c.(553-555)TCA>TGA	p.S185*	DIAPH2_uc004eft.3_Intron|DIAPH2_uc004efu.3_Intron|DIAPH2_uc004efs.2_Intron	NM_013347	NP_037479	Q13156	RFA4_HUMAN	replication protein A4, 34kDa	185					DNA damage checkpoint|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|nucleotide-excision repair	DNA replication factor A complex|nucleoplasm	single-stranded DNA binding				0						GTGTCTCCATCAGAAGTGAAT	0.483								Other_identified_genes_with_known_or_suspected_DNA_repair_function					15	136	---	---	---	---	PASS
TCEAL6	158931	broad.mit.edu	37	X	101396087	101396087	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:101396087C>T	uc004eiq.2	-	3	378	c.217G>A	c.(217-219)GAA>AAA	p.E73K		NM_001006938	NP_001006939	Q6IPX3	TCAL6_HUMAN	transcription elongation factor A (SII)-like 6	73	Glu-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(1)	1						CCCTCACCTTCGGACTTGCCC	0.448													82	248	---	---	---	---	PASS
TCEAL5	340543	broad.mit.edu	37	X	102529495	102529495	+	5'UTR	SNP	G	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:102529495G>A	uc004ejz.1	-	3						NM_001012979	NP_001012997	Q5H9L2	TCAL5_HUMAN	transcription elongation factor A (SII)-like 5						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding			lung(1)|breast(1)	2						TTTCCATGTTGAGATGTTCCC	0.269													11	228	---	---	---	---	PASS
FAM127B	26071	broad.mit.edu	37	X	134185839	134185839	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:134185839C>A	uc004eyf.2	-	1	383	c.300G>T	c.(298-300)GAG>GAT	p.E100D	FAM127B_uc004eyg.3_Intron	NM_001078172	NP_001071640	Q9BWD3	F127B_HUMAN	family with sequence similarity 127, member B	100											0	Acute lymphoblastic leukemia(192;0.000127)					CCCGCTTCATCTCGGCCAGGA	0.642													27	68	---	---	---	---	PASS
F9	2158	broad.mit.edu	37	X	138619261	138619261	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:138619261G>C	uc004fas.1	+	2	210	c.181G>C	c.(181-183)GAG>CAG	p.E61Q	F9_uc004fat.1_Missense_Mutation_p.E61Q	NM_000133	NP_000124	P00740	FA9_HUMAN	coagulation factor IX preproprotein	61	Gla.				blood coagulation, extrinsic pathway|blood coagulation, intrinsic pathway|peptidyl-glutamic acid carboxylation|post-translational protein modification|proteolysis	endoplasmic reticulum lumen|extracellular region|Golgi lumen|plasma membrane	calcium ion binding|serine-type endopeptidase activity			lung(2)|ovary(1)	3	Acute lymphoblastic leukemia(192;0.000127)				Antihemophilic Factor(DB00025)|Coagulation Factor IX(DB00100)|Heparin(DB01109)|Menadione(DB00170)	AGGGAACCTTGAGAGAGAATG	0.358													7	212	---	---	---	---	PASS
MAGEC3	139081	broad.mit.edu	37	X	140985492	140985492	+	Silent	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:140985492C>T	uc011mwp.1	+	8	1806	c.1806C>T	c.(1804-1806)TCC>TCT	p.S602S	MAGEC3_uc004fbs.2_3'UTR|MAGEC3_uc010nsj.2_3'UTR	NM_138702	NP_619647	Q8TD91	MAGC3_HUMAN	melanoma antigen family C, 3 isoform 1	602	MAGE 2.									skin(2)|central_nervous_system(1)	3	Acute lymphoblastic leukemia(192;6.56e-05)					CCTTTCCATCCTGGTACATGG	0.478													38	119	---	---	---	---	PASS
SLITRK2	84631	broad.mit.edu	37	X	144904038	144904038	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:144904038G>C	uc004fcd.2	+	5	1085	c.95G>C	c.(94-96)CGC>CCC	p.R32P	SLITRK2_uc010nsp.2_Missense_Mutation_p.R32P|SLITRK2_uc010nso.2_Missense_Mutation_p.R32P|SLITRK2_uc011mwq.1_Missense_Mutation_p.R32P|SLITRK2_uc011mwr.1_Missense_Mutation_p.R32P|SLITRK2_uc011mws.1_Missense_Mutation_p.R32P|SLITRK2_uc004fcg.2_Missense_Mutation_p.R32P|SLITRK2_uc011mwt.1_Missense_Mutation_p.R32P	NM_032539	NP_115928	Q9H156	SLIK2_HUMAN	SLIT and NTRK-like family, member 2 precursor	32	Extracellular (Potential).					integral to membrane				ovary(5)|central_nervous_system(1)|pancreas(1)	7	Acute lymphoblastic leukemia(192;6.56e-05)					TGCAAGATCCGCTGTCTGTGC	0.473													59	56	---	---	---	---	PASS
SLITRK2	84631	broad.mit.edu	37	X	144906362	144906362	+	Missense_Mutation	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:144906362C>T	uc004fcd.2	+	5	3409	c.2419C>T	c.(2419-2421)CCC>TCC	p.P807S	SLITRK2_uc010nsp.2_Missense_Mutation_p.P807S|SLITRK2_uc010nso.2_Missense_Mutation_p.P807S|SLITRK2_uc011mwq.1_Missense_Mutation_p.P807S|SLITRK2_uc011mwr.1_Missense_Mutation_p.P807S|SLITRK2_uc011mws.1_Missense_Mutation_p.P807S|SLITRK2_uc004fcg.2_Missense_Mutation_p.P807S|SLITRK2_uc011mwt.1_Missense_Mutation_p.P807S|CXorf1_uc004fch.2_5'Flank	NM_032539	NP_115928	Q9H156	SLIK2_HUMAN	SLIT and NTRK-like family, member 2 precursor	807	Cytoplasmic (Potential).					integral to membrane				ovary(5)|central_nervous_system(1)|pancreas(1)	7	Acute lymphoblastic leukemia(192;6.56e-05)					ATATGGAACTCCCAGGAAATG	0.438													34	129	---	---	---	---	PASS
MIR890	100126303	broad.mit.edu	37	X	145078711	145078711	+	5'Flank	SNP	C	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:145078711C>T	hsa-mir-890|MI0005533	-						MIR888_hsa-mir-888|MI0005537_5'Flank|MIR892A_hsa-mir-892a|MI0005528_5'Flank																	0						CAAATATATACATGGTGAGCC	0.493													2	0	---	---	---	---	PASS
MAGEA3	4102	broad.mit.edu	37	X	151935416	151935416	+	Missense_Mutation	SNP	C	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:151935416C>A	uc004fgp.2	-	3	960	c.751G>T	c.(751-753)GTG>TTG	p.V251L		NM_005362	NP_005353	P43357	MAGA3_HUMAN	melanoma antigen family A, 3	251	MAGE.										0	Acute lymphoblastic leukemia(192;6.56e-05)					TTTTCCTGCACGAAATGTTGG	0.532													171	128	---	---	---	---	PASS
PDZD4	57595	broad.mit.edu	37	X	153069296	153069296	+	Silent	SNP	G	T	T			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153069296G>T	uc004fiz.1	-	8	2072	c.1822C>A	c.(1822-1824)CGG>AGG	p.R608R	PDZD4_uc004fiy.1_Silent_p.R533R|PDZD4_uc004fix.2_Silent_p.R512R|PDZD4_uc004fja.1_Silent_p.R614R|PDZD4_uc011mze.1_Silent_p.R499R	NM_032512	NP_115901	Q76G19	PDZD4_HUMAN	PDZ domain containing 4	608						cell cortex				breast(1)	1	all_lung(58;3.39e-06)|all_hematologic(71;4.25e-06)|Lung NSC(58;4.7e-06)|Acute lymphoblastic leukemia(192;6.56e-05)					CCGCCCACCCGAGGGCCACCG	0.736													5	11	---	---	---	---	PASS
AVPR2	554	broad.mit.edu	37	X	153171764	153171764	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153171764G>C	uc004fjh.3	+	2	875	c.804G>C	c.(802-804)AAG>AAC	p.K268N	AVPR2_uc004fjg.3_Missense_Mutation_p.K57N|AVPR2_uc004fji.2_Missense_Mutation_p.K268N	NM_000054	NP_000045	P30518	V2R_HUMAN	arginine vasopressin receptor 2 isoform 1	268	Cytoplasmic (Potential).				activation of adenylate cyclase activity|excretion|G-protein signaling, coupled to cAMP nucleotide second messenger|hemostasis|positive regulation of gene expression|transmembrane transport|water transport	endoplasmic reticulum|endosome|Golgi apparatus|integral to plasma membrane	vasopressin receptor activity			breast(1)	1	all_cancers(53;6.72e-15)|all_epithelial(53;3.19e-09)|all_lung(58;3.39e-06)|all_hematologic(71;4.25e-06)|Lung NSC(58;4.7e-06)|Acute lymphoblastic leukemia(192;6.56e-05)				Conivaptan(DB00872)|Terlipressin(DB02638)|Vasopressin(DB00067)	CTGTGGCCAAGACTGTGAGGA	0.677													31	136	---	---	---	---	PASS
ARHGAP4	393	broad.mit.edu	37	X	153173229	153173229	+	Nonsense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153173229G>C	uc004fjk.1	-	22	2837	c.2795C>G	c.(2794-2796)TCA>TGA	p.S932*	ARHGAP4_uc004fjj.1_Nonsense_Mutation_p.S283*|ARHGAP4_uc011mzf.1_Nonsense_Mutation_p.S909*|ARHGAP4_uc004fjl.1_Nonsense_Mutation_p.S972*|ARHGAP4_uc010nup.1_RNA	NM_001666	NP_001657	P98171	RHG04_HUMAN	Rho GTPase activating protein 4 isoform 2	932					apoptosis|cytoskeleton organization|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|Rho protein signal transduction	cytosol|focal adhesion|nucleus	Rho GTPase activator activity|Rho guanyl-nucleotide exchange factor activity|SH3/SH2 adaptor activity			central_nervous_system(1)	1	all_cancers(53;6.72e-15)|all_epithelial(53;3.19e-09)|all_lung(58;3.39e-06)|all_hematologic(71;4.25e-06)|Lung NSC(58;4.7e-06)|Acute lymphoblastic leukemia(192;6.56e-05)					GTGGGAAGCTGAGGGTGAGGC	0.721													11	31	---	---	---	---	PASS
