Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	filter
GABRD	2563	broad.mit.edu	37	1	1961513	1961513	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1961513C>T	uc001aip.2	+	9	1246	c.1151C>T	c.(1150-1152)CCG>CTG	p.P384L		NM_000815	NP_000806	O14764	GBRD_HUMAN	gamma-aminobutyric acid (GABA) A receptor, delta	384	Cytoplasmic (Probable).					cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3	all_cancers(77;0.000708)|all_epithelial(69;0.000943)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;2.7e-19)|all_lung(118;1.22e-08)|Lung NSC(185;1.24e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Medulloblastoma(700;0.123)|Lung SC(97;0.128)		Epithelial(90;2.19e-38)|OV - Ovarian serous cystadenocarcinoma(86;3.17e-24)|GBM - Glioblastoma multiforme(42;9.56e-08)|Colorectal(212;4.12e-05)|COAD - Colon adenocarcinoma(227;0.000194)|Kidney(185;0.00231)|BRCA - Breast invasive adenocarcinoma(365;0.00441)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0344)|Lung(427;0.2)		CGCCGCGTCCCGGGGAACCTG	0.687													13	28	---	---	---	---	PASS
PLCH2	9651	broad.mit.edu	37	1	2411368	2411368	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:2411368G>A	uc001aji.1	+	3	741	c.467G>A	c.(466-468)GGC>GAC	p.G156D	PLCH2_uc010nyz.1_5'Flank|PLCH2_uc009vle.1_5'Flank|PLCH2_uc001ajj.1_5'Flank|PLCH2_uc001ajk.1_5'Flank	NM_014638	NP_055453	O75038	PLCH2_HUMAN	phospholipase C, eta 2	156					intracellular signal transduction|lipid catabolic process	cytoplasm|plasma membrane	calcium ion binding|phosphatidylinositol phospholipase C activity|signal transducer activity			central_nervous_system(3)|ovary(1)|skin(1)	5	all_cancers(77;0.000161)|all_epithelial(69;5.98e-05)|all_lung(157;0.016)|Lung NSC(156;0.0376)|Ovarian(185;0.0634)	all_epithelial(116;7.32e-16)|all_lung(118;1.15e-06)|Lung NSC(185;6.26e-05)|Renal(390;0.00571)|Breast(487;0.00832)|Hepatocellular(190;0.0268)|Myeloproliferative disorder(586;0.028)|Ovarian(437;0.127)|Medulloblastoma(700;0.151)|Lung SC(97;0.217)		Epithelial(90;1.44e-37)|OV - Ovarian serous cystadenocarcinoma(86;6.78e-23)|GBM - Glioblastoma multiforme(42;2.8e-08)|Colorectal(212;4.19e-05)|COAD - Colon adenocarcinoma(227;0.000195)|Kidney(185;0.00034)|BRCA - Breast invasive adenocarcinoma(365;0.00443)|KIRC - Kidney renal clear cell carcinoma(229;0.00548)|STAD - Stomach adenocarcinoma(132;0.00644)|Lung(427;0.2)		CTCATGGCCGGCATCAGCGAC	0.682													3	46	---	---	---	---	PASS
RNF207	388591	broad.mit.edu	37	1	6273210	6273210	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6273210C>T	uc001amg.2	+	16	1793	c.1619C>T	c.(1618-1620)TCC>TTC	p.S540F	RNF207_uc010nzp.1_RNA	NM_207396	NP_997279	Q6ZRF8	RN207_HUMAN	ring finger protein 207	540						intracellular	zinc ion binding				0	Ovarian(185;0.0634)	all_cancers(23;1.22e-38)|all_epithelial(116;4.25e-22)|all_lung(118;7.95e-08)|Lung NSC(185;1.6e-06)|all_neural(13;3.18e-06)|all_hematologic(16;8.99e-06)|Acute lymphoblastic leukemia(12;0.000365)|Breast(487;0.000496)|Renal(390;0.0007)|Colorectal(325;0.00104)|Glioma(11;0.00203)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0392)|Medulloblastoma(700;0.211)		Epithelial(90;4.84e-38)|GBM - Glioblastoma multiforme(13;5.77e-32)|OV - Ovarian serous cystadenocarcinoma(86;2.88e-19)|Colorectal(212;6.9e-08)|COAD - Colon adenocarcinoma(227;8.13e-06)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000896)|BRCA - Breast invasive adenocarcinoma(365;0.00108)|STAD - Stomach adenocarcinoma(132;0.00311)|READ - Rectum adenocarcinoma(331;0.0642)|Lung(427;0.182)		TACGTCCGCTCCATTGCCAAG	0.582													14	70	---	---	---	---	PASS
TAS1R1	80835	broad.mit.edu	37	1	6634877	6634877	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6634877G>A	uc001ant.2	+	3	685	c.685G>A	c.(685-687)GAG>AAG	p.E229K	TAS1R1_uc001anu.2_Intron|TAS1R1_uc001anv.2_Intron|TAS1R1_uc001anw.2_Missense_Mutation_p.E229K	NM_138697	NP_619642	Q7RTX1	TS1R1_HUMAN	sweet taste receptor T1r isoform b	229	Extracellular (Potential).				sensory perception of umami taste	plasma membrane	protein heterodimerization activity|taste receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3	Ovarian(185;0.0212)|all_lung(157;0.154)	all_cancers(23;8.73e-34)|all_epithelial(116;9.26e-22)|all_lung(118;7.57e-07)|Lung NSC(185;4.26e-06)|Breast(487;0.000353)|Renal(390;0.0007)|Colorectal(325;0.00104)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0443)		Colorectal(212;1.29e-07)|COAD - Colon adenocarcinoma(227;1.33e-05)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000896)|BRCA - Breast invasive adenocarcinoma(365;0.00108)|STAD - Stomach adenocarcinoma(132;0.0167)|READ - Rectum adenocarcinoma(331;0.0642)		GCAGGCACTGGAGAACCAGGC	0.597													17	97	---	---	---	---	PASS
SLC2A5	6518	broad.mit.edu	37	1	9097668	9097668	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:9097668G>T	uc001apo.2	-	12	1775	c.1483C>A	c.(1483-1485)CCA>ACA	p.P495T	SLC2A5_uc010nzy.1_Missense_Mutation_p.P436T|SLC2A5_uc010nzz.1_Missense_Mutation_p.P380T|SLC2A5_uc010oaa.1_Missense_Mutation_p.P451T|SLC2A5_uc010oab.1_Missense_Mutation_p.P495T	NM_003039	NP_003030	P22732	GTR5_HUMAN	solute carrier family 2 (facilitated	495	Cytoplasmic (Potential).				carbohydrate metabolic process	integral to membrane|plasma membrane	fructose transmembrane transporter activity|glucose transmembrane transporter activity			pancreas(2)|ovary(1)	3	Ovarian(185;0.112)|all_lung(157;0.185)	all_epithelial(116;1.34e-15)|all_lung(118;9.46e-05)|Lung NSC(185;0.000172)|Renal(390;0.000469)|Colorectal(325;0.0062)|Breast(348;0.00715)|Hepatocellular(190;0.0228)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.104)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;7.78e-07)|COAD - Colon adenocarcinoma(227;8.83e-05)|Kidney(185;0.000286)|KIRC - Kidney renal clear cell carcinoma(229;0.00103)|STAD - Stomach adenocarcinoma(132;0.0019)|BRCA - Breast invasive adenocarcinoma(304;0.00199)|READ - Rectum adenocarcinoma(331;0.0649)		GTGACAGGTGGAAGCTCTTTC	0.493													19	281	---	---	---	---	PASS
SLC2A5	6518	broad.mit.edu	37	1	9118277	9118277	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:9118277C>G	uc001apo.2	-	2	358	c.66G>C	c.(64-66)CTG>CTC	p.L22L	SLC2A5_uc010nzz.1_Intron|SLC2A5_uc010oaa.1_5'UTR|SLC2A5_uc010oab.1_Silent_p.L22L|SLC2A5_uc010oac.1_Silent_p.L22L|SLC2A5_uc001app.3_Silent_p.L22L	NM_003039	NP_003030	P22732	GTR5_HUMAN	solute carrier family 2 (facilitated	22	Helical; Name=1; (Potential).				carbohydrate metabolic process	integral to membrane|plasma membrane	fructose transmembrane transporter activity|glucose transmembrane transporter activity			pancreas(2)|ovary(1)	3	Ovarian(185;0.112)|all_lung(157;0.185)	all_epithelial(116;1.34e-15)|all_lung(118;9.46e-05)|Lung NSC(185;0.000172)|Renal(390;0.000469)|Colorectal(325;0.0062)|Breast(348;0.00715)|Hepatocellular(190;0.0228)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.104)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;7.78e-07)|COAD - Colon adenocarcinoma(227;8.83e-05)|Kidney(185;0.000286)|KIRC - Kidney renal clear cell carcinoma(229;0.00103)|STAD - Stomach adenocarcinoma(132;0.0019)|BRCA - Breast invasive adenocarcinoma(304;0.00199)|READ - Rectum adenocarcinoma(331;0.0649)		AGGCAGCTATCAGGGTTGCCA	0.582													7	56	---	---	---	---	PASS
LOC649330	649330	broad.mit.edu	37	1	12907714	12907714	+	Silent	SNP	C	T	T	rs138482466		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12907714C>T	uc009vno.2	-	1	524	c.429G>A	c.(427-429)TCG>TCA	p.S143S	HNRNPCL1_uc010obf.1_Silent_p.S143S	NM_001146181	NP_001139653	B7ZW38	B7ZW38_HUMAN	heterogeneous nuclear ribonucleoprotein C-like	143							nucleic acid binding|nucleotide binding				0						GTTGACGTTTCGAGGGCACTA	0.483													48	199	---	---	---	---	PASS
PRAMEF10	343071	broad.mit.edu	37	1	12954931	12954931	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12954931C>G	uc001auo.2	-	3	425	c.352G>C	c.(352-354)GGA>CGA	p.G118R		NM_001039361	NP_001034450	O60809	PRA10_HUMAN	PRAME family member 10	118											0	Ovarian(185;0.249)	Renal(390;0.000469)|Lung NSC(185;0.00143)|all_lung(284;0.00181)|Colorectal(325;0.00215)|Breast(348;0.00224)|Myeloproliferative disorder(586;0.0393)|Hepatocellular(190;0.0623)|Ovarian(437;0.0731)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00812)|Colorectal(212;4.88e-06)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000194)|COAD - Colon adenocarcinoma(227;0.000241)|BRCA - Breast invasive adenocarcinoma(304;0.000293)|STAD - Stomach adenocarcinoma(313;0.0072)|READ - Rectum adenocarcinoma(331;0.0649)		ACCCTGGCTCCAGACCATATG	0.522													33	173	---	---	---	---	PASS
PRDM2	7799	broad.mit.edu	37	1	14107885	14107885	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:14107885G>C	uc001avi.2	+	8	4451	c.3595G>C	c.(3595-3597)GAA>CAA	p.E1199Q	PRDM2_uc001avg.2_Intron|PRDM2_uc001avh.2_Missense_Mutation_p.E1199Q|PRDM2_uc001avj.2_Intron|PRDM2_uc001avk.2_Missense_Mutation_p.E998Q|PRDM2_uc009voe.2_Intron|PRDM2_uc009vof.2_Intron	NM_012231	NP_036363	Q13029	PRDM2_HUMAN	retinoblastoma protein-binding zinc finger	1199	C2H2-type 6.					Golgi apparatus|nucleus	DNA binding|histone-lysine N-methyltransferase activity|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1	Ovarian(185;0.249)	all_lung(284;2.56e-05)|Lung NSC(185;4.94e-05)|Renal(390;0.000147)|Breast(348;0.000162)|Colorectal(325;0.00058)|Ovarian(437;0.00965)|Hepatocellular(190;0.0245)|Myeloproliferative disorder(586;0.0255)	GBM - Glioblastoma multiforme(2;0.00182)	UCEC - Uterine corpus endometrioid carcinoma (279;0.00224)|Colorectal(212;3.23e-08)|BRCA - Breast invasive adenocarcinoma(304;2.16e-05)|COAD - Colon adenocarcinoma(227;2.53e-05)|Kidney(185;0.000762)|KIRC - Kidney renal clear cell carcinoma(229;0.00258)|STAD - Stomach adenocarcinoma(313;0.00446)|READ - Rectum adenocarcinoma(331;0.0276)|Lung(427;0.145)		TTGTAAAAAAGAATTTGCTTT	0.428													13	184	---	---	---	---	PASS
PLEKHM2	23207	broad.mit.edu	37	1	16060319	16060319	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16060319G>A	uc010obo.1	+	20	3177	c.2950G>A	c.(2950-2952)GAA>AAA	p.E984K	SLC25A34_uc001axb.1_5'Flank	NM_015164	NP_055979	Q8IWE5	PKHM2_HUMAN	pleckstrin homology domain containing, family M	984					Golgi organization	cytoplasm	kinesin binding			ovary(1)	1		Colorectal(325;0.000259)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.00057)|Ovarian(437;0.0129)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;9.18e-07)|COAD - Colon adenocarcinoma(227;4.5e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000133)|KIRC - Kidney renal clear cell carcinoma(229;0.00262)|STAD - Stomach adenocarcinoma(313;0.00774)|READ - Rectum adenocarcinoma(331;0.0657)		GGCGATCCAGGAAGCCTCCAA	0.637													16	82	---	---	---	---	PASS
CLCNKB	1188	broad.mit.edu	37	1	16383014	16383014	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16383014C>A	uc001axw.3	+						FAM131C_uc010obz.1_Intron|CLCNKB_uc001axx.3_Intron|CLCNKB_uc001axy.3_Intron	NM_000085	NP_000076	P51801	CLCKB_HUMAN	chloride channel Kb isoform 1						excretion	chloride channel complex|integral to plasma membrane	voltage-gated chloride channel activity			skin(1)	1		Colorectal(325;3.46e-05)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.000567)|Ovarian(437;0.0221)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|Colorectal(212;8.04e-08)|COAD - Colon adenocarcinoma(227;5.46e-06)|BRCA - Breast invasive adenocarcinoma(304;9.02e-05)|Kidney(64;0.00016)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(313;0.00655)|READ - Rectum adenocarcinoma(331;0.0649)		GTACCAGGGTCCCGGGGGCAG	0.627											OREG0013133	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	40	222	---	---	---	---	PASS
C1orf89	79363	broad.mit.edu	37	1	16558793	16558793	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16558793C>G	uc001ayd.2	-							NM_030907	NP_112169	Q9BU20	RSG1_HUMAN	hypothetical protein LOC79363						cellular protein localization|cilium assembly|exocytosis|protein transport|regulation of exocytosis|regulation of vesicle fusion|small GTPase mediated signal transduction	cilium|microtubule basal body	GTP binding				0		Colorectal(325;0.000147)|Renal(390;0.00145)|Breast(348;0.00224)|Lung NSC(340;0.00566)|all_lung(284;0.00831)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0646)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|Colorectal(212;3.2e-07)|COAD - Colon adenocarcinoma(227;2.07e-05)|BRCA - Breast invasive adenocarcinoma(304;9.12e-05)|Kidney(64;0.000163)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(313;0.0114)|READ - Rectum adenocarcinoma(331;0.0649)		CTGGTCAAATCTGGAGGAGGG	0.662													4	10	---	---	---	---	PASS
ACTL8	81569	broad.mit.edu	37	1	18152793	18152793	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:18152793C>G	uc001bat.2	+	3	1096	c.880C>G	c.(880-882)CAC>GAC	p.H294D		NM_030812	NP_110439	Q9H568	ACTL8_HUMAN	actin-like 8	294						cytoplasm|cytoskeleton				ovary(4)	4		Colorectal(325;0.000147)|Renal(390;0.00145)|Breast(348;0.00186)|all_lung(284;0.0054)|Lung NSC(340;0.00566)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0439)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00583)|BRCA - Breast invasive adenocarcinoma(304;6.43e-06)|Kidney(64;0.000258)|KIRC - Kidney renal clear cell carcinoma(64;0.00348)|STAD - Stomach adenocarcinoma(196;0.00652)|READ - Rectum adenocarcinoma(331;0.0698)|Lung(427;0.201)		GCTGGTCTCCCACGTGATGGC	0.652											OREG0013157	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	20	96	---	---	---	---	PASS
ALDH4A1	8659	broad.mit.edu	37	1	19204081	19204081	+	Silent	SNP	G	A	A	rs150927009		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:19204081G>A	uc001bbb.2	-	10	1242	c.966C>T	c.(964-966)TTC>TTT	p.F322F	ALDH4A1_uc010ocu.1_Silent_p.F262F|ALDH4A1_uc001bbc.2_Silent_p.F322F	NM_170726	NP_733844	P30038	AL4A1_HUMAN	aldehyde dehydrogenase 4A1 isoform a precursor	322					proline biosynthetic process|proline catabolic process	mitochondrial matrix	1-pyrroline-5-carboxylate dehydrogenase activity|aldehyde dehydrogenase (NAD) activity|electron carrier activity				0		Colorectal(325;3.46e-05)|all_lung(284;0.000321)|Lung NSC(340;0.000398)|Renal(390;0.000518)|Breast(348;0.000812)|Ovarian(437;0.00764)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00479)|BRCA - Breast invasive adenocarcinoma(304;3.67e-05)|Kidney(64;0.000182)|KIRC - Kidney renal clear cell carcinoma(64;0.00269)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)	NADH(DB00157)	AGCGGTGCACGAAGTGGAAGT	0.657													3	21	---	---	---	---	PASS
HTR6	3362	broad.mit.edu	37	1	19992591	19992591	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:19992591C>G	uc001bcl.2	+	1	812	c.345C>G	c.(343-345)CTC>CTG	p.L115L		NM_000871	NP_000862	P50406	5HT6R_HUMAN	5-hydroxytryptamine (serotonin) receptor 6	115	Helical; Name=3; (By similarity).				G-protein signaling, coupled to cyclic nucleotide second messenger|synaptic transmission	integral to plasma membrane	histamine receptor activity|protein binding			ovary(1)	1		Colorectal(325;0.000147)|Renal(390;0.000469)|all_lung(284;0.00519)|Breast(348;0.00526)|Lung NSC(340;0.00544)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0439)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00462)|BRCA - Breast invasive adenocarcinoma(304;5.81e-05)|Kidney(64;0.00017)|GBM - Glioblastoma multiforme(114;0.00117)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.182)	Granisetron(DB00889)|Ondansetron(DB00904)|Sertindole(DB06144)	CCTCCATCCTCAACCTCTGCC	0.682													15	62	---	---	---	---	PASS
KIF17	57576	broad.mit.edu	37	1	21042067	21042067	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:21042067G>A	uc001bdr.3	-	2	415	c.297C>T	c.(295-297)TTC>TTT	p.F99F	KIF17_uc001bds.3_Silent_p.F99F	NM_020816	NP_065867	Q9P2E2	KIF17_HUMAN	kinesin family member 17 isoform a	99	Kinesin-motor.				microtubule-based movement|protein transport	cytoplasm|microtubule	ATP binding			ovary(3)|skin(1)	4		all_lung(284;2.99e-05)|Lung NSC(340;3.26e-05)|Colorectal(325;3.46e-05)|Renal(390;9.67e-05)|Breast(348;0.00179)|Ovarian(437;0.00327)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0185)|COAD - Colon adenocarcinoma(152;1.43e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000168)|Kidney(64;0.000221)|GBM - Glioblastoma multiforme(114;0.000651)|KIRC - Kidney renal clear cell carcinoma(64;0.0031)|STAD - Stomach adenocarcinoma(196;0.00336)|READ - Rectum adenocarcinoma(331;0.0686)|Lung(427;0.209)		CCTGCATGGTGAAGGACTTCC	0.652													23	54	---	---	---	---	PASS
EIF4G3	8672	broad.mit.edu	37	1	21268017	21268017	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:21268017G>C	uc001bec.2	-	9	1718	c.1462C>G	c.(1462-1464)CAA>GAA	p.Q488E	EIF4G3_uc010odi.1_Missense_Mutation_p.Q92E|EIF4G3_uc010odj.1_Missense_Mutation_p.Q487E|EIF4G3_uc009vpz.2_Intron|EIF4G3_uc001bed.2_Missense_Mutation_p.Q488E|EIF4G3_uc001bef.2_Missense_Mutation_p.Q487E|EIF4G3_uc001bee.2_Missense_Mutation_p.Q494E|EIF4G3_uc001beg.2_Missense_Mutation_p.Q487E|EIF4G3_uc010odk.1_Missense_Mutation_p.Q488E|EIF4G3_uc001beh.2_Missense_Mutation_p.Q499E	NM_003760	NP_003751	O43432	IF4G3_HUMAN	eukaryotic translation initiation factor 4	488					interspecies interaction between organisms|regulation of translational initiation|RNA metabolic process	eukaryotic translation initiation factor 4F complex	protein binding|RNA cap binding|translation initiation factor activity			skin(1)	1		all_lung(284;2.61e-06)|Lung NSC(340;2.81e-06)|Colorectal(325;3.46e-05)|Renal(390;9.67e-05)|Breast(348;0.00149)|Ovarian(437;0.00338)|Myeloproliferative disorder(586;0.0256)		UCEC - Uterine corpus endometrioid carcinoma (279;0.023)|COAD - Colon adenocarcinoma(152;5.42e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000327)|GBM - Glioblastoma multiforme(114;0.000696)|Kidney(64;0.0018)|STAD - Stomach adenocarcinoma(196;0.00644)|KIRC - Kidney renal clear cell carcinoma(64;0.0185)|READ - Rectum adenocarcinoma(331;0.124)|Lung(427;0.191)		TTTAAGTTTTGAGAATCCAAA	0.408													54	349	---	---	---	---	PASS
RAP1GAP	5909	broad.mit.edu	37	1	21935429	21935429	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:21935429C>A	uc001bex.2	-	16	1330	c.1072G>T	c.(1072-1074)GGG>TGG	p.G358W	RAP1GAP_uc001bev.2_Missense_Mutation_p.G358W|RAP1GAP_uc001bew.2_Missense_Mutation_p.G422W|RAP1GAP_uc001bey.2_Missense_Mutation_p.G358W	NM_002885	NP_002876	P47736	RPGP1_HUMAN	RAP1 GTPase activating protein isoform c	358	Rap-GAP.				regulation of Ras GTPase activity|signal transduction	cytosol|Golgi membrane|membrane fraction	GTPase activator activity|GTPase activity|protein homodimerization activity|Ras GTPase binding			breast(2)|ovary(1)	3		Colorectal(325;0.000147)|Renal(390;0.000734)|Lung NSC(340;0.000861)|all_lung(284;0.000901)|Breast(348;0.012)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0427)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0192)|OV - Ovarian serous cystadenocarcinoma(117;2.3e-26)|COAD - Colon adenocarcinoma(152;1.59e-05)|GBM - Glioblastoma multiforme(114;2.7e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000354)|STAD - Stomach adenocarcinoma(196;0.00645)|KIRC - Kidney renal clear cell carcinoma(1967;0.00862)|READ - Rectum adenocarcinoma(331;0.0625)|Lung(427;0.146)		AACTCAGGCCCCTGGAAACTC	0.517													62	224	---	---	---	---	PASS
CELA3A	10136	broad.mit.edu	37	1	22328167	22328167	+	5'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:22328167C>T	uc001bfl.2	+	1					CELA3B_uc009vqf.2_Intron	NM_005747	NP_005738	P09093	CEL3A_HUMAN	elastase 3A, pancreatic preproprotein						cholesterol metabolic process|digestion|proteolysis		serine-type endopeptidase activity			haematopoietic_and_lymphoid_tissue(1)	1						TCACAAAACTCATGATGCTCC	0.572													56	313	---	---	---	---	PASS
SFN	2810	broad.mit.edu	37	1	27189850	27189850	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:27189850G>C	uc001bnc.1	+	1	218	c.147G>C	c.(145-147)AAG>AAC	p.K49N	uc010ofi.1_RNA	NM_006142	NP_006133	P31947	1433S_HUMAN	stratifin	49					DNA damage response, signal transduction resulting in induction of apoptosis|negative regulation of caspase activity|release of cytochrome c from mitochondria	cytoplasm|extracellular space|nucleus	protein domain specific binding|protein kinase C inhibitor activity				0		all_cancers(24;1.23e-26)|all_epithelial(13;1.19e-23)|Colorectal(325;3.46e-05)|all_lung(284;5.94e-05)|Lung NSC(340;7.26e-05)|Breast(348;0.00017)|Renal(390;0.0007)|Ovarian(437;0.00764)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0381)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|all cancers(4;2.1e-52)|Epithelial(14;2.31e-52)|OV - Ovarian serous cystadenocarcinoma(117;8.22e-30)|Colorectal(126;1.31e-09)|COAD - Colon adenocarcinoma(152;3.45e-07)|BRCA - Breast invasive adenocarcinoma(304;0.000501)|STAD - Stomach adenocarcinoma(196;0.000588)|KIRC - Kidney renal clear cell carcinoma(1967;0.000716)|READ - Rectum adenocarcinoma(331;0.0419)|GBM - Glioblastoma multiforme(114;0.0767)|Lung(427;0.215)		TAGCCTATAAGAACGTGGTGG	0.612													5	81	---	---	---	---	PASS
PHACTR4	65979	broad.mit.edu	37	1	28818243	28818243	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:28818243C>G	uc001bpw.2	+	12	2242	c.1960C>G	c.(1960-1962)CAA>GAA	p.Q654E	PHACTR4_uc001bpv.1_RNA|PHACTR4_uc001bpx.2_Missense_Mutation_p.Q638E|PHACTR4_uc001bpy.2_Missense_Mutation_p.Q664E|PHACTR4_uc001bpz.2_RNA	NM_001048183	NP_001041648	Q8IZ21	PHAR4_HUMAN	phosphatase and actin regulator 4 isoform 1	654							actin binding|protein phosphatase inhibitor activity				0		Colorectal(325;3.46e-05)|Lung NSC(340;4.37e-05)|all_lung(284;7.01e-05)|Renal(390;0.00121)|Breast(348;0.00345)|all_neural(195;0.0208)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0261)		OV - Ovarian serous cystadenocarcinoma(117;1.35e-21)|Colorectal(126;2.96e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.00273)|STAD - Stomach adenocarcinoma(196;0.00299)|BRCA - Breast invasive adenocarcinoma(304;0.0144)|READ - Rectum adenocarcinoma(331;0.0649)		AACAGATGCTCAAGATTATGA	0.423													27	75	---	---	---	---	PASS
CSMD2	114784	broad.mit.edu	37	1	33987111	33987111	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:33987111C>T	uc001bxn.1	-	67	10146	c.10117G>A	c.(10117-10119)GGC>AGC	p.G3373S	CSMD2_uc001bxm.1_Missense_Mutation_p.G3517S	NM_052896	NP_443128	Q7Z408	CSMD2_HUMAN	CUB and Sushi multiple domains 2	3373	Extracellular (Potential).					integral to membrane|plasma membrane	protein binding			ovary(6)|skin(5)|pancreas(1)	12		Myeloproliferative disorder(586;0.0294)|all_neural(195;0.249)				TTGACAGAGCCTTGGTAGATG	0.587													19	69	---	---	---	---	PASS
ZMYM4	9202	broad.mit.edu	37	1	35836084	35836084	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35836084A>G	uc001byt.2	+	7	1117	c.1037A>G	c.(1036-1038)AAA>AGA	p.K346R	ZMYM4_uc009vuu.2_Missense_Mutation_p.K314R|ZMYM4_uc001byu.2_Missense_Mutation_p.K22R|ZMYM4_uc009vuv.2_Missense_Mutation_p.K85R|uc001byv.2_5'Flank	NM_005095	NP_005086	Q5VZL5	ZMYM4_HUMAN	zinc finger protein 262	346					multicellular organismal development		DNA binding|zinc ion binding			large_intestine(2)|ovary(1)|kidney(1)|skin(1)	5		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)				GGTTGTAAAAAAATCCTCCAG	0.493													34	89	---	---	---	---	PASS
THRAP3	9967	broad.mit.edu	37	1	36754981	36754981	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36754981C>T	uc001cae.3	+	5	1585	c.1361C>T	c.(1360-1362)TCT>TTT	p.S454F	THRAP3_uc001caf.3_Missense_Mutation_p.S454F|THRAP3_uc001cag.1_Missense_Mutation_p.S454F	NM_005119	NP_005110	Q9Y2W1	TR150_HUMAN	thyroid hormone receptor associated protein 3	454					androgen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	ATP binding|ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			ovary(5)|lung(3)|breast(1)	9		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.164)				AAATTTATGTCTAAAGTCATA	0.438			T	USP6	aneurysmal bone cysts								16	75	---	---	---	---	PASS
GJA9	81025	broad.mit.edu	37	1	39341602	39341602	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39341602C>G	uc001cct.1	-	2	450	c.169G>C	c.(169-171)GAA>CAA	p.E57Q	RRAGC_uc001ccr.2_5'Flank|MYCBP_uc001ccs.2_5'Flank	NM_030772	NP_110399	P57773	CXA9_HUMAN	gap junction protein, alpha 9, 59kDa	57	Extracellular (Potential).				cell communication	connexon complex|integral to membrane					0	Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0393)	OV - Ovarian serous cystadenocarcinoma(33;8.23e-17)			CCTGGTTGTTCTGTATTGCAG	0.468													9	401	---	---	---	---	PASS
HIVEP3	59269	broad.mit.edu	37	1	42047743	42047743	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:42047743C>T	uc001cgz.3	-	4	3939	c.2726G>A	c.(2725-2727)CGC>CAC	p.R909H	HIVEP3_uc001cha.3_Missense_Mutation_p.R909H|HIVEP3_uc001cgy.2_RNA	NM_024503	NP_078779	Q5T1R4	ZEP3_HUMAN	human immunodeficiency virus type I enhancer	909	No DNA binding activity or transactivation activity, but complete prevention of TRAF-dependent NF-Kappa-B activation; associates with TRAF2 and JUN (By similarity).|Nuclear localization signal (Potential).				positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(4)|large_intestine(1)|central_nervous_system(1)	6	Ovarian(52;0.00769)|all_hematologic(146;0.109)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0367)				CTCTGCCAGGCGCAACCTCTT	0.582													42	159	---	---	---	---	PASS
RIMKLA	284716	broad.mit.edu	37	1	42880512	42880512	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:42880512C>G	uc001chi.2	+	5	1181	c.1043C>G	c.(1042-1044)TCT>TGT	p.S348C		NM_173642	NP_775913	Q8IXN7	RIMKA_HUMAN	ribosomal modification protein rimK-like family	348					protein modification process	cytoplasm	acid-amino acid ligase activity|ATP binding|metal ion binding				0						GGGTCTACCTCTAGTGAAAGT	0.562													38	99	---	---	---	---	PASS
SLC2A1	6513	broad.mit.edu	37	1	43395312	43395312	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43395312G>C	uc001cik.2	-	6	1344	c.819C>G	c.(817-819)CTC>CTG	p.L273L		NM_006516	NP_006507	P11166	GTR1_HUMAN	solute carrier family 2 (facilitated glucose	273	Helical; Name=7; (Potential).				carbohydrate metabolic process|energy reserve metabolic process|regulation of insulin secretion|water-soluble vitamin metabolic process	integral to membrane|melanosome|membrane fraction|midbody	D-glucose transmembrane transporter activity|dehydroascorbic acid transporter activity			central_nervous_system(2)|pancreas(2)|ovary(1)	5	Ovarian(52;0.00579)|all_hematologic(146;0.0977)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0122)			Etomidate(DB00292)	CCACAGCGATGAGGATGGGCT	0.627													15	63	---	---	---	---	PASS
KIAA0467	23334	broad.mit.edu	37	1	43909283	43909283	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43909283G>A	uc001cjk.1	+	47	6406	c.5944G>A	c.(5944-5946)GAG>AAG	p.E1982K	KIAA0467_uc001cjl.1_5'Flank	NM_015284	NP_056099	Q5T011	SZT2_HUMAN	hypothetical protein LOC23334	2881						peroxisome					0	all_hematologic(146;0.0958)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0505)				CCATCGCCCTGAGTCAGGGTC	0.617													28	95	---	---	---	---	PASS
PTPRF	5792	broad.mit.edu	37	1	44084309	44084309	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44084309T>G	uc001cjr.2	+	26	4720	c.4380T>G	c.(4378-4380)TGT>TGG	p.C1460W	PTPRF_uc001cjs.2_Missense_Mutation_p.C1451W|PTPRF_uc001cju.2_Missense_Mutation_p.C849W|PTPRF_uc009vwt.2_Missense_Mutation_p.C1020W|PTPRF_uc001cjv.2_Missense_Mutation_p.C931W|PTPRF_uc001cjw.2_Missense_Mutation_p.C686W	NM_002840	NP_002831	P10586	PTPRF_HUMAN	protein tyrosine phosphatase, receptor type, F	1460	Tyrosine-protein phosphatase 1.|Cytoplasmic (Potential).				transmembrane receptor protein tyrosine phosphatase signaling pathway	integral to plasma membrane	transmembrane receptor protein tyrosine phosphatase activity			ovary(4)|skin(3)|lung(1)|kidney(1)|central_nervous_system(1)	10	all_hematologic(146;0.0958)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0333)				AGGTAAAATGTGATCAGTACT	0.602													40	155	---	---	---	---	PASS
DPH2	1802	broad.mit.edu	37	1	44437296	44437296	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44437296G>T	uc001ckz.2	+	4	917	c.722G>T	c.(721-723)TGG>TTG	p.W241L	DPH2_uc001cla.2_Intron|DPH2_uc010okk.1_Missense_Mutation_p.W106L|DPH2_uc001clb.2_Missense_Mutation_p.W165L	NM_001384	NP_001375	Q9BQC3	DPH2_HUMAN	diphthamide biosynthesis protein 2 isoform a	241					peptidyl-diphthamide biosynthetic process from peptidyl-histidine	cytoplasm				ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0511)				CTCTTGGGGTGGGCACCAGGT	0.602													22	109	---	---	---	---	PASS
CCDC24	149473	broad.mit.edu	37	1	44457911	44457911	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44457911G>C	uc001clj.2	+	3	325	c.154G>C	c.(154-156)GAG>CAG	p.E52Q	SLC6A9_uc009vxe.2_Intron|SLC6A9_uc010okm.1_Intron|CCDC24_uc001clk.2_Missense_Mutation_p.E8Q|CCDC24_uc009vxc.2_Intron	NM_152499	NP_689712	Q8N4L8	CCD24_HUMAN	coiled-coil domain containing 24	52											0	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0821)				ACTGCTCCAAGAGGCTCGATC	0.637													29	108	---	---	---	---	PASS
TMEM53	79639	broad.mit.edu	37	1	45120367	45120367	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45120367T>A	uc001cmc.2	-	3	734	c.698A>T	c.(697-699)GAG>GTG	p.E233V	TMEM53_uc001cmb.1_Intron|TMEM53_uc001cmd.2_Missense_Mutation_p.E160V|TMEM53_uc009vxh.1_Missense_Mutation_p.E116V|TMEM53_uc010ola.1_Missense_Mutation_p.E116V	NM_024587	NP_078863	Q6P2H8	TMM53_HUMAN	transmembrane protein 53	233						integral to membrane				ovary(2)	2	Acute lymphoblastic leukemia(166;0.155)					CAGGCGTGCCTCCACCATGCG	0.602													35	142	---	---	---	---	PASS
PLK3	1263	broad.mit.edu	37	1	45268466	45268466	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45268466G>A	uc001cmn.2	+	6	788	c.688G>A	c.(688-690)GAA>AAA	p.E230K	PLK3_uc001cmo.2_RNA	NM_004073	NP_004064	Q9H4B4	PLK3_HUMAN	polo-like kinase 3	230	Protein kinase.					membrane	ATP binding|protein binding|protein serine/threonine kinase activity				0	Acute lymphoblastic leukemia(166;0.155)					TGTGGCTCCAGAAGTGCTGCT	0.622													23	124	---	---	---	---	PASS
KIAA0494	9813	broad.mit.edu	37	1	47173646	47173646	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:47173646C>G	uc001cqk.3	-	3	1389	c.412G>C	c.(412-414)GAG>CAG	p.E138Q	KIAA0494_uc010omh.1_Missense_Mutation_p.E138Q|KIAA0494_uc010omj.1_5'UTR|KIAA0494_uc001cql.1_Missense_Mutation_p.E138Q	NM_014774	NP_055589	O75071	K0494_HUMAN	hypothetical protein LOC9813	138							calcium ion binding				0	Acute lymphoblastic leukemia(166;0.155)					TCAATCTTCTCAAGTTGTTTT	0.338													11	170	---	---	---	---	PASS
SLC5A9	200010	broad.mit.edu	37	1	48694589	48694589	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:48694589C>A	uc001cro.2	+	3	354	c.302C>A	c.(301-303)GCT>GAT	p.A101D	SLC5A9_uc010oms.1_RNA|SLC5A9_uc001crn.2_Missense_Mutation_p.A101D|SLC5A9_uc010omt.1_Missense_Mutation_p.A94D|SLC5A9_uc001crp.2_Translation_Start_Site|SLC5A9_uc010omu.1_Translation_Start_Site	NM_001011547	NP_001011547	Q2M3M2	SC5A9_HUMAN	solute carrier family 5 (sodium/glucose	101	Extracellular (Potential).					integral to membrane|plasma membrane	low-affinity glucose:sodium symporter activity			ovary(3)	3						GGGACAGGGGCTGCCGGAGGC	0.577													18	95	---	---	---	---	PASS
ORC1L	4998	broad.mit.edu	37	1	52854178	52854178	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52854178G>A	uc001ctt.2	-	8	1538	c.1319C>T	c.(1318-1320)TCC>TTC	p.S440F	ORC1L_uc010oni.1_Missense_Mutation_p.S440F|ORC1L_uc001ctu.2_Missense_Mutation_p.S440F|ORC1L_uc009vzd.2_Missense_Mutation_p.S194F	NM_004153	NP_004144	Q13415	ORC1_HUMAN	origin recognition complex, subunit 1	440					cell cycle checkpoint|DNA-dependent DNA replication initiation|M/G1 transition of mitotic cell cycle|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle	cytosol|nuclear origin of replication recognition complex|nucleolus|nucleoplasm|plasma membrane	ATP binding|DNA binding|nucleoside-triphosphatase activity|protein binding				0						CAGGTTCCTGGACACAGTTCT	0.493													81	222	---	---	---	---	PASS
SCP2	6342	broad.mit.edu	37	1	53446098	53446098	+	Nonsense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:53446098A>T	uc001cur.1	+	10	977	c.856A>T	c.(856-858)AGA>TGA	p.R286*	SCP2_uc001cus.1_RNA|SCP2_uc010ono.1_Nonsense_Mutation_p.R205*|SCP2_uc010onp.1_Nonsense_Mutation_p.R262*|SCP2_uc009vzi.1_Nonsense_Mutation_p.R242*|SCP2_uc001cuq.1_Nonsense_Mutation_p.R242*	NM_002979	NP_002970	P22307	NLTP_HUMAN	sterol carrier protein 2 isoform 1 proprotein	286					bile acid biosynthetic process|fatty acid beta-oxidation using acyl-CoA oxidase|lipid transport	mitochondrion|nucleus|peroxisomal matrix	propanoyl-CoA C-acyltransferase activity|propionyl-CoA C2-trimethyltridecanoyltransferase activity|protein binding|sterol binding			breast(1)	1						AGAAGCTGCAAGAAAATGCTA	0.353													35	178	---	---	---	---	PASS
MRPL37	51253	broad.mit.edu	37	1	54681865	54681865	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:54681865G>T	uc001cxa.3	+	6	1119	c.1042G>T	c.(1042-1044)GAT>TAT	p.D348Y	MRPL37_uc009vzp.2_Missense_Mutation_p.D217Y|MRPL37_uc001cxb.1_Missense_Mutation_p.D348Y|MRPL37_uc001cxc.3_Missense_Mutation_p.D36Y|MRPL37_uc010oob.1_RNA	NM_016491	NP_057575	Q9BZE1	RM37_HUMAN	mitochondrial ribosomal protein L37 precursor	348					translation	mitochondrial ribosome	structural constituent of ribosome				0						CGTGGGCACGGATGGACGTGT	0.517													37	195	---	---	---	---	PASS
C1orf175	374977	broad.mit.edu	37	1	55134563	55134563	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55134563C>T	uc010ooe.1	+	5	1666	c.1342C>T	c.(1342-1344)CTG>TTG	p.L448L	C1orf175_uc001cxq.2_RNA|C1orf175_uc010ooc.1_Silent_p.L16L|C1orf175_uc001cxs.2_RNA|C1orf175_uc010ood.1_5'UTR|C1orf175_uc010oof.1_RNA|C1orf175_uc001cxr.1_RNA|C1orf175_uc010oog.1_Silent_p.L448L|C1orf175_uc010ooh.1_RNA|C1orf175_uc009vzq.1_RNA|C1orf175_uc001cxt.1_RNA	NM_001039464	NP_001034553	Q68CQ1	HEAT8_HUMAN	hypothetical protein LOC374977	448						integral to membrane	binding				0						GAGCCAGGATCTGCTGGAGGC	0.557													10	135	---	---	---	---	PASS
PARS2	25973	broad.mit.edu	37	1	55224180	55224180	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55224180C>A	uc001cxy.2	-	2	738	c.655G>T	c.(655-657)GCC>TCC	p.A219S		NM_152268	NP_689481	Q7L3T8	SYPM_HUMAN	prolyl-tRNA synthetase (mitochondrial)(putative)	219					prolyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|proline-tRNA ligase activity			ovary(2)	2					L-Proline(DB00172)	GTCTGCTGGGCAGCCTCTGGG	0.567													12	71	---	---	---	---	PASS
HOOK1	51361	broad.mit.edu	37	1	60330868	60330868	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:60330868G>C	uc009wad.2	+	19	1797	c.1695G>C	c.(1693-1695)CAG>CAC	p.Q565H	HOOK1_uc001czo.2_Missense_Mutation_p.Q565H|HOOK1_uc001czp.2_Intron|HOOK1_uc010oor.1_Missense_Mutation_p.Q523H	NM_015888	NP_056972	Q9UJC3	HOOK1_HUMAN	hook homolog 1	565	Potential.				early endosome to late endosome transport|endosome organization|endosome to lysosome transport|lysosome organization|microtubule cytoskeleton organization|multicellular organismal development|protein transport	FHF complex|microtubule	identical protein binding			ovary(1)|breast(1)	2	all_cancers(7;0.000129)					AAGAATTACAGAAGAAACAAG	0.289													25	91	---	---	---	---	PASS