ARHGAP4	393	broad.mit.edu	37	X	153173337	153173337	+	Missense_Mutation	SNP	G	C	C			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153173337G>C	uc004fjk.1	-	22	2729	c.2687C>G	c.(2686-2688)TCT>TGT	p.S896C	ARHGAP4_uc004fjj.1_Missense_Mutation_p.S247C|ARHGAP4_uc011mzf.1_Missense_Mutation_p.S873C|ARHGAP4_uc004fjl.1_Missense_Mutation_p.S936C|ARHGAP4_uc010nup.1_RNA	NM_001666	NP_001657	P98171	RHG04_HUMAN	Rho GTPase activating protein 4 isoform 2	896					apoptosis|cytoskeleton organization|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|Rho protein signal transduction	cytosol|focal adhesion|nucleus	Rho GTPase activator activity|Rho guanyl-nucleotide exchange factor activity|SH3/SH2 adaptor activity			central_nervous_system(1)	1	all_cancers(53;6.72e-15)|all_epithelial(53;3.19e-09)|all_lung(58;3.39e-06)|all_hematologic(71;4.25e-06)|Lung NSC(58;4.7e-06)|Acute lymphoblastic leukemia(192;6.56e-05)					AGAGGTGGTAGATGCTGGCCC	0.652													45	133	---	---	---	---	PASS
RBMY1A1	5940	broad.mit.edu	37	Y	23702659	23702659	+	Missense_Mutation	SNP	T	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrY:23702659T>A	uc004fuq.3	+	4	501	c.389T>A	c.(388-390)CTG>CAG	p.L130Q	RBMY1A1_uc010nxa.2_Missense_Mutation_p.L130Q|RBMY1A1_uc004fur.3_Intron|RBMY1A1_uc011nbd.1_Missense_Mutation_p.L95Q	NM_001006120	NP_001006120	Q15414	RBY1A_HUMAN	RNA binding motif protein, Y-linked, family 1,	130					mRNA processing|RNA splicing|spermatogenesis	nucleus	nucleotide binding|RNA binding				0						GAAGGGCACCTGGGTAATGTT	0.408													4	10	---	---	---	---	PASS
ACOT7	11332	broad.mit.edu	37	1	6390127	6390128	+	Intron	DEL	GT	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6390127_6390128delGT	uc001ams.2	-						ACOT7_uc010nzq.1_Intron|ACOT7_uc001amt.2_Intron|ACOT7_uc001amu.2_Intron|ACOT7_uc001amv.2_Intron|ACOT7_uc001amq.2_Intron|ACOT7_uc001amr.2_Intron	NM_181864	NP_863654	O00154	BACH_HUMAN	acyl-CoA thioesterase 7 isoform hBACHb							mitochondrion|nucleus	carboxylesterase activity|fatty-acyl-CoA binding|palmitoyl-CoA hydrolase activity				0	Ovarian(185;0.0634)|all_lung(157;0.175)	all_cancers(23;1.42e-38)|all_epithelial(116;3.96e-23)|all_lung(118;3.69e-08)|Lung NSC(185;8.52e-07)|all_hematologic(16;6.92e-06)|Colorectal(325;4.53e-05)|Acute lymphoblastic leukemia(12;5e-05)|all_neural(13;0.000164)|Breast(487;0.000688)|Renal(390;0.0007)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0393)|Medulloblastoma(700;0.211)		Epithelial(90;9.16e-37)|GBM - Glioblastoma multiforme(13;5.89e-29)|OV - Ovarian serous cystadenocarcinoma(86;7.63e-19)|Colorectal(212;1.27e-07)|COAD - Colon adenocarcinoma(227;2.06e-05)|Kidney(185;7.74e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.00129)|BRCA - Breast invasive adenocarcinoma(365;0.00132)|STAD - Stomach adenocarcinoma(132;0.00195)|READ - Rectum adenocarcinoma(331;0.0481)		tgtgtgtgtggtgtgtgtgtgt	0.262													5	3	---	---	---	---	
CELA2B	51032	broad.mit.edu	37	1	15807394	15807394	+	Intron	DEL	T	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:15807394delT	uc001awl.2	+							NM_015849	NP_056933	P08218	CEL2B_HUMAN	elastase 2B preproprotein						proteolysis	extracellular region	serine-type endopeptidase activity			ovary(1)	1						cctggccTGATTttttttttt	0.005													5	3	---	---	---	---	
DNAJC16	23341	broad.mit.edu	37	1	15891041	15891041	+	Intron	DEL	T	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:15891041delT	uc001aws.2	+						DNAJC16_uc001awr.1_Intron|DNAJC16_uc001awt.2_Intron|DNAJC16_uc001awu.2_Intron	NM_015291	NP_056106	Q9Y2G8	DJC16_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 16						cell redox homeostasis|protein folding	integral to membrane	heat shock protein binding|unfolded protein binding			urinary_tract(1)|lung(1)|kidney(1)	3		Colorectal(325;0.00108)|Renal(390;0.00145)|Breast(348;0.00173)|all_lung(284;0.00459)|Lung NSC(340;0.00499)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0798)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;9.18e-07)|COAD - Colon adenocarcinoma(227;4.5e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000133)|KIRC - Kidney renal clear cell carcinoma(229;0.00262)|STAD - Stomach adenocarcinoma(313;0.00774)|READ - Rectum adenocarcinoma(331;0.0657)		tattttttacttttttttttt	0.159													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	1	24819120	24819121	+	IGR	INS	-	TG	TG	rs147975017	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24819120_24819121insTG								NIPAL3 (19648 upstream) : RCAN3 (10266 downstream)																							cctgactagtttgtgtgtgtgt	0.000													5	3	---	---	---	---	
USP24	23358	broad.mit.edu	37	1	55557859	55557860	+	Intron	INS	-	TT	TT	rs144000884	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55557859_55557860insTT	uc001cyg.3	-							NM_015306	NP_056121	Q9UPU5	UBP24_HUMAN	ubiquitin specific protease 24						ubiquitin-dependent protein catabolic process		binding|cysteine-type peptidase activity|ubiquitin thiolesterase activity			ovary(6)|kidney(6)|breast(1)	13						ATTATTACACAGTTACGAACTA	0.282													2	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	1	154350594	154350594	+	IGR	DEL	T	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154350594delT								ATP8B2 (26815 upstream) : IL6R (27075 downstream)																							TCTTTTTTTCTTTTTTTTTTT	0.338													5	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	1	247348801	247348802	+	IGR	DEL	TC	-	-	rs138501449		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247348801_247348802delTC								ZNF124 (13483 upstream) : VN1R5 (70572 downstream)																							GCGGGTGTTTTCTCTTTTTACT	0.485													4	7	---	---	---	---	
TRIB2	28951	broad.mit.edu	37	2	12874063	12874063	+	Intron	DEL	G	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:12874063delG	uc002rbv.3	+						TRIB2_uc010yjp.1_Intron	NM_021643	NP_067675	Q92519	TRIB2_HUMAN	tribbles homolog 2						negative regulation of fat cell differentiation|negative regulation of interleukin-10 biosynthetic process|negative regulation of protein kinase activity|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|regulation of MAP kinase activity	cytoplasm|cytoskeleton|nucleus	ATP binding|protein kinase activity|protein kinase inhibitor activity|transcription factor binding|ubiquitin protein ligase binding|ubiquitin-protein ligase regulator activity			stomach(1)	1	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)					CACAGATGCTGGGAGAGGAAC	0.617													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	133034985	133034989	+	IGR	DEL	CTCCT	-	-	rs71855684	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:133034985_133034989delCTCCT								NCRNA00164 (19443 upstream) : GPR39 (139158 downstream)																							ccccaccccactcctcctcacccca	0.132													5	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	218879594	218879605	+	IGR	DEL	GGAAGGAAGGAA	-	-	rs71834632		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:218879594_218879605delGGAAGGAAGGAA								TNS1 (11876 upstream) : RUFY4 (20106 downstream)																							aaggaaggacggaaggaaggaaggaaggaagg	0.090													4	2	---	---	---	---	