ITGB3BP	23421	broad.mit.edu	37	1	63988814	63988814	+	5'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:63988814C>T	uc001dba.1	-	1					ITGB3BP_uc001dbb.1_5'UTR|ITGB3BP_uc001dbc.1_RNA|ITGB3BP_uc001dbd.1_RNA|ITGB3BP_uc009wak.1_Splice_Site|EFCAB7_uc001dbf.2_5'Flank	NM_014288	NP_055103	Q13352	CENPR_HUMAN	integrin beta 3 binding protein						apoptosis|cell adhesion|CenH3-containing nucleosome assembly at centromere|induction of apoptosis by extracellular signals|mitotic prometaphase|nerve growth factor receptor signaling pathway|regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome, centromeric region|cytosol|membrane fraction|nucleoplasm	protein C-terminus binding|signal transducer activity				0						TTCTGAGATTCGGGAAAGCAC	0.512													41	185	---	---	---	---	PASS
CACHD1	57685	broad.mit.edu	37	1	65147010	65147010	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:65147010G>C	uc001dbo.1	+	25	3428	c.3323G>C	c.(3322-3324)AGA>ACA	p.R1108T	CACHD1_uc001dbp.1_Missense_Mutation_p.R863T|CACHD1_uc001dbq.1_Missense_Mutation_p.R863T|CACHD1_uc010opa.1_Missense_Mutation_p.R352T	NM_020925	NP_065976	Q5VU97	CAHD1_HUMAN	cache domain containing 1	1159	Cytoplasmic (Potential).				calcium ion transport	integral to membrane				ovary(2)	2						CACGAAGACAGAGGCATCAGT	0.423													19	88	---	---	---	---	PASS
DNAJC6	9829	broad.mit.edu	37	1	65852522	65852522	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:65852522C>G	uc001dcd.1	+	8	1016	c.852C>G	c.(850-852)ATC>ATG	p.I284M	DNAJC6_uc001dcc.1_Missense_Mutation_p.I315M|DNAJC6_uc010opc.1_Missense_Mutation_p.I271M|DNAJC6_uc001dce.1_Missense_Mutation_p.I341M	NM_014787	NP_055602	O75061	AUXI_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 6	284	C2 tensin-type.				cellular membrane organization|post-Golgi vesicle-mediated transport	cytosol	heat shock protein binding|protein tyrosine phosphatase activity|SH3 domain binding			large_intestine(1)|lung(1)|ovary(1)	3						ATGGAAAAATCTTCATTCCCT	0.418													6	165	---	---	---	---	PASS
C1orf141	400757	broad.mit.edu	37	1	67591441	67591441	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67591441G>C	uc001ddl.1	-	3	338	c.227C>G	c.(226-228)TCA>TGA	p.S76*	C1orf141_uc001ddm.1_Nonsense_Mutation_p.S76*|C1orf141_uc001ddn.1_RNA	NM_001013674	NP_001013696	Q5JVX7	CA141_HUMAN	hypothetical protein LOC400757	76										ovary(1)	1						TTACATTTTTGATTTTGTAAT	0.239													46	246	---	---	---	---	PASS
LRRC7	57554	broad.mit.edu	37	1	70555512	70555512	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70555512G>A	uc001dep.2	+						LRRC7_uc009wbg.2_Intron|LRRC7_uc001deq.2_Intron	NM_020794	NP_065845	Q96NW7	LRRC7_HUMAN	leucine rich repeat containing 7							centrosome|focal adhesion|nucleolus	protein binding			ovary(9)|breast(2)|central_nervous_system(2)|liver(1)	14						GGTAAGAAATGAATATCTTGT	0.323													24	102	---	---	---	---	PASS
LRRC7	57554	broad.mit.edu	37	1	70573482	70573482	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70573482A>G	uc001dep.2	+	24	4509	c.4479A>G	c.(4477-4479)CTA>CTG	p.L1493L	LRRC7_uc009wbg.2_Silent_p.L777L|LRRC7_uc001deq.2_Silent_p.L687L	NM_020794	NP_065845	Q96NW7	LRRC7_HUMAN	leucine rich repeat containing 7	1493	PDZ.					centrosome|focal adhesion|nucleolus	protein binding			ovary(9)|breast(2)|central_nervous_system(2)|liver(1)	14						CATCAAACCTACTGCAGCCTG	0.408													27	200	---	---	---	---	PASS
C1orf173	127254	broad.mit.edu	37	1	75037256	75037256	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:75037256C>T	uc001dgg.2	-	14	4357	c.4138G>A	c.(4138-4140)GAT>AAT	p.D1380N		NM_001002912	NP_001002912	Q5RHP9	CA173_HUMAN	hypothetical protein LOC127254	1380	Glu-rich.									ovary(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	5						TCAGCAACATCTGAAAAGGAG	0.517													43	217	---	---	---	---	PASS
ZZZ3	26009	broad.mit.edu	37	1	78098555	78098555	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:78098555C>T	uc001dhq.2	-	5	961	c.485G>A	c.(484-486)CGA>CAA	p.R162Q	ZZZ3_uc001dhr.2_Intron|ZZZ3_uc009wbz.1_Missense_Mutation_p.R162Q|ZZZ3_uc001dhp.2_Missense_Mutation_p.R162Q	NM_015534	NP_056349	Q8IYH5	ZZZ3_HUMAN	zinc finger, ZZ-type containing 3	162					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(4)|large_intestine(1)	5						TCGACAAGCTCGTTTAGTCCC	0.393													73	365	---	---	---	---	PASS
ELTD1	64123	broad.mit.edu	37	1	79386062	79386062	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:79386062C>G	uc001diq.3	-	10	1423	c.1267G>C	c.(1267-1269)GAT>CAT	p.D423H		NM_022159	NP_071442	Q9HBW9	ELTD1_HUMAN	EGF, latrophilin and seven transmembrane domain	423	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(1)|skin(1)	2				COAD - Colon adenocarcinoma(225;0.0905)|Colorectal(170;0.103)|all cancers(265;0.105)|Epithelial(280;0.148)		ATATTATAATCTTTAATACCC	0.294													21	72	---	---	---	---	PASS
MCOLN3	55283	broad.mit.edu	37	1	85499857	85499857	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85499857G>C	uc001dkp.2	-	4	567	c.474C>G	c.(472-474)ATC>ATG	p.I158M	MCOLN3_uc001dkq.2_Missense_Mutation_p.I102M|MCOLN3_uc001dkr.2_Missense_Mutation_p.I158M|MCOLN3_uc001dks.3_Missense_Mutation_p.I3M	NM_018298	NP_060768	Q8TDD5	MCLN3_HUMAN	mucolipin 3	158						integral to membrane	ion channel activity			skin(1)	1				all cancers(265;0.00957)|Epithelial(280;0.0254)		AGTGCTGACAGATTGCCATAG	0.403													34	135	---	---	---	---	PASS
SYDE2	84144	broad.mit.edu	37	1	85634814	85634814	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85634814C>T	uc009wcm.2	-	5	2815	c.2766G>A	c.(2764-2766)TTG>TTA	p.L922L		NM_032184	NP_115560	Q5VT97	SYDE2_HUMAN	synapse defective 1, Rho GTPase, homolog 2	922	Rho-GAP.				activation of Rho GTPase activity|small GTPase mediated signal transduction	cytosol	Rho GTPase activator activity			ovary(1)|central_nervous_system(1)	2				all cancers(265;0.0126)|Epithelial(280;0.0336)		ATGACATTTTCAAAGGACTTT	0.398													41	201	---	---	---	---	PASS
COL24A1	255631	broad.mit.edu	37	1	86591095	86591095	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86591095C>G	uc001dlj.2	-	3	966	c.924G>C	c.(922-924)CAG>CAC	p.Q308H	COL24A1_uc010osd.1_5'UTR|COL24A1_uc001dlk.2_RNA|COL24A1_uc010ose.1_RNA|COL24A1_uc010osf.1_RNA|COL24A1_uc009wcq.2_Missense_Mutation_p.Q308H	NM_152890	NP_690850	Q17RW2	COOA1_HUMAN	collagen, type XXIV, alpha 1 precursor	308					cell adhesion	collagen	extracellular matrix structural constituent			ovary(3)|central_nervous_system(1)|skin(1)	5				all cancers(265;0.0627)|Epithelial(280;0.0689)		ATCTTGATATCTGGTGTTCTT	0.378													38	171	---	---	---	---	PASS
COL24A1	255631	broad.mit.edu	37	1	86591140	86591140	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86591140G>A	uc001dlj.2	-	3	921	c.879C>T	c.(877-879)ATC>ATT	p.I293I	COL24A1_uc010osd.1_5'UTR|COL24A1_uc001dlk.2_RNA|COL24A1_uc010ose.1_RNA|COL24A1_uc010osf.1_RNA|COL24A1_uc009wcq.2_Silent_p.I293I	NM_152890	NP_690850	Q17RW2	COOA1_HUMAN	collagen, type XXIV, alpha 1 precursor	293					cell adhesion	collagen	extracellular matrix structural constituent			ovary(3)|central_nervous_system(1)|skin(1)	5				all cancers(265;0.0627)|Epithelial(280;0.0689)		CATTTTTTATGATATTTGGAA	0.388													35	186	---	---	---	---	PASS
COL24A1	255631	broad.mit.edu	37	1	86591631	86591631	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86591631T>C	uc001dlj.2	-	3	430	c.388A>G	c.(388-390)AGA>GGA	p.R130G	COL24A1_uc010osd.1_Translation_Start_Site|COL24A1_uc001dlk.2_RNA|COL24A1_uc010ose.1_RNA|COL24A1_uc010osf.1_RNA|COL24A1_uc009wcq.2_Missense_Mutation_p.R130G	NM_152890	NP_690850	Q17RW2	COOA1_HUMAN	collagen, type XXIV, alpha 1 precursor	130	TSP N-terminal.				cell adhesion	collagen	extracellular matrix structural constituent			ovary(3)|central_nervous_system(1)|skin(1)	5				all cancers(265;0.0627)|Epithelial(280;0.0689)		AATTGCAGTCTATTTTTATTT	0.368													23	100	---	---	---	---	PASS
ODF2L	57489	broad.mit.edu	37	1	86836693	86836693	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86836693C>A	uc001dll.1	-						ODF2L_uc001dlm.1_Intron|ODF2L_uc001dln.2_Intron|ODF2L_uc001dlo.2_Intron|ODF2L_uc001dlp.2_Intron|ODF2L_uc010osg.1_Intron|ODF2L_uc001dlq.1_Intron|ODF2L_uc009wcr.1_Intron	NM_020729	NP_065780	Q9ULJ1	ODF2L_HUMAN	outer dense fiber of sperm tails 2-like isoform							centrosome				ovary(1)	1				all cancers(265;0.0313)|Epithelial(280;0.0611)		AACACTCATACATAGTACCTT	0.308													17	94	---	---	---	---	PASS
ABCD3	5825	broad.mit.edu	37	1	94930375	94930375	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:94930375C>T	uc001dqn.3	+	3	294	c.192C>T	c.(190-192)TTC>TTT	p.F64F	ABCD3_uc001dqm.3_Silent_p.F64F|ABCD3_uc010oto.1_Silent_p.F88F|ABCD3_uc010otp.1_5'UTR|ABCD3_uc009wdr.2_Silent_p.F64F	NM_002858	NP_002849	P28288	ABCD3_HUMAN	ATP-binding cassette, sub-family D, member 3	64	Targeting to peroxisomes.|Interaction with PEX19.				peroxisomal long-chain fatty acid import|peroxisome organization	cytosol|integral to peroxisomal membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			skin(1)	1		all_lung(203;0.000434)|Lung NSC(277;0.0019)		all cancers(265;0.0261)|Epithelial(280;0.165)		AGGTGTTTTTCTCAAGGCTCA	0.308													29	154	---	---	---	---	PASS
PTBP2	58155	broad.mit.edu	37	1	97270493	97270493	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:97270493G>C	uc001drq.2	+	9	1288	c.1042G>C	c.(1042-1044)GAG>CAG	p.E348Q	PTBP2_uc001drn.2_Missense_Mutation_p.E353Q|PTBP2_uc001dro.2_Missense_Mutation_p.E348Q|PTBP2_uc010otz.1_Missense_Mutation_p.E364Q|PTBP2_uc001drp.2_RNA|PTBP2_uc009wdw.2_Missense_Mutation_p.E296Q|PTBP2_uc001drr.2_Missense_Mutation_p.E353Q|PTBP2_uc010oua.1_Missense_Mutation_p.E356Q|PTBP2_uc001dru.2_RNA|PTBP2_uc001drs.1_5'UTR|PTBP2_uc001drt.2_5'UTR	NM_021190	NP_067013	Q9UKA9	PTBP2_HUMAN	polypyrimidine tract binding protein 2	348	RRM 3.						nucleotide binding				0		all_epithelial(167;2.95e-05)|all_lung(203;0.000396)|Lung NSC(277;0.00171)		all cancers(265;0.0582)|Epithelial(280;0.0716)|Colorectal(170;0.0879)|KIRC - Kidney renal clear cell carcinoma(1967;0.202)		TTTAAATGAAGAGGTTAGTAA	0.294													18	64	---	---	---	---	PASS
LPPR4	9890	broad.mit.edu	37	1	99753711	99753711	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:99753711G>C	uc001dse.2	+						LPPR4_uc010oue.1_Intron	NM_014839	NP_055654	Q7Z2D5	LPPR4_HUMAN	plasticity related gene 1								phosphatidate phosphatase activity			ovary(3)	3		all_epithelial(167;3.54e-06)|all_lung(203;0.00139)|Lung NSC(277;0.00202)		Epithelial(280;0.0736)|all cancers(265;0.0975)|COAD - Colon adenocarcinoma(174;0.142)|Lung(183;0.201)|Colorectal(170;0.22)		ATTACGGTAAGAATTACCCCC	0.408													24	107	---	---	---	---	PASS
AGL	178	broad.mit.edu	37	1	100379264	100379264	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:100379264C>T	uc001dsi.1	+	30	4531	c.4131C>T	c.(4129-4131)CTC>CTT	p.L1377L	AGL_uc001dsj.1_Silent_p.L1377L|AGL_uc001dsk.1_Silent_p.L1377L|AGL_uc001dsl.1_Silent_p.L1377L|AGL_uc001dsm.1_Silent_p.L1361L|AGL_uc001dsn.1_Silent_p.L1360L	NM_000642	NP_000633	P35573	GDE_HUMAN	amylo-1,6-glucosidase,	1377	4-alpha-glucanotransferase.				glucose metabolic process|glycogen biosynthetic process|glycogen catabolic process	cytosol|isoamylase complex|nucleus	4-alpha-glucanotransferase activity|amylo-alpha-1,6-glucosidase activity|cation binding			ovary(1)|central_nervous_system(1)|skin(1)	3		all_epithelial(167;2.2e-06)|all_lung(203;0.000295)|Lung NSC(277;0.00131)		Epithelial(280;0.15)|COAD - Colon adenocarcinoma(174;0.151)|Lung(183;0.209)|all cancers(265;0.237)		ACTATCAGCTCAGGCCTAATT	0.373													57	224	---	---	---	---	PASS
DPH5	51611	broad.mit.edu	37	1	101487267	101487267	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:101487267C>G	uc001dts.2	-	3	337	c.190G>C	c.(190-192)GAA>CAA	p.E64Q	DPH5_uc001dtr.2_Missense_Mutation_p.E64Q|DPH5_uc001dtq.2_RNA|DPH5_uc001dtt.2_Missense_Mutation_p.E64Q|DPH5_uc001dtu.2_RNA|DPH5_uc001dtv.2_RNA|DPH5_uc001dtw.2_RNA|DPH5_uc001dtx.2_Missense_Mutation_p.E64Q|DPH5_uc001dty.2_5'UTR|DPH5_uc001dtz.2_RNA	NM_015958	NP_057042	Q9H2P9	DPH5_HUMAN	diphthine synthase isoform a	64					peptidyl-diphthamide biosynthetic process from peptidyl-histidine		diphthine synthase activity				0		all_epithelial(167;3.1e-06)|all_lung(203;0.000414)|Lung NSC(277;0.000946)		Epithelial(280;0.0385)|all cancers(265;0.043)|COAD - Colon adenocarcinoma(174;0.151)|Colorectal(144;0.173)|Lung(183;0.198)		TTATCTGCTTCTTGTTCCACT	0.363													27	113	---	---	---	---	PASS
S1PR1	1901	broad.mit.edu	37	1	101704702	101704702	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:101704702C>T	uc001dud.2	+	2	676	c.162C>T	c.(160-162)CTC>CTT	p.L54L	S1PR1_uc009weg.2_Silent_p.L54L	NM_001400	NP_001391	P21453	S1PR1_HUMAN	sphingosine-1-phosphate receptor 1	54	Helical; Name=1; (By similarity).				cell adhesion	integral to membrane	lysosphingolipid and lysophosphatidic acid receptor activity			ovary(2)|lung(1)	3						TGTTCATTCTCATCTGCTGCT	0.438											OREG0013620	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	39	147	---	---	---	---	PASS
OLFM3	118427	broad.mit.edu	37	1	102290775	102290775	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:102290775G>T	uc001duf.2	-	4	530	c.459C>A	c.(457-459)CTC>CTA	p.L153L	OLFM3_uc001dug.2_Silent_p.L133L|OLFM3_uc001duh.2_RNA|OLFM3_uc001dui.2_RNA|OLFM3_uc001duj.2_Silent_p.L58L|OLFM3_uc001due.2_RNA	NM_058170	NP_477518	Q96PB7	NOE3_HUMAN	olfactomedin 3	153	Potential.					extracellular region				ovary(2)|skin(1)	3		all_epithelial(167;1.87e-06)|all_lung(203;8.12e-05)|Lung NSC(277;0.000189)		all cancers(265;0.0843)|Epithelial(280;0.0921)|COAD - Colon adenocarcinoma(174;0.145)		TCAAAGGCAGGAGCTCGTCCA	0.418													11	58	---	---	---	---	PASS
COL11A1	1301	broad.mit.edu	37	1	103427758	103427758	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103427758C>T	uc001dul.2	-	40	3406	c.3088G>A	c.(3088-3090)GGG>AGG	p.G1030R	COL11A1_uc001duk.2_Missense_Mutation_p.G226R|COL11A1_uc001dum.2_Missense_Mutation_p.G1042R|COL11A1_uc001dun.2_Missense_Mutation_p.G991R|COL11A1_uc009weh.2_Missense_Mutation_p.G914R	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	1030	Triple-helical region.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)		CCTCTTTCCCCTGGGAAACCA	0.378													27	119	---	---	---	---	PASS
COL11A1	1301	broad.mit.edu	37	1	103470228	103470228	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103470228A>T	uc001dul.2	-						COL11A1_uc001duk.2_Intron|COL11A1_uc001dum.2_Intron|COL11A1_uc001dun.2_Intron|COL11A1_uc009weh.2_Intron	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A						collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)		CTGTTAAATCAATACAAATAA	0.358													9	26	---	---	---	---	PASS
COL11A1	1301	broad.mit.edu	37	1	103477982	103477982	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103477982C>G	uc001dul.2	-	14	1934	c.1616G>C	c.(1615-1617)AGA>ACA	p.R539T	COL11A1_uc001duk.2_5'UTR|COL11A1_uc001dum.2_Missense_Mutation_p.R551T|COL11A1_uc001dun.2_Missense_Mutation_p.R500T|COL11A1_uc009weh.2_Missense_Mutation_p.R423T	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	539	Triple-helical region.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)		AGGACCTGGTCTTCCAGTTAG	0.398													3	91	---	---	---	---	PASS
COL11A1	1301	broad.mit.edu	37	1	103483430	103483430	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103483430C>A	uc001dul.2	-	11	1677	c.1359G>T	c.(1357-1359)ATG>ATT	p.M453I	COL11A1_uc001duk.2_5'UTR|COL11A1_uc001dum.2_Missense_Mutation_p.M465I|COL11A1_uc001dun.2_Missense_Mutation_p.M414I|COL11A1_uc009weh.2_Missense_Mutation_p.M337I	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	453	Triple-helical region (interrupted).				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)		CTGGAGGACCCATAATACCCT	0.413													46	221	---	---	---	---	PASS
GPR61	83873	broad.mit.edu	37	1	110085670	110085670	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110085670C>T	uc001dxy.2	+	2	709	c.26C>T	c.(25-27)TCA>TTA	p.S9L		NM_031936	NP_114142	Q9BZJ8	GPR61_HUMAN	G protein-coupled receptor 61	9	Extracellular (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			central_nervous_system(2)	2		all_epithelial(167;2.83e-05)|all_lung(203;0.00016)|Lung NSC(277;0.000318)|Breast(1374;0.244)		Lung(183;0.0426)|Colorectal(144;0.11)|Epithelial(280;0.128)|all cancers(265;0.132)|LUSC - Lung squamous cell carcinoma(189;0.228)		ATCCCCCAGTCATCAGGGAAC	0.632													11	41	---	---	---	---	PASS
CHIA	27159	broad.mit.edu	37	1	111861204	111861204	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:111861204G>C	uc001eas.2	+	9	922	c.819G>C	c.(817-819)CTG>CTC	p.L273L	CHIA_uc001ear.2_Silent_p.L165L|CHIA_uc001eaq.2_Silent_p.L165L|CHIA_uc009wgc.2_Silent_p.L165L|CHIA_uc001eat.2_Silent_p.L112L|CHIA_uc001eav.2_Silent_p.L112L|CHIA_uc001eau.2_Silent_p.L112L|CHIA_uc009wgd.2_Silent_p.L112L	NM_201653	NP_970615	Q9BZP6	CHIA_HUMAN	acidic chitinase isoform c	273					apoptosis|cell wall chitin metabolic process|chitin catabolic process|digestion|immune response|positive regulation of chemokine secretion|production of molecular mediator involved in inflammatory response|response to acid|response to fungus	cytoplasm|extracellular space	cation binding|chitin binding|chitinase activity|kinase binding|lysozyme activity|sugar binding			ovary(1)	1		all_cancers(81;3.23e-05)|all_epithelial(167;1.2e-05)|all_lung(203;0.000154)|Lung NSC(277;0.000304)		Colorectal(144;0.0115)|Lung(183;0.0292)|COAD - Colon adenocarcinoma(174;0.0314)|all cancers(265;0.0477)|Epithelial(280;0.0918)|LUSC - Lung squamous cell carcinoma(189;0.154)		ACTTCATCCTGAGCAACCCCT	0.527													45	210	---	---	---	---	PASS
RSBN1	54665	broad.mit.edu	37	1	114308953	114308953	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:114308953G>C	uc001edq.2	-	7	2094	c.2058C>G	c.(2056-2058)TTC>TTG	p.F686L	RSBN1_uc001edr.2_RNA	NM_018364	NP_060834	Q5VWQ0	RSBN1_HUMAN	round spermatid basic protein 1	686						nucleus				ovary(1)	1	Lung SC(450;0.184)	all_cancers(81;3.78e-08)|all_epithelial(167;5.56e-08)|all_lung(203;6.97e-06)|Lung NSC(69;1.18e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)		AAACTGTTTTGAACTGATGAA	0.423													48	213	---	---	---	---	PASS
WDR3	10885	broad.mit.edu	37	1	118494594	118494594	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:118494594C>T	uc010oxe.1	+						WDR3_uc001ehi.2_Intron	NM_006784	NP_006775	Q9UNX4	WDR3_HUMAN	WD repeat-containing protein 3							nuclear membrane|nucleolus				upper_aerodigestive_tract(1)	1	Esophageal squamous(2;0.162)	all_cancers(81;2.72e-05)|Acute lymphoblastic leukemia(138;1e-08)|all_epithelial(167;4.4e-07)|all_lung(203;1.7e-06)|Lung NSC(69;1.98e-05)|Prostate(1639;0.00955)|Breast(1374;0.244)		OV - Ovarian serous cystadenocarcinoma(397;1.39e-08)|Epithelial(280;1.82e-07)|all cancers(265;2.04e-05)|Lung(183;0.0525)|BRCA - Breast invasive adenocarcinoma(282;0.0695)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.185)		TTTTATTTCTCATAGGATGGA	0.368													49	165	---	---	---	---	PASS
SPAG17	200162	broad.mit.edu	37	1	118609430	118609430	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:118609430C>T	uc001ehk.2	-	18	2546	c.2478G>A	c.(2476-2478)ATG>ATA	p.M826I		NM_206996	NP_996879	Q6Q759	SPG17_HUMAN	sperm associated antigen 17	826						cilium|flagellar axoneme|microtubule				upper_aerodigestive_tract(2)|ovary(2)|large_intestine(1)|skin(1)	6	Esophageal squamous(2;0.0106)	all_cancers(81;0.0204)|all_lung(203;9.46e-05)|Lung NSC(69;0.000675)|all_epithelial(167;0.01)		Lung(183;0.0858)		GTTGTCTATTCATTGGATTGT	0.333													28	134	---	---	---	---	PASS
PDE4DIP	9659	broad.mit.edu	37	1	144915496	144915496	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144915496C>G	uc001elw.3	-	14	2220	c.1929G>C	c.(1927-1929)ATG>ATC	p.M643I	NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|PDE4DIP_uc001elx.3_Missense_Mutation_p.M709I|PDE4DIP_uc001emc.1_Missense_Mutation_p.M643I|PDE4DIP_uc001emd.1_Missense_Mutation_p.M643I|PDE4DIP_uc001emb.1_Missense_Mutation_p.M806I|PDE4DIP_uc001eme.1_Missense_Mutation_p.M172I|PDE4DIP_uc001emf.1_Missense_Mutation_p.M428I	NM_014644	NP_055459	Q5VU43	MYOME_HUMAN	phosphodiesterase 4D interacting protein isoform	643	Potential.			M -> V (in Ref. 4; CAD91152).	cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)		CTTGAATCTCCATTTCATGTT	0.468			T	PDGFRB	MPD								56	624	---	---	---	---	PASS
SEC22B	9554	broad.mit.edu	37	1	145104002	145104002	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145104002G>A	uc001eml.1	+	4	310	c.170G>A	c.(169-171)GGA>GAA	p.G57E	NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron	NM_004892	NP_004883	O75396	SC22B_HUMAN	SEC22 vesicle trafficking protein homolog B	57	Longin.|Cytoplasmic (Potential).				ER to Golgi vesicle-mediated transport|protein transport	endoplasmic reticulum membrane|ER-Golgi intermediate compartment membrane|Golgi membrane|integral to membrane|melanosome	protein binding				0						TTGGAAGCAGGAGCCATGACT	0.368													7	39	---	---	---	---	PASS
ITGA10	8515	broad.mit.edu	37	1	145536083	145536083	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145536083G>C	uc001eoa.2	+	17	2251	c.2175G>C	c.(2173-2175)CGG>CGC	p.R725R	NBPF10_uc001emp.3_Intron|ITGA10_uc010oyv.1_Silent_p.R594R|ITGA10_uc009wiw.2_Silent_p.R582R|ITGA10_uc010oyw.1_Silent_p.R670R	NM_003637	NP_003628	O75578	ITA10_HUMAN	integrin, alpha 10 precursor	725	Extracellular (Potential).				cell-matrix adhesion|integrin-mediated signaling pathway	integrin complex	collagen binding|receptor activity			lung(2)|ovary(2)|kidney(2)|large_intestine(1)|skin(1)	8	all_hematologic(18;0.0187)|Acute lymphoblastic leukemia(18;0.0786)					TGTCCCCTCGGAGGCTCCGGC	0.557													43	165	---	---	---	---	PASS
RNF115	27246	broad.mit.edu	37	1	145650499	145650499	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145650499G>A	uc001eoj.2	+	3	382	c.178G>A	c.(178-180)GGC>AGC	p.G60S	NBPF10_uc001emp.3_Intron|RNF115_uc001eok.2_Missense_Mutation_p.G27S|RNF115_uc009wiy.2_5'UTR	NM_014455	NP_055270	Q9Y4L5	RN115_HUMAN	Rabring 7	60					protein autoubiquitination	cytosol	protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1						AGGTGGTGGCGGCAGTCGGAT	0.403													20	99	---	---	---	---	PASS
LOC200030	200030	broad.mit.edu	37	1	148344675	148344675	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:148344675C>T	uc001eqf.2	-	2	278	c.243G>A	c.(241-243)AAG>AAA	p.K81K	LOC200030_uc001eqe.2_Intron|LOC200030_uc001eqg.2_Intron|NBPF14_uc009wkf.1_Intron|uc001erd.3_Silent_p.K81K|uc001erc.3_Intron|uc010paj.1_Intron|uc010pau.1_5'Flank|uc010pav.1_Silent_p.K81K|uc010paw.1_Intron	NM_017940	NP_060410	Q86T75	NBPFB_HUMAN	hypothetical protein LOC55672	81	Potential.					cytoplasm					0						GCTCTGCAAGCTTCTCCTCCT	0.527													8	458	---	---	---	---	PASS
LOC200030	200030	broad.mit.edu	37	1	148346684	148346684	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:148346684G>A	uc001eqf.2	-	1	108	c.73C>T	c.(73-75)CGC>TGC	p.R25C	LOC200030_uc001eqe.2_5'UTR|LOC200030_uc001eqg.2_5'UTR|NBPF14_uc009wkf.1_RNA|uc001erd.3_Missense_Mutation_p.R25C|uc001erc.3_RNA|uc010paj.1_5'UTR|uc010pav.1_Missense_Mutation_p.R25C|uc010paw.1_5'UTR	NM_017940	NP_060410	Q86T75	NBPFB_HUMAN	hypothetical protein LOC55672	25						cytoplasm					0						AACTGGGGGCGCAATTTCTCG	0.507													6	450	---	---	---	---	PASS
HIST2H2AC	8338	broad.mit.edu	37	1	149858795	149858795	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:149858795G>C	uc001etd.2	+	1	271	c.271G>C	c.(271-273)GAC>CAC	p.D91H	HIST2H2BE_uc001etc.2_5'Flank	NM_003517	NP_003508	Q16777	H2A2C_HUMAN	histone cluster 2, H2ac	91					nucleosome assembly	nucleosome|nucleus	DNA binding			ovary(1)|skin(1)	2	Breast(34;0.0124)|all_hematologic(923;0.127)		STAD - Stomach adenocarcinoma(528;0.133)|LUSC - Lung squamous cell carcinoma(543;0.221)			CATCCGCAACGACGAGGAACT	0.597													18	112	---	---	---	---	PASS
ADAMTSL4	54507	broad.mit.edu	37	1	150529462	150529462	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150529462C>T	uc001eux.2	+	11	2033	c.1797C>T	c.(1795-1797)ATC>ATT	p.I599I	ADAMTSL4_uc001euw.2_Silent_p.I599I|ADAMTSL4_uc009wlw.2_Silent_p.I622I|ADAMTSL4_uc010pcg.1_Intron|ADAMTSL4_uc009wlx.2_5'Flank	NM_019032	NP_061905	Q6UY14	ATL4_HUMAN	thrombospondin repeat containing 1 isoform 1	599					apoptosis|positive regulation of apoptosis		metalloendopeptidase activity|protease binding			ovary(1)|skin(1)	2	all_cancers(9;3.13e-53)|all_epithelial(9;3.74e-43)|all_lung(15;2.43e-34)|Lung NSC(24;8.86e-31)|Breast(34;0.000326)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Melanoma(130;0.128)|Colorectal(459;0.171)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0241)|Epithelial(6;3.18e-23)|all cancers(9;1.79e-22)|OV - Ovarian serous cystadenocarcinoma(6;1.13e-14)|BRCA - Breast invasive adenocarcinoma(12;0.000503)|LUSC - Lung squamous cell carcinoma(543;0.171)|STAD - Stomach adenocarcinoma(528;0.206)			AGTATGTCATCTCTTCACCTC	0.537													26	644	---	---	---	---	PASS
CTSS	1520	broad.mit.edu	37	1	150727603	150727603	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150727603C>G	uc001evn.2	-	4	406	c.273G>C	c.(271-273)TTG>TTC	p.L91F	CTSS_uc010pcj.1_Intron|CTSS_uc001evo.1_Missense_Mutation_p.L91F	NM_004079	NP_004070	P25774	CATS_HUMAN	cathepsin S preproprotein	91					immune response|proteolysis	extracellular region|lysosome	cysteine-type endopeptidase activity				0	all_cancers(9;6.17e-52)|all_epithelial(9;9.7e-43)|all_lung(15;5.74e-35)|Lung NSC(24;2.09e-31)|Breast(34;0.00146)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Melanoma(130;0.128)|Colorectal(459;0.171)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0485)|Epithelial(6;5.02e-21)|all cancers(9;1.28e-20)|OV - Ovarian serous cystadenocarcinoma(6;1.09e-14)|BRCA - Breast invasive adenocarcinoma(12;0.00501)|LUSC - Lung squamous cell carcinoma(543;0.171)			GGGAACTCATCAAAGACATCA	0.294													15	335	---	---	---	---	PASS
CGN	57530	broad.mit.edu	37	1	151501993	151501993	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151501993G>C	uc009wmw.2	+	11	2208	c.2064G>C	c.(2062-2064)AAG>AAC	p.K688N		NM_020770	NP_065821	Q9P2M7	CING_HUMAN	cingulin	682	Glu-rich.|Potential.					myosin complex|tight junction	actin binding|motor activity			ovary(2)|pancreas(1)	3	Ovarian(49;0.0273)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		LUSC - Lung squamous cell carcinoma(543;0.181)			AGCTACAAAAGACCCTCCAGC	0.622													5	39	---	---	---	---	PASS
FLG	2312	broad.mit.edu	37	1	152285429	152285429	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152285429G>C	uc001ezu.1	-	3	1969	c.1933C>G	c.(1933-1935)CAT>GAT	p.H645D	uc001ezv.2_5'Flank	NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	645	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			GATCCATGATGGTTTCTGGAA	0.557									Ichthyosis				270	480	---	---	---	---	PASS
CRNN	49860	broad.mit.edu	37	1	152383036	152383036	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152383036C>G	uc001ezx.2	-	3	596	c.522G>C	c.(520-522)CAG>CAC	p.Q174H		NM_016190	NP_057274	Q9UBG3	CRNN_HUMAN	cornulin	174	Gln-rich.				cell-cell adhesion|response to heat	cytoplasm|membrane	calcium ion binding			ovary(2)|skin(1)	3	Hepatocellular(266;0.0877)|all_hematologic(923;0.127)|Melanoma(130;0.242)		LUSC - Lung squamous cell carcinoma(543;0.206)			TTTCCTGGCTCTGGGACTCAG	0.577													128	522	---	---	---	---	PASS
S100A14	57402	broad.mit.edu	37	1	153587501	153587501	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153587501G>C	uc001fce.2	-						S100A16_uc001fcd.1_5'Flank	NM_020672	NP_065723	Q9HCY8	S10AE_HUMAN	S100 calcium binding protein A14						calcium ion homeostasis|defense response to bacterium|positive regulation of granulocyte chemotaxis|positive regulation of monocyte chemotaxis|response to lipopolysaccharide|toll-like receptor 4 signaling pathway	cell junction|microtubule cytoskeleton|perinuclear region of cytoplasm	calcium ion binding|chemokine receptor binding				0	all_lung(78;1.84e-32)|Lung NSC(65;6.67e-31)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.171)			CAGTTGCTCTGAGGGGAGTGA	0.567													25	163	---	---	---	---	PASS
NPR1	4881	broad.mit.edu	37	1	153652175	153652175	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153652175C>T	uc001fcs.3	+	1	1012	c.591C>T	c.(589-591)TTC>TTT	p.F197F	NPR1_uc010pdz.1_5'Flank	NM_000906	NP_000897	P16066	ANPRA_HUMAN	natriuretic peptide receptor 1 precursor	197	Extracellular (Potential).				body fluid secretion|intracellular signal transduction|negative regulation of angiogenesis|negative regulation of cell growth|positive regulation of renal sodium excretion|positive regulation of urine volume|receptor guanylyl cyclase signaling pathway|regulation of blood pressure|regulation of blood vessel size|regulation of vascular permeability|regulation of vasodilation		ATP binding|GTP binding|guanylate cyclase activity|natriuretic peptide receptor activity|peptide receptor activity, G-protein coupled|protein kinase activity			ovary(3)|lung(2)|stomach(1)|breast(1)	7	all_lung(78;3.75e-32)|Lung NSC(65;1.37e-30)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.151)		Erythrityl Tetranitrate(DB01613)|Isosorbide Dinitrate(DB00883)|Isosorbide Mononitrate(DB01020)|Nesiritide(DB04899)|Nitric Oxide(DB00435)|Nitroglycerin(DB00727)|Nitroprusside(DB00325)	AGCACTGCTTCTTCCTCGTGG	0.662													11	21	---	---	---	---	PASS
INTS3	65123	broad.mit.edu	37	1	153736693	153736693	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153736693G>A	uc009wom.2	+	19	2142	c.1921G>A	c.(1921-1923)GAG>AAG	p.E641K	INTS3_uc001fct.2_Missense_Mutation_p.E641K|INTS3_uc001fcu.2_Missense_Mutation_p.E333K|INTS3_uc001fcv.2_Missense_Mutation_p.E435K|INTS3_uc010peb.1_Missense_Mutation_p.E435K|INTS3_uc001fcw.2_Missense_Mutation_p.E154K|INTS3_uc010pec.1_Missense_Mutation_p.E154K|INTS3_uc001fcy.2_5'Flank|INTS3_uc001fcx.2_5'Flank	NM_023015	NP_075391	Q68E01	INT3_HUMAN	integrator complex subunit 3	642					DNA repair|G2/M transition checkpoint|response to ionizing radiation|snRNA processing	integrator complex|SOSS complex	protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	all_lung(78;3.75e-32)|Lung NSC(65;1.37e-30)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.151)			GGAGATTACTGAGGAGTAAGG	0.537													50	86	---	---	---	---	PASS
UBAP2L	9898	broad.mit.edu	37	1	154227363	154227363	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154227363G>C	uc001fep.3	+	16	2073	c.1906G>C	c.(1906-1908)GAA>CAA	p.E636Q	UBAP2L_uc009wot.2_Missense_Mutation_p.E636Q|UBAP2L_uc010pek.1_Missense_Mutation_p.E628Q|UBAP2L_uc010pel.1_Missense_Mutation_p.E646Q|UBAP2L_uc010pen.1_Missense_Mutation_p.E550Q|UBAP2L_uc001feq.2_5'Flank|UBAP2L_uc001fer.2_5'Flank	NM_014847	NP_055662	Q14157	UBP2L_HUMAN	ubiquitin associated protein 2-like isoform a	636					binding of sperm to zona pellucida		protein binding			ovary(1)|central_nervous_system(1)	2	all_lung(78;1.09e-30)|Lung NSC(65;1.66e-28)|Hepatocellular(266;0.0877)		LUSC - Lung squamous cell carcinoma(543;0.185)			ACAATCTGTTGAAGGTGAGTG	0.408													18	169	---	---	---	---	PASS
IL6R	3570	broad.mit.edu	37	1	154407188	154407188	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154407188C>G	uc001fez.1	+						IL6R_uc001ffa.1_Intron	NM_000565	NP_000556	P08887	IL6RA_HUMAN	interleukin 6 receptor isoform 1 precursor						acute-phase response|ciliary neurotrophic factor-mediated signaling pathway|defense response to Gram-negative bacterium|defense response to Gram-positive bacterium|endocrine pancreas development|hepatic immune response|negative regulation of collagen biosynthetic process|negative regulation of interleukin-8 production|positive regulation of activation of Janus kinase activity|positive regulation of anti-apoptosis|positive regulation of chemokine production|positive regulation of chemokine production|positive regulation of interleukin-6 production|positive regulation of leukocyte chemotaxis|positive regulation of MAPKKK cascade|positive regulation of osteoblast differentiation|positive regulation of smooth muscle cell proliferation|positive regulation of tyrosine phosphorylation of Stat3 protein|regulation of apoptosis	apical plasma membrane|basolateral plasma membrane|extracellular space|interleukin-6 receptor complex	ciliary neurotrophic factor binding|enzyme binding|protein homodimerization activity			ovary(3)|breast(1)	4	all_lung(78;1.72e-29)|Lung NSC(65;2.96e-27)|Hepatocellular(266;0.0877)		LUSC - Lung squamous cell carcinoma(543;0.185)			TACGTAAGCTCTAACCCCCTC	0.488													8	203	---	---	---	---	PASS
ADAM15	8751	broad.mit.edu	37	1	155029655	155029655	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155029655C>T	uc001fgr.1	+						ADAM15_uc001fgq.1_Intron|ADAM15_uc010pet.1_Intron|ADAM15_uc010peu.1_Intron|ADAM15_uc001fgt.1_Intron|ADAM15_uc010pev.1_Intron|ADAM15_uc001fgs.1_Intron|ADAM15_uc001fgu.1_Intron|ADAM15_uc001fgw.1_Intron|ADAM15_uc001fgv.1_Intron|ADAM15_uc001fgx.1_Intron|ADAM15_uc001fgz.1_Intron|ADAM15_uc001fgy.1_Intron|ADAM15_uc001fha.1_Intron|ADAM15_uc001fhb.1_5'Flank	NM_207197	NP_997080	Q13444	ADA15_HUMAN	a disintegrin and metalloproteinase domain 15						angiogenesis|cell-matrix adhesion|collagen catabolic process|proteolysis	acrosomal vesicle|adherens junction|endomembrane system|flagellum|integral to membrane	metalloendopeptidase activity|SH3 domain binding|zinc ion binding			central_nervous_system(3)|skin(2)|ovary(1)	6	all_epithelial(22;1.43e-30)|all_lung(78;6.64e-28)|all_hematologic(923;0.0359)|Hepatocellular(266;0.0877)		BRCA - Breast invasive adenocarcinoma(34;0.000434)			TCCTTGCCACCCTCCCCAGCT	0.637													8	64	---	---	---	---	PASS
RUSC1	23623	broad.mit.edu	37	1	155292628	155292628	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155292628C>A	uc001fkj.2	+	2	1293	c.1064C>A	c.(1063-1065)TCG>TAG	p.S355*	RAG1AP1_uc010pey.1_Intron|C1orf104_uc001fkh.1_5'Flank|C1orf104_uc001fki.2_Intron|RUSC1_uc001fkk.2_Nonsense_Mutation_p.S355*|RUSC1_uc009wqn.1_RNA|RUSC1_uc009wqo.1_5'Flank|RUSC1_uc001fkl.2_5'Flank|RUSC1_uc001fkp.2_5'Flank|RUSC1_uc001fkq.2_5'Flank|RUSC1_uc010pgb.1_5'Flank|RUSC1_uc009wqp.1_5'Flank|RUSC1_uc001fkn.2_5'Flank|RUSC1_uc001fko.2_5'Flank|RUSC1_uc001fkr.2_5'Flank|RUSC1_uc001fks.2_5'Flank	NM_001105203	NP_001098673	Q9BVN2	RUSC1_HUMAN	RUN and SH3 domain containing 1 isoform a	355						cytoplasm|nucleolus	SH3/SH2 adaptor activity			ovary(2)	2	Hepatocellular(266;0.0877)|all_hematologic(923;0.145)		Epithelial(20;1.55e-10)|all cancers(21;4.15e-10)|BRCA - Breast invasive adenocarcinoma(34;0.000549)|LUSC - Lung squamous cell carcinoma(543;0.127)			CTCCCCCCCTCGGGGTCGCCG	0.701													14	39	---	---	---	---	PASS