DIS3L2	129563	broad.mit.edu	37	2	233197798	233197799	+	Intron	INS	-	CCTCCTCCTCTT	CCTCCTCCTCTT			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233197798_233197799insCCTCCTCCTCTT	uc010fxz.2	+						DIS3L2_uc002vsm.3_Intron|DIS3L2_uc002vso.2_Intron|DIS3L2_uc002vsp.1_5'Flank	NM_152383	NP_689596	Q8IYB7	DI3L2_HUMAN	DIS3 mitotic control homolog (S.								exonuclease activity|ribonuclease activity|RNA binding			ovary(1)|breast(1)|central_nervous_system(1)	3		all_hematologic(139;0.00809)|Renal(207;0.0113)|Acute lymphoblastic leukemia(138;0.0195)|all_lung(227;0.0465)|Lung NSC(271;0.136)		Epithelial(121;1.6e-13)|BRCA - Breast invasive adenocarcinoma(100;0.00104)|LUSC - Lung squamous cell carcinoma(224;0.0109)|Lung(119;0.0149)		ACCGCAGGCGGcctcctcctct	0.297													8	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	235453286	235453288	+	IGR	DEL	GAA	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:235453286_235453288delGAA								ARL4C (47593 upstream) : SH3BP4 (407340 downstream)																							aggaaggaaggaaggaagggaag	0.143													7	4	---	---	---	---	
HDLBP	3069	broad.mit.edu	37	2	242178792	242178792	+	Intron	DEL	T	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242178792delT	uc002waz.2	-						HDLBP_uc002wba.2_Intron|HDLBP_uc002wbb.2_Intron	NM_203346	NP_976221	Q00341	VIGLN_HUMAN	high density lipoprotein binding protein						cholesterol metabolic process|lipid transport	cytoplasm|high-density lipoprotein particle|nucleus|plasma membrane	lipid binding|protein binding|RNA binding			breast(3)|skin(1)	4		all_cancers(19;7.77e-41)|all_epithelial(40;1.74e-18)|Breast(86;1.53e-05)|Renal(207;0.00179)|all_lung(227;0.00338)|Ovarian(221;0.00556)|Lung NSC(271;0.0121)|Esophageal squamous(248;0.129)|all_hematologic(139;0.158)|Melanoma(123;0.16)|all_neural(83;0.243)|Hepatocellular(293;0.244)		Epithelial(32;8.13e-34)|all cancers(36;4.71e-31)|OV - Ovarian serous cystadenocarcinoma(60;2.34e-15)|Kidney(56;3.72e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.76e-08)|BRCA - Breast invasive adenocarcinoma(100;3.38e-06)|Lung(119;0.000109)|LUSC - Lung squamous cell carcinoma(224;0.000964)|Colorectal(34;0.0132)|COAD - Colon adenocarcinoma(134;0.0928)		tctctctctctTTTTTTTTTT	0.294													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	40485179	40485179	+	Intron	DEL	A	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:40485179delA	uc003cke.3	-											Homo sapiens hypothetical protein FLJ36665, mRNA (cDNA clone IMAGE:5299018).																		ggaaggaaggaaagaaagaaa	0.010													4	2	---	---	---	---	
ROBO1	6091	broad.mit.edu	37	3	78933773	78933774	+	Intron	INS	-	AA	AA			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:78933773_78933774insAA	uc003dqe.2	-						ROBO1_uc003dqb.2_Intron|ROBO1_uc003dqc.2_Intron|ROBO1_uc003dqd.2_Intron	NM_002941	NP_002932	Q9Y6N7	ROBO1_HUMAN	roundabout 1 isoform a						activation of caspase activity|axon midline choice point recognition|cell migration involved in sprouting angiogenesis|chemorepulsion involved in postnatal olfactory bulb interneuron migration|homophilic cell adhesion|negative regulation of chemokine-mediated signaling pathway|negative regulation of mammary gland epithelial cell proliferation|negative regulation of negative chemotaxis|positive regulation of axonogenesis|Roundabout signaling pathway	cell surface|cytoplasm|integral to plasma membrane	axon guidance receptor activity|identical protein binding|LRR domain binding			large_intestine(2)	2		Lung SC(41;0.0257)|Lung NSC(201;0.0439)		LUSC - Lung squamous cell carcinoma(21;0.008)|Epithelial(33;0.00999)|Lung(72;0.0177)|BRCA - Breast invasive adenocarcinoma(55;0.0274)		gaaagaaagagagaaagaaaga	0.020													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	105642817	105642818	+	IGR	INS	-	AGGC	AGGC	rs73001507	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:105642817_105642818insAGGC								CBLB (54551 upstream) : LOC100302640 (912842 downstream)																							ggaaggaaggaaggcaggcaag	0.074													2	4	---	---	---	---	
UROC1	131669	broad.mit.edu	37	3	126216641	126216645	+	Intron	DEL	GGCTT	-	-	rs71797104		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:126216641_126216645delGGCTT	uc003eiz.1	-						UROC1_uc010hsi.1_Intron	NM_144639	NP_653240	Q96N76	HUTU_HUMAN	urocanase domain containing 1 isoform 1						histidine catabolic process	cytosol	urocanate hydratase activity			ovary(1)	1				GBM - Glioblastoma multiforme(114;0.17)		GGAGGGCAGAGGCTTGGTGTGGGTG	0.590													5	6	---	---	---	---	
ALG1L2	644974	broad.mit.edu	37	3	129814833	129814833	+	Intron	DEL	A	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:129814833delA	uc011bld.1	+						ALG1L2_uc010hth.2_Intron	NM_001136152	NP_001129624	C9J202	AG1L2_HUMAN	asparagine-linked glycosylation 1-like 2						biosynthetic process		transferase activity, transferring glycosyl groups				0						CTGTGCTGGGAGGATTTGTGT	0.612													15	28	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	137254635	137254636	+	IGR	INS	-	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:137254635_137254636insA								IL20RB (524715 upstream) : SOX14 (228943 downstream)																							AACATACTAGCAAAAAAATCCT	0.441													6	4	---	---	---	---	
ATP1B3	483	broad.mit.edu	37	3	141632860	141632861	+	Intron	INS	-	A	A	rs147422245	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:141632860_141632861insA	uc003eug.1	+						ATP1B3_uc011bne.1_Intron|ATP1B3_uc003euh.1_Intron	NM_001679	NP_001670	P54709	AT1B3_HUMAN	Na+/K+ -ATPase beta 3 subunit						ATP biosynthetic process|blood coagulation|leukocyte migration	melanosome|sodium:potassium-exchanging ATPase complex	protein binding|sodium:potassium-exchanging ATPase activity				0						GTTTATATGGCAAAAAAAAGAG	0.327													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	176487539	176487542	+	IGR	DEL	AGGA	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:176487539_176487542delAGGA								NAALADL2 (964113 upstream) : TBL1XR1 (251001 downstream)																							ggagggagggaggaaggaaggaag	0.054													11	6	---	---	---	---	
TBL1XR1	79718	broad.mit.edu	37	3	176767668	176767671	+	Intron	DEL	TTAC	-	-	rs35503291		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:176767668_176767671delTTAC	uc003fiw.3	-						TBL1XR1_uc003fix.3_Intron|TBL1XR1_uc011bpz.1_Intron	NM_024665	NP_078941	Q9BZK7	TBL1R_HUMAN	transducin (beta)-like 1 X-linked receptor 1						canonical Wnt receptor signaling pathway|cellular lipid metabolic process|chromatin modification|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|proteasomal ubiquitin-dependent protein catabolic process|transcription, DNA-dependent	spindle microtubule|transcriptional repressor complex	beta-catenin binding|histone binding|protein N-terminus binding|transcription corepressor activity|transcription regulatory region DNA binding			ovary(1)	1	all_cancers(143;1.44e-17)|Ovarian(172;0.00163)|Breast(254;0.214)	Acute lymphoblastic leukemia(1;0.00599)|all_hematologic(1;0.0632)|Prostate(884;0.215)	OV - Ovarian serous cystadenocarcinoma(80;9.83e-31)			CGGTTTGTTGTTACTAGTTAATAA	0.333													3	4	---	---	---	---	
C3orf21	152002	broad.mit.edu	37	3	194791015	194791015	+	Intron	DEL	C	-	-	rs74504494		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194791015delC	uc003fum.3	-						C3orf21_uc003ful.2_Intron|C3orf21_uc003fuk.2_Intron	NM_152531	NP_689744	Q8NBI6	CC021_HUMAN	hypothetical protein LOC152002							integral to membrane	transferase activity, transferring glycosyl groups				0	all_cancers(143;9.33e-09)|Ovarian(172;0.0634)		Epithelial(36;1.73e-20)|all cancers(36;1.42e-18)|OV - Ovarian serous cystadenocarcinoma(49;1.56e-17)|Lung(62;0.000117)|LUSC - Lung squamous cell carcinoma(58;0.000146)	GBM - Glioblastoma multiforme(46;1.36e-05)		gggctctggaccccaagcctc	0.184													3	3	---	---	---	---	
SORCS2	57537	broad.mit.edu	37	4	7726316	7726317	+	Intron	INS	-	GAG	GAG			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:7726316_7726317insGAG	uc003gkb.3	+						SORCS2_uc011bwi.1_Intron	NM_020777	NP_065828	Q96PQ0	SORC2_HUMAN	VPS10 domain receptor protein SORCS 2 precursor							integral to membrane	neuropeptide receptor activity			ovary(1)|central_nervous_system(1)	2						atggtggtggtgttggtgatgg	0.000													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	4	16306158	16306159	+	IGR	INS	-	GT	GT	rs145711702	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:16306158_16306159insGT								FLJ39653 (46348 upstream) : LDB2 (197008 downstream)																							gccagattgcagtgtgtgtgtg	0.000													2	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	4	25599670	25599671	+	IGR	DEL	CC	-	-	rs35202612	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:25599670_25599671delCC								ANAPC4 (179551 upstream) : SLC34A2 (57764 downstream)																							cacacacacacccacacacaca	0.144													4	2	---	---	---	---	
CXCL9	4283	broad.mit.edu	37	4	76926198	76926198	+	Intron	DEL	T	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:76926198delT	uc003hjh.1	-							NM_002416	NP_002407	Q07325	CXCL9_HUMAN	small inducible cytokine B9 precursor						cell-cell signaling|cellular defense response|chemotaxis|G-protein coupled receptor protein signaling pathway|immune response|inflammatory response	extracellular space	chemokine activity			ovary(1)	1			Lung(101;0.0809)|LUSC - Lung squamous cell carcinoma(112;0.0934)			ACTGGTTGAAttttttttttt	0.149													6	3	---	---	---	---	
ADAMTS16	170690	broad.mit.edu	37	5	5234982	5234983	+	Intron	INS	-	AG	AG	rs5865597		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:5234982_5234983insAG	uc003jdl.2	+						ADAMTS16_uc003jdk.1_Intron|ADAMTS16_uc010itk.1_5'Flank	NM_139056	NP_620687	Q8TE57	ATS16_HUMAN	ADAM metallopeptidase with thrombospondin type 1						proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(3)|lung(2)|large_intestine(1)|breast(1)|pancreas(1)	8						gactccatctcaaaaaaaaaaa	0.124													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	6	12628846	12628861	+	IGR	DEL	CCTCCCTCCCTCCCTC	-	-	rs141722878	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:12628846_12628861delCCTCCCTCCCTCCCTC								EDN1 (331420 upstream) : PHACTR1 (88027 downstream)																							ttccttccttcctccctccctccctcccttccttcc	0.106													8	4	---	---	---	---	
SRPK1	6732	broad.mit.edu	37	6	35810504	35810504	+	Intron	DEL	A	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35810504delA	uc003olj.2	-						SRPK1_uc011dtg.1_Intron|SRPK1_uc003olh.2_Intron|SRPK1_uc003oli.2_Intron	NM_003137	NP_003128	Q96SB4	SRPK1_HUMAN	SFRS protein kinase 1						cell differentiation|chromosome segregation|interspecies interaction between organisms|intracellular protein kinase cascade|mRNA processing|negative regulation of viral genome replication|positive regulation of viral genome replication|regulation of mRNA processing|RNA splicing	cytoplasm|nucleus	ATP binding|magnesium ion binding|protein binding|protein serine/threonine kinase activity			ovary(1)	1						TAGATCATTTAAAAAAAAAAA	0.308													4	2	---	---	---	---	
UTRN	7402	broad.mit.edu	37	6	145011208	145011210	+	Intron	DEL	CTG	-	-	rs7768069		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:145011208_145011210delCTG	uc003qkt.2	+							NM_007124	NP_009055	P46939	UTRO_HUMAN	utrophin						muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)		ccaaaagtttctgtttttttttt	0.000													4	2	---	---	---	---	
RPS6KA2	6196	broad.mit.edu	37	6	166831109	166831110	+	Intron	DEL	AC	-	-	rs142289267		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:166831109_166831110delAC	uc003qvb.1	-						RPS6KA2_uc011ego.1_Intron|RPS6KA2_uc010kkl.1_Intron|RPS6KA2_uc003qvc.1_Intron|RPS6KA2_uc003qvd.1_Intron|RPS6KA2_uc010kkk.1_Intron	NM_021135	NP_066958	Q15349	KS6A2_HUMAN	ribosomal protein S6 kinase, 90kDa, polypeptide						axon guidance|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|stress-activated MAPK cascade|synaptic transmission|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			ovary(2)|lung(2)|skin(2)|large_intestine(1)|central_nervous_system(1)	8		Breast(66;2.04e-05)|Ovarian(120;0.0652)|Prostate(117;0.105)		OV - Ovarian serous cystadenocarcinoma(33;2.76e-18)|GBM - Glioblastoma multiforme(31;9.94e-06)|BRCA - Breast invasive adenocarcinoma(81;1.36e-05)		ctctctctatacacacacacac	0.050													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	7	1429845	1429845	+	IGR	DEL	G	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:1429845delG								UNCX (153233 upstream) : MICALL2 (44151 downstream)																							aaggaaggaagggagAGAGAA	0.040													5	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	7	56592013	56592014	+	IGR	INS	-	A	A			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:56592013_56592014insA								DKFZp434L192 (27036 upstream) : ZNF479 (595314 downstream)																							cctgggtaattaaaaaaaatgt	0.000													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	7	149224027	149224028	+	IGR	DEL	TG	-	-	rs146256084		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149224027_149224028delTG								ZNF746 (29129 upstream) : ZNF767 (20217 downstream)																							tatgaaatTCtgtgtgtgtgtg	0.134													4	2	---	---	---	---	
SLC39A14	23516	broad.mit.edu	37	8	22261971	22261972	+	Intron	INS	-	TT	TT			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22261971_22261972insTT	uc003xbq.3	+						SLC39A14_uc011kzg.1_Intron|SLC39A14_uc003xbp.3_Intron|SLC39A14_uc011kzh.1_Intron	NM_001128431	NP_001121903	Q15043	S39AE_HUMAN	solute carrier family 39 (zinc transporter),							endoplasmic reticulum|Golgi apparatus|integral to membrane|lamellipodium|plasma membrane	zinc ion transmembrane transporter activity				0				Colorectal(74;0.019)|COAD - Colon adenocarcinoma(73;0.0731)		CCGCATTGCTGTTTGTTTTTTT	0.163													3	3	---	---	---	---	
WRN	7486	broad.mit.edu	37	8	30968977	30968977	+	Intron	DEL	G	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:30968977delG	uc003xio.3	+						WRN_uc010lvk.2_Intron	NM_000553	NP_000544	Q14191	WRN_HUMAN	Werner syndrome protein						base-excision repair|cellular response to starvation|DNA recombination|DNA synthesis involved in DNA repair|multicellular organismal aging|nucleolus to nucleoplasm transport|positive regulation of hydrolase activity|regulation of apoptosis|replication fork processing|response to oxidative stress|response to UV-C|telomere maintenance	centrosome|nucleolus|nucleoplasm	3'-5' exonuclease activity|ATP binding|ATP-dependent 3'-5' DNA helicase activity|bubble DNA binding|four-way junction helicase activity|G-quadruplex DNA binding|magnesium ion binding|manganese ion binding|protein complex binding|protein homodimerization activity|Y-form DNA binding			ovary(2)|kidney(2)|large_intestine(1)|lung(1)|skin(1)	7		Breast(100;0.195)		KIRC - Kidney renal clear cell carcinoma(542;0.147)|Kidney(114;0.176)|Colorectal(111;0.192)		CAAGTTAGTAGGGAGATTTTT	0.303			Mis|N|F|S			osteosarcoma|meningioma|others		Genes_defective_in_diseases_associated_with_sensitivity_to_DNA_damaging_agents	Werner_syndrome				4	3	---	---	---	---	