ASH1L	55870	broad.mit.edu	37	1	155449335	155449335	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155449335G>T	uc009wqq.2	-	3	3806	c.3326C>A	c.(3325-3327)TCT>TAT	p.S1109Y	ASH1L_uc001fkt.2_Missense_Mutation_p.S1109Y|ASH1L_uc009wqr.1_Missense_Mutation_p.S1109Y	NM_018489	NP_060959	Q9NR48	ASH1L_HUMAN	absent, small, or homeotic 1-like	1109					cell-cell signaling|DNA packaging|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	chromosome|Golgi apparatus|nucleus|tight junction	DNA binding|histone-lysine N-methyltransferase activity|zinc ion binding			skin(5)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	11	Hepatocellular(266;0.0997)|all_neural(408;0.129)|all_hematologic(923;0.145)		Epithelial(20;1.74e-08)|all cancers(21;3.29e-08)|BRCA - Breast invasive adenocarcinoma(34;0.021)			AGAAGACTGAGAGCAAATAGG	0.473													23	159	---	---	---	---	PASS
BCAN	63827	broad.mit.edu	37	1	156626090	156626090	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156626090C>T	uc001fpp.2	+	9	2295	c.1959C>T	c.(1957-1959)AGC>AGT	p.S653S		NM_021948	NP_068767	Q96GW7	PGCB_HUMAN	brevican isoform 1	653	EGF-like.				cell adhesion	anchored to membrane|proteinaceous extracellular matrix	hyaluronic acid binding|sugar binding			ovary(1)|pancreas(1)	2	all_hematologic(923;0.088)|Hepatocellular(266;0.158)					GTGTCCCCAGCCCCTGCCACA	0.642													23	179	---	---	---	---	PASS
NES	10763	broad.mit.edu	37	1	156641855	156641855	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156641855C>G	uc001fpq.2	-	4	2258	c.2125G>C	c.(2125-2127)GAG>CAG	p.E709Q		NM_006617	NP_006608	P48681	NEST_HUMAN	nestin	709	Tail.				brain development|embryonic camera-type eye development|G2/M transition of mitotic cell cycle|negative regulation of apoptosis|positive regulation of intermediate filament depolymerization|positive regulation of neural precursor cell proliferation|stem cell proliferation	cytoplasm|intermediate filament	intermediate filament binding|structural molecule activity			ovary(6)	6	all_hematologic(923;0.088)|Hepatocellular(266;0.158)					CTAAAGGCCTCTTTGTTCTCA	0.468													10	271	---	---	---	---	PASS
NES	10763	broad.mit.edu	37	1	156642404	156642404	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156642404C>G	uc001fpq.2	-	4	1709	c.1576G>C	c.(1576-1578)GAA>CAA	p.E526Q		NM_006617	NP_006608	P48681	NEST_HUMAN	nestin	526	Tail.				brain development|embryonic camera-type eye development|G2/M transition of mitotic cell cycle|negative regulation of apoptosis|positive regulation of intermediate filament depolymerization|positive regulation of neural precursor cell proliferation|stem cell proliferation	cytoplasm|intermediate filament	intermediate filament binding|structural molecule activity			ovary(6)	6	all_hematologic(923;0.088)|Hepatocellular(266;0.158)					AGATCCTCTTCTTCCCATATT	0.488													15	384	---	---	---	---	PASS
ISG20L2	81875	broad.mit.edu	37	1	156694046	156694046	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156694046C>T	uc001fps.1	-	2	1103	c.842G>A	c.(841-843)CGT>CAT	p.R281H	ISG20L2_uc001fpt.1_Missense_Mutation_p.R281H	NM_030980	NP_112242	Q9H9L3	I20L2_HUMAN	interferon stimulated exonuclease gene	281	Exonuclease.				ribosome biogenesis	nucleolus	exonuclease activity|nucleic acid binding|protein binding			ovary(1)|central_nervous_system(1)	2	all_hematologic(923;0.088)|Hepatocellular(266;0.158)					GGAGGTGTCACGGGTGAGGGA	0.542													9	205	---	---	---	---	PASS
SH2D2A	9047	broad.mit.edu	37	1	156779563	156779563	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156779563C>G	uc001fqd.2	-	6	744	c.604G>C	c.(604-606)GAA>CAA	p.E202Q	SH2D2A_uc001fqc.1_Missense_Mutation_p.E174Q|SH2D2A_uc009wsh.2_Missense_Mutation_p.E212Q|SH2D2A_uc001fqe.2_Missense_Mutation_p.E184Q|SH2D2A_uc010phs.1_Missense_Mutation_p.E202Q	NM_003975	NP_003966	Q9NP31	SH22A_HUMAN	SH2 domain protein 2A isoform 2	202	Pro-rich.				angiogenesis|cell differentiation|signal transduction	cytoplasm|soluble fraction	SH3 domain binding|SH3/SH2 adaptor activity				0	all_hematologic(923;0.0839)|Hepatocellular(266;0.158)					AAGTTTGATTCTTCGGTCCTC	0.587													120	312	---	---	---	---	PASS
PEAR1	375033	broad.mit.edu	37	1	156879910	156879910	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156879910C>A	uc001fqj.1	+						PEAR1_uc001fqk.1_Intron	NM_001080471	NP_001073940	Q5VY43	PEAR1_HUMAN	platelet endothelial aggregation receptor 1							integral to membrane				ovary(2)|central_nervous_system(1)	3	all_hematologic(923;0.0839)|Hepatocellular(266;0.158)					GGTGAGCATTCTGGGGCCCCA	0.607											OREG0013890	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	5	179	---	---	---	---	PASS
FCRL3	115352	broad.mit.edu	37	1	157648534	157648534	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:157648534T>A	uc001frb.2	-	15	2463	c.2171A>T	c.(2170-2172)AAT>ATT	p.N724I	FCRL3_uc001fqx.3_RNA|FCRL3_uc001fqy.3_RNA|FCRL3_uc001fqz.3_Missense_Mutation_p.N724I|FCRL3_uc009wsn.2_RNA|FCRL3_uc009wso.2_RNA|FCRL3_uc001fra.2_Missense_Mutation_p.N450I|FCRL3_uc001frc.1_Missense_Mutation_p.N724I	NM_052939	NP_443171	Q96P31	FCRL3_HUMAN	Fc receptor-like 3 precursor	724	ITIM motif 4.|Cytoplasmic (Potential).					integral to membrane|plasma membrane	receptor activity			ovary(3)|breast(1)	4	all_hematologic(112;0.0378)					ACGTGGTACATTCTCATAGTT	0.502													30	240	---	---	---	---	PASS
KIRREL	55243	broad.mit.edu	37	1	158064513	158064513	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158064513G>A	uc001frn.3	+	15	2281	c.1877G>A	c.(1876-1878)CGT>CAT	p.R626H	KIRREL_uc010pib.1_Missense_Mutation_p.R526H|KIRREL_uc009wsq.2_Missense_Mutation_p.R462H|KIRREL_uc001fro.3_Missense_Mutation_p.R440H|uc001frp.2_5'Flank	NM_018240	NP_060710	Q96J84	KIRR1_HUMAN	kin of IRRE like precursor	626	Cytoplasmic (Potential).					integral to membrane				ovary(1)	1	all_hematologic(112;0.0378)					GCTGACTACCGTGCCCCTGGC	0.647													8	108	---	---	---	---	PASS
OR10X1	128367	broad.mit.edu	37	1	158549092	158549092	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158549092C>G	uc010pin.1	-	1	598	c.598G>C	c.(598-600)GTT>CTT	p.V200L		NM_001004477	NP_001004477	Q8NGY0	O10X1_HUMAN	olfactory receptor, family 10, subfamily X,	200	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_hematologic(112;0.0378)					AGCCTAATAACTGCCAGCATA	0.443													9	162	---	---	---	---	PASS
SPTA1	6708	broad.mit.edu	37	1	158655095	158655095	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158655095C>G	uc001fst.1	-	2	266	c.67G>C	c.(67-69)GAG>CAG	p.E23Q		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	23	Spectrin 1.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)					TCCTGGATCTCTTCTGCTGTT	0.383													44	243	---	---	---	---	PASS
OR6K2	81448	broad.mit.edu	37	1	158669950	158669950	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158669950G>T	uc001fsu.1	-	1	493	c.493C>A	c.(493-495)CTG>ATG	p.L165M		NM_001005279	NP_001005279	Q8NGY2	OR6K2_HUMAN	olfactory receptor, family 6, subfamily K,	165	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			pancreas(1)	1	all_hematologic(112;0.0378)					CAAAATGGCAGTGTAGAGATC	0.488													76	143	---	---	---	---	PASS
OR6N1	128372	broad.mit.edu	37	1	158735813	158735813	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158735813C>A	uc010piq.1	-	1	660	c.660G>T	c.(658-660)CAG>CAT	p.Q220H		NM_001005185	NP_001005185	Q8NGY5	OR6N1_HUMAN	olfactory receptor, family 6, subfamily N,	220	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_hematologic(112;0.0378)					TGCAGATGATCTGCACATAGG	0.488													14	318	---	---	---	---	PASS
IGSF8	93185	broad.mit.edu	37	1	160064893	160064893	+	Missense_Mutation	SNP	C	T	T	rs144014563	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160064893C>T	uc001fva.2	-	2	253	c.208G>A	c.(208-210)GAG>AAG	p.E70K	IGSF8_uc001fuz.2_Missense_Mutation_p.E70K|IGSF8_uc009wtf.2_Missense_Mutation_p.E70K	NM_052868	NP_443100	Q969P0	IGSF8_HUMAN	immunoglobulin superfamily, member 8	70	Ig-like C2-type 1.|Extracellular (Potential).				cell proliferation|cellular component movement|nervous system development|single fertilization|skeletal muscle tissue development	integral to membrane	protein binding				0	all_cancers(52;1.11e-16)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.111)|LUSC - Lung squamous cell carcinoma(543;0.246)			TCTGGGGCCTCGGGCCTATAC	0.587													14	124	---	---	---	---	PASS
COPA	1314	broad.mit.edu	37	1	160262323	160262323	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160262323G>C	uc009wti.2	-	28	3305	c.2911C>G	c.(2911-2913)CAG>GAG	p.Q971E	COPA_uc001fvv.3_Missense_Mutation_p.Q980E	NM_004371	NP_004362	P53621	COPA_HUMAN	coatomer protein complex, subunit alpha isoform	971					COPI coating of Golgi vesicle|intracellular protein transport|pancreatic juice secretion|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat|cytosol|extracellular space|microsome|soluble fraction	hormone activity|structural molecule activity			ovary(1)|skin(1)	2	all_cancers(52;8.15e-18)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.111)			GGCAGAGCCTGATAGGTTGTG	0.507													31	245	---	---	---	---	PASS
COPA	1314	broad.mit.edu	37	1	160281683	160281683	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160281683C>A	uc009wti.2	-	11	1445	c.1051G>T	c.(1051-1053)GAT>TAT	p.D351Y	COPA_uc001fvv.3_Missense_Mutation_p.D351Y|COPA_uc009wtj.1_Missense_Mutation_p.D297Y	NM_004371	NP_004362	P53621	COPA_HUMAN	coatomer protein complex, subunit alpha isoform	351					COPI coating of Golgi vesicle|intracellular protein transport|pancreatic juice secretion|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat|cytosol|extracellular space|microsome|soluble fraction	hormone activity|structural molecule activity			ovary(1)|skin(1)	2	all_cancers(52;8.15e-18)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.111)			ACAGCTACATCTTTGGAGCTG	0.473													7	89	---	---	---	---	PASS
SLAMF6	114836	broad.mit.edu	37	1	160460006	160460006	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160460006G>C	uc001fwe.1	-	5	838	c.778C>G	c.(778-780)CAG>GAG	p.Q260E	SLAMF6_uc001fwd.1_Missense_Mutation_p.Q260E|SLAMF6_uc010pjh.1_Missense_Mutation_p.Q211E|SLAMF6_uc010pji.1_Missense_Mutation_p.Q149E|SLAMF6_uc010pjj.1_Missense_Mutation_p.Q149E	NM_052931	NP_443163	Q96DU3	SLAF6_HUMAN	activating NK receptor precursor	260	Cytoplasmic (Potential).					integral to membrane|plasma membrane	receptor activity			ovary(1)|skin(1)	2	all_cancers(52;1.05e-18)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.0923)			TGTGTTCGCTGAGTAGACAAA	0.488													7	359	---	---	---	---	PASS
USP21	27005	broad.mit.edu	37	1	161134932	161134932	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161134932C>T	uc010pke.1	+	13	1983	c.1606C>T	c.(1606-1608)CGT>TGT	p.R536C	USP21_uc010pkf.1_Missense_Mutation_p.R536C|PPOX_uc001fyj.2_5'Flank|PPOX_uc001fyn.2_5'Flank|PPOX_uc001fyg.2_5'Flank|PPOX_uc001fyl.2_5'Flank|PPOX_uc001fym.2_5'Flank|PPOX_uc001fyk.2_5'Flank|PPOX_uc001fyh.2_5'Flank|PPOX_uc010pkg.1_5'Flank|PPOX_uc009wuc.1_5'Flank|PPOX_uc010pkh.1_5'Flank|PPOX_uc001fyi.2_5'Flank	NM_001014443	NP_001014443	Q9UK80	UBP21_HUMAN	ubiquitin-specific protease 21	536					histone deubiquitination|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent|ubiquitin-dependent protein catabolic process	nucleus	metal ion binding|NEDD8-specific protease activity|protein binding|transcription coactivator activity|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(2)|lung(1)|prostate(1)|breast(1)	5	all_cancers(52;3.73e-19)|Breast(13;0.000577)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00275)			CAATGACTCTCGGTGAGAATA	0.562													8	190	---	---	---	---	PASS
FCGR3A	2214	broad.mit.edu	37	1	161518346	161518346	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161518346G>A	uc001gat.3	-	4	321	c.184C>T	c.(184-186)CAC>TAC	p.H62Y	FCGR3A_uc001gar.2_Missense_Mutation_p.H98Y|FCGR3A_uc001gas.2_Missense_Mutation_p.H97Y|FCGR3A_uc009wuh.2_Missense_Mutation_p.H61Y|FCGR3A_uc009wui.2_Missense_Mutation_p.H62Y	NM_001127595	NP_001121067	P08637	FCG3A_HUMAN	Fc fragment of IgG, low affinity IIIa, receptor	62	Ig-like C2-type 1.|Extracellular (Potential).				immune response|regulation of immune response	extracellular region|integral to membrane|plasma membrane	IgG binding|receptor activity			ovary(1)	1	all_cancers(52;4.89e-16)|all_hematologic(112;0.0207)		BRCA - Breast invasive adenocarcinoma(70;0.00376)		Abciximab(DB00054)|Adalimumab(DB00051)|Alefacept(DB00092)|Alemtuzumab(DB00087)|Basiliximab(DB00074)|Bevacizumab(DB00112)|Cetuximab(DB00002)|Daclizumab(DB00111)|Efalizumab(DB00095)|Etanercept(DB00005)|Gemtuzumab ozogamicin(DB00056)|Ibritumomab(DB00078)|Immune globulin(DB00028)|Muromonab(DB00075)|Natalizumab(DB00108)|Palivizumab(DB00110)|Rituximab(DB00073)|Tositumomab(DB00081)|Trastuzumab(DB00072)	CTCTCATTGTGAAACCACTGT	0.552													11	739	---	---	---	---	PASS
ATF6	22926	broad.mit.edu	37	1	161833057	161833057	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161833057C>T	uc001gbr.2	+	14	1741	c.1674C>T	c.(1672-1674)GCC>GCT	p.A558A	ATF6_uc001gbq.1_Silent_p.A558A	NM_007348	NP_031374	P18850	ATF6A_HUMAN	activating transcription factor 6	558	Lumenal (Potential).				positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response|protein folding	endoplasmic reticulum membrane|Golgi membrane|integral to membrane|nuclear envelope|nucleoplasm	protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity			ovary(2)|skin(1)	3	all_hematologic(112;0.156)		BRCA - Breast invasive adenocarcinoma(70;0.00953)			TTTTTGAAGCCATCCGCAGAA	0.303													45	322	---	---	---	---	PASS
OLFML2B	25903	broad.mit.edu	37	1	161967758	161967758	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161967758A>G	uc001gbu.2	-	6	1755	c.1331T>C	c.(1330-1332)ATG>ACG	p.M444T	OLFML2B_uc010pkq.1_Missense_Mutation_p.M445T	NM_015441	NP_056256	Q68BL8	OLM2B_HUMAN	olfactomedin-like 2B precursor	444										skin(1)	1	all_hematologic(112;0.156)		BRCA - Breast invasive adenocarcinoma(70;0.0172)			CATAGCTTCCATCAATGCCTC	0.632													22	202	---	---	---	---	PASS
DUSP27	92235	broad.mit.edu	37	1	167086653	167086653	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:167086653C>T	uc001geb.1	+	3	294	c.294C>T	c.(292-294)AAC>AAT	p.N98N		NM_001080426	NP_001073895	Q5VZP5	DUS27_HUMAN	dual specificity phosphatase 27	98					protein dephosphorylation		protein tyrosine/serine/threonine phosphatase activity			ovary(3)	3						ACCTGTACAACCGCGTCAGGG	0.597													15	8	---	---	---	---	PASS
DUSP27	92235	broad.mit.edu	37	1	167086707	167086707	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:167086707G>C	uc001geb.1	+	3	348	c.348G>C	c.(346-348)CTG>CTC	p.L116L		NM_001080426	NP_001073895	Q5VZP5	DUS27_HUMAN	dual specificity phosphatase 27	116					protein dephosphorylation		protein tyrosine/serine/threonine phosphatase activity			ovary(3)	3						CCTGTGTCCTGGACCTACAGC	0.572													15	18	---	---	---	---	PASS
NME7	29922	broad.mit.edu	37	1	169204413	169204413	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169204413C>G	uc001gfu.2	-	9	1082	c.844G>C	c.(844-846)GAG>CAG	p.E282Q	NME7_uc010plq.1_RNA|NME7_uc001gft.2_Missense_Mutation_p.E246Q	NM_013330	NP_037462	Q9Y5B8	NDK7_HUMAN	nucleoside diphosphate kinase 7 isoform a	282					CTP biosynthetic process|GTP biosynthetic process|UTP biosynthetic process	centrosome	ATP binding|metal ion binding|nucleoside diphosphate kinase activity			central_nervous_system(1)	1	all_hematologic(923;0.208)					TAGAATTCCTCAACATTAACC	0.254													6	71	---	---	---	---	PASS
NME7	29922	broad.mit.edu	37	1	169267888	169267888	+	Missense_Mutation	SNP	C	T	T	rs139755731		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169267888C>T	uc001gfu.2	-	6	792	c.554G>A	c.(553-555)CGC>CAC	p.R185H	NME7_uc010plq.1_RNA|NME7_uc001gft.2_Missense_Mutation_p.R149H|NME7_uc001gfv.1_Missense_Mutation_p.R185H	NM_013330	NP_037462	Q9Y5B8	NDK7_HUMAN	nucleoside diphosphate kinase 7 isoform a	185					CTP biosynthetic process|GTP biosynthetic process|UTP biosynthetic process	centrosome	ATP binding|metal ion binding|nucleoside diphosphate kinase activity			central_nervous_system(1)	1	all_hematologic(923;0.208)					AGCATCTGTGCGTGCCACTCC	0.453													155	117	---	---	---	---	PASS
F5	2153	broad.mit.edu	37	1	169551757	169551757	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169551757C>G	uc001ggg.1	-	2	307	c.162G>C	c.(160-162)TTG>TTC	p.L54F	F5_uc010plr.1_Intron	NM_000130	NP_000121	P12259	FA5_HUMAN	coagulation factor V precursor	54	F5/8 type A 1.|Plastocyanin-like 1.				cell adhesion|platelet activation|platelet degranulation	plasma membrane|platelet alpha granule lumen	copper ion binding|oxidoreductase activity			ovary(3)|large_intestine(1)|central_nervous_system(1)|skin(1)	6	all_hematologic(923;0.208)				Drotrecogin alfa(DB00055)	CAGAAAGATTCAAACTGGAAA	0.289													4	97	---	---	---	---	PASS
SELP	6403	broad.mit.edu	37	1	169576241	169576241	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169576241C>T	uc001ggi.3	-	9	1530	c.1465G>A	c.(1465-1467)GTG>ATG	p.V489M	SELP_uc001ggh.2_Missense_Mutation_p.V324M|SELP_uc009wvr.2_Missense_Mutation_p.V489M	NM_003005	NP_002996	P16109	LYAM3_HUMAN	selectin P precursor	489	Extracellular (Potential).|Sushi 5.				platelet activation|platelet degranulation|positive regulation of platelet activation	external side of plasma membrane|extracellular space|integral to plasma membrane|membrane fraction|platelet alpha granule membrane|platelet dense granule membrane|soluble fraction	fucose binding|glycosphingolipid binding|heparin binding|lipopolysaccharide binding|oligosaccharide binding|sialic acid binding			ovary(2)|skin(2)	4	all_hematologic(923;0.208)				Clopidogrel(DB00758)|Heparin(DB01109)|Tirofiban(DB00775)	CACTGTAGCACACTTGCTCCC	0.502													85	93	---	---	---	---	PASS
SELL	6402	broad.mit.edu	37	1	169672451	169672451	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169672451C>G	uc001ggk.2	-	6	1095	c.897G>C	c.(895-897)AAG>AAC	p.K299N	C1orf112_uc001ggj.2_Intron|SELL_uc010pls.1_Missense_Mutation_p.K252N|SELL_uc001ggl.1_Missense_Mutation_p.K312N	NM_000655	NP_000646	P14151	LYAM1_HUMAN	selectin L precursor	299	Extracellular (Potential).|Sushi 2.				blood coagulation|cell adhesion|leukocyte migration|regulation of immune response	integral to plasma membrane	glycosphingolipid binding|heparin binding|protease binding|sugar binding				0	all_hematologic(923;0.208)					AAATGGTTTTCTTCTTCCCAA	0.423													59	45	---	---	---	---	PASS
BAT2L2	23215	broad.mit.edu	37	1	171504701	171504701	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:171504701C>T	uc010pmg.1	+	13	2268	c.2002C>T	c.(2002-2004)CAG>TAG	p.Q668*		NM_015172	NP_055987	Q9Y520	PRC2C_HUMAN	HBxAg transactivated protein 2	668	Gln-rich.						protein C-terminus binding				0						CAAACAGTTTCAGAAGTCTTT	0.433													16	427	---	---	---	---	PASS
DARS2	55157	broad.mit.edu	37	1	173814391	173814391	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173814391G>A	uc001gjh.1	+	12	1563	c.1153G>A	c.(1153-1155)GAA>AAA	p.E385K		NM_018122	NP_060592	Q6PI48	SYDM_HUMAN	aspartyl-tRNA synthetase 2, mitochondrial	385					tRNA aminoacylation for protein translation	mitochondrial matrix|nucleus	aspartate-tRNA ligase activity|ATP binding|nucleic acid binding			central_nervous_system(2)	2					L-Aspartic Acid(DB00128)	GAAAGACATTGAATCCATTAG	0.289													75	117	---	---	---	---	PASS
PAPPA2	60676	broad.mit.edu	37	1	176659276	176659276	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:176659276G>T	uc001gkz.2	+	5	3305	c.2141G>T	c.(2140-2142)GGC>GTC	p.G714V	PAPPA2_uc001gky.1_Missense_Mutation_p.G714V|PAPPA2_uc009www.2_RNA	NM_020318	NP_064714	Q9BXP8	PAPP2_HUMAN	pappalysin 2 isoform 1	714	Metalloprotease.				cell differentiation|proteolysis|regulation of cell growth	extracellular region|intracellular|membrane	metalloendopeptidase activity|zinc ion binding			ovary(7)|central_nervous_system(5)|skin(2)|lung(1)|breast(1)	16						ATTGCAGGTGGCATTGTCCTC	0.418													27	255	---	---	---	---	PASS
PAPPA2	60676	broad.mit.edu	37	1	176762710	176762710	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:176762710C>G	uc001gkz.2	+	20	6199	c.5035C>G	c.(5035-5037)CCA>GCA	p.P1679A	PAPPA2_uc009www.2_RNA	NM_020318	NP_064714	Q9BXP8	PAPP2_HUMAN	pappalysin 2 isoform 1	1679	Sushi 5.				cell differentiation|proteolysis|regulation of cell growth	extracellular region|intracellular|membrane	metalloendopeptidase activity|zinc ion binding			ovary(7)|central_nervous_system(5)|skin(2)|lung(1)|breast(1)	16						AGTGTGTTCCCCATTGTGTGT	0.458													9	159	---	---	---	---	PASS
ASTN1	460	broad.mit.edu	37	1	176915110	176915110	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:176915110T>C	uc001glc.2	-	13	2413	c.2201A>G	c.(2200-2202)AAC>AGC	p.N734S	ASTN1_uc001glb.1_Missense_Mutation_p.N734S|ASTN1_uc001gld.1_Missense_Mutation_p.N734S|ASTN1_uc009wwx.1_Missense_Mutation_p.N734S	NM_004319	NP_004310	O14525	ASTN1_HUMAN	astrotactin isoform 1	742					cell migration|neuron cell-cell adhesion	integral to membrane				ovary(6)|skin(5)|central_nervous_system(2)|large_intestine(1)|lung(1)	15						CTTGGAATGGTTGTTGTAACC	0.488													11	300	---	---	---	---	PASS
C1orf125	126859	broad.mit.edu	37	1	179380370	179380370	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:179380370G>C	uc001gmo.2	+	12	1326	c.1199G>C	c.(1198-1200)TGG>TCG	p.W400S	C1orf125_uc009wxg.2_RNA|C1orf125_uc001gmn.1_Missense_Mutation_p.W188S|C1orf125_uc010pnl.1_RNA|C1orf125_uc001gmp.2_Missense_Mutation_p.W400S	NM_144696	NP_653297	Q5T1B0	AXDN1_HUMAN	hypothetical protein LOC126859 isoform 1	400	Potential.										0						AGAGATATCTGGAGCTCAGCC	0.328													32	104	---	---	---	---	PASS
LAMC1	3915	broad.mit.edu	37	1	183105618	183105618	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183105618G>C	uc001gpy.3	+	25	4469	c.4212G>C	c.(4210-4212)AAG>AAC	p.K1404N		NM_002293	NP_002284	P11047	LAMC1_HUMAN	laminin, gamma 1 precursor	1404	Potential.|Domain II and I.				axon guidance|cell migration|endoderm development|extracellular matrix disassembly|hemidesmosome assembly|positive regulation of epithelial cell proliferation|protein complex assembly|substrate adhesion-dependent cell spreading	extracellular space|laminin-1 complex|laminin-10 complex|laminin-11 complex	extracellular matrix structural constituent			ovary(3)|large_intestine(1)|kidney(1)	5					Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)	CCAATGAAAAGACCAGAGAAG	0.567													20	48	---	---	---	---	PASS
EDEM3	80267	broad.mit.edu	37	1	184690474	184690474	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:184690474C>A	uc010pok.1	-	9	1161	c.900G>T	c.(898-900)TTG>TTT	p.L300F	EDEM3_uc010pol.1_RNA|EDEM3_uc010pom.1_Missense_Mutation_p.L300F|EDEM3_uc001gqy.2_Missense_Mutation_p.L223F	NM_025191	NP_079467	Q9BZQ6	EDEM3_HUMAN	ER degradation enhancer, mannosidase alpha-like	300					post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine|response to unfolded protein	endoplasmic reticulum lumen|endoplasmic reticulum membrane	calcium ion binding|mannosyl-oligosaccharide 1,2-alpha-mannosidase activity|misfolded protein binding			skin(1)	1						CATAGGCTTTCAACAGATATT	0.279													33	95	---	---	---	---	PASS
HMCN1	83872	broad.mit.edu	37	1	186086122	186086122	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186086122C>A	uc001grq.1	+							NM_031935	NP_114141	Q96RW7	HMCN1_HUMAN	hemicentin 1 precursor						response to stimulus|visual perception	basement membrane	calcium ion binding			ovary(22)|skin(1)	23						AATGTGTCTTCTAGGCTCCTT	0.368													52	196	---	---	---	---	PASS
HMCN1	83872	broad.mit.edu	37	1	186143736	186143736	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186143736G>C	uc001grq.1	+	103	16134	c.15905G>C	c.(15904-15906)AGA>ACA	p.R5302T	HMCN1_uc001grs.1_Missense_Mutation_p.R871T	NM_031935	NP_114141	Q96RW7	HMCN1_HUMAN	hemicentin 1 precursor	5302	EGF-like 5; calcium-binding (Potential).				response to stimulus|visual perception	basement membrane	calcium ion binding			ovary(22)|skin(1)	23						GTATGCCCAAGAGGTTATCGG	0.418													47	100	---	---	---	---	PASS
TPR	7175	broad.mit.edu	37	1	186305729	186305729	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186305729C>G	uc001grv.2	-	33	4901	c.4604G>C	c.(4603-4605)AGA>ACA	p.R1535T		NM_003292	NP_003283	P12270	TPR_HUMAN	nuclear pore complex-associated protein TPR	1535	Potential.				carbohydrate metabolic process|glucose transport|mitotic cell cycle spindle assembly checkpoint|mRNA transport|protein import into nucleus|regulation of glucose transport|seryl-tRNA aminoacylation|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytoplasm|nuclear membrane|nuclear pore|nucleoplasm	ATP binding|protein binding|serine-tRNA ligase activity			ovary(2)|lung(2)|urinary_tract(1)|central_nervous_system(1)|skin(1)	7		Breast(1374;0.000659)|Lung SC(1967;0.0262)|Prostate(1639;0.157)		Colorectal(1306;1.12e-05)|KIRC - Kidney renal clear cell carcinoma(1967;0.00553)		CTGTGTGGTTCTATCTTGAAG	0.413			T	NTRK1	papillary thyroid								6	210	---	---	---	---	PASS
B3GALT2	8707	broad.mit.edu	37	1	193150056	193150056	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:193150056G>C	uc001gtc.3	-	2	1352	c.637C>G	c.(637-639)CAT>GAT	p.H213D	CDC73_uc001gtb.2_Intron	NM_003783	NP_003774	O43825	B3GT2_HUMAN	UDP-Gal:betaGlcNAc beta	213	Lumenal (Potential).				protein glycosylation	Golgi membrane|integral to membrane	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity			ovary(1)	1						ATTATATCATGATATTGTCTG	0.353													58	162	---	---	---	---	PASS
CFHR5	81494	broad.mit.edu	37	1	196963300	196963300	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:196963300C>A	uc001gts.3	+	4	649	c.521C>A	c.(520-522)TCC>TAC	p.S174Y		NM_030787	NP_110414	Q9BXR6	FHR5_HUMAN	complement factor H-related 5 precursor	174	Sushi 3.				complement activation, alternative pathway	extracellular region				breast(1)|skin(1)	2						TTGAAATTCTCCTGCAGAAAA	0.353													75	213	---	---	---	---	PASS
ZBTB41	360023	broad.mit.edu	37	1	197150130	197150130	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:197150130G>A	uc001gtx.1	-	5	1733	c.1664C>T	c.(1663-1665)TCA>TTA	p.S555L	ZBTB41_uc009wyz.1_RNA	NM_194314	NP_919290	Q5SVQ8	ZBT41_HUMAN	zinc finger and BTB domain containing 41	555	C2H2-type 8.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|skin(1)	2						TTCTCGTACTGATTTTCCACA	0.343													40	159	---	---	---	---	PASS
ZBTB41	360023	broad.mit.edu	37	1	197169465	197169465	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:197169465C>T	uc001gtx.1	-	1	208	c.139G>A	c.(139-141)GCT>ACT	p.A47T	ZBTB41_uc009wyz.1_RNA|CRB1_uc010poz.1_5'Flank	NM_194314	NP_919290	Q5SVQ8	ZBT41_HUMAN	zinc finger and BTB domain containing 41	47					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|skin(1)	2						CAGTGAAGAGCTTCAGGAGTT	0.388													5	208	---	---	---	---	PASS
CRB1	23418	broad.mit.edu	37	1	197396927	197396927	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:197396927C>G	uc001gtz.2	+	7	2607	c.2472C>G	c.(2470-2472)ATC>ATG	p.I824M	CRB1_uc010poz.1_Missense_Mutation_p.I755M|CRB1_uc010ppa.1_RNA|CRB1_uc009wza.2_Missense_Mutation_p.I712M|CRB1_uc010ppb.1_Intron|CRB1_uc010ppc.1_RNA|CRB1_uc010ppd.1_Missense_Mutation_p.I305M|CRB1_uc001gub.1_Missense_Mutation_p.I473M	NM_201253	NP_957705	P82279	CRUM1_HUMAN	crumbs homolog 1 precursor	824	Extracellular (Potential).|Laminin G-like 2.				cell-cell signaling|establishment or maintenance of cell polarity	apical plasma membrane|extracellular region|integral to membrane	calcium ion binding|protein binding			ovary(5)|skin(3)|large_intestine(1)	9						CGTGGAAAATCGAAAAGGGAG	0.373													21	86	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202701006	202701006	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202701006G>A	uc001gyf.2	-	24	4087	c.3971C>T	c.(3970-3972)TCA>TTA	p.S1324L	KDM5B_uc009xag.2_Missense_Mutation_p.S1360L|KDM5B_uc001gyg.1_Missense_Mutation_p.S1166L	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	1324					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						GTGCAAATATGAGGTTCTGTT	0.418													49	125	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202702639	202702639	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202702639G>A	uc001gyf.2	-	23	3915	c.3799C>T	c.(3799-3801)CAG>TAG	p.Q1267*	KDM5B_uc009xag.2_Nonsense_Mutation_p.Q1303*|KDM5B_uc001gyg.1_Nonsense_Mutation_p.Q1109*	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	1267					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						AGCAGTTGCTGGGCTCTGTGC	0.522													70	144	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202702640	202702640	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202702640G>A	uc001gyf.2	-	23	3914	c.3798C>T	c.(3796-3798)GCC>GCT	p.A1266A	KDM5B_uc009xag.2_Silent_p.A1302A|KDM5B_uc001gyg.1_Silent_p.A1108A	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	1266					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						GCAGTTGCTGGGCTCTGTGCT	0.522													71	140	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202703017	202703017	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202703017G>A	uc001gyf.2	-						KDM5B_uc009xag.2_Intron|KDM5B_uc001gyg.1_Intron	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B						negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						GTTGCCATCTGAAAAAGAGTT	0.408													86	230	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202704571	202704571	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202704571C>G	uc001gyf.2	-	22	3525	c.3409G>C	c.(3409-3411)GAG>CAG	p.E1137Q	KDM5B_uc009xag.2_Missense_Mutation_p.E1173Q|KDM5B_uc001gyg.1_Missense_Mutation_p.E979Q	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	1137					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						GAAGCAGTCTCCTTGCTTTCA	0.388													73	186	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202709841	202709841	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202709841C>G	uc001gyf.2	-	20	3161	c.3045G>C	c.(3043-3045)CAG>CAC	p.Q1015H	KDM5B_uc009xag.2_Missense_Mutation_p.Q1051H|KDM5B_uc001gyg.1_Missense_Mutation_p.Q857H	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	1015					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						CTCTGGCTCTCTGCACTGAGT	0.458													48	101	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202715077	202715077	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202715077C>T	uc001gyf.2	-	16	2348	c.2232G>A	c.(2230-2232)ATG>ATA	p.M744I	KDM5B_uc009xag.2_Missense_Mutation_p.M780I|KDM5B_uc001gyg.1_Missense_Mutation_p.M586I	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	744					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						ATGCATTCATCATAGGGTAGA	0.398													125	302	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202729662	202729662	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202729662C>T	uc001gyf.2	-	8	1074	c.958G>A	c.(958-960)GAT>AAT	p.D320N	KDM5B_uc009xag.2_Missense_Mutation_p.D356N|KDM5B_uc001gyg.1_Missense_Mutation_p.D162N	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	320	PHD-type 1.				negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						CGGTCTTCATCATTGCCACTG	0.438													30	64	---	---	---	---	PASS
AVPR1B	553	broad.mit.edu	37	1	206224942	206224942	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206224942C>T	uc001hds.2	+	1	660	c.502C>T	c.(502-504)CAA>TAA	p.Q168*		NM_000707	NP_000698	P47901	V1BR_HUMAN	arginine vasopressin receptor 1B	168	Helical; Name=4; (Potential).				activation of phospholipase C activity|elevation of cytosolic calcium ion concentration	endosome|integral to plasma membrane	protein kinase C binding|vasopressin receptor activity			ovary(2)|large_intestine(1)	3			BRCA - Breast invasive adenocarcinoma(75;0.0312)		Desmopressin(DB00035)|Terlipressin(DB02638)|Vasopressin(DB00067)	CAGCCTCCCTCAAGTCTTCAT	0.652													37	76	---	---	---	---	PASS
C1orf107	27042	broad.mit.edu	37	1	210012483	210012483	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:210012483C>T	uc001hhr.1	+						C1orf107_uc009xcu.1_Intron	NM_014388	NP_055203	Q68CQ4	DIEXF_HUMAN	digestive-organ expansion factor homolog						multicellular organismal development	nucleus					0				OV - Ovarian serous cystadenocarcinoma(81;0.0367)		GGTAATTCTTCCTTATCAACT	0.443													16	69	---	---	---	---	PASS
KCNH1	3756	broad.mit.edu	37	1	211256146	211256146	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:211256146G>T	uc001hib.2	-	5	704	c.534C>A	c.(532-534)GTC>GTA	p.V178V	KCNH1_uc001hic.2_Silent_p.V178V	NM_172362	NP_758872	O95259	KCNH1_HUMAN	potassium voltage-gated channel, subfamily H,	178	Cytoplasmic (Potential).				myoblast fusion|regulation of transcription, DNA-dependent	voltage-gated potassium channel complex	calmodulin binding|delayed rectifier potassium channel activity|two-component sensor activity			ovary(4)|central_nervous_system(1)	5				OV - Ovarian serous cystadenocarcinoma(81;0.0109)|all cancers(67;0.141)|Epithelial(68;0.185)		AGTGCTTGTGGACATTCTCGC	0.562													64	118	---	---	---	---	PASS
CENPF	1063	broad.mit.edu	37	1	214787149	214787149	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:214787149C>T	uc001hkm.2	+	2	226	c.52C>T	c.(52-54)CAG>TAG	p.Q18*		NM_016343	NP_057427	P49454	CENPF_HUMAN	centromere protein F	18	Interaction with SNAP25 and required for localization to the cytoplasm (By similarity).|Potential.				cell differentiation|cell division|cell proliferation|DNA replication|G2 phase of mitotic cell cycle|kinetochore assembly|metaphase plate congression|mitotic cell cycle spindle assembly checkpoint|mitotic prometaphase|muscle organ development|negative regulation of transcription, DNA-dependent|protein transport|regulation of G2/M transition of mitotic cell cycle|regulation of striated muscle tissue development|response to drug	condensed chromosome outer kinetochore|cytosol|midbody|nuclear envelope|nuclear matrix|perinuclear region of cytoplasm|spindle pole	chromatin binding|dynein binding|protein C-terminus binding|protein homodimerization activity|transcription factor binding			ovary(6)|central_nervous_system(4)|large_intestine(2)|skin(1)	13				all cancers(67;0.00836)|OV - Ovarian serous cystadenocarcinoma(81;0.00855)|GBM - Glioblastoma multiforme(131;0.0694)|Epithelial(68;0.0833)		AAGAGCTCTTCAGAAAATTCA	0.433													46	122	---	---	---	---	PASS
USH2A	7399	broad.mit.edu	37	1	216420010	216420010	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216420010G>T	uc001hku.1	-	13	3113	c.2726C>A	c.(2725-2727)CCT>CAT	p.P909H	USH2A_uc001hkv.2_Missense_Mutation_p.P909H	NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	909	Laminin EGF-like 8.|Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)		AATGGTCCCAGGTAATGTCCC	0.458										HNSCC(13;0.011)			92	230	---	---	---	---	PASS