NRG1	3084	broad.mit.edu	37	8	31687872	31687887	+	Intron	DEL	TCCTTCCCTCCTTCCC	-	-	rs36126687	byFrequency	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:31687872_31687887delTCCTTCCCTCCTTCCC	uc003xip.2	+							NM_013962	NP_039256	Q02297	NRG1_HUMAN	neuregulin 1 isoform GGF2						activation of transmembrane receptor protein tyrosine kinase activity|anti-apoptosis|cardiac muscle cell differentiation|cell communication|cell proliferation|cellular protein complex disassembly|embryo development|mammary gland development|negative regulation of cardiac muscle cell apoptosis|negative regulation of secretion|negative regulation of transcription, DNA-dependent|nervous system development|neural crest cell development|Notch signaling pathway|positive regulation of cardiac muscle cell proliferation|positive regulation of cell adhesion|positive regulation of cell growth|positive regulation of striated muscle cell differentiation|regulation of protein heterodimerization activity|regulation of protein homodimerization activity|transmembrane receptor protein tyrosine kinase signaling pathway|ventricular cardiac muscle cell differentiation|wound healing|wound healing	apical plasma membrane|extracellular region|extracellular space|integral to membrane|nucleus|plasma membrane	cytokine activity|ErbB-3 class receptor binding|growth factor activity|growth factor activity|protein binding|protein tyrosine kinase activator activity|receptor tyrosine kinase binding|transcription cofactor activity|transmembrane receptor protein tyrosine kinase activator activity				0		Breast(100;0.203)		KIRC - Kidney renal clear cell carcinoma(67;0.0768)|Kidney(114;0.0943)		cttccttccttccttccctccttccctccttccctc	0.139													3	3	---	---	---	---	
PREX2	80243	broad.mit.edu	37	8	68992517	68992518	+	Intron	INS	-	AGAGA	AGAGA	rs57574488		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:68992517_68992518insAGAGA	uc003xxv.1	+						PREX2_uc003xxu.1_Intron|PREX2_uc011lez.1_Intron	NM_024870	NP_079146	Q70Z35	PREX2_HUMAN	DEP domain containing 2 isoform a						G-protein coupled receptor protein signaling pathway|intracellular signal transduction	intracellular	protein binding|Rac GTPase activator activity|Rac guanyl-nucleotide exchange factor activity			skin(6)|large_intestine(4)|pancreas(3)|lung(2)|ovary(1)|kidney(1)	17						TATAGAAAGAGAAAAAAAACAA	0.327													4	2	---	---	---	---	
RIMS2	9699	broad.mit.edu	37	8	105261141	105261144	+	Intron	DEL	TTCC	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:105261141_105261144delTTCC	uc003yls.2	+						RIMS2_uc003ylp.2_Intron|RIMS2_uc003ylw.2_Intron|RIMS2_uc003ylq.2_Intron|RIMS2_uc003ylr.2_Intron	NM_014677	NP_055492	Q9UQ26	RIMS2_HUMAN	regulating synaptic membrane exocytosis 2						intracellular protein transport	cell junction|presynaptic membrane	metal ion binding|Rab GTPase binding			ovary(6)|lung(2)|breast(2)|skin(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	15			OV - Ovarian serous cystadenocarcinoma(57;7.7e-07)|STAD - Stomach adenocarcinoma(118;0.229)			ctctctctctttccctctctctct	0.103										HNSCC(12;0.0054)			4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	8	131768785	131768786	+	IGR	INS	-	CTTT	CTTT			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:131768785_131768786insCTTT								ASAP1 (354569 upstream) : ADCY8 (23762 downstream)																							ctccttccttccttccttcctt	0.000													4	4	---	---	---	---	
TG	7038	broad.mit.edu	37	8	134052198	134052199	+	Intron	INS	-	CACA	CACA	rs147401482	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:134052198_134052199insCACA	uc003ytw.2	+						TG_uc010mdw.2_Intron|TG_uc011ljb.1_Intron|TG_uc011ljc.1_Intron|SLA_uc003ytz.2_Intron|SLA_uc011lje.1_Intron|SLA_uc011ljf.1_Intron|SLA_uc011ljg.1_Intron|SLA_uc011ljd.1_Intron	NM_003235	NP_003226	P01266	THYG_HUMAN	thyroglobulin precursor						hormone biosynthetic process|signal transduction|thyroid gland development|thyroid hormone generation	extracellular space	hormone activity			ovary(8)|breast(4)|pancreas(1)|central_nervous_system(1)|skin(1)	15	Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)	Myeloproliferative disorder(644;0.00878)|Acute lymphoblastic leukemia(644;0.0559)|Breast(495;0.0735)	BRCA - Breast invasive adenocarcinoma(115;0.000701)	KIRC - Kidney renal clear cell carcinoma(542;0.0546)		GCACTTGCATGcacacacacac	0.460													4	2	---	---	---	---	
KIAA1797	54914	broad.mit.edu	37	9	20995359	20995360	+	Intron	INS	-	AA	AA			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:20995359_20995360insAA	uc003zog.1	+						KIAA1797_uc003zoh.1_Intron	NM_017794	NP_060264	Q5VW36	K1797_HUMAN	hypothetical protein LOC54914							integral to membrane	binding			ovary(8)|breast(1)|kidney(1)	10				GBM - Glioblastoma multiforme(3;2.1e-125)|Lung(42;2.76e-14)|LUSC - Lung squamous cell carcinoma(42;1.99e-11)		CAGGGTAACTTAAAAAAAAAAA	0.238													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	69721737	69721737	+	IGR	DEL	G	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:69721737delG								LOC100133920 (56788 upstream) : FOXD4L5 (453972 downstream)																							ATGATGGGGTGGGGGGGGGCG	0.418													17	8	---	---	---	---	
PCSK5	5125	broad.mit.edu	37	9	78790226	78790227	+	Intron	INS	-	AGAAC	AGAAC	rs45587131	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:78790226_78790227insAGAAC	uc004ajz.2	+						PCSK5_uc004ajy.2_3'UTR|PCSK5_uc004aka.2_Intron	NM_006200	NP_006191	Q92824	PCSK5_HUMAN	proprotein convertase subtilisin/kexin type 5						anterior/posterior pattern formation|cell-cell signaling|cytokine biosynthetic process|embryo implantation|embryonic digestive tract development|embryonic skeletal system development|heart development|kidney development|limb morphogenesis|nerve growth factor processing|nerve growth factor receptor signaling pathway|peptide biosynthetic process|renin secretion into blood stream|respiratory tube development|signal peptide processing|viral assembly, maturation, egress, and release	extracellular space|Golgi lumen|stored secretory granule	peptide binding|serine-type endopeptidase activity			ovary(2)|skin(1)	3						tagaatagaatagaacagaaca	0.119													3	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	107008293	107008293	+	IGR	DEL	G	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:107008293delG								SMC2 (104600 upstream) : OR13F1 (258251 downstream)																							aaggaaggaaggaaggaagga	0.025													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	2221205	2221205	+	IGR	DEL	A	-	-	rs112068462		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:2221205delA								ADARB2 (441487 upstream) : PFKP (888547 downstream)																							aacacaaagcaaaacatgctt	0.000													4	4	---	---	---	---	
UPF2	26019	broad.mit.edu	37	10	11978367	11978372	+	Intron	DEL	AAAAAC	-	-	rs72416162		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:11978367_11978372delAAAAAC	uc001ila.2	-						UPF2_uc001ilb.2_Intron|UPF2_uc001ilc.2_Intron	NM_080599	NP_542166	Q9HAU5	RENT2_HUMAN	UPF2 regulator of nonsense transcripts homolog						mRNA export from nucleus|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	exon-exon junction complex|perinuclear region of cytoplasm	identical protein binding|RNA binding			central_nervous_system(2)|ovary(1)	3		Renal(717;0.228)				ccgtctcaaaaaaaacaaaaacaaaa	0.121													2	5	---	---	---	---	
RASGEF1A	221002	broad.mit.edu	37	10	43701329	43701329	+	Intron	DEL	C	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43701329delC	uc001jap.1	-						RASGEF1A_uc001jao.1_Intron	NM_145313	NP_660356	Q8N9B8	RGF1A_HUMAN	RasGEF domain family, member 1A						cell migration|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	intracellular	Ras guanyl-nucleotide exchange factor activity				0						GCCCAGGTCACCCCATTAGTC	0.642													65	30	---	---	---	---	