TGFB2	7042	broad.mit.edu	37	1	218614660	218614660	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:218614660G>C	uc001hlm.2	+	7	1854	c.1201G>C	c.(1201-1203)GAA>CAA	p.E401Q	TGFB2_uc001hln.2_Missense_Mutation_p.E429Q|TGFB2_uc010pue.1_RNA|TGFB2_uc001hlo.2_RNA	NM_003238	NP_003229	P61812	TGFB2_HUMAN	transforming growth factor, beta 2 isoform 2	401					activation of protein kinase activity|angiogenesis|cardiac epithelial to mesenchymal transition|cardiac muscle cell proliferation|cardioblast differentiation|catagen|cell cycle arrest|cell death|cell growth|cell-cell junction organization|cell-cell signaling|collagen fibril organization|dopamine biosynthetic process|embryonic digestive tract development|eye development|glial cell migration|hair follicle morphogenesis|hemopoiesis|menstrual cycle phase|negative regulation of alkaline phosphatase activity|negative regulation of cell growth|negative regulation of epithelial cell proliferation|negative regulation of immune response|negative regulation of macrophage cytokine production|neuron development|neutrophil chemotaxis|odontogenesis|pathway-restricted SMAD protein phosphorylation|platelet activation|platelet degranulation|positive regulation of cardioblast differentiation|positive regulation of catagen|positive regulation of cell adhesion mediated by integrin|positive regulation of cell cycle|positive regulation of cell division|positive regulation of cell growth|positive regulation of cell proliferation|positive regulation of epithelial cell migration|positive regulation of epithelial to mesenchymal transition|positive regulation of heart contraction|positive regulation of immune response|positive regulation of integrin biosynthetic process|positive regulation of neuron apoptosis|positive regulation of ossification|positive regulation of phosphatidylinositol 3-kinase cascade|positive regulation of protein secretion|positive regulation of stress-activated MAPK cascade|regulation of transforming growth factor-beta2 production|response to hypoxia|response to progesterone stimulus|salivary gland morphogenesis|SMAD protein import into nucleus|somatic stem cell division|transforming growth factor beta receptor signaling pathway	axon|extracellular matrix|extracellular space|neuronal cell body|platelet alpha granule lumen	beta-amyloid binding|cytokine activity|growth factor activity|protein heterodimerization activity|protein homodimerization activity|receptor signaling protein serine/threonine kinase activity|type II transforming growth factor beta receptor binding				0				all cancers(67;0.0459)|OV - Ovarian serous cystadenocarcinoma(81;0.049)|GBM - Glioblastoma multiforme(131;0.0776)		ACCCAAGATTGAACAGCTTTC	0.328													43	140	---	---	---	---	PASS
TAF1A	9015	broad.mit.edu	37	1	222761894	222761894	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222761894G>C	uc009xdz.1	-	2	201	c.12C>G	c.(10-12)TTC>TTG	p.F4L	TAF1A_uc001hni.1_5'UTR|TAF1A_uc001hnj.2_Missense_Mutation_p.F4L|TAF1A_uc001hnk.2_5'UTR|TAF1A_uc010pur.1_Missense_Mutation_p.F4L	NM_139352	NP_647603	Q15573	TAF1A_HUMAN	TBP-associated factor 1A isoform 2	4					regulation of transcription, DNA-dependent|termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase I promoter	RNA polymerase I transcription factor complex	DNA binding				0				GBM - Glioblastoma multiforme(131;0.0186)		ATTCTTCACTGAAATCACTCA	0.383													4	292	---	---	---	---	PASS
MIA3	375056	broad.mit.edu	37	1	222801268	222801268	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222801268G>A	uc001hnl.2	+	4	715	c.706G>A	c.(706-708)GAT>AAT	p.D236N	MIA3_uc009xea.1_Missense_Mutation_p.D72N	NM_198551	NP_940953	Q5JRA6	MIA3_HUMAN	melanoma inhibitory activity family, member 3	236	Extracellular (Potential).				exocytosis|negative regulation of cell adhesion|negative regulation of cell migration|positive regulation of leukocyte migration|protein transport|wound healing	endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(4)|central_nervous_system(1)	5				GBM - Glioblastoma multiforme(131;0.0199)		AATGCTGCAAGATAAACTAAA	0.383													31	80	---	---	---	---	PASS
LBR	3930	broad.mit.edu	37	1	225597990	225597990	+	Intron	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:225597990T>A	uc001hoy.2	-						LBR_uc001hoz.2_Intron|LBR_uc001hpa.1_Intron	NM_002296	NP_002287	Q14739	LBR_HUMAN	lamin B receptor						cholesterol biosynthetic process	integral to nuclear inner membrane	chromo shadow domain binding|delta14-sterol reductase activity|DNA binding|lamin binding|receptor activity			ovary(1)|skin(1)	2	Breast(184;0.165)			GBM - Glioblastoma multiforme(131;0.117)		TAAAATTAATTACCTCATTCC	0.478													79	142	---	---	---	---	PASS
OBSCN	84033	broad.mit.edu	37	1	228401979	228401979	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228401979C>A	uc009xez.1	+	4	1407	c.1363C>A	c.(1363-1365)CGG>AGG	p.R455R	OBSCN_uc001hsn.2_Silent_p.R455R|uc001hsm.1_5'Flank	NM_001098623	NP_001092093	Q5VST9	OBSCN_HUMAN	obscurin, cytoskeletal calmodulin and	455	Ig-like 5.				apoptosis|cell differentiation|induction of apoptosis by extracellular signals|multicellular organismal development|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|M band|Z disc	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity|Rho guanyl-nucleotide exchange factor activity|structural constituent of muscle|titin binding			stomach(8)|large_intestine(7)|breast(5)|ovary(4)|skin(2)|central_nervous_system(1)|pancreas(1)	28		Prostate(94;0.0405)				CCACTGGCTGCGGAACCAGGA	0.697													16	47	---	---	---	---	PASS
TRIM17	51127	broad.mit.edu	37	1	228596932	228596932	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228596932G>T	uc001hsu.2	-	6	1209	c.824C>A	c.(823-825)ACC>AAC	p.T275N	TRIM11_uc001hss.2_5'Flank|TRIM11_uc010pvx.1_5'Flank|TRIM11_uc001hst.1_5'Flank|TRIM17_uc001hsv.2_Missense_Mutation_p.T275N|TRIM17_uc001hsw.2_Missense_Mutation_p.T248N|TRIM17_uc009xfb.2_Missense_Mutation_p.T275N	NM_016102	NP_057186	Q9Y577	TRI17_HUMAN	tripartite motif-containing 17 isoform 1	275					protein autoubiquitination	intracellular	protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1		Prostate(94;0.0724)				CCTGGGTCTGGTTGGGGGGGC	0.582													67	218	---	---	---	---	PASS
DISC1	27185	broad.mit.edu	37	1	232172460	232172460	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:232172460G>C	uc001huz.2	+	13	2501	c.2448G>C	c.(2446-2448)CAG>CAC	p.Q816H	DISC1_uc001hva.2_Missense_Mutation_p.Q794H	NM_018662	NP_061132	Q9NRI5	DISC1_HUMAN	disrupted in schizophrenia 1 isoform L	816	Necessary and sufficient for interaction with PCNT and localization at the centrosome.|Interaction with NDEL1.|Interaction with ATF4 and ATF5.|Interaction with PAFAH1B1.|Potential.				microtubule cytoskeleton organization|neuron migration|positive regulation of neuroblast proliferation|positive regulation of Wnt receptor signaling pathway|Wnt receptor signaling pathway	centrosome|microtubule	protein binding			skin(1)	1		all_cancers(173;0.0208)|Prostate(94;0.0975)				GGGAGCTCCAGATGGTGAAGG	0.582													15	32	---	---	---	---	PASS
ARID4B	51742	broad.mit.edu	37	1	235383098	235383098	+	Intron	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:235383098A>G	uc001hwq.2	-						ARID4B_uc001hwr.2_Intron|ARID4B_uc001hws.3_Intron|ARID4B_uc001hwt.3_Intron	NM_016374	NP_057458	Q4LE39	ARI4B_HUMAN	AT rich interactive domain 4B isoform 1						regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|protein binding			ovary(2)|lung(1)	3	Ovarian(103;0.0473)|Breast(184;0.23)	all_cancers(173;0.000782)|Prostate(94;0.0132)|all_epithelial(177;0.0808)|Lung SC(1967;0.24)	OV - Ovarian serous cystadenocarcinoma(106;2.86e-05)			ACCAAAAACAATTTTCTTACC	0.313													61	196	---	---	---	---	PASS
LYST	1130	broad.mit.edu	37	1	235944340	235944340	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:235944340G>C	uc001hxj.2	-	16	5214	c.5039C>G	c.(5038-5040)TCA>TGA	p.S1680*	LYST_uc009xgb.1_RNA|LYST_uc010pxs.1_RNA	NM_000081	NP_000072	Q99698	LYST_HUMAN	lysosomal trafficking regulator	1680					defense response to bacterium|defense response to protozoan|defense response to virus|endosome to lysosome transport via multivesicular body sorting pathway|leukocyte chemotaxis|mast cell secretory granule organization|melanosome organization|natural killer cell mediated cytotoxicity|protein transport	cytoplasm|microtubule cytoskeleton	protein binding			ovary(6)|breast(4)|central_nervous_system(2)	12	Ovarian(103;0.0634)|Breast(184;0.23)	all_cancers(173;0.00246)|Prostate(94;0.0771)|Acute lymphoblastic leukemia(190;0.228)	OV - Ovarian serous cystadenocarcinoma(106;0.000674)			GGCCTCTTGTGAACCAACCTT	0.343									Chediak-Higashi_syndrome				23	66	---	---	---	---	PASS
RYR2	6262	broad.mit.edu	37	1	237780608	237780608	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237780608T>A	uc001hyl.1	+	38	5858	c.5738T>A	c.(5737-5739)CTC>CAC	p.L1913H		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	1913	Cytoplasmic (By similarity).|4 X approximate repeats.				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)			CTTCAGTACCTCTGTGACTGC	0.378													7	27	---	---	---	---	PASS
GREM2	64388	broad.mit.edu	37	1	240656472	240656472	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:240656472T>G	uc001hys.2	-	2	584	c.304A>C	c.(304-306)AAC>CAC	p.N102H		NM_022469	NP_071914	Q9H772	GREM2_HUMAN	gremlin 2 precursor	102	CTCK.				BMP signaling pathway	extracellular space	cytokine activity				0		all_cancers(173;0.0196)	OV - Ovarian serous cystadenocarcinoma(106;0.0123)			TAGAAGGAGTTGCACTGGCCG	0.647													12	73	---	---	---	---	PASS
OPN3	23596	broad.mit.edu	37	1	241767865	241767865	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:241767865G>C	uc001hza.2	-	2	535	c.390C>G	c.(388-390)GCC>GCG	p.A130A	OPN3_uc001hzb.2_RNA|OPN3_uc001hzc.2_Intron	NM_014322	NP_055137	Q9H1Y3	OPN3_HUMAN	opsin 3	130	Helical; Name=3; (Potential).				phototransduction|protein-chromophore linkage|regulation of circadian rhythm|visual perception	integral to plasma membrane	G-protein coupled photoreceptor activity				0	Ovarian(103;0.103)|all_lung(81;0.23)	all_cancers(173;0.0231)	OV - Ovarian serous cystadenocarcinoma(106;0.0125)			CGGTTAGGGTGGCAATGGAAA	0.498													9	38	---	---	---	---	PASS
C1orf100	200159	broad.mit.edu	37	1	244538705	244538705	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:244538705C>G	uc001iah.2	+	3	201	c.88C>G	c.(88-90)CAA>GAA	p.Q30E	C1orf100_uc001iai.2_Missense_Mutation_p.Q30E	NM_001012970	NP_001012988	Q5SVJ3	CA100_HUMAN	hypothetical protein LOC200159	30											0	all_cancers(71;3.94e-05)|all_epithelial(71;0.000138)|all_neural(11;0.0269)|Breast(184;0.0654)|Glioma(6;0.0724)|all_lung(81;0.0736)|Ovarian(71;0.0761)|Lung NSC(105;0.103)		all cancers(7;8.19e-08)|GBM - Glioblastoma multiforme(7;2.05e-05)|OV - Ovarian serous cystadenocarcinoma(106;0.000984)			AAGAGACGTTCAAGGCTATTA	0.458													32	117	---	---	---	---	PASS
NLRP3	114548	broad.mit.edu	37	1	247592978	247592978	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247592978G>T	uc001icr.2	+	6	2386	c.2248G>T	c.(2248-2250)GAC>TAC	p.D750Y	NLRP3_uc001ics.2_Missense_Mutation_p.D750Y|NLRP3_uc001icu.2_Missense_Mutation_p.D750Y|NLRP3_uc001icw.2_Intron|NLRP3_uc001icv.2_Intron|NLRP3_uc010pyw.1_Missense_Mutation_p.D748Y	NM_001079821	NP_001073289	Q96P20	NALP3_HUMAN	NLR family, pyrin domain containing 3 isoform a	750	LRR 1.				detection of biotic stimulus|induction of apoptosis|inflammatory response|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|positive regulation of interleukin-1 beta secretion|protein oligomerization|signal transduction	cytoplasm	ATP binding|peptidoglycan binding|protein binding			lung(8)|skin(8)|ovary(7)|upper_aerodigestive_tract(1)|breast(1)|pancreas(1)	26	all_cancers(71;9.66e-05)|all_epithelial(71;1.85e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)	all_cancers(173;0.0172)	OV - Ovarian serous cystadenocarcinoma(106;0.0141)			GGACCTCAGTGACAATTCTCT	0.512													12	171	---	---	---	---	PASS
OR2G2	81470	broad.mit.edu	37	1	247752339	247752339	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247752339C>T	uc010pyy.1	+	1	678	c.678C>T	c.(676-678)CAC>CAT	p.H226H		NM_001001915	NP_001001915	Q8NGZ5	OR2G2_HUMAN	olfactory receptor, family 2, subfamily G,	226	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(71;3.24e-05)|all_epithelial(71;1.3e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)		OV - Ovarian serous cystadenocarcinoma(106;0.017)			ACATTGCCCACGCAGTGTTGA	0.423													52	132	---	---	---	---	PASS
OR6F1	343169	broad.mit.edu	37	1	247875190	247875190	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247875190A>T	uc001idj.1	-	1	868	c.868T>A	c.(868-870)TAT>AAT	p.Y290N		NM_001005286	NP_001005286	Q8NGZ6	OR6F1_HUMAN	olfactory receptor, family 6, subfamily F,	290	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(71;3.24e-05)|all_epithelial(71;1.3e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)		OV - Ovarian serous cystadenocarcinoma(106;0.0168)			CGAAGCGTATAGATGAAGGGG	0.443													68	172	---	---	---	---	PASS
OR2G6	391211	broad.mit.edu	37	1	248685476	248685476	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248685476A>T	uc001ien.1	+	1	529	c.529A>T	c.(529-531)ATT>TTT	p.I177F		NM_001013355	NP_001013373	Q5TZ20	OR2G6_HUMAN	olfactory receptor, family 2, subfamily G,	177	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(1)	3	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)	all_cancers(173;0.0156)	OV - Ovarian serous cystadenocarcinoma(106;0.0265)			ACTGGATCATATTTTCTGTGA	0.537													35	90	---	---	---	---	PASS
OR2T29	343563	broad.mit.edu	37	1	248722743	248722743	+	Missense_Mutation	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248722743A>C	uc001ieo.1	-	1	32	c.32T>G	c.(31-33)ATC>AGC	p.I11S		NM_001004694	NP_001004694	Q8NH02	O2T29_HUMAN	olfactory receptor, family 2, subfamily T,	17	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)			TCCCATGAGGATGAAATCCAA	0.493													12	77	---	---	---	---	PASS
OR2T34	127068	broad.mit.edu	37	1	248737468	248737468	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248737468G>C	uc001iep.1	-	1	591	c.591C>G	c.(589-591)GTC>GTG	p.V197V		NM_001001821	NP_001001821	Q8NGX1	O2T34_HUMAN	olfactory receptor, family 2, subfamily T,	197	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(1)|ovary(1)	2	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)			TATAGAGGGAGACGTCAGAGC	0.517													57	235	---	---	---	---	PASS
OR2T27	403239	broad.mit.edu	37	1	248813379	248813379	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248813379C>A	uc010pzo.1	-	1	807	c.807G>T	c.(805-807)GAG>GAT	p.E269D		NM_001001824	NP_001001824	Q8NH04	O2T27_HUMAN	olfactory receptor, family 2, subfamily T,	269	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;1.15e-05)|all_epithelial(71;5.29e-06)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.089)|Lung NSC(105;0.0969)|Melanoma(84;0.199)	all_cancers(173;0.237)	OV - Ovarian serous cystadenocarcinoma(106;0.0265)			CTTTGTCCTGCTCAGGGGTGT	0.527													20	78	---	---	---	---	PASS
OR2T27	403239	broad.mit.edu	37	1	248814024	248814024	+	Silent	SNP	G	A	A	rs141254125		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248814024G>A	uc010pzo.1	-	1	162	c.162C>T	c.(160-162)CGC>CGT	p.R54R		NM_001001824	NP_001001824	Q8NH04	O2T27_HUMAN	olfactory receptor, family 2, subfamily T,	54	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;1.15e-05)|all_epithelial(71;5.29e-06)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.089)|Lung NSC(105;0.0969)|Melanoma(84;0.199)	all_cancers(173;0.237)	OV - Ovarian serous cystadenocarcinoma(106;0.0265)			GGGTGTGGAGGCGGGAGTCTA	0.532													5	38	---	---	---	---	PASS
TPO	7173	broad.mit.edu	37	2	1488566	1488566	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1488566G>A	uc002qww.2	+	9	1628	c.1537G>A	c.(1537-1539)GAC>AAC	p.D513N	TPO_uc010ewj.2_RNA|TPO_uc002qwu.2_Missense_Mutation_p.D513N|TPO_uc002qwr.2_Missense_Mutation_p.D513N|TPO_uc002qwx.2_Missense_Mutation_p.D513N|TPO_uc010yio.1_Missense_Mutation_p.D340N|TPO_uc010yip.1_Missense_Mutation_p.D513N|TPO_uc002qwy.1_5'UTR|TPO_uc002qwz.2_RNA	NM_000547	NP_000538	P07202	PERT_HUMAN	thyroid peroxidase isoform a	513	Extracellular (Potential).				cellular nitrogen compound metabolic process|hormone biosynthetic process|hydrogen peroxide catabolic process	cell surface|cytoplasm|integral to plasma membrane	calcium ion binding|heme binding|iodide peroxidase activity			ovary(7)|pancreas(6)|skin(5)|lung(1)|kidney(1)	20	all_hematologic(175;0.0487)|Acute lymphoblastic leukemia(172;0.0627)	all_cancers(51;0.0338)		all cancers(51;0.0356)|OV - Ovarian serous cystadenocarcinoma(76;0.0748)|Epithelial(75;0.12)	Carbimazole(DB00389)|Methimazole(DB00763)|Propylthiouracil(DB00550)	GGAGCACCCCGACCTGCCCGG	0.642													6	113	---	---	---	---	PASS
TSSC1	7260	broad.mit.edu	37	2	3217970	3217970	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:3217970C>T	uc002qxj.2	-	5	659	c.466G>A	c.(466-468)GAT>AAT	p.D156N	TSSC1_uc002qxi.2_RNA	NM_003310	NP_003301	Q53HC9	TSSC1_HUMAN	tumor suppressing subtransferable candidate 1	156	WD 1.						protein binding				0	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.093)	all_cancers(51;0.212)		OV - Ovarian serous cystadenocarcinoma(76;0.00877)|Epithelial(75;0.0283)|all cancers(51;0.0464)		ATATGGTTATCAGCCAAGGAA	0.398													80	244	---	---	---	---	PASS
ID2	3398	broad.mit.edu	37	2	8822394	8822394	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:8822394G>C	uc010yiu.1	+	3	594	c.99G>C	c.(97-99)ATG>ATC	p.M33I	ID2_uc002qza.2_Missense_Mutation_p.M33I	NM_002166	NP_002157	Q02363	ID2_HUMAN	inhibitor of DNA binding 2	33					cellular senescence|embryonic digestive tract morphogenesis|endodermal digestive tract morphogenesis|epithelial cell differentiation involved in mammary gland alveolus development|mammary gland epithelial cell proliferation|negative regulation of neural precursor cell proliferation|negative regulation of neuron differentiation|negative regulation of sequence-specific DNA binding transcription factor activity|neuron fate commitment|positive regulation of blood pressure|positive regulation of cell cycle arrest|positive regulation of smooth muscle cell proliferation|positive regulation of transcription, DNA-dependent	protein complex	protein binding				0	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)					ACGACCCGATGAGCCTGCTAT	0.562													4	134	---	---	---	---	PASS
CPSF3	51692	broad.mit.edu	37	2	9607846	9607846	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:9607846G>A	uc002qzo.1	+	16	1832	c.1797G>A	c.(1795-1797)CAG>CAA	p.Q599Q	CPSF3_uc002qzp.1_Silent_p.Q562Q|CPSF3_uc002qzq.1_Silent_p.Q176Q	NM_016207	NP_057291	Q9UKF6	CPSF3_HUMAN	cleavage and polyadenylation specific factor 3,	599					histone mRNA 3'-end processing|mRNA cleavage|mRNA export from nucleus|mRNA polyadenylation|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	mRNA cleavage and polyadenylation specificity factor complex|ribonucleoprotein complex	5'-3' exonuclease activity|endoribonuclease activity|metal ion binding|protein binding|RNA binding			breast(2)	2	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)	all_cancers(51;2.39e-25)|all_epithelial(98;8.75e-19)|Lung NSC(108;2.38e-06)|Ovarian(717;0.0308)		all cancers(51;2.2e-40)|Epithelial(75;6.71e-35)|OV - Ovarian serous cystadenocarcinoma(76;4.35e-21)|STAD - Stomach adenocarcinoma(1183;0.00644)		GTGCAGTACAGAAGGTTTCTA	0.353													4	142	---	---	---	---	PASS
GREB1	9687	broad.mit.edu	37	2	11741049	11741049	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:11741049G>A	uc002rbk.1	+	16	2757	c.2457G>A	c.(2455-2457)CCG>CCA	p.P819P	GREB1_uc002rbo.1_Silent_p.P453P	NM_014668	NP_055483	Q4ZG55	GREB1_HUMAN	growth regulation by estrogen in breast cancer 1	819						integral to membrane				ovary(1)	1	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.115)|OV - Ovarian serous cystadenocarcinoma(76;0.186)		CCTCCTTCCCGTATGCACTGC	0.592													7	302	---	---	---	---	PASS
MYCN	4613	broad.mit.edu	37	2	16086030	16086030	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:16086030C>T	uc002rci.2	+	3	1506	c.1206C>T	c.(1204-1206)CTC>CTT	p.L402L	MYCN_uc010yjr.1_Silent_p.L394L	NM_005378	NP_005369	P04198	MYCN_HUMAN	v-myc myelocytomatosis viral related oncogene,	402	Helix-loop-helix motif.				regulation of transcription from RNA polymerase II promoter	chromatin|nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity	p.L402F(1)		central_nervous_system(2)|ovary(1)|lung(1)|skin(1)	5	all_cancers(1;1.35e-08)|all_neural(1;2.92e-24)|Lung SC(1;3.26e-07)|Medulloblastoma(1;6.9e-06)|all_lung(1;1.26e-05)|Glioma(3;0.135)|Acute lymphoblastic leukemia(172;0.155)|all_epithelial(1;0.169)|all_hematologic(175;0.197)		GBM - Glioblastoma multiforme(3;0.000332)			CCAGCTTTCTCACGCTCAGGG	0.587			A		neuroblastoma								16	244	---	---	---	---	PASS
RAD51AP2	729475	broad.mit.edu	37	2	17698620	17698620	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:17698620T>C	uc002rcl.1	-	1	1087	c.1063A>G	c.(1063-1065)AGT>GGT	p.S355G	RAD51AP2_uc010exn.1_Missense_Mutation_p.S346G	NM_001099218	NP_001092688	Q09MP3	R51A2_HUMAN	RAD51 associated protein 2	355										ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.158)					CACTGGATACTACTGCAGTTA	0.363													46	135	---	---	---	---	PASS
LAPTM4A	9741	broad.mit.edu	37	2	20232958	20232958	+	3'UTR	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:20232958G>T	uc002rdm.2	-	7					LAPTM4A_uc002rdn.2_3'UTR	NM_014713	NP_055528	Q15012	LAP4A_HUMAN	lysosomal protein transmembrane 4 alpha						transport	endomembrane system|Golgi apparatus|integral to membrane				ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					GTCAAAGGCAGAATTTCTTCA	0.358													55	138	---	---	---	---	PASS
C2orf43	60526	broad.mit.edu	37	2	20901344	20901344	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:20901344C>T	uc002rec.2	-	6	805	c.772G>A	c.(772-774)GAG>AAG	p.E258K	C2orf43_uc002rea.1_Missense_Mutation_p.E258K|C2orf43_uc002reb.1_RNA|C2orf43_uc010yka.1_3'UTR|C2orf43_uc010ykb.1_Missense_Mutation_p.E128K|C2orf43_uc010ykc.1_Missense_Mutation_p.E210K|C2orf43_uc010ykd.1_3'UTR|C2orf43_uc010yke.1_Missense_Mutation_p.E216K|C2orf43_uc010ykf.1_Missense_Mutation_p.E128K	NM_021925	NP_068744	Q9H6V9	CB043_HUMAN	hypothetical protein LOC60526	258											0	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					CATAAATGCTCCTTTATGGTT	0.393													29	617	---	---	---	---	PASS
ITSN2	50618	broad.mit.edu	37	2	24427169	24427169	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:24427169G>C	uc002rfe.2	-	39	5139	c.4881C>G	c.(4879-4881)CTC>CTG	p.L1627L	ITSN2_uc002rff.2_Silent_p.L1600L	NM_006277	NP_006268	Q9NZM3	ITSN2_HUMAN	intersectin 2 isoform 1	1627	C2.				endocytosis|regulation of Rho protein signal transduction	cytoplasm	calcium ion binding|Rho guanyl-nucleotide exchange factor activity|SH3/SH2 adaptor activity			kidney(2)|ovary(1)|central_nervous_system(1)	4	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					CGTCTTGGTAGAGATCCTTAA	0.493													8	210	---	---	---	---	PASS
C2orf16	84226	broad.mit.edu	37	2	27801450	27801450	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27801450G>C	uc002rkz.3	+	1	2062	c.2011G>C	c.(2011-2013)GAG>CAG	p.E671Q		NM_032266	NP_115642	Q68DN1	CB016_HUMAN	hypothetical protein LOC84226	671										large_intestine(1)	1	Acute lymphoblastic leukemia(172;0.155)					ATCTCCATTTGAGGAACATAC	0.398													85	151	---	---	---	---	PASS
SLC4A1AP	22950	broad.mit.edu	37	2	27887280	27887280	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27887280G>C	uc002rlk.3	+	1	943	c.661G>C	c.(661-663)GAC>CAC	p.D221H	SUPT7L_uc002rlh.1_5'Flank|SUPT7L_uc002rli.1_5'Flank|SUPT7L_uc010ymf.1_5'Flank|SUPT7L_uc002rlj.1_5'Flank|SUPT7L_uc010ezh.1_5'Flank	NM_018158	NP_060628	Q9BWU0	NADAP_HUMAN	solute carrier family 4 (anion exchanger),	221	FHA.					cytoplasm|nucleus	double-stranded RNA binding|protein binding				0	Acute lymphoblastic leukemia(172;0.155)					GTCCGGCCCTGACGGAGAATG	0.607													7	132	---	---	---	---	PASS
PLB1	151056	broad.mit.edu	37	2	28762018	28762018	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:28762018C>T	uc002rmb.1	+	11	671	c.671C>T	c.(670-672)TCT>TTT	p.S224F	PLB1_uc010ezj.1_Missense_Mutation_p.S235F	NM_153021	NP_694566	Q6P1J6	PLB1_HUMAN	phospholipase B1 precursor	224	4 X 308-326 AA approximate repeats.|Extracellular (Potential).|1.				lipid catabolic process|retinoid metabolic process|steroid metabolic process	apical plasma membrane|integral to membrane	lysophospholipase activity|phospholipase A2 activity|retinyl-palmitate esterase activity			ovary(4)|large_intestine(2)|skin(2)|breast(1)	9	Acute lymphoblastic leukemia(172;0.155)					GCAGAGGTCTCTCGTCAGTAT	0.562													26	101	---	---	---	---	PASS
XDH	7498	broad.mit.edu	37	2	31589730	31589730	+	Intron	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:31589730A>G	uc002rnv.1	-							NM_000379	NP_000370	P47989	XDH_HUMAN	xanthine dehydrogenase						purine nucleotide catabolic process|xanthine catabolic process	cytosol|extracellular region|peroxisome	2 iron, 2 sulfur cluster binding|electron carrier activity|flavin adenine dinucleotide binding|iron ion binding|molybdopterin cofactor binding|protein homodimerization activity|xanthine dehydrogenase activity|xanthine oxidase activity			skin(4)|breast(2)|ovary(1)|central_nervous_system(1)	8	Acute lymphoblastic leukemia(172;0.155)				Allopurinol(DB00437)|Carvedilol(DB01136)|Daunorubicin(DB00694)|Deferoxamine(DB00746)|Desflurane(DB01189)|Menadione(DB00170)|Mercaptopurine(DB01033)|Methotrexate(DB00563)|NADH(DB00157)|Nitrofurazone(DB00336)|Papaverine(DB01113)|Procarbazine(DB01168)|Pyrazinamide(DB00339)|Rasburicase(DB00049)|Spermine(DB00127)|Trifluoperazine(DB00831)|Vitamin E(DB00163)	CCCAAAAGGCATCTACCTGGG	0.562													93	262	---	---	---	---	PASS
BIRC6	57448	broad.mit.edu	37	2	32673984	32673984	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32673984G>T	uc010ezu.2	+	22	4740	c.4606G>T	c.(4606-4608)GAT>TAT	p.D1536Y		NM_016252	NP_057336	Q9NR09	BIRC6_HUMAN	baculoviral IAP repeat-containing 6	1536					anti-apoptosis|apoptosis	intracellular	acid-amino acid ligase activity|cysteine-type endopeptidase inhibitor activity|protein binding			ovary(5)|skin(4)|lung(2)|central_nervous_system(1)|breast(1)|pancreas(1)	14	Acute lymphoblastic leukemia(172;0.155)					TGATTTATCAGATGTCCTTTC	0.328													51	99	---	---	---	---	PASS
SLC3A1	6519	broad.mit.edu	37	2	44547706	44547706	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:44547706C>T	uc002ruc.3	+	10	2064	c.1986C>T	c.(1984-1986)TTC>TTT	p.F662F	PREPL_uc002ruf.2_3'UTR|PREPL_uc002rug.2_3'UTR|PREPL_uc002ruh.2_3'UTR|PREPL_uc010fax.2_3'UTR|PREPL_uc002rui.3_3'UTR|PREPL_uc002ruj.1_3'UTR|PREPL_uc002ruk.1_3'UTR|SLC3A1_uc002rud.3_Silent_p.F384F|SLC3A1_uc002rue.3_Silent_p.F282F	NM_000341	NP_000332	Q07837	SLC31_HUMAN	solute carrier family 3, member 1	662	Extracellular (Potential).				carbohydrate metabolic process|cellular amino acid metabolic process|ion transport	integral to plasma membrane|membrane fraction	basic amino acid transmembrane transporter activity|catalytic activity|cation binding|L-cystine transmembrane transporter activity				0		all_hematologic(82;0.166)|Acute lymphoblastic leukemia(82;0.17)			L-Cystine(DB00138)	AAACAGCTTTCAGAGATAGAT	0.423													13	234	---	---	---	---	PASS
MSH6	2956	broad.mit.edu	37	2	48018263	48018263	+	Splice_Site	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48018263G>T	uc002rwd.3	+	2	609	c.457_splice	c.e2+1	p.G153_splice	MSH6_uc002rwc.2_Splice_Site_p.G153_splice|MSH6_uc010fbj.2_Splice_Site|MSH6_uc010yoi.1_Intron|MSH6_uc010yoj.1_Splice_Site	NM_000179	NP_000170	P52701	MSH6_HUMAN	mutS homolog 6						determination of adult lifespan|DNA damage response, signal transduction resulting in induction of apoptosis|isotype switching|meiotic mismatch repair|negative regulation of DNA recombination|positive regulation of helicase activity|reciprocal meiotic recombination|response to UV|somatic hypermutation of immunoglobulin genes	MutSalpha complex	ATP binding|DNA-dependent ATPase activity|protein binding			large_intestine(53)|central_nervous_system(28)|endometrium(28)|stomach(22)|haematopoietic_and_lymphoid_tissue(9)|lung(7)|skin(6)|urinary_tract(5)|breast(5)|ovary(3)|thyroid(1)|upper_aerodigestive_tract(1)	168		Acute lymphoblastic leukemia(82;0.0299)|all_hematologic(82;0.0358)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)			CCATATACAGGTAAGAGTCAC	0.348			Mis|N|F|S		colorectal	colorectal|endometrial|ovarian		MMR	Lynch_syndrome|Muir-Torre_syndrome|Turcot_syndrome|Constitutional_Mismatch_Repair_Deficiency_Syndrome				7	128	---	---	---	---	PASS
FBXO11	80204	broad.mit.edu	37	2	48059968	48059968	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48059968C>T	uc010fbl.2	-	9	955	c.841G>A	c.(841-843)GAG>AAG	p.E281K	FBXO11_uc002rwe.2_Missense_Mutation_p.E281K|FBXO11_uc002rwf.2_Missense_Mutation_p.E281K|FBXO11_uc002rwg.1_Missense_Mutation_p.E281K|FBXO11_uc010fbk.2_5'Flank	NM_025133	NP_079409	Q86XK2	FBX11_HUMAN	F-box only protein 11 isoform 1	365					ubiquitin-dependent protein catabolic process	cytoplasm|nucleolus|ubiquitin ligase complex	protein binding|protein-arginine N-methyltransferase activity|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|lung(1)	2		Acute lymphoblastic leukemia(82;0.0299)|all_hematologic(82;0.0358)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)			ACTGTAATCTCTAAGCAGTGG	0.313													99	228	---	---	---	---	PASS
KLRAQ1	129285	broad.mit.edu	37	2	48687003	48687003	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48687003C>T	uc002rwm.2	+	5	671	c.486C>T	c.(484-486)ACC>ACT	p.T162T	KLRAQ1_uc002rwi.1_Silent_p.T162T|KLRAQ1_uc002rwj.2_Silent_p.T162T|KLRAQ1_uc002rwl.2_Silent_p.T116T|KLRAQ1_uc002rwk.2_Silent_p.T162T|KLRAQ1_uc010yok.1_Silent_p.T162T	NM_001135629	NP_001129101	Q6ZMI0	KLRAQ_HUMAN	KLRAQ motif containing 1 isoform 1	162	Potential.									ovary(1)	1						ACGGTCTCACCCGGAAGTACA	0.502													14	69	---	---	---	---	PASS
BCL11A	53335	broad.mit.edu	37	2	60679701	60679701	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:60679701C>T	uc010ypj.1	-	4	2609	c.2381G>A	c.(2380-2382)TGA>TAA	p.*794*	BCL11A_uc002sab.2_3'UTR|BCL11A_uc002sac.2_Silent_p.*244*|BCL11A_uc010ypi.1_3'UTR	NM_022893	NP_075044	Q9H165	BC11A_HUMAN	B-cell CLL/lymphoma 11A isoform 1	794					negative regulation of axon extension|negative regulation of collateral sprouting|negative regulation of dendrite development|positive regulation of collateral sprouting|positive regulation of neuron projection development|positive regulation of transcription from RNA polymerase II promoter|protein sumoylation|regulation of dendrite development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|cytoplasm|nucleus|nucleus	nucleic acid binding|protein heterodimerization activity|protein homodimerization activity|zinc ion binding			central_nervous_system(6)|breast(3)|ovary(2)|skin(2)	13			LUSC - Lung squamous cell carcinoma(5;9.29e-08)|Lung(5;1.34e-06)|Epithelial(17;0.0562)|all cancers(80;0.199)			CTGGGGGCTTCAAATTTTCTC	0.542			T	IGH@	B-CLL								8	153	---	---	---	---	PASS
USP34	9736	broad.mit.edu	37	2	61561087	61561087	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61561087G>A	uc002sbe.2	-	19	2786	c.2764C>T	c.(2764-2766)CGT>TGT	p.R922C		NM_014709	NP_055524	Q70CQ2	UBP34_HUMAN	ubiquitin specific protease 34	922					positive regulation of canonical Wnt receptor signaling pathway|protein K48-linked deubiquitination|ubiquitin-dependent protein catabolic process|Wnt receptor signaling pathway		cysteine-type endopeptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(8)|breast(5)|skin(3)|lung(2)|prostate(1)	19			Epithelial(17;0.229)			GGAAGAAGACGAAGTGAAATT	0.274													7	70	---	---	---	---	PASS
EHBP1	23301	broad.mit.edu	37	2	63091897	63091897	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:63091897A>T	uc002sby.2	+	10	1376	c.894A>T	c.(892-894)AAA>AAT	p.K298N	EHBP1_uc010fcp.2_Missense_Mutation_p.K263N|EHBP1_uc002sbx.2_Missense_Mutation_p.K263N|EHBP1_uc002sbz.2_Missense_Mutation_p.K263N|EHBP1_uc002scb.2_Missense_Mutation_p.K263N	NM_015252	NP_056067	Q8NDI1	EHBP1_HUMAN	EH domain binding protein 1 isoform 1	298						cytoplasm|membrane				ovary(1)|breast(1)	2	Lung NSC(7;0.0951)|all_lung(7;0.169)		LUSC - Lung squamous cell carcinoma(7;7.74e-05)|Epithelial(17;0.189)			CACCTAGAAAAACAGAAGACT	0.328									Hereditary_Prostate_Cancer				7	255	---	---	---	---	PASS
VPS54	51542	broad.mit.edu	37	2	64126700	64126700	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:64126700G>A	uc002scq.2	-	21	2804	c.2641C>T	c.(2641-2643)CCT>TCT	p.P881S	VPS54_uc002scp.2_Missense_Mutation_p.P869S|VPS54_uc002scn.2_Missense_Mutation_p.P43S|VPS54_uc002sco.2_Missense_Mutation_p.P366S|VPS54_uc010fct.2_Missense_Mutation_p.P728S	NM_016516	NP_057600	Q9P1Q0	VPS54_HUMAN	vacuolar protein sorting 54 isoform 1	881					protein transport|retrograde transport, endosome to Golgi						0						GAAGGAACAGGAGCCTTCACT	0.378													51	144	---	---	---	---	PASS
DYSF	8291	broad.mit.edu	37	2	71753403	71753403	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71753403C>G	uc002sie.2	+	12	1483	c.1107C>G	c.(1105-1107)CTC>CTG	p.L369L	DYSF_uc010feg.2_Silent_p.L400L|DYSF_uc010feh.2_Silent_p.L369L|DYSF_uc002sig.3_Silent_p.L369L|DYSF_uc010yqx.1_RNA|DYSF_uc010fee.2_Silent_p.L369L|DYSF_uc010fef.2_Silent_p.L400L|DYSF_uc010fei.2_Silent_p.L400L|DYSF_uc010fek.2_Silent_p.L401L|DYSF_uc010fej.2_Silent_p.L370L|DYSF_uc010fel.2_Silent_p.L370L|DYSF_uc010feo.2_Silent_p.L401L|DYSF_uc010fem.2_Silent_p.L370L|DYSF_uc010fen.2_Silent_p.L401L|DYSF_uc002sif.2_Silent_p.L370L	NM_003494	NP_003485	O75923	DYSF_HUMAN	dysferlin isoform 8	369	Cytoplasmic (Potential).|C2 3.					cytoplasmic vesicle membrane|integral to membrane|sarcolemma	calcium-dependent phospholipid binding			ovary(3)|breast(2)|pancreas(1)|skin(1)	7						GCAACCTGCTCCGGCCCACAG	0.592													90	342	---	---	---	---	PASS
EXOC6B	23233	broad.mit.edu	37	2	72968457	72968457	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:72968457C>A	uc010fep.2	-	2	393	c.255G>T	c.(253-255)GTG>GTT	p.V85V	EXOC6B_uc002sij.2_Silent_p.V85V	NM_015189	NP_056004	Q9Y2D4	EXC6B_HUMAN	SEC15-like 2	85	Potential.				protein transport|vesicle docking involved in exocytosis	exocyst				central_nervous_system(2)	2						CTTCTCCTCTCACTTTCAGCA	0.408													17	396	---	---	---	---	PASS
SMYD5	10322	broad.mit.edu	37	2	73453006	73453006	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73453006G>T	uc002siw.2	+	13	1218	c.1189G>T	c.(1189-1191)GAA>TAA	p.E397*	SMYD5_uc010yre.1_Nonsense_Mutation_p.E281*|SMYD5_uc002six.1_RNA	NM_006062	NP_006053	Q6GMV2	SMYD5_HUMAN	SMYD family member 5	397	Glu-rich.						metal ion binding				0						agaggaagaggaagaggagga	0.463													56	204	---	---	---	---	PASS
C2orf7	84279	broad.mit.edu	37	2	73456653	73456653	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73456653C>G	uc002siy.2	-	3	282	c.214G>C	c.(214-216)GAG>CAG	p.E72Q		NM_032319	NP_115695	Q9BSG0	PADC1_HUMAN	chromosome 2 open reading frame 7 precursor	72						extracellular region					0						CCGCAGGCCTCTGGAGGTTCA	0.532													6	225	---	---	---	---	PASS