PCDH15	65217	broad.mit.edu	37	10	57298158	57298161	+	Intron	DEL	CTTC	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:57298158_57298161delCTTC	uc001jjv.1	-							NM_001142770	NP_001136242	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD2-2 precursor						equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				tccttcctttcttccttccttcct	0.137										HNSCC(58;0.16)			8	7	---	---	---	---	
PSMA1	5682	broad.mit.edu	37	11	14539652	14539652	+	Intron	DEL	T	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:14539652delT	uc001mlk.2	-						PSMA1_uc001mll.2_Intron|PSMA1_uc010rcp.1_Intron|PSMA1_uc001mlj.2_Intron|PSMA1_uc010rcq.1_Intron	NM_002786	NP_002777	P25786	PSA1_HUMAN	proteasome alpha 1 subunit isoform 2						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	cytoplasm|nucleus|polysome|proteasome core complex, alpha-subunit complex	protein binding|RNA binding|threonine-type endopeptidase activity			upper_aerodigestive_tract(1)|skin(1)	2						TCAAGAGACCttttttttttt	0.134													4	2	---	---	---	---	
GPR137	56834	broad.mit.edu	37	11	64038448	64038449	+	Intron	DEL	AC	-	-	rs72297834		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64038448_64038449delAC	uc009ypj.1	+						BAD_uc001nzd.2_Intron|BAD_uc001nzc.2_Intron	NM_020155	NP_064540	Q96N19	G137A_HUMAN	G protein-coupled receptor 137							integral to membrane				central_nervous_system(1)	1						ATGCCCTGTGacacacacacac	0.327													5	3	---	---	---	---	
ANO1	55107	broad.mit.edu	37	11	69949370	69949371	+	Intron	INS	-	A	A	rs142425384	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:69949370_69949371insA	uc001opj.2	+						ANO1_uc001opk.1_Intron|ANO1_uc001opl.1_Intron	NM_018043	NP_060513	Q5XXA6	ANO1_HUMAN	anoctamin 1, calcium activated chloride channel						multicellular organismal development	chloride channel complex|cytoplasm|plasma membrane	intracellular calcium activated chloride channel activity			ovary(1)|pancreas(1)	2						CTGAGTTTTATAAAAAAAAAAC	0.545													5	3	---	---	---	---	
DSCAML1	57453	broad.mit.edu	37	11	117383477	117383478	+	Intron	DEL	CA	-	-	rs72324377		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:117383477_117383478delCA	uc001prh.1	-							NM_020693	NP_065744	Q8TD84	DSCL1_HUMAN	Down syndrome cell adhesion molecule like 1						axonogenesis|brain development|cell fate determination|dorsal/ventral pattern formation|embryonic skeletal system morphogenesis|homophilic cell adhesion	cell surface|integral to membrane|plasma membrane	protein homodimerization activity			ovary(3)|large_intestine(2)|skin(2)|upper_aerodigestive_tract(1)	8	all_hematologic(175;0.0487)	Breast(348;0.0424)|Medulloblastoma(222;0.0523)|all_hematologic(192;0.232)		BRCA - Breast invasive adenocarcinoma(274;9.12e-06)|Epithelial(105;0.00172)		cctctaggaTcacacacacaca	0.208													4	2	---	---	---	---	
GRIK4	2900	broad.mit.edu	37	11	120833533	120833534	+	Intron	DEL	TT	-	-	rs113458507		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:120833533_120833534delTT	uc001pxn.2	+						GRIK4_uc009zav.1_3'UTR|GRIK4_uc009zaw.1_Intron|GRIK4_uc009zax.1_Intron	NM_014619	NP_055434	Q16099	GRIK4_HUMAN	glutamate receptor KA1 precursor						glutamate signaling pathway|synaptic transmission	cell junction|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|kainate selective glutamate receptor activity			ovary(2)|central_nervous_system(1)	3		Breast(109;0.000868)|Medulloblastoma(222;0.0453)|all_neural(223;0.116)|all_hematologic(192;0.21)		BRCA - Breast invasive adenocarcinoma(274;1.24e-05)|OV - Ovarian serous cystadenocarcinoma(223;0.116)	L-Glutamic Acid(DB00142)	CATTCTAAAGTTTTTTTTTTTT	0.356													9	4	---	---	---	---	
LIN7A	8825	broad.mit.edu	37	12	81205199	81205200	+	Intron	DEL	TA	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:81205199_81205200delTA	uc001szj.1	-						LIN7A_uc001szk.1_Intron	NM_004664	NP_004655	O14910	LIN7A_HUMAN	lin-7 homolog A						exocytosis|protein complex assembly|protein transport	basolateral plasma membrane|postsynaptic density|postsynaptic membrane|synaptosome|tight junction	L27 domain binding			ovary(1)|skin(1)	2						tgtgtgtgtgtatatatatata	0.153													4	2	---	---	---	---	
C12orf63	374467	broad.mit.edu	37	12	97073170	97073170	+	Intron	DEL	T	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:97073170delT	uc001tet.1	+							NM_198520	NP_940922	Q6ZTY8	CL063_HUMAN	hypothetical protein LOC374467											skin(6)|ovary(1)	7						TTTTCCAAGCTTTTTTTTTTT	0.318													4	2	---	---	---	---	
DNAH10	196385	broad.mit.edu	37	12	124315343	124315343	+	Intron	DEL	T	-	-	rs7976816		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124315343delT	uc001uft.3	+							NM_207437	NP_997320	Q8IVF4	DYH10_HUMAN	dynein, axonemal, heavy chain 10						microtubule-based movement	cilium axoneme|cytoplasm|dynein complex|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(3)|skin(2)|central_nervous_system(1)	6	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000207)|Epithelial(86;0.000556)|all cancers(50;0.00346)		aaaaaaaaaattagctgagcg	0.100													5	4	---	---	---	---	
SETDB2	83852	broad.mit.edu	37	13	50057746	50057753	+	Intron	DEL	TTTTTTTT	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:50057746_50057753delTTTTTTTT	uc001vcz.2	+						SETDB2_uc001vcy.3_Intron|SETDB2_uc010adh.2_Intron|SETDB2_uc001vda.2_Intron	NM_031915	NP_114121	Q96T68	SETB2_HUMAN	SET domain, bifurcated 2 isoform a						cell division|chromosome segregation|heart looping|left/right axis specification|mitosis|negative regulation of transcription, DNA-dependent	chromosome|nucleus	DNA binding|histone methyltransferase activity (H3-K9 specific)|zinc ion binding			ovary(1)|central_nervous_system(1)	2		Lung NSC(96;0.000408)|Breast(56;0.00131)|Prostate(109;0.00446)|Hepatocellular(98;0.0556)|Glioma(44;0.236)	KIRC - Kidney renal clear cell carcinoma(9;0.206)	GBM - Glioblastoma multiforme(99;3.1e-09)		CTTTTTTAAAtttttttttttttttttt	0.154													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	13	63976118	63976121	+	IGR	DEL	TTCC	-	-	rs111579679		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:63976118_63976121delTTCC								None (None upstream) : OR7E156P (335447 downstream)																							aatcaTGTGTttccttccttcctt	0.078													4	2	---	---	---	---	
TMTC4	84899	broad.mit.edu	37	13	101264909	101264912	+	Intron	DEL	ACAC	-	-	rs74114800		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101264909_101264912delACAC	uc001vou.2	-						TMTC4_uc001vot.2_Intron|TMTC4_uc010tja.1_Intron	NM_001079669	NP_001073137	Q5T4D3	TMTC4_HUMAN	transmembrane and tetratricopeptide repeat							integral to membrane	binding			ovary(2)|breast(1)	3	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)					ATCATGTAATacacacacacacac	0.294													5	3	---	---	---	---	
MYO16	23026	broad.mit.edu	37	13	109793494	109793494	+	Frame_Shift_Del	DEL	C	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:109793494delC	uc001vqt.1	+	32	4994	c.4868delC	c.(4867-4869)GCCfs	p.A1623fs	MYO16_uc010agk.1_Frame_Shift_Del_p.A1645fs	NM_015011	NP_055826	Q9Y6X6	MYO16_HUMAN	myosin heavy chain Myr 8	1623	Pro-rich.				cerebellum development|negative regulation of cell proliferation|negative regulation of S phase of mitotic cell cycle	myosin complex|nucleoplasm|perinuclear region of cytoplasm|plasma membrane	actin filament binding|ATP binding|motor activity			ovary(6)|large_intestine(1)|kidney(1)|breast(1)|central_nervous_system(1)	10	all_lung(23;0.000332)|all_neural(89;0.00294)|Medulloblastoma(90;0.00596)|Lung NSC(43;0.00751)|Lung SC(71;0.104)		BRCA - Breast invasive adenocarcinoma(86;0.19)|all cancers(43;0.201)			CCAAACTCTGCCCCCGTGGCC	0.716													29	43	---	---	---	---	