C2orf78	388960	broad.mit.edu	37	2	74043401	74043401	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74043401C>A	uc002sjr.1	+	3	2172	c.2051C>A	c.(2050-2052)CCG>CAG	p.P684Q		NM_001080474	NP_001073943	A6NCI8	CB078_HUMAN	hypothetical protein LOC388960	684										ovary(2)	2						GGTAAAGGCCCGGAGAAAATT	0.517													31	89	---	---	---	---	PASS
TET3	200424	broad.mit.edu	37	2	74317177	74317177	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74317177G>T	uc002skb.3	+							NM_144993	NP_659430	O43151	TET3_HUMAN	tet oncogene family member 3								metal ion binding|methylcytosine dioxygenase activity|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen				0						CCAAAGAGGTGAGCAGAGCTG	0.562													54	177	---	---	---	---	PASS
MOGS	7841	broad.mit.edu	37	2	74690051	74690051	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74690051G>A	uc010ffj.2	-	4	1028	c.865C>T	c.(865-867)CCC>TCC	p.P289S	MOGS_uc010ffh.2_Missense_Mutation_p.P14S|MOGS_uc010yrt.1_Missense_Mutation_p.P170S|MOGS_uc010ffi.2_Missense_Mutation_p.P183S|MOGS_uc010yru.1_3'UTR	NM_006302	NP_006293	Q13724	MOGS_HUMAN	mannosyl-oligosaccharide glucosidase isoform 1	289	Lumenal (Potential).				oligosaccharide metabolic process|post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine	endoplasmic reticulum membrane|integral to membrane|membrane fraction	mannosyl-oligosaccharide glucosidase activity				0						GCCCCTGGGGGCCGATGCTGA	0.587													18	442	---	---	---	---	PASS
SEMA4F	10505	broad.mit.edu	37	2	74902690	74902690	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74902690C>G	uc002sna.1	+	11	1522	c.1411C>G	c.(1411-1413)CAG>GAG	p.Q471E	SEMA4F_uc010ffq.1_Missense_Mutation_p.Q438E|SEMA4F_uc010ffr.1_Missense_Mutation_p.Q83E|SEMA4F_uc002snb.1_Missense_Mutation_p.Q83E|SEMA4F_uc002snc.1_Missense_Mutation_p.Q316E	NM_004263	NP_004254	O95754	SEM4F_HUMAN	semaphorin W precursor	471	Sema.|Extracellular (Potential).				cell-cell signaling	endoplasmic reticulum|integral to plasma membrane	receptor activity			ovary(2)|pancreas(1)|skin(1)	4						GATCGGAGCTCAGCTCAGCGT	0.498													57	184	---	---	---	---	PASS
REG1A	5967	broad.mit.edu	37	2	79350349	79350349	+	3'UTR	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:79350349T>A	uc002snz.2	+	6					REG1A_uc010ysd.1_3'UTR	NM_002909	NP_002900	P05451	REG1A_HUMAN	regenerating islet-derived 1 alpha precursor						positive regulation of cell proliferation	extracellular region	growth factor activity|sugar binding				0						TAGAGGCAACTGGAAAATACA	0.408													4	90	---	---	---	---	PASS
CTNNA2	1496	broad.mit.edu	37	2	80136780	80136780	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:80136780G>A	uc010ysh.1	+	6	918	c.913G>A	c.(913-915)GAG>AAG	p.E305K	CTNNA2_uc010yse.1_Missense_Mutation_p.E305K|CTNNA2_uc010ysf.1_Missense_Mutation_p.E305K|CTNNA2_uc010ysg.1_Missense_Mutation_p.E305K	NM_004389	NP_004380	P26232	CTNA2_HUMAN	catenin, alpha 2 isoform 1	305					axonogenesis|brain morphogenesis|cell-cell adhesion|dendrite morphogenesis|muscle cell differentiation|positive regulation of muscle cell differentiation|prepulse inhibition|radial glia guided migration of Purkinje cell|regulation of synapse structural plasticity	actin cytoskeleton|axon|cytosol	cadherin binding|structural constituent of cytoskeleton			pancreas(4)|lung(3)|breast(1)|skin(1)	9						GTCCCTGGAGGAGAGGCTGGA	0.597													40	128	---	---	---	---	PASS
TEKT4	150483	broad.mit.edu	37	2	95539782	95539782	+	Missense_Mutation	SNP	G	C	C	rs143585686		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:95539782G>C	uc002stw.1	+	3	735	c.642G>C	c.(640-642)GAG>GAC	p.E214D	uc002stv.1_Intron|TEKT4_uc010fhr.1_RNA	NM_144705	NP_653306	Q8WW24	TEKT4_HUMAN	tektin 4	214					cell projection organization|microtubule cytoskeleton organization	cilium axoneme|flagellar axoneme|microtubule				ovary(1)|breast(1)|skin(1)	3						ACATCGACGAGACCTGCGGGC	0.642													31	104	---	---	---	---	PASS
VWA3B	200403	broad.mit.edu	37	2	98866858	98866858	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:98866858C>G	uc002syo.2	+	20	3015	c.2751C>G	c.(2749-2751)ATC>ATG	p.I917M	VWA3B_uc002sym.2_Missense_Mutation_p.I917M|VWA3B_uc002syn.1_RNA|VWA3B_uc010yvi.1_Missense_Mutation_p.I574M|VWA3B_uc002syp.1_Missense_Mutation_p.I309M|VWA3B_uc002syq.1_Missense_Mutation_p.I193M|VWA3B_uc002syr.1_Missense_Mutation_p.I234M|VWA3B_uc010fii.1_RNA|VWA3B_uc002sys.2_RNA	NM_144992	NP_659429	Q502W6	VWA3B_HUMAN	von Willebrand factor A domain containing 3B	917										ovary(3)|large_intestine(2)|skin(1)	6						AACTCAATATCTACAAGCGAA	0.403													57	135	---	---	---	---	PASS
NMS	129521	broad.mit.edu	37	2	101097576	101097576	+	Intron	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:101097576T>C	uc002tan.1	+							NM_001011717	NP_001011717	Q5H8A3	NMS_HUMAN	neuromedin S precursor						neuropeptide signaling pathway|regulation of smooth muscle contraction	extracellular region				ovary(1)	1						CTTGTGTTTCTATATGTTGCA	0.333													51	171	---	---	---	---	PASS
CREG2	200407	broad.mit.edu	37	2	101967465	101967465	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:101967465T>C	uc002tba.2	-	4	839	c.793A>G	c.(793-795)ATC>GTC	p.I265V		NM_153836	NP_722578	Q8IUH2	CREG2_HUMAN	cellular repressor of E1A-stimulated genes 2	265						extracellular region	FMN binding			ovary(1)	1						TGAAGCCAGATATGTTCTATC	0.453													56	169	---	---	---	---	PASS
GPR45	11250	broad.mit.edu	37	2	105859124	105859124	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:105859124T>A	uc002tco.1	+	1	925	c.809T>A	c.(808-810)CTG>CAG	p.L270Q		NM_007227	NP_009158	Q9Y5Y3	GPR45_HUMAN	G protein-coupled receptor 45	270	Helical; Name=6; (Potential).			L -> P (in Ref. 3; AAH67455).		integral to membrane|plasma membrane	G-protein coupled receptor activity|protein binding			ovary(1)|breast(1)|central_nervous_system(1)	3						ACCACCATCCTGATCCTCTTC	0.622													123	262	---	---	---	---	PASS
SULT1C2	6819	broad.mit.edu	37	2	108921915	108921915	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:108921915G>C	uc002tdy.2	+	7	1095	c.642G>C	c.(640-642)AAG>AAC	p.K214N	SULT1C2_uc010ywp.1_Missense_Mutation_p.K129N|SULT1C2_uc002tdx.2_Missense_Mutation_p.K225N|SULT1C2_uc010ywq.1_Missense_Mutation_p.K228N	NM_001056	NP_001047	O00338	ST1C2_HUMAN	sulfotransferase family, cytosolic, 1C, member 1	214	PAPS (By similarity).				3'-phosphoadenosine 5'-phosphosulfate metabolic process|amine metabolic process|sulfation|xenobiotic metabolic process	cytosol|microtubule cytoskeleton	sulfotransferase activity			ovary(1)	1						TCATGGGAAAGAAGGTGGATG	0.393													21	76	---	---	---	---	PASS
RANBP2	5903	broad.mit.edu	37	2	109397776	109397776	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:109397776C>T	uc002tem.3	+	26	8777	c.8651C>T	c.(8650-8652)TCA>TTA	p.S2884L		NM_006267	NP_006258	P49792	RBP2_HUMAN	RAN binding protein 2	2884					carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA transport|protein folding|protein import into nucleus|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|nuclear pore	peptidyl-prolyl cis-trans isomerase activity|Ran GTPase binding|zinc ion binding		RANBP2/ALK(16)	soft_tissue(16)|lung(1)|pancreas(1)	18						GGAACACAGTCAGTCGGAACC	0.358													24	80	---	---	---	---	PASS
IL1B	3553	broad.mit.edu	37	2	113588118	113588118	+	Silent	SNP	C	T	T	rs138009692		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:113588118C>T	uc002tii.1	-	7	717	c.630G>A	c.(628-630)AAG>AAA	p.K210K	IL1B_uc002tih.1_Silent_p.K179K	NM_000576	NP_000567	P01584	IL1B_HUMAN	interleukin 1, beta proprotein	210					activation of MAPK activity|anti-apoptosis|apoptosis|cell-cell signaling|cellular response to drug|cellular response to mechanical stimulus|cytokine-mediated signaling pathway|embryo implantation|fever generation|negative regulation of adiponectin secretion|negative regulation of cell proliferation|negative regulation of glucose transport|negative regulation of insulin receptor signaling pathway|negative regulation of lipid catabolic process|negative regulation of MAP kinase activity|positive regulation of angiogenesis|positive regulation of calcidiol 1-monooxygenase activity|positive regulation of cell adhesion molecule production|positive regulation of cell division|positive regulation of fever generation|positive regulation of granulocyte macrophage colony-stimulating factor production|positive regulation of heterotypic cell-cell adhesion|positive regulation of histone acetylation|positive regulation of histone phosphorylation|positive regulation of interferon-gamma production|positive regulation of interleukin-2 biosynthetic process|positive regulation of interleukin-6 production|positive regulation of interleukin-8 production|positive regulation of lipid catabolic process|positive regulation of membrane protein ectodomain proteolysis|positive regulation of mitosis|positive regulation of monocyte chemotactic protein-1 production|positive regulation of myosin light chain kinase activity|positive regulation of NF-kappaB import into nucleus|positive regulation of NF-kappaB transcription factor activity|positive regulation of nitric oxide biosynthetic process|positive regulation of prostaglandin secretion|positive regulation of protein export from nucleus|positive regulation of T cell proliferation|positive regulation vascular endothelial growth factor production|regulation of insulin secretion|sequestering of triglyceride|smooth muscle adaptation	cytosol|extracellular space	cytokine activity|growth factor activity|interleukin-1 receptor binding|protein domain specific binding			lung(3)|breast(1)	4					Anakinra(DB00026)|Minocycline(DB01017)|Procaterol(DB01366)	GCTTTTCCATCTTCTTCTTTG	0.418													86	177	---	---	---	---	PASS
DBI	1622	broad.mit.edu	37	2	120125782	120125782	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:120125782G>T	uc002tlv.2	+	2	152	c.28G>T	c.(28-30)GCA>TCA	p.A10S	C2orf76_uc002tls.2_5'Flank|C2orf76_uc010flf.1_5'Flank|C2orf76_uc010yyg.1_5'Flank|C2orf76_uc002tlt.2_5'Flank|C2orf76_uc002tlu.2_5'Flank|DBI_uc010yyh.1_Missense_Mutation_p.A27S|DBI_uc010yyi.1_Missense_Mutation_p.A27S|DBI_uc010yyj.1_RNA|DBI_uc010yyk.1_Missense_Mutation_p.A52S|DBI_uc010yyl.1_Missense_Mutation_p.A27S|DBI_uc010yym.1_Missense_Mutation_p.A20S|DBI_uc010yyn.1_Missense_Mutation_p.A27S|DBI_uc002tlw.2_Missense_Mutation_p.A27S|DBI_uc010yyo.1_RNA|DBI_uc002tlx.2_Missense_Mutation_p.A11S|DBI_uc010yyp.1_5'Flank	NM_001079862	NP_001073331	P07108	ACBP_HUMAN	diazepam binding inhibitor isoform 3	10	ACB.				transport		benzodiazepine receptor binding|fatty-acyl-CoA binding				0						TGAGAAAGCTGCAGAGGAGGT	0.517													56	152	---	---	---	---	PASS
TFCP2L1	29842	broad.mit.edu	37	2	121981961	121981961	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:121981961C>G	uc002tmx.2	-	15	1489	c.1396G>C	c.(1396-1398)GAG>CAG	p.E466Q	TFCP2L1_uc010flr.2_Missense_Mutation_p.E401Q|TFCP2L1_uc010flq.2_RNA	NM_014553	NP_055368	Q9NZI6	TF2L1_HUMAN	LBP-9	466					female pregnancy|steroid biosynthetic process	mitochondrion|nucleolus	DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			pancreas(2)|ovary(1)	3	Renal(3;0.01)					TCATTGCTCTCAGCTGCAAGA	0.517													4	34	---	---	---	---	PASS
BIN1	274	broad.mit.edu	37	2	127828402	127828402	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:127828402G>C	uc002tns.1	-						BIN1_uc010yzf.1_Intron|BIN1_uc010yzg.1_Intron|BIN1_uc002tnu.1_Intron|BIN1_uc002toa.1_Intron|BIN1_uc002tnt.1_Intron|BIN1_uc002tnv.1_Intron|BIN1_uc002tnw.1_Intron|BIN1_uc002tnx.1_Intron|BIN1_uc002tny.1_Intron|BIN1_uc002tnz.1_Intron|BIN1_uc002tob.1_Intron|BIN1_uc002toc.1_Intron	NM_139343	NP_647593	O00499	BIN1_HUMAN	bridging integrator 1 isoform 1						cell proliferation|endocytosis|interspecies interaction between organisms|multicellular organismal development	actin cytoskeleton|nucleus				ovary(2)|central_nervous_system(2)|skin(2)|lung(1)	7	Colorectal(110;0.0831)			BRCA - Breast invasive adenocarcinoma(221;0.073)		TCTGCAAAGAGAAGGACAAGG	0.627													5	34	---	---	---	---	PASS
FAM123C	205147	broad.mit.edu	37	2	131520801	131520801	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:131520801G>T	uc002trw.2	+	2	1346	c.1156G>T	c.(1156-1158)GGC>TGC	p.G386C	FAM123C_uc010fmv.2_Missense_Mutation_p.G386C|FAM123C_uc010fms.1_Missense_Mutation_p.G386C|FAM123C_uc010fmt.1_Missense_Mutation_p.G386C|FAM123C_uc010fmu.1_Missense_Mutation_p.G386C	NM_152698	NP_689911	Q8N944	F123C_HUMAN	hypothetical protein LOC205147	386										pancreas(2)|ovary(1)	3	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.13)		AAGTGACGAGGGCTACTATGA	0.627													21	81	---	---	---	---	PASS
POTEE	445582	broad.mit.edu	37	2	132021592	132021592	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:132021592C>G	uc002tsn.2	+	15	2616	c.2564C>G	c.(2563-2565)TCT>TGT	p.S855C	PLEKHB2_uc002tsh.2_Intron|POTEE_uc002tsk.2_Missense_Mutation_p.S455C|POTEE_uc002tsl.2_Missense_Mutation_p.S437C|POTEE_uc010fmy.1_Missense_Mutation_p.S319C	NM_001083538	NP_001077007	Q6S8J3	POTEE_HUMAN	protein expressed in prostate, ovary, testis,	855	Actin-like.						ATP binding				0						GTGATGGACTCTGGTGACGGG	0.612													6	206	---	---	---	---	PASS
R3HDM1	23518	broad.mit.edu	37	2	136393534	136393534	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:136393534G>C	uc002tuo.2	+	10	1143	c.773G>C	c.(772-774)AGA>ACA	p.R258T	R3HDM1_uc010fni.2_Missense_Mutation_p.R256T|R3HDM1_uc002tup.2_Missense_Mutation_p.R202T|R3HDM1_uc010zbh.1_Missense_Mutation_p.R90T	NM_015361	NP_056176	Q15032	R3HD1_HUMAN	R3H domain containing 1	258							nucleic acid binding			skin(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.127)		ATCCTCAAGAGAGATAACTCT	0.303													9	260	---	---	---	---	PASS
UBXN4	23190	broad.mit.edu	37	2	136528164	136528164	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:136528164G>C	uc002tur.2	+	8	992	c.681G>C	c.(679-681)GAG>GAC	p.E227D	UBXN4_uc002tus.2_5'UTR	NM_014607	NP_055422	Q92575	UBXN4_HUMAN	UBX domain containing 2	227	Cytoplasmic (Potential).				response to unfolded protein	endoplasmic reticulum membrane|nuclear envelope	protein binding			skin(2)	2						AGGAAATTGAGAGGAGAAAAA	0.303													4	21	---	---	---	---	PASS
THSD7B	80731	broad.mit.edu	37	2	137748464	137748464	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:137748464G>T	uc002tva.1	+	1	3	c.3G>T	c.(1-3)ATG>ATT	p.M1I	THSD7B_uc010zbj.1_Intron	NM_001080427	NP_001073896			thrombospondin, type I, domain containing 7B											ovary(4)|central_nervous_system(2)|pancreas(1)	7				BRCA - Breast invasive adenocarcinoma(221;0.19)		GCGAAACGATGCATAACACAG	0.403													4	10	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141232707	141232707	+	Missense_Mutation	SNP	C	A	A	rs77794732		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141232707C>A	uc002tvj.1	-	60	10597	c.9625G>T	c.(9625-9627)GTC>TTC	p.V3209F		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	3209	Extracellular (Potential).|LDL-receptor class B 31.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		CTGGACCAACCTTTGTGTCTA	0.289										TSP Lung(27;0.18)			24	176	---	---	---	---	PASS
ARHGAP15	55843	broad.mit.edu	37	2	144381815	144381815	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:144381815G>C	uc002tvm.3	+	12	1268	c.1117G>C	c.(1117-1119)GAG>CAG	p.E373Q	ARHGAP15_uc002tvn.2_Missense_Mutation_p.E139Q	NM_018460	NP_060930	Q53QZ3	RHG15_HUMAN	ARHGAP15	373	Rho-GAP.				regulation of cell shape|small GTPase mediated signal transduction	cytosol|membrane	protein binding|Rac GTPase activator activity			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(221;0.151)		CAGTTTCTTTGAGCAGTTTGT	0.458													4	88	---	---	---	---	PASS
KIF5C	3800	broad.mit.edu	37	2	149799217	149799217	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:149799217G>A	uc010zbu.1	+	7	900	c.532G>A	c.(532-534)GAG>AAG	p.E178K		NM_004522	NP_004513	O60282	KIF5C_HUMAN	kinesin family member 5C	178	Kinesin-motor.|Microtubule-binding.				microtubule-based movement|organelle organization	cytoplasm|kinesin complex|microtubule	ATP binding|microtubule motor activity			skin(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.108)		GTCGAGCCCTGAGGAAGTCAT	0.493													6	16	---	---	---	---	PASS
KIF5C	3800	broad.mit.edu	37	2	149806962	149806962	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:149806962G>C	uc010zbu.1	+	10	1322	c.954G>C	c.(952-954)CTG>CTC	p.L318L	KIF5C_uc002tws.1_RNA	NM_004522	NP_004513	O60282	KIF5C_HUMAN	kinesin family member 5C	318	Kinesin-motor.				microtubule-based movement|organelle organization	cytoplasm|kinesin complex|microtubule	ATP binding|microtubule motor activity			skin(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.108)		AGTCCACACTGATGTTCGGAC	0.453													15	35	---	---	---	---	PASS
NMI	9111	broad.mit.edu	37	2	152132274	152132274	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152132274G>A	uc002txi.2	-	5	775	c.445C>T	c.(445-447)CAG>TAG	p.Q149*	NMI_uc010zbx.1_Nonsense_Mutation_p.Q149*	NM_004688	NP_004679	Q13287	NMI_HUMAN	N-myc and STAT interactor	149					inflammatory response|JAK-STAT cascade|transcription from RNA polymerase II promoter	cytoplasm|nucleus	nucleotide binding|protein binding|transcription cofactor activity				0				BRCA - Breast invasive adenocarcinoma(221;0.0571)		CCTGTTACCTGGAATCTGACT	0.353													10	121	---	---	---	---	PASS
NEB	4703	broad.mit.edu	37	2	152427061	152427061	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152427061C>T	uc010fnx.2	-	80	12156	c.11965G>A	c.(11965-11967)GAT>AAT	p.D3989N	NEB_uc002txr.2_Missense_Mutation_p.D412N	NM_004543	NP_004534	P20929	NEBU_HUMAN	nebulin isoform 3	3989	Nebulin 109.				muscle filament sliding|muscle organ development|regulation of actin filament length|somatic muscle development	actin cytoskeleton|cytosol|Z disc	actin binding|structural constituent of muscle			ovary(8)|large_intestine(5)|breast(3)|central_nervous_system(2)|skin(1)|pancreas(1)	20				BRCA - Breast invasive adenocarcinoma(221;0.219)		GGGATGGCATCCAGCCGGACA	0.483													4	16	---	---	---	---	PASS
PKP4	8502	broad.mit.edu	37	2	159536982	159536982	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:159536982G>A	uc002tzv.2	+	22	3632	c.3372G>A	c.(3370-3372)AAG>AAA	p.K1124K	PKP4_uc002tzw.2_Silent_p.K1081K|PKP4_uc002tzx.2_Silent_p.K781K|PKP4_uc002uaa.2_Silent_p.K933K|uc002uab.1_Intron|PKP4_uc002uac.2_Silent_p.K305K|PKP4_uc002uad.2_RNA	NM_003628	NP_003619	Q99569	PKP4_HUMAN	plakophilin 4 isoform a	1124					cell adhesion	desmosome	protein binding			ovary(5)|skin(2)	7						CCAACAGAAAGAACTTTGATG	0.328										HNSCC(62;0.18)			26	214	---	---	---	---	PASS
SCN1A	6323	broad.mit.edu	37	2	166848121	166848121	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:166848121C>G	uc010zcz.1	-	26	5649	c.5631G>C	c.(5629-5631)CAG>CAC	p.Q1877H		NM_006920	NP_008851	P35498	SCN1A_HUMAN	sodium channel, voltage-gated, type I, alpha	1888						voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(6)|skin(6)|large_intestine(1)	13					Lamotrigine(DB00555)|Levetiracetam(DB01202)|Phenacemide(DB01121)|Phenytoin(DB00252)|Topiramate(DB00273)|Zonisamide(DB00909)	GCTCTTCCATCTGTATTCGTA	0.438													17	162	---	---	---	---	PASS
B3GALT1	8708	broad.mit.edu	37	2	168726011	168726011	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:168726011C>G	uc002udz.1	+	2	813	c.462C>G	c.(460-462)CTC>CTG	p.L154L		NM_020981	NP_066191	Q9Y5Z6	B3GT1_HUMAN	UDP-Gal:betaGlcNAc beta	154	Lumenal (Potential).				lipid glycosylation|protein glycosylation	Golgi membrane|integral to membrane	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity			ovary(2)|pancreas(1)|skin(1)	4						ACCTTACCCTCAAAACATTAA	0.408													33	91	---	---	---	---	PASS
UBR3	130507	broad.mit.edu	37	2	170929929	170929929	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170929929G>A	uc010zdi.1	+						UBR3_uc002ufr.3_RNA|UBR3_uc010fqa.2_Intron|UBR3_uc002uft.3_Intron|UBR3_uc010zdj.1_Intron|UBR3_uc002ufu.3_Intron	NM_172070	NP_742067	Q6ZT12	UBR3_HUMAN	E3 ubiquitin-protein ligase UBR3						sensory perception of smell|suckling behavior|ubiquitin-dependent protein catabolic process	integral to membrane	ubiquitin-protein ligase activity|zinc ion binding				0						CCTATTTCATGTCTAAAAGGA	0.358													24	274	---	---	---	---	PASS
RAPGEF4	11069	broad.mit.edu	37	2	173659797	173659797	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:173659797G>T	uc002uhv.3	+	2	297	c.110G>T	c.(109-111)CGA>CTA	p.R37L	RAPGEF4_uc002uhu.2_Missense_Mutation_p.R37L|RAPGEF4_uc010fqn.2_Missense_Mutation_p.R20L	NM_007023	NP_008954	Q8WZA2	RPGF4_HUMAN	Rap guanine nucleotide exchange factor (GEF) 4	37					blood coagulation|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|regulation of insulin secretion|regulation of protein phosphorylation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cAMP-dependent protein kinase complex|membrane fraction|plasma membrane	cAMP binding|cAMP-dependent protein kinase regulator activity|Ras GTPase binding|Ras guanyl-nucleotide exchange factor activity			large_intestine(2)|skin(2)|kidney(1)|central_nervous_system(1)	6			OV - Ovarian serous cystadenocarcinoma(117;0.194)			ATCTTCACTCGACTGAAAGAA	0.378													71	333	---	---	---	---	PASS
RAPGEF4	11069	broad.mit.edu	37	2	173891404	173891404	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:173891404A>G	uc002uhv.3	+	24	2545	c.2358A>G	c.(2356-2358)GAA>GAG	p.E786E	RAPGEF4_uc002uhw.3_Silent_p.E642E	NM_007023	NP_008954	Q8WZA2	RPGF4_HUMAN	Rap guanine nucleotide exchange factor (GEF) 4	786	Ras-GEF.				blood coagulation|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|regulation of insulin secretion|regulation of protein phosphorylation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cAMP-dependent protein kinase complex|membrane fraction|plasma membrane	cAMP binding|cAMP-dependent protein kinase regulator activity|Ras GTPase binding|Ras guanyl-nucleotide exchange factor activity			large_intestine(2)|skin(2)|kidney(1)|central_nervous_system(1)	6			OV - Ovarian serous cystadenocarcinoma(117;0.194)			ATGATTGGGAACTCTTCAACT	0.438													41	131	---	---	---	---	PASS
EVX2	344191	broad.mit.edu	37	2	176948324	176948324	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:176948324C>T	uc010zeu.1	-	1	367	c.181G>A	c.(181-183)GCT>ACT	p.A61T		NM_001080458	NP_001073927	Q03828	EVX2_HUMAN	even-skipped homeobox 2	61						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.0207)|Epithelial(96;0.18)	READ - Rectum adenocarcinoma(9;0.0678)|Colorectal(32;0.115)		TCTCCCAGAGCGCTGTGCAGG	0.607													11	92	---	---	---	---	PASS
DFNB59	494513	broad.mit.edu	37	2	179319253	179319253	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179319253C>T	uc002umi.3	+	3	762	c.406C>T	c.(406-408)CGA>TGA	p.R136*	DFNB59_uc002umj.3_Nonsense_Mutation_p.R136*	NM_001042702	NP_001036167	Q0ZLH3	PJVK_HUMAN	deafness, autosomal recessive 59	136					sensory perception of sound						0			OV - Ovarian serous cystadenocarcinoma(117;0.00406)|Epithelial(96;0.0159)|all cancers(119;0.0564)			AATTACTACACGGTCAGTATA	0.299													25	64	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179424611	179424611	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179424611C>T	uc010zfg.1	-	275	78768	c.78544G>A	c.(78544-78546)GAA>AAA	p.E26182K	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.E19877K|TTN_uc010zfi.1_Missense_Mutation_p.E19810K|TTN_uc010zfj.1_Missense_Mutation_p.E19685K	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	27109							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			AAAGGTTCTTCTTCTCTTTCC	0.428													7	215	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179431097	179431097	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179431097C>G	uc010zfg.1	-	275	72282	c.72058G>C	c.(72058-72060)GAA>CAA	p.E24020Q	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.E17715Q|TTN_uc010zfi.1_Missense_Mutation_p.E17648Q|TTN_uc010zfj.1_Missense_Mutation_p.E17523Q	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	24947							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			TCAGGTGCTTCAAGTTTATCT	0.423													22	424	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179546413	179546413	+	Silent	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179546413T>G	uc010zfg.1	-	133	29639	c.29415A>C	c.(29413-29415)ACA>ACC	p.T9805T	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Silent_p.T6466T|TTN_uc010fre.1_Silent_p.T652T|TTN_uc002una.1_5'Flank|TTN_uc010frf.1_5'Flank	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	10732							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			CCTTTGGTTTTGTGGGAACTG	0.378													63	119	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179613783	179613783	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179613783C>G	uc002unb.2	-	46	13568	c.13344G>C	c.(13342-13344)GAG>GAC	p.E4448D	TTN_uc010zfg.1_Intron|TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Intron	NM_133379	NP_596870	Q8WZ42	TITIN_HUMAN	titin isoform novex-3	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			GGTAGTGTATCTCTTCACCAA	0.338													22	135	---	---	---	---	PASS
COL5A2	1290	broad.mit.edu	37	2	189964841	189964841	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:189964841C>G	uc002uqk.2	-	4	636	c.361G>C	c.(361-363)GTG>CTG	p.V121L		NM_000393	NP_000384	P05997	CO5A2_HUMAN	alpha 2 type V collagen preproprotein	121					axon guidance|collagen fibril organization|eye morphogenesis|skin development	collagen type V	extracellular matrix structural constituent			ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.0106)|Epithelial(96;0.127)			ACAACAGGCACTAATCCTGGT	0.313													23	112	---	---	---	---	PASS
DNAH7	56171	broad.mit.edu	37	2	196620855	196620855	+	Splice_Site	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196620855A>C	uc002utj.3	-	62	11687	c.11586_splice	c.e62+1	p.Q3862_splice	DNAH7_uc002uti.3_Splice_Site_p.Q345_splice	NM_018897	NP_061720	Q8WXX0	DYH7_HUMAN	dynein, axonemal, heavy chain 7						ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(10)|ovary(2)	12						AGACGAACTTACCTGCAAGAA	0.368													15	94	---	---	---	---	PASS
HECW2	57520	broad.mit.edu	37	2	197171251	197171251	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197171251G>A	uc002utm.1	-	13	2958	c.2775C>T	c.(2773-2775)CTC>CTT	p.L925L	HECW2_uc002utl.1_Silent_p.L569L	NM_020760	NP_065811	Q9P2P5	HECW2_HUMAN	HECT, C2 and WW domain containing E3 ubiquitin	925	Interaction with TP73.				protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm	ubiquitin-protein ligase activity			skin(5)|ovary(5)|lung(4)|pancreas(2)|central_nervous_system(1)|kidney(1)	18						CTGGGCTGATGAGGAACTTCA	0.512													23	132	---	---	---	---	PASS
AOX1	316	broad.mit.edu	37	2	201476101	201476101	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:201476101C>A	uc002uvx.2	+						AOX1_uc010zhf.1_Intron|AOX1_uc010fsu.2_Intron	NM_001159	NP_001150	Q06278	ADO_HUMAN	aldehyde oxidase 1						inflammatory response|reactive oxygen species metabolic process	cytoplasm	2 iron, 2 sulfur cluster binding|aldehyde oxidase activity|flavin adenine dinucleotide binding|iron ion binding|NAD binding|xanthine dehydrogenase activity			ovary(4)|pancreas(1)|skin(1)	6					Brimonidine(DB00484)|Chlorpromazine(DB00477)|Famciclovir(DB00426)|Menadione(DB00170)|Methotrexate(DB00563)|NADH(DB00157)|Palonosetron(DB00377)|Penciclovir(DB00299)|Raloxifene(DB00481)|Zaleplon(DB00962)|Zonisamide(DB00909)	TCATTTCTTTCCACAGAAGGA	0.398													59	285	---	---	---	---	PASS
CASP10	843	broad.mit.edu	37	2	202050702	202050702	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202050702G>A	uc002uxl.1	+	2	620	c.202G>A	c.(202-204)GAG>AAG	p.E68K	CASP10_uc002uxi.1_Missense_Mutation_p.E68K|CASP10_uc010zhn.1_RNA|CASP10_uc002uxj.1_Missense_Mutation_p.E68K|CASP10_uc002uxk.1_Missense_Mutation_p.E68K|CASP10_uc010fta.1_Missense_Mutation_p.E68K|CASP10_uc002uxm.1_Missense_Mutation_p.E68K|CASP10_uc010ftb.1_RNA	NM_032974	NP_116756	Q92851	CASPA_HUMAN	caspase 10 isoform b preproprotein	68	DED 1.			E -> G (in Ref. 2; AAB46730).	apoptosis|induction of apoptosis by extracellular signals|proteolysis	cytosol|plasma membrane	cysteine-type endopeptidase activity|identical protein binding|protein binding			skin(3)|ovary(1)|pancreas(1)|breast(1)	6						TCTCTTGGCAGAGGATCTGCT	0.488													16	77	---	---	---	---	PASS
MPP4	58538	broad.mit.edu	37	2	202521026	202521026	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202521026C>A	uc002uyk.3	-	17	1403	c.1195G>T	c.(1195-1197)GTG>TTG	p.V399L	MPP4_uc002uyi.3_Missense_Mutation_p.V17L|MPP4_uc010ftj.2_Missense_Mutation_p.V392L|MPP4_uc010zhq.1_Missense_Mutation_p.V368L|MPP4_uc010zhr.1_Missense_Mutation_p.V375L|MPP4_uc010zhs.1_Missense_Mutation_p.V324L|MPP4_uc002uyj.3_Missense_Mutation_p.V364L|MPP4_uc010zht.1_Missense_Mutation_p.V341L|MPP4_uc002uyl.3_RNA|MPP4_uc010ftk.2_Missense_Mutation_p.V355L	NM_033066	NP_149055	Q96JB8	MPP4_HUMAN	membrane protein, palmitoylated 4	399						cytoplasm	protein binding				0						GTGCAGCACACACTGGCATGC	0.612													3	0	---	---	---	---	PASS
WDR12	55759	broad.mit.edu	37	2	203760895	203760895	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:203760895G>C	uc002uzl.2	-	6	1252	c.502C>G	c.(502-504)CTC>GTC	p.L168V	WDR12_uc010ftt.2_Missense_Mutation_p.L168V	NM_018256	NP_060726	Q9GZL7	WDR12_HUMAN	WD repeat domain 12 protein	168	WD 2.|Sufficient for nucleolar localization.				cell proliferation|maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	nucleoplasm|PeBoW complex|preribosome, large subunit precursor	protein binding				0						TCCCATAAGAGAATAGTCTGA	0.393													17	124	---	---	---	---	PASS
CTLA4	1493	broad.mit.edu	37	2	204737534	204737534	+	Nonstop_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:204737534G>T	uc002vak.1	+	4	828	c.671G>T	c.(670-672)TGA>TTA	p.*224L	CTLA4_uc002val.1_3'UTR|CTLA4_uc010fty.1_3'UTR|CTLA4_uc010ftz.1_RNA	NM_005214	NP_005205	P16410	CTLA4_HUMAN	cytotoxic T-lymphocyte-associated protein 4	224					B cell receptor signaling pathway|immune response|negative regulation of B cell proliferation|negative regulation of regulatory T cell differentiation|positive regulation of apoptosis|response to DNA damage stimulus|T cell costimulation	clathrin-coated endocytic vesicle|external side of plasma membrane|Golgi apparatus|integral to plasma membrane|perinuclear region of cytoplasm					0					Abatacept(DB01281)	CCCATCAATTGAGAAACCATT	0.363													24	72	---	---	---	---	PASS
GPR1	2825	broad.mit.edu	37	2	207041686	207041686	+	Missense_Mutation	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:207041686A>C	uc002vbl.3	-	3	672	c.286T>G	c.(286-288)TAT>GAT	p.Y96D	GPR1_uc010fue.2_Missense_Mutation_p.Y96D|GPR1_uc010fuf.2_Missense_Mutation_p.Y96D	NM_005279	NP_005270	P46091	GPR1_HUMAN	G protein-coupled receptor 1	96	Extracellular (Potential).					integral to plasma membrane	G-protein coupled receptor activity				0		Lung NSC(271;7.93e-06)|Renal(323;0.000147)|Hepatocellular(293;0.000888)		UCEC - Uterine corpus endometrioid carcinoma (47;0.000241)|Epithelial(149;1.91e-37)|STAD - Stomach adenocarcinoma(1183;0.00178)|Lung(261;0.111)|LUSC - Lung squamous cell carcinoma(261;0.184)		ATGGCCACATAGGAGATGTAC	0.478													85	191	---	---	---	---	PASS
ZDBF2	57683	broad.mit.edu	37	2	207174260	207174260	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:207174260G>C	uc002vbp.2	+	5	5258	c.5008G>C	c.(5008-5010)GAA>CAA	p.E1670Q		NM_020923	NP_065974	Q9HCK1	ZDBF2_HUMAN	zinc finger, DBF-type containing 2	1670							nucleic acid binding|zinc ion binding			ovary(3)	3						ATTTAATTTGGAAGACACTTC	0.408													3	113	---	---	---	---	PASS
ADAM23	8745	broad.mit.edu	37	2	207459510	207459510	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:207459510G>A	uc002vbq.2	+	23	2351	c.2128G>A	c.(2128-2130)GAT>AAT	p.D710N	ADAM23_uc010ziv.1_RNA	NM_003812	NP_003803	O75077	ADA23_HUMAN	ADAM metallopeptidase domain 23 preproprotein	710	Extracellular (Potential).				cell adhesion|central nervous system development|proteolysis	extracellular region|integral to plasma membrane	integrin binding|metalloendopeptidase activity|zinc ion binding			skin(2)|ovary(1)	3				LUSC - Lung squamous cell carcinoma(261;0.0961)|Lung(261;0.182)|Epithelial(149;0.205)		CTATGTAGAAGATGGAACGCC	0.428													28	160	---	---	---	---	PASS
CPS1	1373	broad.mit.edu	37	2	211476995	211476995	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:211476995C>A	uc002vee.3	+	20	2678	c.2546C>A	c.(2545-2547)ACG>AAG	p.T849K	CPS1_uc010fur.2_Missense_Mutation_p.T855K|CPS1_uc010fus.2_Missense_Mutation_p.T398K	NM_001875	NP_001866	P31327	CPSM_HUMAN	carbamoyl-phosphate synthetase 1 isoform b	849					carbamoyl phosphate biosynthetic process|citrulline biosynthetic process|glutamine metabolic process|glycogen catabolic process|nitric oxide metabolic process|positive regulation of vasodilation|response to lipopolysaccharide|triglyceride catabolic process|urea cycle	mitochondrial nucleoid	ATP binding|carbamoyl-phosphate synthase (ammonia) activity			ovary(8)|central_nervous_system(3)|breast(1)|skin(1)	13				Epithelial(149;0.00697)|Lung(261;0.0521)|LUSC - Lung squamous cell carcinoma(261;0.0544)|all cancers(144;0.0843)		CCAAGCAGCACGCGTATCTAT	0.428													53	142	---	---	---	---	PASS
CPS1	1373	broad.mit.edu	37	2	211502462	211502462	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:211502462G>T	uc002vee.3	+	22	2856	c.2724G>T	c.(2722-2724)AAG>AAT	p.K908N	CPS1_uc010fur.2_Missense_Mutation_p.K914N|CPS1_uc010fus.2_Missense_Mutation_p.K457N	NM_001875	NP_001866	P31327	CPSM_HUMAN	carbamoyl-phosphate synthetase 1 isoform b	908					carbamoyl phosphate biosynthetic process|citrulline biosynthetic process|glutamine metabolic process|glycogen catabolic process|nitric oxide metabolic process|positive regulation of vasodilation|response to lipopolysaccharide|triglyceride catabolic process|urea cycle	mitochondrial nucleoid	ATP binding|carbamoyl-phosphate synthase (ammonia) activity			ovary(8)|central_nervous_system(3)|breast(1)|skin(1)	13				Epithelial(149;0.00697)|Lung(261;0.0521)|LUSC - Lung squamous cell carcinoma(261;0.0544)|all cancers(144;0.0843)		AAAGGGCAAAGGAGATTGGGT	0.418													32	154	---	---	---	---	PASS
CPS1	1373	broad.mit.edu	37	2	211512728	211512728	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:211512728G>A	uc002vee.3	+	26	3415	c.3283G>A	c.(3283-3285)GTC>ATC	p.V1095I	CPS1_uc010fur.2_Missense_Mutation_p.V1101I|CPS1_uc010fus.2_Missense_Mutation_p.V644I	NM_001875	NP_001866	P31327	CPSM_HUMAN	carbamoyl-phosphate synthetase 1 isoform b	1095	ATP-grasp 2.				carbamoyl phosphate biosynthetic process|citrulline biosynthetic process|glutamine metabolic process|glycogen catabolic process|nitric oxide metabolic process|positive regulation of vasodilation|response to lipopolysaccharide|triglyceride catabolic process|urea cycle	mitochondrial nucleoid	ATP binding|carbamoyl-phosphate synthase (ammonia) activity			ovary(8)|central_nervous_system(3)|breast(1)|skin(1)	13				Epithelial(149;0.00697)|Lung(261;0.0521)|LUSC - Lung squamous cell carcinoma(261;0.0544)|all cancers(144;0.0843)		CTTCTCAGCTGTCTTGGATGA	0.463													60	144	---	---	---	---	PASS
ERBB4	2066	broad.mit.edu	37	2	212483998	212483998	+	Silent	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:212483998A>C	uc002veg.1	-	19	2303	c.2205T>G	c.(2203-2205)GGT>GGG	p.G735G	ERBB4_uc002veh.1_Silent_p.G735G|ERBB4_uc010zji.1_Silent_p.G725G|ERBB4_uc010zjj.1_Silent_p.G725G|ERBB4_uc010fut.1_Silent_p.G735G	NM_005235	NP_005226	Q15303	ERBB4_HUMAN	v-erb-a erythroblastic leukemia viral oncogene	735	Protein kinase.|Cytoplasmic (Potential).				cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent|transmembrane receptor protein tyrosine kinase signaling pathway	basolateral plasma membrane|cytoplasm|integral to membrane|nucleus	ATP binding|protein binding|receptor signaling protein tyrosine kinase activity|transmembrane receptor protein tyrosine kinase activity			lung(21)|skin(5)|stomach(2)|breast(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	33		Renal(323;0.06)|Lung NSC(271;0.197)		UCEC - Uterine corpus endometrioid carcinoma (47;0.214)|Epithelial(149;5.86e-06)|all cancers(144;2.95e-05)|Lung(261;0.00244)|LUSC - Lung squamous cell carcinoma(224;0.00266)		GTACCCAAATACCCTTTGGGG	0.313										TSP Lung(8;0.080)			16	116	---	---	---	---	PASS
BARD1	580	broad.mit.edu	37	2	215595156	215595156	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:215595156G>C	uc002veu.2	-	10	2115	c.1980C>G	c.(1978-1980)AGC>AGG	p.S660R	BARD1_uc010zjm.1_Missense_Mutation_p.S516R	NM_000465	NP_000456	Q99728	BARD1_HUMAN	BRCA1 associated RING domain 1	660					cell cycle arrest|DNA repair|negative regulation of apoptosis|negative regulation of mRNA 3'-end processing|negative regulation of protein export from nucleus|positive regulation of apoptosis|positive regulation of protein catabolic process|protein K6-linked ubiquitination|regulation of phosphorylation|tissue homeostasis	BRCA1-A complex|BRCA1-BARD1 complex|cytoplasm	kinase binding|protein heterodimerization activity|protein homodimerization activity|RNA binding|ubiquitin-protein ligase activity|zinc ion binding			lung(2)	2		Renal(323;0.0243)		Epithelial(149;3.2e-06)|all cancers(144;0.000461)|LUSC - Lung squamous cell carcinoma(224;0.00829)|Lung(261;0.011)		TGTTGAGCCTGCTTCTGCGTG	0.363									Neuroblastoma_Familial_Clustering_of|Congenital_Central_Hypoventilation_Syndrome				46	122	---	---	---	---	PASS
TNS1	7145	broad.mit.edu	37	2	218682809	218682809	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:218682809G>A	uc002vgt.2	-	24	4332	c.3934C>T	c.(3934-3936)CCC>TCC	p.P1312S	TNS1_uc002vgr.2_Missense_Mutation_p.P1299S|TNS1_uc002vgs.2_Missense_Mutation_p.P1291S|TNS1_uc010zjv.1_Missense_Mutation_p.P1291S	NM_022648	NP_072174	Q9HBL0	TENS1_HUMAN	tensin	1312						cytoplasm|cytoskeleton|focal adhesion	actin binding			ovary(3)|breast(1)	4		Renal(207;0.0483)|Lung NSC(271;0.213)		Epithelial(149;4.43e-06)|all cancers(144;0.000653)|LUSC - Lung squamous cell carcinoma(224;0.0091)|Lung(261;0.013)		GGGCTGCCGGGAACCACAGAT	0.632													4	28	---	---	---	---	PASS
CXCR2	3579	broad.mit.edu	37	2	219000499	219000499	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219000499C>T	uc002vgz.1	+	4	1200	c.975C>T	c.(973-975)CTC>CTT	p.L325L	CXCR2_uc002vha.1_Silent_p.L325L|CXCR2_uc002vhb.1_Silent_p.L325L	NM_001557	NP_001548	P25025	CXCR2_HUMAN	interleukin 8 receptor beta	325	Cytoplasmic (Potential).				activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|cellular defense response|dendritic cell chemotaxis|inflammatory response|neutrophil activation|neutrophil chemotaxis|positive regulation of cell proliferation	cell surface|integral to plasma membrane|mast cell granule	interleukin-8 receptor activity			lung(1)|breast(1)	2						GCCATGGACTCCTCAAGATTC	0.542													32	151	---	---	---	---	PASS
ATG9A	79065	broad.mit.edu	37	2	220091598	220091598	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220091598C>G	uc002vke.1	-	5	391	c.205G>C	c.(205-207)GAG>CAG	p.E69Q	ATG9A_uc002vkd.1_RNA|ATG9A_uc002vkf.1_Missense_Mutation_p.E69Q|ANKZF1_uc010zkv.1_5'Flank|ANKZF1_uc010zkw.1_5'Flank|ANKZF1_uc002vkg.2_5'Flank|ANKZF1_uc002vkh.2_5'Flank	NM_001077198	NP_001070666	Q7Z3C6	ATG9A_HUMAN	APG9 autophagy 9-like 1	69	Helical; (Potential).				autophagic vacuole assembly|protein transport	autophagic vacuole membrane|cytoplasmic vesicle|Golgi apparatus|integral to membrane|late endosome membrane				skin(1)	1		Renal(207;0.0474)		Epithelial(149;1.37e-06)|all cancers(144;0.000222)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		TACATGAGCTCAAAGATCTCC	0.373													5	159	---	---	---	---	PASS
GLB1L	79411	broad.mit.edu	37	2	220103023	220103023	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220103023G>C	uc002vkm.2	-	14	1529	c.1290C>G	c.(1288-1290)TTC>TTG	p.F430L	GLB1L_uc002vkk.2_Missense_Mutation_p.F187L|GLB1L_uc010zkx.1_Missense_Mutation_p.F340L|GLB1L_uc002vkn.2_Missense_Mutation_p.F430L	NM_024506	NP_078782	Q6UWU2	GLB1L_HUMAN	galactosidase, beta 1-like precursor	430					carbohydrate metabolic process	extracellular region	cation binding|hydrolase activity, hydrolyzing O-glycosyl compounds				0		all_lung(227;1.19e-05)|Lung NSC(271;2.76e-05)|Medulloblastoma(418;0.0208)|Esophageal squamous(248;0.0559)		Epithelial(149;1.3e-11)|all cancers(144;2.07e-10)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		TTGGCACCCAGAATGGTGTTG	0.488													70	141	---	---	---	---	PASS
PTPRN	5798	broad.mit.edu	37	2	220161194	220161194	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220161194G>A	uc002vkz.2	-	17	2444	c.2355C>T	c.(2353-2355)GGC>GGT	p.G785G	PTPRN_uc010zlc.1_Silent_p.G695G|PTPRN_uc002vla.2_Silent_p.G756G|uc010zld.1_5'Flank|MIR153-1_hsa-mir-153-1|MI0000463_5'Flank	NM_002846	NP_002837	Q16849	PTPRN_HUMAN	protein tyrosine phosphatase, receptor type, N	785	Cytoplasmic (Potential).|Tyrosine-protein phosphatase.				response to reactive oxygen species	integral to plasma membrane	transmembrane receptor protein tyrosine phosphatase activity			ovary(2)|lung(1)|skin(1)	4		Renal(207;0.0474)		Epithelial(149;4.22e-07)|all cancers(144;8.82e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)|STAD - Stomach adenocarcinoma(1183;0.0875)		GGGACAGCGGGCCCTGCGTGG	0.597													44	104	---	---	---	---	PASS
CUL3	8452	broad.mit.edu	37	2	225371641	225371641	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:225371641C>G	uc002vny.2	-	7	1347	c.963G>C	c.(961-963)TTG>TTC	p.L321F	CUL3_uc010zls.1_Missense_Mutation_p.L255F|CUL3_uc010fwy.1_Missense_Mutation_p.L327F	NM_003590	NP_003581	Q13618	CUL3_HUMAN	cullin 3	321					cell cycle arrest|cell migration|cyclin catabolic process|cytokinesis|G1/S transition of mitotic cell cycle|induction of apoptosis by intracellular signals|mitotic anaphase|negative regulation of Rho protein signal transduction|positive regulation of cell proliferation|protein ubiquitination|stress fiber assembly	Cul3-RING ubiquitin ligase complex|Golgi apparatus|nucleus|polar microtubule	ubiquitin protein ligase binding			upper_aerodigestive_tract(1)|ovary(1)|liver(1)|kidney(1)	4		all_lung(227;0.00877)|Lung NSC(271;0.011)|Renal(207;0.0112)|all_hematologic(139;0.138)		Epithelial(121;1.58e-11)|all cancers(144;1.43e-08)|Lung(261;0.00863)|LUSC - Lung squamous cell carcinoma(224;0.00902)		CTTGCTCCCTCAAATAGGAAC	0.378													50	106	---	---	---	---	PASS
TRIP12	9320	broad.mit.edu	37	2	230638826	230638826	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:230638826T>A	uc002vpw.1	-	37	5565	c.5456A>T	c.(5455-5457)GAG>GTG	p.E1819V	TRIP12_uc002vpx.1_Missense_Mutation_p.E1867V|TRIP12_uc002vpy.1_Missense_Mutation_p.E1549V	NM_004238	NP_004229	Q14669	TRIPC_HUMAN	thyroid hormone receptor interactor 12	1819					protein ubiquitination involved in ubiquitin-dependent protein catabolic process	proteasome complex	thyroid hormone receptor binding|ubiquitin-protein ligase activity			ovary(4)|lung(2)|breast(1)|central_nervous_system(1)|skin(1)	9		Renal(207;0.025)|all_hematologic(139;0.122)|all_lung(227;0.126)|Acute lymphoblastic leukemia(138;0.164)		Epithelial(121;4.76e-13)|all cancers(144;4.34e-10)|LUSC - Lung squamous cell carcinoma(224;0.00864)|Lung(119;0.0116)		TAGATACTCCTCTAAATTGTG	0.463													44	132	---	---	---	---	PASS
TRIP12	9320	broad.mit.edu	37	2	230638827	230638827	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:230638827C>A	uc002vpw.1	-	37	5564	c.5455G>T	c.(5455-5457)GAG>TAG	p.E1819*	TRIP12_uc002vpx.1_Nonsense_Mutation_p.E1867*|TRIP12_uc002vpy.1_Nonsense_Mutation_p.E1549*	NM_004238	NP_004229	Q14669	TRIPC_HUMAN	thyroid hormone receptor interactor 12	1819					protein ubiquitination involved in ubiquitin-dependent protein catabolic process	proteasome complex	thyroid hormone receptor binding|ubiquitin-protein ligase activity			ovary(4)|lung(2)|breast(1)|central_nervous_system(1)|skin(1)	9		Renal(207;0.025)|all_hematologic(139;0.122)|all_lung(227;0.126)|Acute lymphoblastic leukemia(138;0.164)		Epithelial(121;4.76e-13)|all cancers(144;4.34e-10)|LUSC - Lung squamous cell carcinoma(224;0.00864)|Lung(119;0.0116)		AGATACTCCTCTAAATTGTGG	0.468													44	134	---	---	---	---	PASS
HTR2B	3357	broad.mit.edu	37	2	231973603	231973603	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:231973603G>C	uc002vro.2	-	4	1579	c.1074C>G	c.(1072-1074)CTC>CTG	p.L358L	PSMD1_uc002vrm.1_Intron|PSMD1_uc010fxu.1_Intron|PSMD1_uc002vrn.1_Intron|HTR2B_uc010fxv.2_Silent_p.L291L	NM_000867	NP_000858	P41595	5HT2B_HUMAN	5-hydroxytryptamine (serotonin) receptor 2B	358	Extracellular (By similarity).				activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|calcium-mediated signaling|cardiac muscle hypertrophy|cellular response to calcium ion|cellular response to temperature stimulus|cGMP biosynthetic process|embryonic morphogenesis|ERK1 and ERK2 cascade|G-protein coupled receptor internalization|heart morphogenesis|intestine smooth muscle contraction|negative regulation of apoptosis|negative regulation of autophagy|neural crest cell migration|phosphatidylinositol 3-kinase cascade|phosphatidylinositol biosynthetic process|phosphorylation|positive regulation of cell division|positive regulation of cytokine production|positive regulation of cytokine secretion|positive regulation of endothelial cell proliferation|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of MAP kinase activity|positive regulation of nitric-oxide synthase activity|protein kinase C signaling cascade|regulation of behavior|release of sequestered calcium ion into cytosol|response to drug|vasoconstriction	cytoplasm|integral to membrane|plasma membrane	calcium channel activity|drug binding|G-protein alpha-subunit binding|phosphatidylinositol phospholipase C activity|Ras GTPase activator activity|serotonin binding|serotonin receptor activity				0		Renal(207;0.025)|all_hematologic(139;0.094)|Acute lymphoblastic leukemia(138;0.164)|Medulloblastoma(418;0.232)		Epithelial(121;4.48e-11)|LUSC - Lung squamous cell carcinoma(224;0.0115)|Lung(119;0.0141)	Chlorprothixene(DB01239)|Eletriptan(DB00216)|Fenfluramine(DB00574)|Methotrimeprazine(DB01403)|Minaprine(DB00805)|Quetiapine(DB01224)|Sumatriptan(DB00669)|Tegaserod(DB01079)|Triflupromazine(DB00508)	GGAGCATTTGGAGAGTAGTTT	0.383													3	198	---	---	---	---	PASS
PDE6D	5147	broad.mit.edu	37	2	232603904	232603904	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:232603904C>T	uc002vse.1	-						PDE6D_uc002vsf.1_Intron	NM_002601	NP_002592	O43924	PDE6D_HUMAN	phosphodiesterase 6D						regulation of GTP catabolic process|response to stimulus|visual perception		3',5'-cyclic-nucleotide phosphodiesterase activity|GTPase inhibitor activity|protein binding				0		all_hematologic(139;0.00793)|Renal(207;0.0112)|Acute lymphoblastic leukemia(138;0.0182)|all_lung(227;0.142)		Epithelial(121;2.19e-12)|BRCA - Breast invasive adenocarcinoma(100;0.00145)|LUSC - Lung squamous cell carcinoma(224;0.0125)|Lung(119;0.0154)		AATTTCTGATCAAATATGACT	0.418													37	195	---	---	---	---	PASS
LRRFIP1	9208	broad.mit.edu	37	2	238672274	238672274	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:238672274G>A	uc002vxe.2	+	11	2210	c.1918G>A	c.(1918-1920)GAA>AAA	p.E640K	LRRFIP1_uc002vxc.2_Intron|LRRFIP1_uc010znm.1_Intron|LRRFIP1_uc002vxd.2_Missense_Mutation_p.E616K|LRRFIP1_uc002vxf.2_Missense_Mutation_p.E584K	NM_001137552	NP_001131024	Q32MZ4	LRRF1_HUMAN	leucine rich repeat (in FLII) interacting	640					negative regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	cytoplasm|cytoskeleton|nucleus	DNA binding|double-stranded RNA binding|protein binding			breast(3)	3		Breast(86;0.00257)|Renal(207;0.00571)|Ovarian(221;0.17)|all_hematologic(139;0.182)		Epithelial(121;9.75e-23)|OV - Ovarian serous cystadenocarcinoma(60;1.01e-10)|Kidney(56;4.85e-09)|KIRC - Kidney renal clear cell carcinoma(57;1.31e-07)|BRCA - Breast invasive adenocarcinoma(100;0.000151)|Lung(119;0.0137)|LUSC - Lung squamous cell carcinoma(224;0.0325)|COAD - Colon adenocarcinoma(134;0.228)		AGAAAGCAGTGAAAATGTTGA	0.423													11	38	---	---	---	---	PASS
PASK	23178	broad.mit.edu	37	2	242066101	242066101	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242066101G>A	uc002wao.1	-	10	2321	c.2229C>T	c.(2227-2229)CTC>CTT	p.L743L	PASK_uc010zol.1_Silent_p.L557L|PASK_uc010zom.1_Silent_p.L708L|PASK_uc010fzl.1_Silent_p.L743L|PASK_uc010zon.1_Silent_p.L524L|PASK_uc002wap.2_Silent_p.L286L|PASK_uc002waq.2_Silent_p.L743L	NM_015148	NP_055963	Q96RG2	PASK_HUMAN	PAS domain containing serine/threonine kinase	743					regulation of transcription, DNA-dependent	Golgi apparatus	ATP binding|identical protein binding|protein serine/threonine kinase activity|signal transducer activity			ovary(4)|lung(1)|skin(1)	6		all_cancers(19;4.46e-39)|all_epithelial(40;1.34e-17)|Breast(86;1.53e-05)|Renal(207;0.00179)|all_lung(227;0.00481)|Lung NSC(271;0.017)|Ovarian(221;0.0228)|Esophageal squamous(248;0.129)|all_hematologic(139;0.158)|Melanoma(123;0.16)|all_neural(83;0.243)|Hepatocellular(293;0.244)		Epithelial(32;1.34e-31)|all cancers(36;1e-28)|OV - Ovarian serous cystadenocarcinoma(60;3.53e-14)|Kidney(56;4.31e-09)|KIRC - Kidney renal clear cell carcinoma(57;4.35e-08)|BRCA - Breast invasive adenocarcinoma(100;5.64e-06)|Lung(119;0.000596)|LUSC - Lung squamous cell carcinoma(224;0.00481)|Colorectal(34;0.014)|COAD - Colon adenocarcinoma(134;0.0968)		AGAGTTCCTTGAGGTTCCAGG	0.547													47	98	---	---	---	---	PASS
PASK	23178	broad.mit.edu	37	2	242066878	242066878	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242066878G>A	uc002wao.1	-						PASK_uc010zol.1_Intron|PASK_uc010zom.1_Intron|PASK_uc010fzl.1_Intron|PASK_uc010zon.1_Intron|PASK_uc002wap.2_Intron|PASK_uc002waq.2_Intron	NM_015148	NP_055963	Q96RG2	PASK_HUMAN	PAS domain containing serine/threonine kinase						regulation of transcription, DNA-dependent	Golgi apparatus	ATP binding|identical protein binding|protein serine/threonine kinase activity|signal transducer activity			ovary(4)|lung(1)|skin(1)	6		all_cancers(19;4.46e-39)|all_epithelial(40;1.34e-17)|Breast(86;1.53e-05)|Renal(207;0.00179)|all_lung(227;0.00481)|Lung NSC(271;0.017)|Ovarian(221;0.0228)|Esophageal squamous(248;0.129)|all_hematologic(139;0.158)|Melanoma(123;0.16)|all_neural(83;0.243)|Hepatocellular(293;0.244)		Epithelial(32;1.34e-31)|all cancers(36;1e-28)|OV - Ovarian serous cystadenocarcinoma(60;3.53e-14)|Kidney(56;4.31e-09)|KIRC - Kidney renal clear cell carcinoma(57;4.35e-08)|BRCA - Breast invasive adenocarcinoma(100;5.64e-06)|Lung(119;0.000596)|LUSC - Lung squamous cell carcinoma(224;0.00481)|Colorectal(34;0.014)|COAD - Colon adenocarcinoma(134;0.0968)		TGGGGATAATGACATGGGTGA	0.507													29	96	---	---	---	---	PASS
FARP2	9855	broad.mit.edu	37	2	242312635	242312635	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242312635G>C	uc002wbi.1	+	2	230	c.113G>C	c.(112-114)AGA>ACA	p.R38T	FARP2_uc010zoq.1_Missense_Mutation_p.R38T|FARP2_uc010zor.1_Missense_Mutation_p.R38T	NM_014808	NP_055623	O94887	FARP2_HUMAN	FERM, RhoGEF and pleckstrin domain protein 2	38					axon guidance|neuron remodeling|Rac protein signal transduction|regulation of Rho protein signal transduction	cytoskeleton|cytosol|extrinsic to membrane	cytoskeletal protein binding|Rho guanyl-nucleotide exchange factor activity			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3		all_cancers(19;4.88e-34)|all_epithelial(40;4.81e-14)|Breast(86;0.000141)|Renal(207;0.0143)|all_lung(227;0.0344)|Lung NSC(271;0.0886)|Ovarian(221;0.0905)|Esophageal squamous(248;0.131)|all_hematologic(139;0.182)|Melanoma(123;0.238)		Epithelial(32;1.81e-33)|all cancers(36;1.61e-30)|OV - Ovarian serous cystadenocarcinoma(60;6.83e-15)|Kidney(56;1.19e-08)|KIRC - Kidney renal clear cell carcinoma(57;8.98e-08)|BRCA - Breast invasive adenocarcinoma(100;1.49e-06)|Lung(119;0.000152)|LUSC - Lung squamous cell carcinoma(224;0.00125)|Colorectal(34;0.0199)|COAD - Colon adenocarcinoma(134;0.121)		CTCTTGCCCAGAATGCAAGAG	0.507													12	92	---	---	---	---	PASS
CNTN4	152330	broad.mit.edu	37	3	3081838	3081838	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:3081838G>T	uc003bpc.2	+	19	2502	c.2281G>T	c.(2281-2283)GTG>TTG	p.V761L	CNTN4_uc003bpb.1_Missense_Mutation_p.V432L|CNTN4_uc003bpe.2_Missense_Mutation_p.V433L|CNTN4_uc003bpf.2_Missense_Mutation_p.V432L|CNTN4_uc003bpg.2_Missense_Mutation_p.V17L	NM_175607	NP_783200	Q8IWV2	CNTN4_HUMAN	contactin 4 isoform a precursor	761	Fibronectin type-III 2.				axon guidance|axonal fasciculation|brain development|negative regulation of neuron differentiation|neuron cell-cell adhesion|regulation of synaptic plasticity	anchored to membrane|axon|extracellular region|plasma membrane	protein binding			large_intestine(2)|ovary(2)|lung(1)|central_nervous_system(1)|pancreas(1)	7		Ovarian(110;0.156)		Epithelial(13;0.000695)|all cancers(10;0.0047)|OV - Ovarian serous cystadenocarcinoma(96;0.01)		CTCTAGATACGTGTTCAGGAA	0.522													62	112	---	---	---	---	PASS
CAV3	859	broad.mit.edu	37	3	8787497	8787497	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:8787497G>A	uc003bra.2	+	2	467	c.400G>A	c.(400-402)GCG>ACG	p.A134T	C3orf32_uc003bqz.2_5'Flank|CAV3_uc003brb.2_Missense_Mutation_p.A134T	NM_001234	NP_001225	P56539	CAV3_HUMAN	caveolin 3	134	Cytoplasmic (Potential).				cell growth|elevation of cytosolic calcium ion concentration|muscle organ development|negative regulation of cardiac muscle hypertrophy|negative regulation of cell size|negative regulation of MAP kinase activity|negative regulation of sarcomere organization|positive regulation of microtubule polymerization|regulation of skeletal muscle contraction|regulation of ventricular cardiomyocyte membrane repolarization|T-tubule organization	caveola|dystrophin-associated glycoprotein complex|Golgi membrane|neuromuscular junction|T-tubule	protein C-terminus binding|protein complex binding|protein complex scaffold|sodium channel regulator activity			lung(1)|breast(1)	2						CCCACTCTTCGCGGCCCTGGG	0.622													34	63	---	---	---	---	PASS
IL17RE	132014	broad.mit.edu	37	3	9945092	9945092	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:9945092C>G	uc003btu.2	+	3	261	c.144C>G	c.(142-144)TTC>TTG	p.F48L	CIDEC_uc003bto.2_Intron|IL17RE_uc003btv.2_Missense_Mutation_p.F48L|IL17RE_uc011atn.1_Intron|IL17RE_uc003btw.2_Missense_Mutation_p.F48L|IL17RE_uc003btx.2_Intron|IL17RE_uc010hcq.2_Missense_Mutation_p.F48L|IL17RE_uc003bty.2_Intron	NM_153483	NP_705616	Q8NFR9	I17RE_HUMAN	interleukin 17 receptor E isoform 1	48	Extracellular (Potential).					cytoplasm|extracellular region|integral to membrane	receptor activity			central_nervous_system(1)	1				OV - Ovarian serous cystadenocarcinoma(96;5.34e-64)		ATGACAGTTTCACTGGTGAGT	0.507													46	88	---	---	---	---	PASS
CCR4	1233	broad.mit.edu	37	3	32995269	32995269	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:32995269G>A	uc003cfg.1	+	2	523	c.355G>A	c.(355-357)GTG>ATG	p.V119M		NM_005508	NP_005499	P51679	CCR4_HUMAN	chemokine (C-C motif) receptor 4	119	Helical; Name=3; (Potential).				chemotaxis|elevation of cytosolic calcium ion concentration|immune response|inflammatory response	integral to plasma membrane				lung(1)	1						GATGTACTTGGTGGGCTTTTA	0.483													25	354	---	---	---	---	PASS
TRANK1	9881	broad.mit.edu	37	3	36875113	36875113	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:36875113G>T	uc003cgj.2	-	12	4481	c.4179C>A	c.(4177-4179)TTC>TTA	p.F1393L		NM_014831	NP_055646	O15050	TRNK1_HUMAN	lupus brain antigen 1	1943					DNA repair		ATP binding|ATP-dependent DNA helicase activity|DNA binding			ovary(1)|central_nervous_system(1)	2						ATGAGGCCTGGAAGTCCTTGT	0.577													9	40	---	---	---	---	PASS
ITGA9	3680	broad.mit.edu	37	3	37560748	37560748	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:37560748C>G	uc003chd.2	+						ITGA9_uc003chc.2_Intron	NM_002207	NP_002198	Q13797	ITA9_HUMAN	integrin, alpha 9 precursor						axon guidance|cell adhesion|integrin-mediated signaling pathway	integrin complex	receptor activity			breast(3)|pancreas(1)|lung(1)|skin(1)	6				KIRC - Kidney renal clear cell carcinoma(284;0.165)|Kidney(284;0.197)		TTTTTACCCTCAGATGTGGCC	0.463													8	45	---	---	---	---	PASS
DLEC1	9940	broad.mit.edu	37	3	38158078	38158078	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38158078G>A	uc003cho.1	+	28	4012	c.3991G>A	c.(3991-3993)GAG>AAG	p.E1331K	DLEC1_uc003chp.1_Missense_Mutation_p.E1331K|DLEC1_uc010hgv.1_Missense_Mutation_p.E1334K|DLEC1_uc003chr.1_Missense_Mutation_p.E402K|DLEC1_uc010hgx.1_RNA|DLEC1_uc003chs.1_5'Flank	NM_007335	NP_031361	Q9Y238	DLEC1_HUMAN	deleted in lung and esophageal cancer 1 isoform	1331					negative regulation of cell proliferation	cytoplasm				ovary(2)|pancreas(2)|central_nervous_system(2)|skin(2)|breast(1)	9				KIRC - Kidney renal clear cell carcinoma(284;0.0664)|Kidney(284;0.0827)		TGATACCCCTGAGGGTGGCTG	0.622													4	164	---	---	---	---	PASS
OXSR1	9943	broad.mit.edu	37	3	38240203	38240203	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38240203C>G	uc003chy.2	+						OXSR1_uc010hhb.2_Intron|OXSR1_uc010hha.1_Intron	NM_005109	NP_005100	O95747	OXSR1_HUMAN	oxidative-stress responsive 1						intracellular protein kinase cascade|response to oxidative stress		ATP binding|identical protein binding|magnesium ion binding|protein serine/threonine kinase activity			skin(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.0588)|Kidney(284;0.0738)		ATTATGTCTTCTGTTTTCAGG	0.343													4	105	---	---	---	---	PASS
MYRIP	25924	broad.mit.edu	37	3	40231546	40231546	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:40231546G>A	uc003cka.2	+	10	1392	c.1257G>A	c.(1255-1257)AGG>AGA	p.R419R	MYRIP_uc010hhu.2_RNA|MYRIP_uc010hhv.2_Silent_p.R419R|MYRIP_uc010hhw.2_Silent_p.R330R|MYRIP_uc011ayz.1_Silent_p.R232R|uc003ckb.2_Intron	NM_015460	NP_056275	Q8NFW9	MYRIP_HUMAN	myosin VIIA and Rab interacting protein	419	Myosin-binding.				intracellular protein transport		actin binding|zinc ion binding			ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	5				KIRC - Kidney renal clear cell carcinoma(284;0.174)|Kidney(284;0.206)		CCCTGCCCAGGAACCCCCAGC	0.632													50	95	---	---	---	---	PASS
ZNF621	285268	broad.mit.edu	37	3	40571743	40571743	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:40571743G>A	uc003ckm.2	+	4	411	c.195G>A	c.(193-195)GAG>GAA	p.E65E	ZNF621_uc003ckn.2_Silent_p.E65E|ZNF621_uc003cko.2_Silent_p.E30E|ZNF621_uc011aze.1_Silent_p.E57E	NM_001098414	NP_001091884	Q6ZSS3	ZN621_HUMAN	zinc finger protein 621	65	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.0515)|Kidney(284;0.0648)		CCCACCTGGAGAGAGGGGAAG	0.507													18	145	---	---	---	---	PASS
ZNF502	91392	broad.mit.edu	37	3	44763395	44763395	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:44763395G>C	uc011baa.1	+	4	1341	c.1086G>C	c.(1084-1086)CAG>CAC	p.Q362H	ZNF502_uc003cns.2_Missense_Mutation_p.Q362H|ZNF502_uc011bab.1_Missense_Mutation_p.Q362H|ZNF502_uc003cnt.2_Missense_Mutation_p.Q362H	NM_001134440	NP_001127912	Q8TBZ5	ZN502_HUMAN	zinc finger protein 502	362	C2H2-type 8.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				BRCA - Breast invasive adenocarcinoma(193;0.00855)|KIRC - Kidney renal clear cell carcinoma(197;0.0471)|Kidney(197;0.0589)		CCTTTTGTCAGAGCCCATCTC	0.403													47	69	---	---	---	---	PASS
SCAP	22937	broad.mit.edu	37	3	47462159	47462159	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:47462159G>A	uc003crh.1	-	12	1703	c.1448C>T	c.(1447-1449)TCC>TTC	p.S483F	SCAP_uc011baz.1_Missense_Mutation_p.S228F|SCAP_uc003crg.2_Missense_Mutation_p.S91F	NM_012235	NP_036367	Q12770	SCAP_HUMAN	SREBF chaperone protein	483	Cytoplasmic (By similarity).				cholesterol metabolic process|negative regulation of cholesterol biosynthetic process|positive regulation of low-density lipoprotein particle receptor biosynthetic process|positive regulation of transcription via sterol regulatory element binding involved in ER-nuclear sterol response pathway	endoplasmic reticulum membrane|ER to Golgi transport vesicle membrane|Golgi membrane|integral to membrane	unfolded protein binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.000278)|KIRC - Kidney renal clear cell carcinoma(197;0.00592)|Kidney(197;0.00679)		GTGGGGTGTGGACGGCCTCAC	0.662											OREG0015548	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	3	33	---	---	---	---	PASS
CCDC51	79714	broad.mit.edu	37	3	48474121	48474121	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48474121C>G	uc003csz.2	-	4	1054	c.933G>C	c.(931-933)AGG>AGC	p.R311S	PLXNB1_uc003csx.2_5'Flank|CCDC51_uc003cta.2_Missense_Mutation_p.R202S|CCDC51_uc003ctb.2_Missense_Mutation_p.R202S|CCDC51_uc003ctc.2_Missense_Mutation_p.R311S|CCDC51_uc003ctd.2_Missense_Mutation_p.R202S	NM_024661	NP_078937	Q96ER9	CCD51_HUMAN	coiled-coil domain containing 51	311						integral to membrane					0				BRCA - Breast invasive adenocarcinoma(193;0.000293)|KIRC - Kidney renal clear cell carcinoma(197;0.00551)|Kidney(197;0.00621)		AATGGACTTGCCTGGAATGAC	0.517													41	73	---	---	---	---	PASS
DNAH1	25981	broad.mit.edu	37	3	52360904	52360904	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52360904G>T	uc011bef.1	+	5	996	c.735G>T	c.(733-735)CTG>CTT	p.L245L	DNAH1_uc003ddt.1_Silent_p.L245L	NM_015512	NP_056327	Q9P2D7	DYH1_HUMAN	dynein, axonemal, heavy chain 1	245	Stem (By similarity).				ciliary or flagellar motility|microtubule-based movement|response to mechanical stimulus	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			large_intestine(3)	3				BRCA - Breast invasive adenocarcinoma(193;2.02e-05)|OV - Ovarian serous cystadenocarcinoma(275;0.000207)|Kidney(197;0.0022)|KIRC - Kidney renal clear cell carcinoma(197;0.00245)		ACCTCCCACTGAAGGTGAGCC	0.597													5	25	---	---	---	---	PASS
DNAH1	25981	broad.mit.edu	37	3	52420190	52420190	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52420190C>T	uc011bef.1	+	55	8901	c.8640C>T	c.(8638-8640)ATC>ATT	p.I2880I	DNAH1_uc003ddv.2_5'UTR	NM_015512	NP_056327	Q9P2D7	DYH1_HUMAN	dynein, axonemal, heavy chain 1	2880	Potential.|Stalk (By similarity).				ciliary or flagellar motility|microtubule-based movement|response to mechanical stimulus	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			large_intestine(3)	3				BRCA - Breast invasive adenocarcinoma(193;2.02e-05)|OV - Ovarian serous cystadenocarcinoma(275;0.000207)|Kidney(197;0.0022)|KIRC - Kidney renal clear cell carcinoma(197;0.00245)		ATACGGCCATCGCCGAGGAGA	0.428													5	31	---	---	---	---	PASS
PBRM1	55193	broad.mit.edu	37	3	52643429	52643429	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52643429C>G	uc003des.2	-	16	2479	c.2467G>C	c.(2467-2469)GAC>CAC	p.D823H	PBRM1_uc003dex.2_RNA|PBRM1_uc003deq.2_Missense_Mutation_p.D823H|PBRM1_uc003der.2_Missense_Mutation_p.D791H|PBRM1_uc003det.2_Missense_Mutation_p.D838H|PBRM1_uc003deu.2_Missense_Mutation_p.D838H|PBRM1_uc003dev.2_RNA|PBRM1_uc003dew.2_Missense_Mutation_p.D823H|PBRM1_uc010hmk.1_Missense_Mutation_p.D823H|PBRM1_uc003dey.2_Missense_Mutation_p.D823H|PBRM1_uc003dez.1_Missense_Mutation_p.D823H|PBRM1_uc003dfb.1_Missense_Mutation_p.D736H|PBRM1_uc003dfa.1_Missense_Mutation_p.D169H|PBRM1_uc003dfc.2_Missense_Mutation_p.D190H	NM_181042	NP_060635	Q86U86	PB1_HUMAN	polybromo 1 isoform 4	823	Bromo 6.				chromatin remodeling|mitosis|negative regulation of cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear chromosome	chromatin binding|DNA binding|protein binding			kidney(136)|breast(4)	140				BRCA - Breast invasive adenocarcinoma(193;1.8e-05)|Kidney(197;0.00105)|KIRC - Kidney renal clear cell carcinoma(197;0.00122)|OV - Ovarian serous cystadenocarcinoma(275;0.0613)		CTAATTATGTCAAATGTAAGG	0.403			Mis|N|F|S|D|O		clear cell renal carcinoma|breast								57	114	---	---	---	---	PASS
NEK4	6787	broad.mit.edu	37	3	52778246	52778246	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52778246C>G	uc003dfq.3	-						NEK4_uc011bej.1_Intron|NEK4_uc003dfr.2_Intron	NM_003157	NP_003148	P51957	NEK4_HUMAN	NIMA-related kinase 4						cell division|mitosis	nucleus	ATP binding|metal ion binding|protein serine/threonine kinase activity			large_intestine(1)	1				BRCA - Breast invasive adenocarcinoma(193;7.44e-05)|Kidney(197;0.000711)|KIRC - Kidney renal clear cell carcinoma(197;0.00086)|OV - Ovarian serous cystadenocarcinoma(275;0.0513)		GAAAAGAAGTCAACTTTACCT	0.428													4	455	---	---	---	---	PASS
APPL1	26060	broad.mit.edu	37	3	57291330	57291330	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:57291330C>G	uc003dio.2	+	15	1451	c.1304C>G	c.(1303-1305)TCT>TGT	p.S435C	APPL1_uc010hnb.2_Missense_Mutation_p.S435C|APPL1_uc011bey.1_Missense_Mutation_p.S418C	NM_012096	NP_036228	Q9UKG1	DP13A_HUMAN	adaptor protein, phosphotyrosine interaction, PH	435					apoptosis|cell cycle|cell proliferation|insulin receptor signaling pathway|regulation of apoptosis|regulation of establishment of protein localization in plasma membrane|regulation of glucose import	cytosol|early endosome membrane|microsome|nucleus|vesicle membrane	protein kinase B binding			breast(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.0124)|Kidney(284;0.0144)		GGATCTGAGTCTACAAATTTG	0.458													54	115	---	---	---	---	PASS
FLNB	2317	broad.mit.edu	37	3	58134386	58134386	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:58134386C>T	uc003djj.2	+	36	6063	c.5898C>T	c.(5896-5898)TTC>TTT	p.F1966F	FLNB_uc010hne.2_Silent_p.F1997F|FLNB_uc003djk.2_Silent_p.F1955F|FLNB_uc010hnf.2_Silent_p.F1942F|FLNB_uc003djl.2_Silent_p.F1786F|FLNB_uc003djm.2_Silent_p.F1773F|FLNB_uc010hng.1_5'Flank	NM_001457	NP_001448	O75369	FLNB_HUMAN	filamin B isoform 2	1966	Filamin 18.|Interaction with the cytoplasmic tail of GP1BA.				actin cytoskeleton organization|cell differentiation|cytoskeletal anchoring at plasma membrane|signal transduction	cell cortex|integral to membrane|nucleus|sarcomere	actin binding			breast(8)|ovary(5)|lung(3)|skin(2)|central_nervous_system(1)	19				BRCA - Breast invasive adenocarcinoma(55;0.000335)|KIRC - Kidney renal clear cell carcinoma(284;0.0726)|Kidney(284;0.0898)		GCATCTCCTTCATCCCCCGGG	0.527													25	44	---	---	---	---	PASS
ATXN7	6314	broad.mit.edu	37	3	63965681	63965681	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:63965681G>C	uc003dlw.3	+	6	1143	c.590G>C	c.(589-591)GGA>GCA	p.G197A	ATXN7_uc003dlv.2_Missense_Mutation_p.G197A|ATXN7_uc010hnv.2_Missense_Mutation_p.G197A|ATXN7_uc010hnw.2_Missense_Mutation_p.G52A|ATXN7_uc011bfn.1_Missense_Mutation_p.G52A	NM_000333	NP_000324	O15265	ATX7_HUMAN	ataxin 7 isoform a	197	Ser-rich.				cell death|histone deubiquitination|nucleus organization|regulation of transcription, DNA-dependent|transcription, DNA-dependent|visual perception	cytoplasm|nuclear matrix|nucleolus	protein binding|zinc ion binding				0		Prostate(884;0.0181)		BRCA - Breast invasive adenocarcinoma(55;0.000614)|KIRC - Kidney renal clear cell carcinoma(15;0.00294)|Kidney(15;0.00305)		AAAAGCAAAGGAGGCAGTGCA	0.478													11	128	---	---	---	---	PASS
PSMD6	9861	broad.mit.edu	37	3	64004611	64004611	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:64004611G>C	uc003dma.1	-	4	625	c.600C>G	c.(598-600)CTC>CTG	p.L200L	PSMD6_uc003dlz.1_Silent_p.L151L|PSMD6_uc003dmb.1_Silent_p.L253L|PSMD6_uc003dmc.1_Silent_p.L161L|PSMD6_uc003dmd.1_Silent_p.L162L	NM_014814	NP_055629	Q15008	PSMD6_HUMAN	proteasome (prosome, macropain) 26S subunit,	200	PCI.				anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	proteasome complex	ATPase activity|protein binding			central_nervous_system(1)|skin(1)	2		Lung NSC(201;0.136)		BRCA - Breast invasive adenocarcinoma(55;0.000805)|Kidney(15;0.00188)|KIRC - Kidney renal clear cell carcinoma(15;0.00212)		TGTCAAGGAAGAGTTCAGCTG	0.388													50	289	---	---	---	---	PASS
FLJ10213	55096	broad.mit.edu	37	3	73111632	73111632	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:73111632G>C	uc003dpj.2	+	1	823	c.400G>C	c.(400-402)GAT>CAT	p.D134H	PPP4R2_uc003dph.1_Intron|PPP4R2_uc003dpi.1_Intron	NM_018029	NP_060499	Q6P2I7	EBLN2_HUMAN	hypothetical protein LOC55096	134							protein binding				0		Prostate(10;0.0187)|Lung SC(41;0.236)		Epithelial(33;3.9e-05)|BRCA - Breast invasive adenocarcinoma(55;7.72e-05)|LUSC - Lung squamous cell carcinoma(21;0.00156)|Lung(16;0.00487)|KIRC - Kidney renal clear cell carcinoma(39;0.012)|Kidney(39;0.0139)		TTTCATATTTGATGGGTTACA	0.433													4	42	---	---	---	---	PASS
EPHA6	285220	broad.mit.edu	37	3	96706180	96706180	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:96706180G>A	uc010how.1	+	3	500	c.457G>A	c.(457-459)GCC>ACC	p.A153T	EPHA6_uc003drp.1_Missense_Mutation_p.A153T	NM_001080448	NP_001073917	Q9UF33	EPHA6_HUMAN	EPH receptor A6 isoform a	58	Ephrin-binding.|Extracellular (Potential).					integral to plasma membrane	ATP binding|ephrin receptor activity			stomach(5)|lung(4)|central_nervous_system(3)|breast(1)|skin(1)|ovary(1)|kidney(1)	16						GCAGTGGGATGCCATCACTGA	0.328													25	183	---	---	---	---	PASS
ARL6	84100	broad.mit.edu	37	3	97510649	97510649	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97510649G>T	uc003drv.2	+	8	827	c.514G>T	c.(514-516)GAA>TAA	p.E172*	ARL6_uc003drw.2_RNA|ARL6_uc003dru.2_Nonsense_Mutation_p.E172*|ARL6_uc010hoy.2_Nonsense_Mutation_p.E172*	NM_177976	NP_816931	Q9H0F7	ARL6_HUMAN	ADP-ribosylation factor-like 6	172					cilium assembly|determination of left/right symmetry|melanosome transport|protein polymerization|protein targeting to membrane|small GTPase mediated signal transduction|visual perception|Wnt receptor signaling pathway	axonemal microtubule|cilium axoneme|cilium membrane|membrane coat|microtubule basal body	GTP binding|metal ion binding|phospholipid binding|protein binding				0		Lung NSC(201;0.0193)|Prostate(884;0.174)		LUSC - Lung squamous cell carcinoma(29;0.0118)|Lung(72;0.0189)		AGGCTTGCAAGAAGGTGTAGA	0.299									Bardet-Biedl_syndrome				25	127	---	---	---	---	PASS