Unknown	0	broad.mit.edu	37	13	110078781	110078788	+	IGR	DEL	TCCCTCCT	-	-	rs57962643	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:110078781_110078788delTCCCTCCT								MYO16 (218426 upstream) : IRS2 (327398 downstream)																							cctccctccctccctcctccttccttcc	0.197													1	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	14	34669510	34669513	+	IGR	DEL	GATG	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:34669510_34669513delGATG								EGLN3 (249223 upstream) : C14orf147 (232632 downstream)																							aacagagcaagaTggatggatgga	0.000													19	10	---	---	---	---	
Unknown	0	broad.mit.edu	37	14	49785521	49785522	+	IGR	INS	-	GAAGGAAGGAAGGAAG	GAAGGAAGGAAGGAAG			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:49785521_49785522insGAAGGAAGGAAGGAAG								None (None upstream) : SDCCAG1 (247505 downstream)																							CAAAGAAAGGAgaaggaaggaa	0.168													6	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	14	95121839	95121840	+	IGR	INS	-	CA	CA	rs71412323		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95121839_95121840insCA								SERPINA13 (8509 upstream) : GSC (112721 downstream)																							GCGCACGCGCGcacacacacac	0.114													4	5	---	---	---	---	
ADAM6	8755	broad.mit.edu	37	14	106478307	106478308	+	RNA	INS	-	ACC	ACC			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:106478307_106478308insACC	uc010tyt.1	-	1857		c.35978_35979insGGT								Parts of antibodies, mostly variable regions.												0						CTCCAGTAGTAACTACTGATGG	0.609													10	8	---	---	---	---	
ADAM6	8755	broad.mit.edu	37	14	106491258	106491259	+	Intron	DEL	AC	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:106491258_106491259delAC	uc010tyt.1	-											Parts of antibodies, mostly variable regions.												0						TTAGTTTCTAacacacacacac	0.193													3	4	---	---	---	---	
METRN	79006	broad.mit.edu	37	16	767426	767427	+	3'UTR	INS	-	G	G	rs147270224	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:767426_767427insG	uc002cjd.2	+	4					uc010bra.1_5'Flank	NM_024042	NP_076947	Q9UJH8	METRN_HUMAN	meteorin, glial cell differentiation regulator												0		Hepatocellular(780;0.00335)				GGAGGGAGGGTGGGCCCACTGC	0.658													5	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	16	87906524	87906525	+	IGR	INS	-	CT	CT			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:87906524_87906525insCT								SLC7A5 (3424 upstream) : CA5A (15100 downstream)																							ttctttctttcttccttccttc	0.000													5	3	---	---	---	---	
ZFPM1	161882	broad.mit.edu	37	16	88593210	88593211	+	Intron	DEL	CT	-	-	rs150280017	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88593210_88593211delCT	uc002fkv.2	+							NM_153813	NP_722520	Q8IX07	FOG1_HUMAN	zinc finger protein, multitype 1						blood coagulation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm	DNA binding|transcription factor binding|zinc ion binding			central_nervous_system(1)	1				BRCA - Breast invasive adenocarcinoma(80;0.0478)		TGTTCCTACCCTCCCCCCCCAG	0.688													4	2	---	---	---	---	
TNFSF12-TNFSF13	407977	broad.mit.edu	37	17	7451499	7451502	+	5'Flank	DEL	TCCC	-	-	rs143544491		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7451499_7451502delTCCC	uc002ghi.1	+						TNFSF12_uc002ghg.2_5'Flank|TNFSF12_uc002ghh.2_5'Flank	NM_172089	NP_742086	Q8IZK7	Q8IZK7_HUMAN	TNFSF12-TNFSF13 protein						immune response	extracellular space|membrane	cytokine activity|tumor necrosis factor receptor binding				0		Prostate(122;0.157)				cttccttccttccctccttccctc	0.010													7	9	---	---	---	---	
DHRS7C	201140	broad.mit.edu	37	17	9683469	9683469	+	Intron	DEL	A	-	-	rs111824797		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:9683469delA	uc010vvb.1	-						DHRS7C_uc010cof.2_Intron	NM_001105571	NP_001099041	A6NNS2	DRS7C_HUMAN	dehydrogenase/reductase (SDR family) member 7C							extracellular region	binding|oxidoreductase activity				0						GAAATGACTGAAAAAAAAAAA	0.413													4	2	---	---	---	---	
FAM117A	81558	broad.mit.edu	37	17	47840486	47840489	+	Intron	DEL	ACAC	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:47840486_47840489delACAC	uc002ipk.2	-						FAM117A_uc010wlz.1_Intron	NM_030802	NP_110429	Q9C073	F117A_HUMAN	family with sequence similarity 117, member A											ovary(1)	1						CCCCCCCGCTacacacacacacac	0.412													6	3	---	---	---	---	
TBX2	6909	broad.mit.edu	37	17	59481894	59481894	+	Intron	DEL	C	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59481894delC	uc010wox.1	+						TBX2_uc002ize.2_Intron|TBX2_uc002izg.2_Intron	NM_005994	NP_005985	Q13207	TBX2_HUMAN	T-box 2						cell aging|positive regulation of cell proliferation		sequence-specific DNA binding				0						GTGGCGGGTGCCCGCGGGAGC	0.667													24	11	---	---	---	---	
TBX2	6909	broad.mit.edu	37	17	59482169	59482169	+	Intron	DEL	C	-	-	rs35619711		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59482169delC	uc010wox.1	+						TBX2_uc002ize.2_Frame_Shift_Del_p.R354fs|TBX2_uc002izg.2_Intron	NM_005994	NP_005985	Q13207	TBX2_HUMAN	T-box 2						cell aging|positive regulation of cell proliferation		sequence-specific DNA binding				0						GAGGTGGCGGCGGGGGGTCCT	0.706													4	2	---	---	---	---	
TBC1D3P2	440452	broad.mit.edu	37	17	60347260	60347260	+	Intron	DEL	T	-	-	rs71934275		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:60347260delT	uc002izq.2	-						TBC1D3P2_uc010woz.1_Intron|uc010wpa.1_5'Flank					SubName: Full=Putative uncharacterized protein TBC1D3E;												0						CTCTGAATGATTTTTTTTTTT	0.448													6	3	---	---	---	---	
MARCH10	162333	broad.mit.edu	37	17	60878820	60878821	+	Intron	INS	-	TT	TT			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:60878820_60878821insTT	uc010ddr.2	-						MARCH10_uc002jag.3_Intron|MARCH10_uc010dds.2_Intron|MARCH10_uc002jah.2_Intron	NM_001100875	NP_001094345	Q8NA82	MARHA_HUMAN	ring finger protein 190								ligase activity|zinc ion binding				0						agctatccccgttttttttttt	0.035													4	2	---	---	---	---	
HKR1	284459	broad.mit.edu	37	19	37852828	37852828	+	Intron	DEL	A	-	-	rs67608963		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37852828delA	uc002ogb.2	+						HKR1_uc002ofx.2_Intron|HKR1_uc002ofy.2_Intron|HKR1_uc002oga.2_Intron|HKR1_uc010xto.1_Intron|HKR1_uc002ogc.2_Intron|HKR1_uc010xtp.1_Intron|HKR1_uc002ogd.2_Intron	NM_181786	NP_861451	P10072	HKR1_HUMAN	GLI-Kruppel family member HKR1						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2			COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)			aaaaaaaaacaaaaaaacaaa	0.144													6	7	---	---	---	---	
SPTBN4	57731	broad.mit.edu	37	19	41055990	41055990	+	Intron	DEL	A	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41055990delA	uc002ony.2	+						SPTBN4_uc002onx.2_Intron|SPTBN4_uc002onz.2_Intron|SPTBN4_uc010egx.2_Intron|SPTBN4_uc010egy.1_Intron|SPTBN4_uc002ooa.2_Intron	NM_020971	NP_066022	Q9H254	SPTN4_HUMAN	spectrin, beta, non-erythrocytic 4 isoform						actin filament capping|axon guidance|cytoskeletal anchoring at plasma membrane|vesicle-mediated transport	cytosol|nuclear matrix|PML body|spectrin	actin binding|ankyrin binding|structural constituent of cytoskeleton			ovary(3)|central_nervous_system(1)|skin(1)	5			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)			catctcaaagaaaaaaaaaaa	0.239													6	3	---	---	---	---	
NUCB1	4924	broad.mit.edu	37	19	49414649	49414653	+	Intron	DEL	TTTCT	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49414649_49414653delTTTCT	uc002plb.3	+						NUCB1_uc002pla.2_Intron|NUCB1_uc002plc.2_Intron	NM_006184	NP_006175	Q02818	NUCB1_HUMAN	nucleobindin 1 precursor							ER-Golgi intermediate compartment|extracellular space|Golgi apparatus|membrane|microtubule cytoskeleton	calcium ion binding|DNA binding				0		all_lung(116;4.89e-05)|Lung NSC(112;8.3e-05)|all_epithelial(76;8.64e-05)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.000171)|all cancers(93;0.000333)|Epithelial(262;0.0174)|GBM - Glioblastoma multiforme(486;0.0244)		GGCTGAGTCGTTtcttttcttttct	0.293													4	2	---	---	---	---	
ISOC2	79763	broad.mit.edu	37	19	55964546	55964547	+	3'UTR	INS	-	CC	CC	rs139098245	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55964546_55964547insCC	uc002qlb.2	-	6					ISOC2_uc002qla.2_3'UTR|ISOC2_uc002qlc.2_3'UTR	NM_001136201	NP_001129673	Q96AB3	ISOC2_HUMAN	isochorismatase domain containing 2 isoform 1						protein destabilization	mitochondrion|nucleus	catalytic activity|protein binding			ovary(1)	1	Breast(117;0.155)		BRCA - Breast invasive adenocarcinoma(297;0.18)|LUSC - Lung squamous cell carcinoma(43;0.193)	GBM - Glioblastoma multiforme(193;0.0535)		GCAGCACCCTGCCCCCCCCACA	0.639													6	4	---	---	---	---	
C20orf94	128710	broad.mit.edu	37	20	10520733	10520745	+	Intron	DEL	TCCTTCCTTCCTT	-	-	rs36230137		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:10520733_10520745delTCCTTCCTTCCTT	uc010zre.1	+							NM_001009608	NP_001009608	Q5VYV7	CT094_HUMAN	hypothetical protein LOC128710								protein binding				0						ttcttttctctccttccttcctttccttccttc	0.009													4	2	---	---	---	---	
ENTPD6	955	broad.mit.edu	37	20	25198695	25198697	+	Intron	DEL	CTC	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:25198695_25198697delCTC	uc002wuj.2	+						ENTPD6_uc010zsy.1_Intron|ENTPD6_uc010gdj.1_Intron|ENTPD6_uc010zsz.1_Intron|ENTPD6_uc002wum.2_Intron|ENTPD6_uc010zta.1_Intron|ENTPD6_uc002wun.2_Intron|ENTPD6_uc002wuk.2_Intron|ENTPD6_uc002wul.2_Intron|ENTPD6_uc010ztb.1_Intron|ENTPD6_uc010ztc.1_Intron|ENTPD6_uc002wuo.2_Intron|ENTPD6_uc010ztd.1_Intron	NM_001247	NP_001238	O75354	ENTP6_HUMAN	ectonucleoside triphosphate diphosphohydrolase 6							Golgi membrane|integral to membrane	nucleoside-diphosphatase activity				0						AGAcctctctctcctcctcctcc	0.246													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	21	9857293	9857293	+	IGR	DEL	T	-	-	rs71251986		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:9857293delT								None (None upstream) : None (None downstream)																							GCAAGGATGGTGCCTTGCCTG	0.602													2	4	---	---	---	---	
APP	351	broad.mit.edu	37	21	27429790	27429791	+	Intron	DEL	CA	-	-	rs113693222		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:27429790_27429791delCA	uc002ylz.2	-						APP_uc010glk.2_Intron|APP_uc002yma.2_Intron|APP_uc011ach.1_Intron|APP_uc002ymb.2_Intron|APP_uc010glj.2_Intron|APP_uc011aci.1_Intron|APP_uc011acj.1_Intron	NM_000484	NP_000475	P05067	A4_HUMAN	amyloid beta A4 protein isoform a precursor						adult locomotory behavior|axon cargo transport|axon midline choice point recognition|cell adhesion|cellular copper ion homeostasis|collateral sprouting in absence of injury|dendrite development|endocytosis|extracellular matrix organization|G2 phase of mitotic cell cycle|innate immune response|ionotropic glutamate receptor signaling pathway|mating behavior|mRNA polyadenylation|neuron apoptosis|neuron remodeling|Notch signaling pathway|platelet activation|platelet degranulation|positive regulation of mitotic cell cycle|protein phosphorylation|regulation of epidermal growth factor receptor activity|regulation of multicellular organism growth|regulation of synapse structure and activity|regulation of translation|visual learning	axon|cell surface|coated pit|dendritic shaft|dendritic spine|extracellular region|Golgi apparatus|integral to plasma membrane|platelet alpha granule lumen	acetylcholine receptor binding|DNA binding|heparin binding|identical protein binding|metal ion binding|protein binding|protein binding|PTB domain binding|serine-type endopeptidase inhibitor activity			ovary(1)	1		Breast(209;0.00295)				TGTcacacaccacacacacaca	0.292													4	3	---	---	---	---	
BPIL2	254240	broad.mit.edu	37	22	32832328	32832360	+	Intron	DEL	GAGGAAGAGGAGGAGGAGGAGGAGGAGGAGGAG	-	-	rs13054935		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:32832328_32832360delGAGGAAGAGGAGGAGGAGGAGGAGGAGGAGGAG	uc003amn.2	-						BPIL2_uc010gwo.2_Intron|BPIL2_uc011amb.1_Intron	NM_174932	NP_777592	Q8NFQ6	BPIL2_HUMAN	bactericidal/permeability-increasing							extracellular region	lipopolysaccharide binding|phospholipid binding			ovary(1)|skin(1)	2						gaagaaagaagaggaagaggaggaggaggaggaggaggaggaggaggaagagg	0.000													4	2	---	---	---	---	
CACNA1I	8911	broad.mit.edu	37	22	39966252	39966259	+	5'Flank	DEL	CCTTCCTT	-	-	rs10528897		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:39966252_39966259delCCTTCCTT	uc003ayc.2	+						CACNA1I_uc003ayd.2_5'Flank	NM_021096	NP_066919	Q9P0X4	CAC1I_HUMAN	calcium channel, voltage-dependent, T type,						axon guidance|signal transduction	voltage-gated calcium channel complex	low voltage-gated calcium channel activity|protein binding			breast(1)|central_nervous_system(1)	2	Melanoma(58;0.0749)				Flunarizine(DB04841)|Paramethadione(DB00617)|Verapamil(DB00661)	AGTTAAGATCccttccttccttccttcc	0.144													5	4	---	---	---	---	
GRAMD4	23151	broad.mit.edu	37	22	47037290	47037293	+	Intron	DEL	AAGG	-	-	rs36132763		TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:47037290_47037293delAAGG	uc003bhx.2	+						GRAMD4_uc010had.2_Intron	NM_015124	NP_055939	Q6IC98	GRAM4_HUMAN	death-inducing-protein						apoptosis	integral to membrane|mitochondrial membrane				ovary(1)	1		Breast(42;0.00571)|Ovarian(80;0.00965)|all_neural(38;0.0416)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0178)|BRCA - Breast invasive adenocarcinoma(115;0.166)		ATAAATAAATaaggaaggaaggaa	0.176													10	7	---	---	---	---	
MOV10L1	54456	broad.mit.edu	37	22	50529105	50529106	+	Intron	INS	-	TG	TG	rs150705221	by1000genomes	TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50529105_50529106insTG	uc003bjj.2	+						MOV10L1_uc003bjk.3_Intron|MOV10L1_uc011arp.1_Intron|MOV10L1_uc010han.2_Intron	NM_018995	NP_061868	Q9BXT6	M10L1_HUMAN	MOV10-like 1 isoform 1						germ cell development|multicellular organismal development|spermatogenesis		ATP binding|ATP-dependent RNA helicase activity|magnesium ion binding|RNA binding			ovary(2)|skin(1)	3		all_cancers(38;3.31e-11)|all_epithelial(38;5.69e-10)|all_lung(38;3.73e-05)|Breast(42;0.000525)|Lung NSC(38;0.000954)|Ovarian(80;0.0367)|Lung SC(80;0.114)		LUAD - Lung adenocarcinoma(64;0.0215)|BRCA - Breast invasive adenocarcinoma(115;0.24)		CCTGAGGTGTTTGTGTGTGTGT	0.322													3	3	---	---	---	---	
PPP2R3B	28227	broad.mit.edu	37	X	302265	302265	+	Intron	DEL	T	-	-			TCGA-66-2773-01	TCGA-66-2773-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:302265delT	uc004cpg.2	-						PPP2R3B_uc004cpf.2_5'UTR	NM_013239	NP_037371	Q9Y5P8	P2R3B_HUMAN	protein phosphatase 2, regulatory subunit B'',						cell cycle arrest|protein dephosphorylation	nucleus|protein phosphatase type 2A complex	calcium ion binding|protein phosphatase type 2A regulator activity|protein serine/threonine phosphatase activity				0		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)				ctcctgcccctcctcctgcct	0.537													8	4	---	---	---	---	