GABRR3	200959	broad.mit.edu	37	3	97731304	97731304	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97731304C>T	uc011bgr.1	-	4	414	c.414G>A	c.(412-414)AAG>AAA	p.K138K		NM_001105580	NP_001099050	A8MPY1	GBRR3_HUMAN	gamma-aminobutyric acid (GABA) receptor, rho 3	138	Extracellular (Potential).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity				0						GCACCCAGATCTTTCTGGTCA	0.418													30	149	---	---	---	---	PASS
OR5H15	403274	broad.mit.edu	37	3	97888090	97888090	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97888090C>A	uc011bgu.1	+	1	547	c.547C>A	c.(547-549)CCA>ACA	p.P183T		NM_001005515	NP_001005515	A6NDH6	O5H15_HUMAN	olfactory receptor, family 5, subfamily H,	183	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity	p.P183L(1)		ovary(1)|skin(1)	2						TGACACTATCCCATTGTCTAA	0.313													12	76	---	---	---	---	PASS
OR5K4	403278	broad.mit.edu	37	3	98072901	98072901	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:98072901G>C	uc011bgv.1	+	1	204	c.204G>C	c.(202-204)CTG>CTC	p.L68L		NM_001005517	NP_001005517	A6NMS3	OR5K4_HUMAN	olfactory receptor, family 5, subfamily K,	68	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			central_nervous_system(1)	1						ACCTGGCTCTGATGGATTCCT	0.433													256	539	---	---	---	---	PASS
OR5K1	26339	broad.mit.edu	37	3	98188414	98188414	+	5'Flank	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:98188414G>A	uc003dsm.2	+							NM_001004736	NP_001004736	Q8NHB7	OR5K1_HUMAN	olfactory receptor, family 5, subfamily K,						sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(1)	1						TTTCAGACAAGTCAGGAATGG	0.383													66	143	---	---	---	---	PASS
OR5K2	402135	broad.mit.edu	37	3	98216823	98216823	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:98216823A>G	uc011bgx.1	+	1	299	c.299A>G	c.(298-300)CAG>CGG	p.Q100R		NM_001004737	NP_001004737	Q8NHB8	OR5K2_HUMAN	olfactory receptor, family 5, subfamily K,	100	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2						TGTGCAGTACAGTTTTATTTT	0.468													51	353	---	---	---	---	PASS
DCBLD2	131566	broad.mit.edu	37	3	98538068	98538068	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:98538068C>G	uc003dtd.2	-	8	1428	c.1065G>C	c.(1063-1065)TTG>TTC	p.L355F	DCBLD2_uc003dte.2_Missense_Mutation_p.L355F	NM_080927	NP_563615	Q96PD2	DCBD2_HUMAN	discoidin, CUB and LCCL domain containing 2	355	Extracellular (Potential).|F5/8 type C.				cell adhesion|intracellular receptor mediated signaling pathway|negative regulation of cell growth|wound healing	cell surface|integral to plasma membrane				ovary(2)|central_nervous_system(1)	3						TTTCCTTATTCAAATCTATTT	0.338													8	21	---	---	---	---	PASS
GPR128	84873	broad.mit.edu	37	3	100413697	100413697	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100413697C>T	uc003duc.2	+	16	2514	c.2246C>T	c.(2245-2247)TCA>TTA	p.S749L	GPR128_uc011bhc.1_Missense_Mutation_p.S450L|GPR128_uc003dud.2_Missense_Mutation_p.S272L	NM_032787	NP_116176	Q96K78	GP128_HUMAN	G protein-coupled receptor 128 precursor	749	Cytoplasmic (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)|skin(1)	4						TCATTGCCTTCAGTGACGCGG	0.443													42	98	---	---	---	---	PASS
ZPLD1	131368	broad.mit.edu	37	3	102175084	102175084	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:102175084G>T	uc003dvs.1	+	11	1257	c.375G>T	c.(373-375)GTG>GTT	p.V125V	ZPLD1_uc003dvt.1_Silent_p.V141V|ZPLD1_uc011bhg.1_Silent_p.V125V	NM_175056	NP_778226	Q8TCW7	ZPLD1_HUMAN	zona pellucida-like domain containing 1	125	ZP.|Extracellular (Potential).					integral to membrane				ovary(2)|skin(2)|central_nervous_system(1)	5						CAACTTCAGTGCAAGTAGGAA	0.358													53	240	---	---	---	---	PASS
ALCAM	214	broad.mit.edu	37	3	105238952	105238952	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:105238952A>G	uc003dvx.2	+	2	655	c.115A>G	c.(115-117)ATT>GTT	p.I39V	ALCAM_uc003dvv.2_Missense_Mutation_p.I39V|ALCAM_uc003dvw.1_Missense_Mutation_p.I39V|ALCAM_uc003dvy.2_Missense_Mutation_p.I39V|ALCAM_uc011bhh.1_5'UTR	NM_001627	NP_001618	Q13740	CD166_HUMAN	activated leukocyte cell adhesion molecule	39	Extracellular (Potential).|Ig-like V-type 1.				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(2)|breast(1)	3						TGGAGATACCATTATCATACC	0.318													70	152	---	---	---	---	PASS
MYH15	22989	broad.mit.edu	37	3	108174595	108174595	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108174595A>T	uc003dxa.1	-	21	2367	c.2310T>A	c.(2308-2310)TTT>TTA	p.F770L		NM_014981	NP_055796	Q9Y2K3	MYH15_HUMAN	myosin, heavy polypeptide 15	770	Myosin head-like.|Actin-binding (By similarity).					myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity			ovary(5)|central_nervous_system(2)	7						TAGTGATTCCAAATCGGTACT	0.418													39	218	---	---	---	---	PASS
KIAA1524	57650	broad.mit.edu	37	3	108279531	108279531	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108279531C>T	uc003dxb.3	-	14	2061	c.1792G>A	c.(1792-1794)GAA>AAA	p.E598K	KIAA1524_uc010hpv.1_3'UTR	NM_020890	NP_065941	Q8TCG1	CIP2A_HUMAN	p90 autoantigen	598						cytoplasm|integral to membrane	protein binding			ovary(2)|central_nervous_system(1)	3						ATTAATTCTTCAATATTCAAT	0.348													13	399	---	---	---	---	PASS
DPPA4	55211	broad.mit.edu	37	3	109049596	109049596	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:109049596C>G	uc003dxq.3	-	5	509	c.454G>C	c.(454-456)GAA>CAA	p.E152Q	DPPA4_uc011bho.1_Intron|DPPA4_uc011bhp.1_Missense_Mutation_p.E152Q	NM_018189	NP_060659	Q7L190	DPPA4_HUMAN	developmental pluripotency associated 4	152						nucleus	protein binding			upper_aerodigestive_tract(1)	1						TCCCCCTTTTCCACCTTTAAT	0.438													8	194	---	---	---	---	PASS
PHLDB2	90102	broad.mit.edu	37	3	111603055	111603055	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111603055C>T	uc010hqa.2	+	2	542	c.131C>T	c.(130-132)TCT>TTT	p.S44F	PHLDB2_uc003dyc.2_Missense_Mutation_p.S71F|PHLDB2_uc003dyd.2_Missense_Mutation_p.S44F|PHLDB2_uc003dyg.2_Missense_Mutation_p.S44F|PHLDB2_uc003dyh.2_Missense_Mutation_p.S44F|PHLDB2_uc003dye.3_Missense_Mutation_p.S44F|PHLDB2_uc003dyf.3_Missense_Mutation_p.S44F	NM_001134438	NP_001127910	Q86SQ0	PHLB2_HUMAN	pleckstrin homology-like domain, family B,	44						cytoplasm|intermediate filament cytoskeleton|plasma membrane				ovary(4)|skin(2)	6						AAGAAATACTCTTCCAGTCTG	0.448													47	328	---	---	---	---	PASS
PHLDB2	90102	broad.mit.edu	37	3	111603312	111603312	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111603312C>G	uc010hqa.2	+	2	799	c.388C>G	c.(388-390)CAT>GAT	p.H130D	PHLDB2_uc003dyc.2_Missense_Mutation_p.H157D|PHLDB2_uc003dyd.2_Missense_Mutation_p.H130D|PHLDB2_uc003dyg.2_Missense_Mutation_p.H130D|PHLDB2_uc003dyh.2_Missense_Mutation_p.H130D|PHLDB2_uc003dye.3_Missense_Mutation_p.H130D|PHLDB2_uc003dyf.3_Missense_Mutation_p.H130D	NM_001134438	NP_001127910	Q86SQ0	PHLB2_HUMAN	pleckstrin homology-like domain, family B,	130						cytoplasm|intermediate filament cytoskeleton|plasma membrane				ovary(4)|skin(2)	6						AGACTTTGATCATTATACTGG	0.443													61	498	---	---	---	---	PASS
GCET2	257144	broad.mit.edu	37	3	111842400	111842400	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111842400C>T	uc003dys.1	-	6	589	c.439G>A	c.(439-441)GAA>AAA	p.E147K	C3orf52_uc011bht.1_Intron|C3orf52_uc003dyr.1_Intron|GCET2_uc003dyt.1_Missense_Mutation_p.E81K	NM_152785	NP_689998	Q8N6F7	GCET2_HUMAN	germinal center expressed transcript 2 isoform	147						mitochondrion					0						AGTTCATATTCATCTTCTGGG	0.418													12	265	---	---	---	---	PASS
WDR52	55779	broad.mit.edu	37	3	113138899	113138899	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113138899G>A	uc003eae.1	-	5	581	c.535C>T	c.(535-537)CGA>TGA	p.R179*		NM_018338	NP_060808	Q96MT7	WDR52_HUMAN	WD repeat domain 52 isoform 2	179										central_nervous_system(1)	1						CTGCTACTTCGCAGGTAGATC	0.433													56	94	---	---	---	---	PASS
GRAMD1C	54762	broad.mit.edu	37	3	113563411	113563411	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113563411C>G	uc003eaq.3	+	2	165	c.89C>G	c.(88-90)CCT>CGT	p.P30R	GRAMD1C_uc011bil.1_RNA|GRAMD1C_uc011bim.1_RNA	NM_017577	NP_060047	Q8IYS0	GRM1C_HUMAN	GRAM domain containing 1C	30						integral to membrane				ovary(2)|skin(1)	3						GAGGAAAATCCTAGTCCAACT	0.373													26	241	---	---	---	---	PASS
GRAMD1C	54762	broad.mit.edu	37	3	113664295	113664295	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113664295G>A	uc003eaq.3	+	18	2035	c.1959G>A	c.(1957-1959)AAG>AAA	p.K653K	GRAMD1C_uc011bil.1_RNA|GRAMD1C_uc003ear.2_Silent_p.K486K|GRAMD1C_uc003eas.2_Silent_p.K448K|GRAMD1C_uc003eat.2_Silent_p.K312K|ZDHHC23_uc003eau.2_5'Flank|ZDHHC23_uc003eav.2_5'Flank	NM_017577	NP_060047	Q8IYS0	GRM1C_HUMAN	GRAM domain containing 1C	653						integral to membrane				ovary(2)|skin(1)	3						TACTAAATAAGAATAAGACTG	0.338													17	121	---	---	---	---	PASS
KIAA1407	57577	broad.mit.edu	37	3	113720457	113720457	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113720457C>G	uc003eax.2	-	13	2295	c.2148G>C	c.(2146-2148)AAG>AAC	p.K716N	KIAA1407_uc011bin.1_RNA	NM_020817	NP_065868	Q8NCU4	K1407_HUMAN	hypothetical protein LOC57577	716	Potential.									ovary(2)	2						TCTTCAGTCTCTTCTCTTCTC	0.453													48	224	---	---	---	---	PASS
GPR156	165829	broad.mit.edu	37	3	119886737	119886737	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:119886737C>G	uc011bjf.1	-	9	1587	c.1587G>C	c.(1585-1587)GAG>GAC	p.E529D	GPR156_uc011bjg.1_Missense_Mutation_p.E525D	NM_153002	NP_694547	Q8NFN8	GP156_HUMAN	G protein-coupled receptor 156	529	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity|GABA-B receptor activity			ovary(1)|skin(1)	2				GBM - Glioblastoma multiforme(114;0.19)		CCTCTGAGTTCTCCAGATGCC	0.582													80	264	---	---	---	---	PASS
HGD	3081	broad.mit.edu	37	3	120347245	120347245	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:120347245G>T	uc003edw.2	-	14	1690	c.1320C>A	c.(1318-1320)AAC>AAA	p.N440K	HGD_uc003edv.2_Missense_Mutation_p.N299K	NM_000187	NP_000178	Q93099	HGD_HUMAN	homogentisate 1,2-dioxygenase	440					L-phenylalanine catabolic process|tyrosine catabolic process	cytosol	homogentisate 1,2-dioxygenase activity|metal ion binding				0				GBM - Glioblastoma multiforme(114;0.158)		GTTCTGCTGGGTTCCTGGAGT	0.468													51	296	---	---	---	---	PASS
CASR	846	broad.mit.edu	37	3	122003739	122003739	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:122003739G>C	uc003eev.3	+	7	3310	c.2938G>C	c.(2938-2940)GAT>CAT	p.D980H	CASR_uc003eew.3_Missense_Mutation_p.D990H	NM_000388	NP_000379	P41180	CASR_HUMAN	calcium-sensing receptor precursor	980	Cytoplasmic (Potential).				anatomical structure morphogenesis|calcium ion import|cellular calcium ion homeostasis|chemosensory behavior|detection of calcium ion|ossification	integral to plasma membrane	G-protein coupled receptor activity|phosphatidylinositol phospholipase C activity			ovary(4)|skin(2)|upper_aerodigestive_tract(1)	7				GBM - Glioblastoma multiforme(114;0.226)	Cinacalcet(DB01012)	ACTGAGCTTTGATGAGCCTCA	0.582													3	82	---	---	---	---	PASS
FAM162A	26355	broad.mit.edu	37	3	122126180	122126180	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:122126180C>G	uc003eez.2	+	4	406	c.316C>G	c.(316-318)CTA>GTA	p.L106V	FAM162A_uc011bjq.1_Missense_Mutation_p.L106V	NM_014367	NP_055182	Q96A26	F162A_HUMAN	growth and transformation-dependent protein	106	Helical; (Potential).					integral to membrane				ovary(1)	1						GATCAGCTATCTAATGATTGC	0.418													29	159	---	---	---	---	PASS
DIRC2	84925	broad.mit.edu	37	3	122545861	122545861	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:122545861G>C	uc003efw.3	+	3	791	c.652G>C	c.(652-654)GAG>CAG	p.E218Q	DIRC2_uc010hrl.2_RNA|DIRC2_uc010hrm.2_Missense_Mutation_p.E56Q	NM_032839	NP_116228	Q96SL1	DIRC2_HUMAN	disrupted in renal carcinoma 2	218					transport	integral to membrane					0				GBM - Glioblastoma multiforme(114;0.0614)		TCTTGCTGCAGAGAGCAGCAG	0.408													97	165	---	---	---	---	PASS
MYLK	4638	broad.mit.edu	37	3	123420317	123420317	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:123420317C>A	uc003ego.2	-	17	2712	c.2430G>T	c.(2428-2430)ATG>ATT	p.M810I	MYLK_uc011bjw.1_Missense_Mutation_p.M810I|MYLK_uc003egp.2_Missense_Mutation_p.M741I|MYLK_uc003egq.2_Missense_Mutation_p.M810I|MYLK_uc003egr.2_Missense_Mutation_p.M741I|MYLK_uc003egs.2_Missense_Mutation_p.M634I|MYLK_uc003egt.2_Missense_Mutation_p.M1I	NM_053025	NP_444253	Q15746	MYLK_HUMAN	myosin light chain kinase isoform 1	810	Ig-like C2-type 6.				aorta smooth muscle tissue morphogenesis|muscle contraction	cytosol	actin binding|ATP binding|calmodulin binding|metal ion binding|myosin light chain kinase activity			ovary(6)|skin(2)|stomach(1)	9		Lung NSC(201;0.0496)		GBM - Glioblastoma multiforme(114;0.0736)		TGTTCTGTAGCATCAGTGACA	0.597													21	121	---	---	---	---	PASS
KALRN	8997	broad.mit.edu	37	3	124281801	124281801	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124281801G>T	uc003ehg.2	+	34	5168	c.5041G>T	c.(5041-5043)GAG>TAG	p.E1681*	KALRN_uc003ehi.2_Nonsense_Mutation_p.E54*	NM_001024660	NP_001019831	O60229	KALRN_HUMAN	kalirin, RhoGEF kinase isoform 1	1681	SH3 1.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|nervous system development|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|vesicle-mediated transport	actin cytoskeleton|cytosol	ATP binding|GTPase activator activity|metal ion binding|protein binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(2)|ovary(2)|central_nervous_system(1)|skin(1)	6						GCGGCCCAGCGAGCGGCCTGG	0.657													8	57	---	---	---	---	PASS
C3orf27	23434	broad.mit.edu	37	3	128292467	128292467	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128292467G>A	uc003ekq.2	-	3	1073	c.106C>T	c.(106-108)CAG>TAG	p.Q36*		NM_007354	NP_031380	O15544	GR6_HUMAN	putative GR6 protein	36											0				GBM - Glioblastoma multiforme(114;0.176)		CCTAGGGGCTGAGAGTCTGGG	0.642													5	95	---	---	---	---	PASS
ACAD9	28976	broad.mit.edu	37	3	128631375	128631375	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128631375G>C	uc003ela.3	+	18	1993	c.1791G>C	c.(1789-1791)CAG>CAC	p.Q597H	KIAA1257_uc003elg.1_Intron|ACAD9_uc011bks.1_Missense_Mutation_p.Q474H|ACAD9_uc003elb.2_Missense_Mutation_p.Q474H|ACAD9_uc003eld.1_RNA|ACAD9_uc003ele.2_Missense_Mutation_p.Q249H|uc003elf.1_Intron	NM_014049	NP_054768	Q9H845	ACAD9_HUMAN	acyl-Coenzyme A dehydrogenase family, member 9	597						mitochondrion	acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding			ovary(2)|central_nervous_system(1)	3						TAGATGAGCAGATTAAGAAAG	0.522													28	93	---	---	---	---	PASS
KIAA1257	57501	broad.mit.edu	37	3	128706490	128706490	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128706490G>T	uc003elj.3	-	4	832	c.636C>A	c.(634-636)TTC>TTA	p.F212L	KIAA1257_uc003elg.1_Missense_Mutation_p.F212L|KIAA1257_uc003eli.3_Missense_Mutation_p.F100L	NM_020741	NP_065792	Q9ULG3	K1257_HUMAN	hypothetical protein LOC57501	212											0						CGTCGTCTGTGAAGCCGGCAG	0.408													9	176	---	---	---	---	PASS
MBD4	8930	broad.mit.edu	37	3	129152001	129152001	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:129152001C>G	uc003emh.1	-	6	1677	c.1501G>C	c.(1501-1503)GAA>CAA	p.E501Q	MBD4_uc003emi.1_Missense_Mutation_p.E501Q|MBD4_uc003emj.1_Missense_Mutation_p.E495Q|MBD4_uc003emk.1_Missense_Mutation_p.E183Q|MBD4_uc011bkw.1_Missense_Mutation_p.E501Q	NM_003925	NP_003916	O95243	MBD4_HUMAN	methyl-CpG binding domain protein 4	501					depyrimidination	nucleoplasm	DNA N-glycosylase activity|endodeoxyribonuclease activity|protein binding|satellite DNA binding			ovary(1)|lung(1)	2						TTAAGAAGTTCTGACACATCT	0.423								BER_DNA_glycosylases					13	236	---	---	---	---	PASS
COL6A6	131873	broad.mit.edu	37	3	130305487	130305487	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130305487C>T	uc010htl.2	+	10	4139	c.4108C>T	c.(4108-4110)CGG>TGG	p.R1370W	COL6A6_uc003eni.3_5'UTR	NM_001102608	NP_001096078	A6NMZ7	CO6A6_HUMAN	collagen type VI alpha 6 precursor	1370	VWFA 7.|Nonhelical region.				axon guidance|cell adhesion	collagen				ovary(6)|central_nervous_system(1)|pancreas(1)	8						ACTTGGAAGCCGGCTGTCAAA	0.368													39	96	---	---	---	---	PASS
COL6A6	131873	broad.mit.edu	37	3	130340679	130340679	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130340679C>T	uc010htl.2	+	23	4861	c.4830C>T	c.(4828-4830)CCC>CCT	p.P1610P	COL6A6_uc003eni.3_5'UTR	NM_001102608	NP_001096078	A6NMZ7	CO6A6_HUMAN	collagen type VI alpha 6 precursor	1610	Triple-helical region.				axon guidance|cell adhesion	collagen				ovary(6)|central_nervous_system(1)|pancreas(1)	8						CTCCAGGACCCGGAGGAGAGG	0.433													23	95	---	---	---	---	PASS
PIK3R4	30849	broad.mit.edu	37	3	130435332	130435332	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130435332T>A	uc003enj.2	-	9	2820	c.2239A>T	c.(2239-2241)ATG>TTG	p.M747L		NM_014602	NP_055417	Q99570	PI3R4_HUMAN	phosphoinositide-3-kinase, regulatory subunit 4	747					fibroblast growth factor receptor signaling pathway|innate immune response|insulin receptor signaling pathway	cytosol	ATP binding|protein binding|protein serine/threonine kinase activity			ovary(3)|lung(2)|breast(2)|skin(2)|stomach(1)|central_nervous_system(1)|kidney(1)	12						TTCTGACGCATGTGAAGATGT	0.433													31	157	---	---	---	---	PASS
NUDT16	131870	broad.mit.edu	37	3	131102151	131102151	+	3'UTR	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:131102151C>A	uc003eof.2	+	2					uc003eoc.1_5'Flank|NUDT16_uc011bln.1_Missense_Mutation_p.S139Y|NUDT16_uc003eog.1_Missense_Mutation_p.S152Y	NM_152395	NP_689608	Q96DE0	NUD16_HUMAN	nudix-type motif 16							nucleolus|nucleoplasm	hydrolase activity|metal ion binding|RNA binding				0						CAGTCTGGCTCTATTTCAGGC	0.537													40	81	---	---	---	---	PASS
DNAJC13	23317	broad.mit.edu	37	3	132175390	132175390	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132175390C>T	uc003eor.2	+	11	1210	c.1145C>T	c.(1144-1146)TCA>TTA	p.S382L	DNAJC13_uc010htq.1_Missense_Mutation_p.S382L|DNAJC13_uc003eos.1_Missense_Mutation_p.S49L	NM_015268	NP_056083	O75165	DJC13_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 13	382							heat shock protein binding			ovary(1)|breast(1)	2						GCTAATATTTCATACAGTGGA	0.308													17	142	---	---	---	---	PASS
DNAJC13	23317	broad.mit.edu	37	3	132257044	132257044	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132257044C>T	uc003eor.2	+	56	6715	c.6650C>T	c.(6649-6651)ACC>ATC	p.T2217I		NM_015268	NP_056083	O75165	DJC13_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 13	2217							heat shock protein binding			ovary(1)|breast(1)	2						GGCTACCTTACCGCAGGTACA	0.453													6	77	---	---	---	---	PASS
NPHP3	27031	broad.mit.edu	37	3	132423047	132423047	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132423047C>G	uc003epe.1	-	9	1596	c.1519G>C	c.(1519-1521)GAG>CAG	p.E507Q	NPHP3_uc003epf.1_Missense_Mutation_p.E262Q	NM_153240	NP_694972	Q7Z494	NPHP3_HUMAN	nephrocystin 3	507					maintenance of organ identity|negative regulation of canonical Wnt receptor signaling pathway|photoreceptor cell maintenance|regulation of Wnt receptor signaling pathway, planar cell polarity pathway|Wnt receptor signaling pathway	cilium	protein binding			ovary(1)	1						CTTACTTTCTCAAATCCCAAC	0.353													54	273	---	---	---	---	PASS
KY	339855	broad.mit.edu	37	3	134346589	134346589	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:134346589G>T	uc010hty.2	-						KY_uc011blw.1_Intron|KY_uc011blx.1_Intron|KY_uc003eqs.1_Intron	NM_178554	NP_848649	Q8NBH2	KY_HUMAN	kyphoscoliosis peptidase							cytoskeleton|Z disc	peptidase activity			ovary(2)	2						GGAAGACTCTGGAACTTACCA	0.274													29	57	---	---	---	---	PASS
KY	339855	broad.mit.edu	37	3	134362194	134362194	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:134362194G>A	uc010hty.2	-	3	288	c.226C>T	c.(226-228)CAG>TAG	p.Q76*	KY_uc011blw.1_Nonsense_Mutation_p.Q76*|KY_uc011blx.1_Intron|KY_uc003eqs.1_Intron	NM_178554	NP_848649	Q8NBH2	KY_HUMAN	kyphoscoliosis peptidase	76						cytoskeleton|Z disc	peptidase activity			ovary(2)	2						TGGGGCTGCTGAGGGTGCTGC	0.552													20	53	---	---	---	---	PASS
ACPL2	92370	broad.mit.edu	37	3	140997235	140997235	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:140997235G>A	uc003etu.2	+	5	430	c.131G>A	c.(130-132)CGA>CAA	p.R44Q	ACPL2_uc003etv.2_Missense_Mutation_p.R44Q|ACPL2_uc011bna.1_Missense_Mutation_p.R6Q|ACPL2_uc011bnb.1_Missense_Mutation_p.R27Q	NM_152282	NP_689495	Q8TE99	ACPL2_HUMAN	acid phosphatase-like 2 precursor	44						extracellular region	acid phosphatase activity			skin(1)	1						AGCAAGAGTCGAAAGAGAATC	0.567													27	101	---	---	---	---	PASS
RASA2	5922	broad.mit.edu	37	3	141290324	141290324	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:141290324G>T	uc003etz.1	+	11	1097	c.1097G>T	c.(1096-1098)CGA>CTA	p.R366L	RASA2_uc010huq.1_Missense_Mutation_p.R366L|RASA2_uc003eua.1_Missense_Mutation_p.R366L|RASA2_uc011bnc.1_5'UTR	NM_006506	NP_006497	Q15283	RASA2_HUMAN	RAS p21 protein activator 2	366	Ras-GAP.				intracellular signal transduction|negative regulation of Ras protein signal transduction	intracellular membrane-bounded organelle|intrinsic to internal side of plasma membrane|perinuclear region of cytoplasm	metal ion binding|Ras GTPase activator activity			ovary(2)|lung(2)|breast(1)|skin(1)	6						CCCCTTGTACGACTGCTGCTG	0.368													149	302	---	---	---	---	PASS
SR140	23350	broad.mit.edu	37	3	142741338	142741338	+	Splice_Site	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142741338G>C	uc003evh.1	+	11	952	c.853_splice	c.e11-1	p.M285_splice	SR140_uc003evi.1_Splice_Site|SR140_uc011bnj.1_Splice_Site_p.M285_splice|SR140_uc003evj.1_Splice_Site|SR140_uc003evk.1_Splice_Site_p.M284_splice	NM_001080415	NP_001073884	O15042	SR140_HUMAN	U2-associated SR140 protein						RNA processing	nucleus	nucleotide binding|RNA binding				0						CTTTTTAATAGATGAATGAAG	0.318													25	154	---	---	---	---	PASS
HLTF	6596	broad.mit.edu	37	3	148786065	148786065	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:148786065G>C	uc003ewq.1	-	8	1170	c.952C>G	c.(952-954)CTT>GTT	p.L318V	HLTF_uc003ewr.1_Missense_Mutation_p.L318V|HLTF_uc003ews.1_Missense_Mutation_p.L318V|HLTF_uc010hve.1_Missense_Mutation_p.L318V	NM_139048	NP_620636	Q14527	HLTF_HUMAN	helicase-like transcription factor	318					chromatin modification|transcription, DNA-dependent	nucleus	ATP binding|DNA binding|helicase activity|ligase activity|zinc ion binding			ovary(1)	1			LUSC - Lung squamous cell carcinoma(72;0.0473)|Lung(72;0.0607)			TCAATAGGAAGAGGTCTGCCA	0.338													27	396	---	---	---	---	PASS
TMEM14E	645843	broad.mit.edu	37	3	152058442	152058442	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:152058442G>C	uc010hvo.2	-	1	338	c.252C>G	c.(250-252)CTC>CTG	p.L84L	MBNL1_uc003ezh.2_Intron|MBNL1_uc003ezi.2_Intron|MBNL1_uc003ezj.2_Intron|MBNL1_uc003ezm.2_Intron|MBNL1_uc003ezl.2_Intron|MBNL1_uc003ezp.2_Intron|MBNL1_uc003ezn.2_Intron|MBNL1_uc003ezo.2_Intron	NM_001123228	NP_001116700	Q6UXP3	TM14E_HUMAN	transmembrane protein 14E	84	Helical; (Potential).					integral to membrane					0						AAATGTTCCAGAGTGTTAGAA	0.428													22	111	---	---	---	---	PASS
MME	4311	broad.mit.edu	37	3	154858076	154858076	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:154858076G>T	uc010hvr.1	+	10	1163	c.952G>T	c.(952-954)GGG>TGG	p.G318W	MME_uc003fab.1_Missense_Mutation_p.G318W|MME_uc003fac.1_Missense_Mutation_p.G318W|MME_uc003fad.1_Missense_Mutation_p.G318W|MME_uc003fae.1_Missense_Mutation_p.G318W	NM_007289	NP_009220	P08473	NEP_HUMAN	membrane metallo-endopeptidase	318	Extracellular (Potential).				cell-cell signaling|proteolysis	integral to plasma membrane	metal ion binding|metalloendopeptidase activity|protein binding			ovary(2)|central_nervous_system(1)	3		all_neural(597;0.00391)|Myeloproliferative disorder(1037;0.0122)	LUSC - Lung squamous cell carcinoma(72;0.114)|Lung(72;0.135)		Candoxatril(DB00616)	AGAGATCAATGGGAAGGTAAG	0.333													4	109	---	---	---	---	PASS
SMC4	10051	broad.mit.edu	37	3	160150074	160150074	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160150074G>T	uc003fdh.2	+	22	3414	c.3301G>T	c.(3301-3303)GAA>TAA	p.E1101*	IFT80_uc003fda.2_Intron|SMC4_uc003fdi.2_Nonsense_Mutation_p.E1076*|SMC4_uc003fdj.2_Nonsense_Mutation_p.E1101*|SMC4_uc010hwd.2_Nonsense_Mutation_p.E1043*|SMC4_uc003fdl.2_Nonsense_Mutation_p.E804*	NM_001002800	NP_001002800	Q9NTJ3	SMC4_HUMAN	SMC4 structural maintenance of chromosomes	1101					cell division|mitotic chromosome condensation	condensin complex|cytoplasm|nucleus	ATP binding|protein heterodimerization activity			ovary(1)|breast(1)	2			Lung(72;0.00334)|LUSC - Lung squamous cell carcinoma(72;0.00523)			TTCACAGGAAGAATTGTATTT	0.269													7	198	---	---	---	---	PASS
PPM1L	151742	broad.mit.edu	37	3	160783332	160783332	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160783332G>C	uc003fdr.2	+	3	817	c.716G>C	c.(715-717)AGA>ACA	p.R239T	PPM1L_uc003fds.2_Missense_Mutation_p.R60T|PPM1L_uc003fdt.2_Missense_Mutation_p.R112T|PPM1L_uc010hwf.2_RNA	NM_139245	NP_640338	Q5SGD2	PPM1L_HUMAN	protein phosphatase 1 (formerly 2C)-like	239	Cytoplasmic (Potential).|PP2C-like.				protein dephosphorylation|sphingolipid metabolic process	endoplasmic reticulum membrane|integral to membrane|protein serine/threonine phosphatase complex	metal ion binding|protein serine/threonine phosphatase activity			breast(1)	1			Lung(72;0.00149)|LUSC - Lung squamous cell carcinoma(72;0.00216)			TTGAAGGAAAGAAAGAGGATA	0.507													14	205	---	---	---	---	PASS
SI	6476	broad.mit.edu	37	3	164754253	164754253	+	Silent	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164754253A>T	uc003fei.2	-	22	2501	c.2439T>A	c.(2437-2439)CCT>CCA	p.P813P		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	813	Lumenal.|Isomaltase.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)	TAAGTCCTAGAGGATTCTTAC	0.348										HNSCC(35;0.089)			61	261	---	---	---	---	PASS
SI	6476	broad.mit.edu	37	3	164755796	164755796	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164755796C>T	uc003fei.2	-	21	2380	c.2318G>A	c.(2317-2319)TGG>TAG	p.W773*		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	773	Lumenal.|Isomaltase.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)	TTGTTTCCTCCATGGCCTTTT	0.323										HNSCC(35;0.089)			94	162	---	---	---	---	PASS
SLITRK3	22865	broad.mit.edu	37	3	164907126	164907126	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164907126G>C	uc003fej.3	-	2	1937	c.1493C>G	c.(1492-1494)GCA>GGA	p.A498G	SLITRK3_uc003fek.2_Missense_Mutation_p.A498G	NM_014926	NP_055741	O94933	SLIK3_HUMAN	slit and trk like 3 protein precursor	498	LRR 10.|Extracellular (Potential).					integral to membrane				ovary(6)|skin(3)|pancreas(1)	10						GCTGAAGGCTGCAGGCTGGAT	0.512										HNSCC(40;0.11)			4	189	---	---	---	---	PASS
SLITRK3	22865	broad.mit.edu	37	3	164907647	164907647	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164907647G>A	uc003fej.3	-	2	1416	c.972C>T	c.(970-972)GTC>GTT	p.V324V	SLITRK3_uc003fek.2_Silent_p.V324V	NM_014926	NP_055741	O94933	SLIK3_HUMAN	slit and trk like 3 protein precursor	324	Extracellular (Potential).					integral to membrane				ovary(6)|skin(3)|pancreas(1)	10						ACTTGTATTCGACAGAAGAAG	0.468										HNSCC(40;0.11)			18	674	---	---	---	---	PASS
BCHE	590	broad.mit.edu	37	3	165548367	165548367	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:165548367G>A	uc003fem.3	-	2	615	c.455C>T	c.(454-456)TCT>TTT	p.S152F	BCHE_uc003fen.3_Intron	NM_000055	NP_000046	P06276	CHLE_HUMAN	butyrylcholinesterase precursor	152					choline metabolic process|cocaine metabolic process|synaptic transmission, cholinergic	endoplasmic reticulum lumen|extracellular space|membrane	acetylcholinesterase activity|beta-amyloid binding|carboxylesterase activity|cholinesterase activity|enzyme binding			ovary(3)|pancreas(1)	4					Ambenonium(DB01122)|Atropine(DB00572)|Bambuterol(DB01408)|Chlorpromazine(DB00477)|Choline(DB00122)|Cinnarizine(DB00568)|Demecarium bromide(DB00944)|Dibucaine(DB00527)|Donepezil(DB00843)|Echothiophate Iodide(DB01057)|Edrophonium(DB01010)|Ethopropazine(DB00392)|Etomidate(DB00292)|Galantamine(DB00674)|Hexafluronium bromide(DB00941)|Isoflurophate(DB00677)|Mefloquine(DB00358)|Mivacurium(DB01226)|Neostigmine(DB01400)|Pancuronium(DB01337)|Pralidoxime(DB00733)|Procainamide(DB01035)|Pyridostigmine(DB00545)|Rivastigmine(DB00989)|Succinylcholine(DB00202)|Terbutaline(DB00871)|Trimethaphan(DB01116)	AACATGTAAAGATGATGTTCC	0.388													18	276	---	---	---	---	PASS
ZBBX	79740	broad.mit.edu	37	3	166960328	166960328	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:166960328T>C	uc003fep.2	-	20	2564	c.2241A>G	c.(2239-2241)TCA>TCG	p.S747S	ZBBX_uc011bpc.1_Silent_p.S786S|ZBBX_uc003feq.2_Silent_p.S718S	NM_024687	NP_078963	A8MT70	ZBBX_HUMAN	zinc finger, B-box domain containing	747						intracellular	zinc ion binding			ovary(2)	2						CCCTCACATGTGAGGTCTTAA	0.383													110	138	---	---	---	---	PASS
MECOM	2122	broad.mit.edu	37	3	168845735	168845735	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:168845735C>T	uc003ffi.3	-	4	432	c.163G>A	c.(163-165)GAA>AAA	p.E55K	MECOM_uc010hwk.1_Missense_Mutation_p.E78K|MECOM_uc003ffj.3_Missense_Mutation_p.E119K|MECOM_uc011bpi.1_Missense_Mutation_p.E55K|MECOM_uc003ffn.3_Missense_Mutation_p.E55K|MECOM_uc003ffk.2_Missense_Mutation_p.E55K|MECOM_uc003ffl.2_Missense_Mutation_p.E215K|MECOM_uc011bpj.1_Missense_Mutation_p.E243K|MECOM_uc011bpk.1_Missense_Mutation_p.E45K|MECOM_uc010hwn.2_Missense_Mutation_p.E243K|MECOM_uc003ffm.1_Missense_Mutation_p.E119K	NM_005241	NP_005232	Q03112	EVI1_HUMAN	MDS1 and EVI1 complex locus isoform b	55	Interaction with MAPK9, SMAD3 and probably SUV39H1.				apoptosis|cell differentiation|hemopoietic stem cell proliferation|negative regulation of JNK cascade|negative regulation of programmed cell death|negative regulation of transcription, DNA-dependent|regulation of cell cycle	nuclear speck	DNA binding|protein binding|protein homodimerization activity|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(5)|skin(5)|upper_aerodigestive_tract(1)|central_nervous_system(1)|ovary(1)|pancreas(1)	14						AAGTCCTCTTCAACCATTGAA	0.438													135	573	---	---	---	---	PASS
TERC	7012	broad.mit.edu	37	3	169482437	169482437	+	RNA	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169482437C>T	uc003ffr.1	-	1		c.412G>A				NR_001566				Homo sapiens cDNA clone IMAGE:40002477.												0						TCCCACAGCTCAGGGAATCGC	0.687									Congenital_Dyskeratosis|Pulmonary_Fibrosis_Idiopathic				5	95	---	---	---	---	PASS
SAMD7	344658	broad.mit.edu	37	3	169644372	169644372	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169644372C>G	uc003fgd.2	+	6	589	c.322C>G	c.(322-324)CAA>GAA	p.Q108E	SAMD7_uc003fge.2_Missense_Mutation_p.Q108E|SAMD7_uc011bpo.1_Missense_Mutation_p.Q9E	NM_182610	NP_872416	Q7Z3H4	SAMD7_HUMAN	sterile alpha motif domain containing 7	108										skin(1)	1	all_cancers(22;1.55e-22)|all_epithelial(15;2.41e-27)|all_lung(20;3.52e-17)|Lung NSC(18;1.44e-16)|Ovarian(172;0.000337)|Breast(254;0.169)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.0106)			TATTTACCAGCAAAGGAGAAT	0.418													82	141	---	---	---	---	PASS
PRKCI	5584	broad.mit.edu	37	3	169998155	169998155	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169998155G>C	uc003fgs.2	+	9	1084	c.846G>C	c.(844-846)ATG>ATC	p.M282I		NM_002740	NP_002731	P41743	KPCI_HUMAN	protein kinase C, iota	282	Protein kinase.				anti-apoptosis|cellular membrane organization|cellular response to insulin stimulus|establishment or maintenance of epithelial cell apical/basal polarity|intracellular signal transduction|nerve growth factor receptor signaling pathway|positive regulation of establishment of protein localization in plasma membrane|positive regulation of glucose import|protein targeting to membrane|secretion|tight junction assembly|vesicle-mediated transport	cytosol|endosome|nucleus|polarisome	ATP binding|phospholipid binding|protein binding|protein kinase C activity|zinc ion binding			lung(2)|ovary(1)|breast(1)|skin(1)	5	all_cancers(22;6.45e-23)|all_epithelial(15;8.52e-28)|all_lung(20;6.31e-17)|Lung NSC(18;2.61e-16)|Ovarian(172;0.000337)|Breast(254;0.169)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.197)			TTTATGCAATGAAAGTTGTGA	0.313													9	246	---	---	---	---	PASS
SLC7A14	57709	broad.mit.edu	37	3	170201274	170201274	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:170201274G>T	uc003fgz.2	-	6	1260	c.944C>A	c.(943-945)ACC>AAC	p.T315N	CLDN11_uc011bpt.1_Intron|uc003fha.1_Intron	NM_020949	NP_066000	Q8TBB6	S7A14_HUMAN	solute carrier family 7 (cationic amino acid	315						integral to membrane	amino acid transmembrane transporter activity			ovary(2)|upper_aerodigestive_tract(1)|liver(1)|central_nervous_system(1)	5	all_cancers(22;2.41e-22)|all_epithelial(15;4.2e-27)|all_lung(20;1.17e-16)|Lung NSC(18;4.91e-16)|Ovarian(172;0.000902)|Breast(254;0.137)		Lung(28;6.23e-13)|LUSC - Lung squamous cell carcinoma(14;1.48e-12)			CGTGTCAATGGTATAATATGG	0.502											OREG0015917	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	9	442	---	---	---	---	PASS
PLD1	5337	broad.mit.edu	37	3	171321035	171321035	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:171321035T>C	uc003fhs.2	-	27	3174	c.3058A>G	c.(3058-3060)ATA>GTA	p.I1020V	PLD1_uc003fht.2_Missense_Mutation_p.I982V	NM_002662	NP_002653	Q13393	PLD1_HUMAN	phospholipase D1 isoform a	1020					cell communication|chemotaxis|Ras protein signal transduction	endoplasmic reticulum membrane|Golgi membrane|late endosome membrane|perinuclear region of cytoplasm	NAPE-specific phospholipase D activity|phosphatidylinositol binding|phospholipase D activity			ovary(2)|lung(1)	3	all_cancers(22;4.53e-19)|Ovarian(172;0.00197)|Breast(254;0.186)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)		Choline(DB00122)	GGCTTGTTTATAAAGTCTCTC	0.383													4	246	---	---	---	---	PASS
PLD1	5337	broad.mit.edu	37	3	171394572	171394572	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:171394572G>A	uc003fhs.2	-	18	2164	c.2048C>T	c.(2047-2049)TCT>TTT	p.S683F	PLD1_uc003fht.2_Missense_Mutation_p.S645F|PLD1_uc003fhu.3_5'Flank|PLD1_uc003fhv.1_Missense_Mutation_p.S8F	NM_002662	NP_002653	Q13393	PLD1_HUMAN	phospholipase D1 isoform a	683	Catalytic.				cell communication|chemotaxis|Ras protein signal transduction	endoplasmic reticulum membrane|Golgi membrane|late endosome membrane|perinuclear region of cytoplasm	NAPE-specific phospholipase D activity|phosphatidylinositol binding|phospholipase D activity			ovary(2)|lung(1)	3	all_cancers(22;4.53e-19)|Ovarian(172;0.00197)|Breast(254;0.186)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)		Choline(DB00122)	GTGGACTGCAGAGGCAATGTC	0.532													18	142	---	---	---	---	PASS
PLD1	5337	broad.mit.edu	37	3	171442514	171442514	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:171442514C>T	uc003fhs.2	-	8	846	c.730G>A	c.(730-732)GGA>AGA	p.G244R	PLD1_uc003fht.2_Missense_Mutation_p.G244R	NM_002662	NP_002653	Q13393	PLD1_HUMAN	phospholipase D1 isoform a	244	PH.				cell communication|chemotaxis|Ras protein signal transduction	endoplasmic reticulum membrane|Golgi membrane|late endosome membrane|perinuclear region of cytoplasm	NAPE-specific phospholipase D activity|phosphatidylinositol binding|phospholipase D activity			ovary(2)|lung(1)	3	all_cancers(22;4.53e-19)|Ovarian(172;0.00197)|Breast(254;0.186)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)		Choline(DB00122)	CAGGCTCTTCCCTGACCACAG	0.388													23	454	---	---	---	---	PASS
NCEH1	57552	broad.mit.edu	37	3	172353864	172353864	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:172353864G>T	uc011bpx.1	-	4	709	c.571C>A	c.(571-573)CCA>ACA	p.P191T	NCEH1_uc003fig.2_Missense_Mutation_p.P183T|NCEH1_uc011bpw.1_Missense_Mutation_p.P18T|NCEH1_uc011bpy.1_Missense_Mutation_p.P18T	NM_001146276	NP_001139748	Q6PIU2	NCEH1_HUMAN	arylacetamide deacetylase-like 1 isoform a	151	Lumenal (Potential).				lipid catabolic process	endoplasmic reticulum|integral to membrane|microsome	carboxylesterase activity				0						TAAACCTTTGGAACTAGCCTG	0.368													10	327	---	---	---	---	PASS
ECT2	1894	broad.mit.edu	37	3	172486940	172486940	+	Intron	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:172486940A>G	uc003fii.2	+						ECT2_uc010hwv.1_Intron|ECT2_uc003fih.2_Intron|ECT2_uc003fij.1_Intron|ECT2_uc003fik.1_Intron|ECT2_uc003fil.1_Intron	NM_018098	NP_060568	Q9H8V3	ECT2_HUMAN	epithelial cell transforming sequence 2 oncogene						apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	Rho guanyl-nucleotide exchange factor activity|signal transducer activity			breast(2)|ovary(1)|skin(1)	4	Ovarian(172;0.00197)|Breast(254;0.158)		Lung(28;1.33e-14)|LUSC - Lung squamous cell carcinoma(14;1.48e-14)			TCAGGTAAGTATGAGTTTGAT	0.299													13	159	---	---	---	---	PASS
NLGN1	22871	broad.mit.edu	37	3	173996659	173996659	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:173996659C>G	uc003fio.1	+	6	1291	c.868C>G	c.(868-870)CAA>GAA	p.Q290E	NLGN1_uc010hww.1_Missense_Mutation_p.Q330E|NLGN1_uc003fip.1_Missense_Mutation_p.Q290E	NM_014932	NP_055747	Q8N2Q7	NLGN1_HUMAN	neuroligin 1	307	Extracellular (Potential).				calcium-dependent cell-cell adhesion|neuron cell-cell adhesion|neuronal signal transduction|positive regulation of dendritic spine development|positive regulation of excitatory postsynaptic membrane potential|positive regulation of intracellular protein kinase cascade|positive regulation of synaptogenesis|protein targeting|regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|regulation of N-methyl-D-aspartate selective glutamate receptor activity|synapse assembly|synaptic vesicle targeting	cell junction|cell surface|dendrite|integral to plasma membrane|postsynaptic density|postsynaptic membrane	cell adhesion molecule binding|neurexin binding|receptor activity			lung(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)|ovary(1)|pancreas(1)	7	Ovarian(172;0.0025)		LUSC - Lung squamous cell carcinoma(14;5.36e-13)|Lung(28;9.49e-13)			AGGACTTTTTCAACGAGCAAT	0.353													6	221	---	---	---	---	PASS
ZNF639	51193	broad.mit.edu	37	3	179047452	179047452	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179047452C>G	uc003fjq.1	+	4	448	c.105C>G	c.(103-105)TTC>TTG	p.F35L	ZNF639_uc003fjr.1_Missense_Mutation_p.F35L	NM_016331	NP_057415	Q9UID6	ZN639_HUMAN	zinc finger protein 639	35					initiation of viral infection|negative regulation by host of viral transcription|negative regulation of transcription, DNA-dependent|positive regulation by host of viral transcription|positive regulation of cell growth|positive regulation of transcription, DNA-dependent	nucleus	protein self-association|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding				0	all_cancers(143;7.9e-17)|Ovarian(172;0.0172)|Breast(254;0.155)		OV - Ovarian serous cystadenocarcinoma(80;5.78e-26)|GBM - Glioblastoma multiforme(14;0.003)|BRCA - Breast invasive adenocarcinoma(182;0.0923)			ATGGAATTTTCTCTGATCATT	0.279													7	636	---	---	---	---	PASS
PEX5L	51555	broad.mit.edu	37	3	179537697	179537697	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179537697G>C	uc003fki.1	-	9	1020	c.890C>G	c.(889-891)TCT>TGT	p.S297C	PEX5L_uc011bqd.1_Missense_Mutation_p.S254C|PEX5L_uc011bqe.1_Missense_Mutation_p.S105C|PEX5L_uc011bqf.1_Missense_Mutation_p.S189C|PEX5L_uc003fkj.1_Missense_Mutation_p.S262C|PEX5L_uc010hxd.1_Missense_Mutation_p.S295C|PEX5L_uc011bqg.1_Missense_Mutation_p.S273C|PEX5L_uc011bqh.1_Missense_Mutation_p.S238C	NM_016559	NP_057643	Q8IYB4	PEX5R_HUMAN	peroxisomal biogenesis factor 5-like	297					protein import into peroxisome matrix|regulation of cAMP-mediated signaling	cytosol|peroxisomal membrane	peroxisome matrix targeting signal-1 binding			ovary(3)|large_intestine(1)	4	all_cancers(143;3.94e-14)|Ovarian(172;0.0338)|Breast(254;0.183)		OV - Ovarian serous cystadenocarcinoma(80;1.75e-26)|GBM - Glioblastoma multiforme(14;0.000518)			TTGGTTCTCAGATATCCAGTT	0.438													39	337	---	---	---	---	PASS
TTC14	151613	broad.mit.edu	37	3	180327971	180327971	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180327971G>C	uc003fkk.2	+	12	2086	c.1954G>C	c.(1954-1956)GAG>CAG	p.E652Q	TTC14_uc003fkl.2_3'UTR|TTC14_uc003fkm.2_Intron	NM_133462	NP_597719	Q96N46	TTC14_HUMAN	tetratricopeptide repeat domain 14 isoform a	652							RNA binding			ovary(1)	1	all_cancers(143;9.31e-15)|Ovarian(172;0.0212)		OV - Ovarian serous cystadenocarcinoma(80;5.62e-23)|GBM - Glioblastoma multiforme(14;0.000558)			AAAGGATATAGAGGGAAGAAA	0.393													5	298	---	---	---	---	PASS
MCF2L2	23101	broad.mit.edu	37	3	183013168	183013168	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183013168C>G	uc003fli.1	-	13	1685	c.1595G>C	c.(1594-1596)CGT>CCT	p.R532P	MCF2L2_uc003flj.1_Missense_Mutation_p.R532P|MCF2L2_uc011bqr.1_RNA|uc003fln.1_Intron|uc003flo.2_5'Flank	NM_015078	NP_055893	Q86YR7	MF2L2_HUMAN	Rho family guanine-nucleotide exchange factor	532					regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			ovary(2)|large_intestine(2)|breast(1)	5	all_cancers(143;1.26e-12)|Ovarian(172;0.0355)		all cancers(12;3.35e-44)|Epithelial(37;6.48e-38)|LUSC - Lung squamous cell carcinoma(7;7.12e-25)|Lung(8;6.39e-23)|OV - Ovarian serous cystadenocarcinoma(80;6.75e-21)			TTGCACTGGACGAGTCTGTTT	0.498													19	225	---	---	---	---	PASS
YEATS2	55689	broad.mit.edu	37	3	183446552	183446552	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183446552G>A	uc003fly.2	+	7	920	c.725G>A	c.(724-726)CGT>CAT	p.R242H		NM_018023	NP_060493	Q9ULM3	YETS2_HUMAN	YEATS domain containing 2	242	YEATS.				histone H3 acetylation|negative regulation of transcription from RNA polymerase II promoter	Ada2/Gcn5/Ada3 transcription activator complex	TBP-class protein binding			ovary(3)|large_intestine(1)	4	all_cancers(143;6.55e-10)|Ovarian(172;0.0303)		all cancers(12;2.38e-42)|Epithelial(37;1.9e-36)|OV - Ovarian serous cystadenocarcinoma(80;6.48e-22)			CGAGGGTCCCGTAGAGAACCC	0.418													6	315	---	---	---	---	PASS
HTR3D	200909	broad.mit.edu	37	3	183756706	183756706	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183756706C>G	uc011bqv.1	+	8	1308	c.1308C>G	c.(1306-1308)CTC>CTG	p.L436L	HTR3D_uc003fmj.2_Silent_p.L261L|HTR3D_uc011bqu.1_Silent_p.L386L|HTR3D_uc010hxp.2_Silent_p.L215L	NM_001163646	NP_001157118	Q70Z44	5HT3D_HUMAN	5-hydroxytryptamine receptor 3 subunit D isoform	436	Helical; Name=4; (Potential).					integral to membrane|plasma membrane	extracellular ligand-gated ion channel activity|receptor activity				0	all_cancers(143;2.33e-10)|Ovarian(172;0.0303)		Epithelial(37;6.23e-36)|OV - Ovarian serous cystadenocarcinoma(80;6.48e-22)			TCTTCCGCCTCTACCTGCTCT	0.587													27	373	---	---	---	---	PASS
ECE2	9718	broad.mit.edu	37	3	184008857	184008857	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184008857C>T	uc003fni.3	+	17	2256	c.2218C>T	c.(2218-2220)CGG>TGG	p.R740W	ECE2_uc011brh.1_Missense_Mutation_p.R593W|ECE2_uc003fnl.3_Missense_Mutation_p.R668W|ECE2_uc003fnm.3_Missense_Mutation_p.R622W|ECE2_uc003fnk.3_Missense_Mutation_p.R593W|ECE2_uc011bri.1_Missense_Mutation_p.R655W|ECE2_uc010hxv.2_3'UTR	NM_014693	NP_055508	O60344	ECE2_HUMAN	endothelin converting enzyme 2 isoform A	740	Lumenal (Potential).|Endothelin-converting enzyme 2 region.				brain development|cardioblast differentiation|cell-cell signaling|peptide hormone processing	cytoplasmic vesicle membrane|Golgi membrane|integral to membrane	metal ion binding|metalloendopeptidase activity|methyltransferase activity			ovary(2)|skin(2)	4	all_cancers(143;1.39e-10)|Ovarian(172;0.0339)		Epithelial(37;8.28e-34)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)			AGGGAACCTGCGGCCCTGGTG	0.587													114	204	---	---	---	---	PASS
ECE2	9718	broad.mit.edu	37	3	184009925	184009925	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184009925C>T	uc003fni.3	+	19	2589	c.2551C>T	c.(2551-2553)CGC>TGC	p.R851C	ECE2_uc003fnl.3_Missense_Mutation_p.R779C|ECE2_uc003fnm.3_Missense_Mutation_p.R733C|ECE2_uc003fnk.3_Missense_Mutation_p.R704C	NM_014693	NP_055508	O60344	ECE2_HUMAN	endothelin converting enzyme 2 isoform A	851	Lumenal (Potential).|Endothelin-converting enzyme 2 region.				brain development|cardioblast differentiation|cell-cell signaling|peptide hormone processing	cytoplasmic vesicle membrane|Golgi membrane|integral to membrane	metal ion binding|metalloendopeptidase activity|methyltransferase activity			ovary(2)|skin(2)	4	all_cancers(143;1.39e-10)|Ovarian(172;0.0339)		Epithelial(37;8.28e-34)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)			TGCCCGCTTCCGCGTGCTGGG	0.677													13	267	---	---	---	---	PASS
EIF4G1	1981	broad.mit.edu	37	3	184042076	184042076	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184042076G>C	uc003fnp.2	+	17	2758	c.2560G>C	c.(2560-2562)GAC>CAC	p.D854H	EIF4G1_uc003fno.1_Missense_Mutation_p.D795H|EIF4G1_uc010hxw.1_Missense_Mutation_p.D690H|EIF4G1_uc003fnt.2_Missense_Mutation_p.D565H|EIF4G1_uc003fnq.2_Missense_Mutation_p.D767H|EIF4G1_uc003fnr.2_Missense_Mutation_p.D690H|EIF4G1_uc010hxx.2_Missense_Mutation_p.D861H|EIF4G1_uc003fns.2_Missense_Mutation_p.D814H|EIF4G1_uc010hxy.2_Missense_Mutation_p.D861H|EIF4G1_uc003fnv.3_Missense_Mutation_p.D855H|EIF4G1_uc003fnu.3_Missense_Mutation_p.D854H|EIF4G1_uc003fnw.2_Missense_Mutation_p.D861H|EIF4G1_uc003fnx.2_Missense_Mutation_p.D659H|EIF4G1_uc003fny.3_Missense_Mutation_p.D658H|SNORD66_uc003fnz.2_5'Flank	NM_198241	NP_937884	Q04637	IF4G1_HUMAN	eukaryotic translation initiation factor 4	854	eIF3/EIF4A-binding.				insulin receptor signaling pathway|interspecies interaction between organisms|nuclear-transcribed mRNA poly(A) tail shortening|regulation of translational initiation	cytosol|eukaryotic translation initiation factor 4F complex	protein binding|translation initiation factor activity			lung(2)|ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	all_cancers(143;1.06e-10)|Ovarian(172;0.0339)		Epithelial(37;1.53e-33)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)			GTTTGAGAAAGACAAAGATGA	0.443													14	299	---	---	---	---	PASS
EIF4G1	1981	broad.mit.edu	37	3	184045480	184045480	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184045480C>A	uc003fnp.2	+	25	3966	c.3768C>A	c.(3766-3768)CTC>CTA	p.L1256L	EIF4G1_uc003fnt.2_Silent_p.L967L|EIF4G1_uc003fnq.2_Silent_p.L1169L|EIF4G1_uc003fnr.2_Silent_p.L1092L|EIF4G1_uc010hxx.2_Silent_p.L1263L|EIF4G1_uc003fns.2_Silent_p.L1216L|EIF4G1_uc010hxy.2_Silent_p.L1263L|EIF4G1_uc003fnv.3_Silent_p.L1257L|EIF4G1_uc003fnu.3_Silent_p.L1256L|EIF4G1_uc003fnw.2_Silent_p.L1263L|EIF4G1_uc003fnx.2_Silent_p.L1061L|EIF4G1_uc003fny.3_Silent_p.L1060L|EIF4G1_uc003foa.2_5'Flank	NM_198241	NP_937884	Q04637	IF4G1_HUMAN	eukaryotic translation initiation factor 4	1256	MI.				insulin receptor signaling pathway|interspecies interaction between organisms|nuclear-transcribed mRNA poly(A) tail shortening|regulation of translational initiation	cytosol|eukaryotic translation initiation factor 4F complex	protein binding|translation initiation factor activity			lung(2)|ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	all_cancers(143;1.06e-10)|Ovarian(172;0.0339)		Epithelial(37;1.53e-33)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)			ATCTCCATCTCAATGACATGA	0.567													20	244	---	---	---	---	PASS
VPS8	23355	broad.mit.edu	37	3	184587302	184587302	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184587302A>G	uc003fpb.1	+	19	1795	c.1624A>G	c.(1624-1626)ATT>GTT	p.I542V	VPS8_uc010hyd.1_Missense_Mutation_p.I542V	NM_015303	NP_056118	Q8N3P4	VPS8_HUMAN	vacuolar protein sorting 8 homolog isoform b	544							zinc ion binding			ovary(1)	1	all_cancers(143;2.51e-11)|Ovarian(172;0.0339)|Breast(254;0.247)		Epithelial(37;1.02e-33)|OV - Ovarian serous cystadenocarcinoma(80;4.81e-22)			GCGAAAGGCTATTGTTGCAGA	0.393													78	134	---	---	---	---	PASS
VPS8	23355	broad.mit.edu	37	3	184648317	184648317	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184648317G>A	uc003fpb.1	+	33	3024	c.2853G>A	c.(2851-2853)GAG>GAA	p.E951E	VPS8_uc010hyd.1_Silent_p.E861E|VPS8_uc010hye.1_Silent_p.E380E	NM_015303	NP_056118	Q8N3P4	VPS8_HUMAN	vacuolar protein sorting 8 homolog isoform b	953							zinc ion binding			ovary(1)	1	all_cancers(143;2.51e-11)|Ovarian(172;0.0339)|Breast(254;0.247)		Epithelial(37;1.02e-33)|OV - Ovarian serous cystadenocarcinoma(80;4.81e-22)			GTGCAGAGGAGAAGCAGTCTG	0.388													5	360	---	---	---	---	PASS
VPS8	23355	broad.mit.edu	37	3	184714182	184714182	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184714182G>C	uc003fpb.1	+	43	3894	c.3723G>C	c.(3721-3723)CTG>CTC	p.L1241L	VPS8_uc010hyd.1_Silent_p.L1151L|VPS8_uc010hye.1_Silent_p.L670L	NM_015303	NP_056118	Q8N3P4	VPS8_HUMAN	vacuolar protein sorting 8 homolog isoform b	1243							zinc ion binding			ovary(1)	1	all_cancers(143;2.51e-11)|Ovarian(172;0.0339)|Breast(254;0.247)		Epithelial(37;1.02e-33)|OV - Ovarian serous cystadenocarcinoma(80;4.81e-22)			TGTGTAACCTGAGAGCTTCGG	0.413													16	165	---	---	---	---	PASS
ETV5	2119	broad.mit.edu	37	3	185766536	185766536	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:185766536G>A	uc003fpz.2	-	13	1672	c.1425C>T	c.(1423-1425)CTC>CTT	p.L475L	ETV5_uc003fpy.2_Silent_p.L517L	NM_004454	NP_004445	P41161	ETV5_HUMAN	ets variant gene 5 (ets-related molecule)	475					cellular response to oxidative stress	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			ovary(2)|skin(2)|breast(1)	5	all_cancers(143;4.06e-12)|Ovarian(172;0.0386)|Breast(254;0.247)		OV - Ovarian serous cystadenocarcinoma(80;1.62e-24)			CCTCCTCGCTGAGGTGGCACT	0.587			T	TMPRSS2|SCL45A3	Prostate 								10	139	---	---	---	---	PASS
HRG	3273	broad.mit.edu	37	3	186395356	186395356	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186395356C>G	uc003fqq.2	+	7	1285	c.1262C>G	c.(1261-1263)CCC>CGC	p.P421R		NM_000412	NP_000403	P04196	HRG_HUMAN	histidine-rich glycoprotein precursor	421	His/Pro-rich (HRR).				fibrinolysis|platelet activation|platelet degranulation	extracellular region|plasma membrane|platelet alpha granule lumen	cysteine-type endopeptidase inhibitor activity|heparin binding			ovary(1)|central_nervous_system(1)	2	all_cancers(143;6.64e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;5.73e-20)	GBM - Glioblastoma multiforme(93;0.0683)		GACCCACCACCCCATAACCAA	0.383													7	84	---	---	---	---	PASS
HRG	3273	broad.mit.edu	37	3	186395357	186395357	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186395357C>A	uc003fqq.2	+	7	1286	c.1263C>A	c.(1261-1263)CCC>CCA	p.P421P		NM_000412	NP_000403	P04196	HRG_HUMAN	histidine-rich glycoprotein precursor	421	His/Pro-rich (HRR).				fibrinolysis|platelet activation|platelet degranulation	extracellular region|plasma membrane|platelet alpha granule lumen	cysteine-type endopeptidase inhibitor activity|heparin binding			ovary(1)|central_nervous_system(1)	2	all_cancers(143;6.64e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;5.73e-20)	GBM - Glioblastoma multiforme(93;0.0683)		ACCCACCACCCCATAACCAAG	0.383													6	84	---	---	---	---	PASS
KNG1	3827	broad.mit.edu	37	3	186435490	186435490	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186435490G>C	uc011bsa.1	+	1	371	c.159G>C	c.(157-159)CAG>CAC	p.Q53H	KNG1_uc003fqr.2_Missense_Mutation_p.Q53H	NM_001102416	NP_001095886	P01042	KNG1_HUMAN	kininogen 1 isoform 1	53	Cystatin 1.				blood coagulation, intrinsic pathway|elevation of cytosolic calcium ion concentration|inflammatory response|negative regulation of blood coagulation|negative regulation of cell adhesion|platelet activation|platelet degranulation|positive regulation of apoptosis|positive regulation of renal sodium excretion|positive regulation of urine volume|smooth muscle contraction|vasodilation	extracellular space|plasma membrane|platelet alpha granule lumen	cysteine-type endopeptidase inhibitor activity|heparin binding|receptor binding|zinc ion binding			skin(1)	1	all_cancers(143;8.96e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;4.12e-20)	GBM - Glioblastoma multiforme(93;0.0798)	Ouabain(DB01092)	GTAACAACCAGTTTGTATTGT	0.403													21	203	---	---	---	---	PASS
KNG1	3827	broad.mit.edu	37	3	186442879	186442879	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186442879G>A	uc011bsa.1	+	4	606	c.394G>A	c.(394-396)GAG>AAG	p.E132K	KNG1_uc003fqr.2_Missense_Mutation_p.E132K	NM_001102416	NP_001095886	P01042	KNG1_HUMAN	kininogen 1 isoform 1	132	Cystatin 1.|O-glycosylated at one site only.				blood coagulation, intrinsic pathway|elevation of cytosolic calcium ion concentration|inflammatory response|negative regulation of blood coagulation|negative regulation of cell adhesion|platelet activation|platelet degranulation|positive regulation of apoptosis|positive regulation of renal sodium excretion|positive regulation of urine volume|smooth muscle contraction|vasodilation	extracellular space|plasma membrane|platelet alpha granule lumen	cysteine-type endopeptidase inhibitor activity|heparin binding|receptor binding|zinc ion binding			skin(1)	1	all_cancers(143;8.96e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;4.12e-20)	GBM - Glioblastoma multiforme(93;0.0798)	Ouabain(DB01092)	TTGTTAAGCCGAGGGCCCTGT	0.458													16	129	---	---	---	---	PASS
RTP2	344892	broad.mit.edu	37	3	187419846	187419846	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:187419846G>T	uc003fro.1	-	1	500	c.71C>A	c.(70-72)GCG>GAG	p.A24E		NM_001004312	NP_001004312	Q5QGT7	RTP2_HUMAN	receptor transporting protein 2	24	Cytoplasmic (Potential).				protein insertion into membrane	cell surface|integral to membrane|plasma membrane	olfactory receptor binding				0	all_cancers(143;4.06e-12)|Ovarian(172;0.0418)		OV - Ovarian serous cystadenocarcinoma(80;1.76e-18)	GBM - Glioblastoma multiforme(93;0.0515)		CCAGCTGTCCGCTGGCTTTGC	0.582													59	558	---	---	---	---	PASS
BCL6	604	broad.mit.edu	37	3	187447462	187447462	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:187447462C>A	uc003frp.3	-	5	1188	c.731G>T	c.(730-732)CGG>CTG	p.R244L	BCL6_uc011bsf.1_Missense_Mutation_p.R244L|BCL6_uc010hza.2_Missense_Mutation_p.R142L|BCL6_uc003frq.1_Missense_Mutation_p.R244L	NM_001130845	NP_001124317	P41182	BCL6_HUMAN	B-cell lymphoma 6 protein isoform 1	244					negative regulation of B cell apoptosis|negative regulation of cell growth|negative regulation of S phase of mitotic cell cycle|negative regulation of transcription from RNA polymerase II promoter|positive regulation of apoptosis|protein import into nucleus, translocation|regulation of germinal center formation|response to DNA damage stimulus	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)|lung(2)|central_nervous_system(1)	5	all_cancers(143;9.45e-12)|Ovarian(172;0.0418)		OV - Ovarian serous cystadenocarcinoma(80;1.76e-18)	GBM - Glioblastoma multiforme(93;0.0141)		CAAAGTCGGCCGGCTGTACTC	0.567			T|Mis	IG loci|ZNFN1A1|LCP1|PIM1|TFRC|MHC2TA|NACA|HSPCB|HSPCA|HIST1H4I|IL21R| POU2AF1|ARHH|EIF4A2|SFRS3	NHL|CLL								22	90	---	---	---	---	PASS
TPRG1	285386	broad.mit.edu	37	3	189038526	189038526	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:189038526G>C	uc003frv.1	+	11	1972	c.745G>C	c.(745-747)GAG>CAG	p.E249Q	TPRG1_uc003frw.1_Missense_Mutation_p.E249Q	NM_198485	NP_940887	Q6ZUI0	TPRG1_HUMAN	tumor protein p63 regulated 1	249											0	all_cancers(143;6.12e-12)|all_hematologic(3;0.0359)|Ovarian(172;0.0925)	all_lung(153;8.23e-09)|Lung NSC(153;3.55e-06)|all_neural(597;0.0019)|Myeloproliferative disorder(1037;0.0255)	Lung(62;6.93e-06)	GBM - Glioblastoma multiforme(93;4.77e-14)		CATTTTGATTGAGACCTACAC	0.438													7	227	---	---	---	---	PASS
GP5	2814	broad.mit.edu	37	3	194118280	194118280	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194118280G>A	uc003ftv.1	-	2	763	c.732C>T	c.(730-732)CTC>CTT	p.L244L		NM_004488	NP_004479	P40197	GPV_HUMAN	glycoprotein V (platelet) precursor	244	Extracellular (Potential).|LRR 8.				blood coagulation, intrinsic pathway|cell adhesion|platelet activation	integral to plasma membrane				skin(2)|breast(1)	3	all_cancers(143;6.64e-09)|Ovarian(172;0.0634)	Melanoma(1037;0.211)	OV - Ovarian serous cystadenocarcinoma(49;7.38e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;4.06e-05)		TCAAAGAACTGAGGTTTGGGA	0.577													62	419	---	---	---	---	PASS
C3orf21	152002	broad.mit.edu	37	3	194991428	194991428	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194991428G>A	uc003fum.3	-	1	468	c.360C>T	c.(358-360)GTC>GTT	p.V120V		NM_152531	NP_689744	Q8NBI6	CC021_HUMAN	hypothetical protein LOC152002	120						integral to membrane	transferase activity, transferring glycosyl groups				0	all_cancers(143;9.33e-09)|Ovarian(172;0.0634)		Epithelial(36;1.73e-20)|all cancers(36;1.42e-18)|OV - Ovarian serous cystadenocarcinoma(49;1.56e-17)|Lung(62;0.000117)|LUSC - Lung squamous cell carcinoma(58;0.000146)	GBM - Glioblastoma multiforme(46;1.36e-05)		AGCGCAGCGCGACGCGGGCCT	0.682													7	49	---	---	---	---	PASS
MUC4	4585	broad.mit.edu	37	3	195489005	195489005	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195489005G>T	uc011bto.1	-	15	14541	c.14081C>A	c.(14080-14082)TCC>TAC	p.S4694Y	MUC4_uc003fuz.2_Missense_Mutation_p.S420Y|MUC4_uc003fva.2_Missense_Mutation_p.S302Y|MUC4_uc003fvb.2_Missense_Mutation_p.S338Y|MUC4_uc003fvc.2_RNA|MUC4_uc003fvd.2_RNA|MUC4_uc003fve.2_Missense_Mutation_p.S338Y|MUC4_uc010hzr.2_RNA|MUC4_uc011btf.1_Missense_Mutation_p.S302Y|MUC4_uc011btg.1_RNA|MUC4_uc011bth.1_Missense_Mutation_p.S386Y|MUC4_uc011bti.1_Missense_Mutation_p.S386Y|MUC4_uc011btj.1_Missense_Mutation_p.S563Y|MUC4_uc011btk.1_Missense_Mutation_p.S302Y|MUC4_uc011btl.1_Missense_Mutation_p.S331Y|MUC4_uc011btm.1_Missense_Mutation_p.S511Y|MUC4_uc011btn.1_Missense_Mutation_p.S302Y|MUC4_uc003fvo.2_Missense_Mutation_p.S586Y|MUC4_uc003fvp.2_Missense_Mutation_p.S535Y	NM_018406	NP_060876	Q99102	MUC4_HUMAN	mucin 4 isoform a	1579	VWFD.				cell-matrix adhesion	integral to plasma membrane|proteinaceous extracellular matrix	ErbB-2 class receptor binding|extracellular matrix constituent, lubricant activity				0	all_cancers(143;1.11e-08)|Ovarian(172;0.0634)|Breast(254;0.206)	Lung NSC(153;0.191)	Epithelial(36;3.72e-24)|all cancers(36;6.22e-22)|OV - Ovarian serous cystadenocarcinoma(49;1.1e-18)|Lung(62;4.65e-05)|LUSC - Lung squamous cell carcinoma(58;5.31e-05)	GBM - Glioblastoma multiforme(46;2.37e-05)		GAGGCTGGCGGAGGCGTGGAG	0.711													4	22	---	---	---	---	PASS
MUC4	4585	broad.mit.edu	37	3	195516771	195516771	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195516771C>A	uc011bto.1	-	2	2140	c.1680G>T	c.(1678-1680)GGG>GGT	p.G560G	MUC4_uc003fvo.2_Intron|MUC4_uc003fvp.2_Intron|MUC4_uc010hzu.1_Silent_p.G442G	NM_018406	NP_060876	Q99102	MUC4_HUMAN	mucin 4 isoform a	565					cell-matrix adhesion	integral to plasma membrane|proteinaceous extracellular matrix	ErbB-2 class receptor binding|extracellular matrix constituent, lubricant activity				0	all_cancers(143;1.11e-08)|Ovarian(172;0.0634)|Breast(254;0.206)	Lung NSC(153;0.191)	Epithelial(36;3.72e-24)|all cancers(36;6.22e-22)|OV - Ovarian serous cystadenocarcinoma(49;1.1e-18)|Lung(62;4.65e-05)|LUSC - Lung squamous cell carcinoma(58;5.31e-05)	GBM - Glioblastoma multiforme(46;2.37e-05)		GGGCGCCTGCCCCTGTTGTTT	0.547													101	616	---	---	---	---	PASS
TM4SF19	116211	broad.mit.edu	37	3	196054466	196054466	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196054466G>A	uc003fwl.1	-						TM4SF19_uc003fwj.2_Intron|TM4SF19_uc010iad.1_Intron|TM4SF19_uc011btv.1_Intron	NM_138461	NP_612470	Q96DZ7	T4S19_HUMAN	transmembrane 4 L six family member 19							integral to membrane					0	all_cancers(143;1.19e-08)|Ovarian(172;0.0634)|Breast(254;0.206)		Epithelial(36;3.94e-24)|all cancers(36;4.34e-22)|OV - Ovarian serous cystadenocarcinoma(49;8.53e-19)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.00314)		CACCATCCTGGAACAGATAGA	0.597													12	154	---	---	---	---	PASS
DLG1	1739	broad.mit.edu	37	3	196778475	196778475	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196778475C>G	uc003fxo.3	-	25	2771	c.2581G>C	c.(2581-2583)GAA>CAA	p.E861Q	DLG1_uc011bub.1_Missense_Mutation_p.E757Q|DLG1_uc011buc.1_Missense_Mutation_p.E745Q|DLG1_uc011bud.1_Missense_Mutation_p.E544Q|DLG1_uc003fxn.3_Missense_Mutation_p.E883Q|DLG1_uc011bue.1_Missense_Mutation_p.E849Q|DLG1_uc010ial.2_Missense_Mutation_p.E861Q	NM_001098424	NP_001091894	Q12959	DLG1_HUMAN	discs, large homolog 1 isoform 1	861	Guanylate kinase-like.				actin filament organization|axon guidance|cell-cell adhesion|cortical actin cytoskeleton organization|endothelial cell proliferation|establishment or maintenance of cell polarity|interspecies interaction between organisms|mitotic cell cycle G1/S transition checkpoint|negative regulation of mitotic cell cycle|protein localization in plasma membrane|synaptic transmission|tight junction assembly	basolateral plasma membrane|cytosol|endoplasmic reticulum membrane|immunological synapse|MPP7-DLG1-LIN7 complex|nucleus|postsynaptic density|postsynaptic membrane|sarcolemma|tight junction	cytoskeletal protein binding|guanylate kinase activity|L27 domain binding|phosphatase binding|phosphoprotein phosphatase activity|potassium channel regulator activity|protein binding|protein C-terminus binding|protein kinase binding			ovary(3)	3	all_cancers(143;6.22e-10)|Ovarian(172;0.0418)|Breast(254;0.0589)	Lung NSC(153;0.133)	Epithelial(36;3.23e-24)|all cancers(36;2.15e-22)|OV - Ovarian serous cystadenocarcinoma(49;3.88e-19)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.0148)		AACTCCTGTTCCAGTTTCATG	0.378													5	271	---	---	---	---	PASS
ACOX3	8310	broad.mit.edu	37	4	8394128	8394128	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:8394128G>C	uc010idk.2	-	11	1377	c.1232C>G	c.(1231-1233)GCC>GGC	p.A411G	ACOX3_uc003glc.3_Missense_Mutation_p.A411G|ACOX3_uc003gld.3_Missense_Mutation_p.A411G|ACOX3_uc003gle.1_Missense_Mutation_p.A316G	NM_003501	NP_003492	O15254	ACOX3_HUMAN	acyl-Coenzyme A oxidase 3 isoform a	411					bile acid metabolic process|fatty acid beta-oxidation using acyl-CoA oxidase	peroxisomal matrix	acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding|pristanoyl-CoA oxidase activity			central_nervous_system(1)	1						GGTCCACGAGGCCAGGGGCTT	0.572													17	381	---	---	---	---	PASS
PPARGC1A	10891	broad.mit.edu	37	4	23825979	23825979	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:23825979G>T	uc003gqs.2	-						PPARGC1A_uc003gqt.2_RNA|PPARGC1A_uc011bxp.1_Intron|PPARGC1A_uc010ier.1_Intron	NM_013261	NP_037393	Q9UBK2	PRGC1_HUMAN	peroxisome proliferator-activated receptor						androgen receptor signaling pathway|brown fat cell differentiation|cellular glucose homeostasis|digestion|fatty acid oxidation|gluconeogenesis|mitochondrion organization|mRNA processing|neuron death|positive regulation of fatty acid oxidation|positive regulation of gluconeogenesis|positive regulation of histone acetylation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|protein complex assembly|protein stabilization|response to muscle activity|response to starvation|RNA splicing|temperature homeostasis|transcription initiation from RNA polymerase II promoter	DNA-directed RNA polymerase II, core complex	androgen receptor binding|DNA binding|ligand-dependent nuclear receptor binding|ligand-dependent nuclear receptor transcription coactivator activity|nucleotide binding|RNA binding|RNA polymerase II transcription cofactor activity|transcription factor binding			ovary(2)|lung(2)|kidney(2)|skin(2)	8		Breast(46;0.0503)				TGGGGTCACTGGAAGATATGG	0.393													123	189	---	---	---	---	PASS
ARAP2	116984	broad.mit.edu	37	4	36093524	36093524	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:36093524G>A	uc003gsq.1	-	28	4742	c.4404C>T	c.(4402-4404)CTC>CTT	p.L1468L		NM_015230	NP_056045	Q8WZ64	ARAP2_HUMAN	ArfGAP with RhoGAP domain, ankyrin repeat and PH	1468	PH 5.				regulation of ARF GTPase activity|small GTPase mediated signal transduction	cytosol	ARF GTPase activator activity|phosphatidylinositol-3,4,5-trisphosphate binding|zinc ion binding			ovary(1)|pancreas(1)|skin(1)	3						TGTAAAGAAAGAGAAACCCAT	0.333													7	123	---	---	---	---	PASS
TBC1D1	23216	broad.mit.edu	37	4	38138813	38138813	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:38138813G>T	uc003gtb.2	+	20	3707	c.3364G>T	c.(3364-3366)GAG>TAG	p.E1122*	TBC1D1_uc011byd.1_Nonsense_Mutation_p.E1113*|TBC1D1_uc010ifd.2_Nonsense_Mutation_p.E909*|TBC1D1_uc003gtd.2_Nonsense_Mutation_p.E134*	NM_015173	NP_055988	Q86TI0	TBCD1_HUMAN	TBC1 (tre-2/USP6, BUB2, cdc16) domain family,	1122						nucleus	Rab GTPase activator activity			ovary(1)	1						CCTGAGCAGTGAGAGCAAGCT	0.557													35	76	---	---	---	---	PASS
FAM114A1	92689	broad.mit.edu	37	4	38907184	38907184	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:38907184C>G	uc003gtn.2	+	5	654	c.478C>G	c.(478-480)CTA>GTA	p.L160V	FAM114A1_uc011byh.1_5'UTR	NM_138389	NP_612398	Q8IWE2	NXP20_HUMAN	hypothetical protein LOC92689	160						cytoplasm				ovary(1)	1						AGGAGCCACTCTACGGATTCA	0.443													68	72	---	---	---	---	PASS
GABRA2	2555	broad.mit.edu	37	4	46388187	46388187	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:46388187G>T	uc003gxc.3	-	2	764	c.91C>A	c.(91-93)CAA>AAA	p.Q31K	GABRA2_uc010igc.2_Missense_Mutation_p.Q31K|GABRA2_uc011bzc.1_5'UTR|GABRA2_uc003gxe.2_Missense_Mutation_p.Q31K|GABRA2_uc010igd.1_Missense_Mutation_p.Q31K	NM_001114175	NP_001107647	P47869	GBRA2_HUMAN	gamma-aminobutyric acid A receptor, alpha 2	31	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway|neurotransmitter transport|regulation of neurotransmitter levels	cell junction|chloride channel complex|integral to synaptic vesicle membrane|postsynaptic membrane	benzodiazepine receptor activity|chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)|skin(2)	4					Alprazolam(DB00404)|Bromazepam(DB01558)|Diazepam(DB00829)|Ethchlorvynol(DB00189)|Fludiazepam(DB01567)|Flunitrazepam(DB01544)|Flurazepam(DB00690)|Lorazepam(DB00186)|Meprobamate(DB00371)|Midazolam(DB00683)	TCATCTTCTTGGATGTTAGCC	0.358													15	74	---	---	---	---	PASS
FRYL	285527	broad.mit.edu	37	4	48559526	48559526	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:48559526C>G	uc003gyh.1	-	34	4674	c.4069G>C	c.(4069-4071)GGA>CGA	p.G1357R	FRYL_uc003gyk.2_Missense_Mutation_p.G1357R|FRYL_uc003gyg.1_Missense_Mutation_p.G53R|FRYL_uc003gyi.1_Missense_Mutation_p.G246R	NM_015030	NP_055845	O94915	FRYL_HUMAN	furry-like	1357					regulation of transcription, DNA-dependent|transcription, DNA-dependent		protein binding			skin(1)	1						TGTGGAGATCCCCATCCTTCT	0.418													23	120	---	---	---	---	PASS
LRRC66	339977	broad.mit.edu	37	4	52861814	52861814	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:52861814G>C	uc003gzi.2	-	4	1387	c.1374C>G	c.(1372-1374)TTC>TTG	p.F458L		NM_001024611	NP_001019782	Q68CR7	LRC66_HUMAN	leucine rich repeat containing 66	458						integral to membrane				ovary(1)|central_nervous_system(1)|skin(1)	3						GTGTCACCCAGAAAGGGGTCT	0.562													22	97	---	---	---	---	PASS
USP46	64854	broad.mit.edu	37	4	53497298	53497298	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:53497298G>C	uc003gzn.2	-	2	235	c.50C>G	c.(49-51)TCT>TGT	p.S17C	USP46_uc003gzm.3_Missense_Mutation_p.S10C|USP46_uc011bzr.1_Missense_Mutation_p.S6C|USP46_uc011bzs.1_5'UTR	NM_022832	NP_073743	P62068	UBP46_HUMAN	ubiquitin specific peptidase 46 isoform 1	17					behavior|protein deubiquitination|regulation of synaptic transmission, GABAergic|ubiquitin-dependent protein catabolic process		protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(1)	1			LUSC - Lung squamous cell carcinoma(32;0.0295)			TTCCAGAGCAGAGGCATTGGT	0.328													3	9	---	---	---	---	PASS
SCFD2	152579	broad.mit.edu	37	4	53751992	53751992	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:53751992G>C	uc003gzu.2	-	8	2018	c.1884C>G	c.(1882-1884)CTC>CTG	p.L628L	SCFD2_uc010igm.2_Silent_p.L583L	NM_152540	NP_689753	Q8WU76	SCFD2_HUMAN	sec1 family domain containing 2	628					protein transport|vesicle docking involved in exocytosis					ovary(2)|pancreas(1)	3			GBM - Glioblastoma multiforme(3;1.07e-26)|LUSC - Lung squamous cell carcinoma(32;0.0134)			CTACCACAAAGAGGATCAGGA	0.512													13	75	---	---	---	---	PASS
EXOC1	55763	broad.mit.edu	37	4	56744156	56744156	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:56744156G>C	uc003hbe.1	+	9	1306	c.1148G>C	c.(1147-1149)AGA>ACA	p.R383T	EXOC1_uc003hbf.1_Missense_Mutation_p.R383T|EXOC1_uc003hbg.1_Missense_Mutation_p.R383T	NM_018261	NP_060731	Q9NV70	EXOC1_HUMAN	exocyst complex component 1 isoform 1	383					exocytosis|protein transport	exocyst	protein binding			ovary(2)|skin(2)|lung(1)|central_nervous_system(1)	6	Glioma(25;0.08)|all_neural(26;0.101)					CCATTTCATAGAGATTTGCTC	0.378													29	132	---	---	---	---	PASS
CEP135	9662	broad.mit.edu	37	4	56886933	56886933	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:56886933G>A	uc003hbi.2	+	24	3541	c.3307G>A	c.(3307-3309)GAA>AAA	p.E1103K	CEP135_uc003hbj.2_Missense_Mutation_p.E809K	NM_025009	NP_079285	Q66GS9	CP135_HUMAN	centrosome protein 4	1103	Potential.				centriole replication|centriole-centriole cohesion|G2/M transition of mitotic cell cycle	centriole|cytosol	protein C-terminus binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5	Glioma(25;0.08)|all_neural(26;0.101)					GATCTCAACTGAAAGATACGA	0.333													50	185	---	---	---	---	PASS
AASDH	132949	broad.mit.edu	37	4	57244467	57244467	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57244467G>C	uc003hbn.2	-	4	668	c.515C>G	c.(514-516)TCT>TGT	p.S172C	AASDH_uc010ihb.2_5'UTR|AASDH_uc011caa.1_Missense_Mutation_p.S19C|AASDH_uc003hbo.2_Missense_Mutation_p.S72C|AASDH_uc011cab.1_Intron|AASDH_uc010ihc.2_Missense_Mutation_p.S172C|AASDH_uc003hbp.2_Missense_Mutation_p.S172C	NM_181806	NP_861522	Q4L235	ACSF4_HUMAN	aminoadipate-semialdehyde dehydrogenase	172					fatty acid metabolic process		acid-thiol ligase activity|acyl carrier activity|ATP binding|cofactor binding			ovary(4)	4	Glioma(25;0.08)|all_neural(26;0.101)	all_hematologic(202;0.0017)				GACATGCTCAGAACTTATGCT	0.373													22	111	---	---	---	---	PASS
LPHN3	23284	broad.mit.edu	37	4	62812641	62812641	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:62812641G>A	uc010ihh.2	+	13	2398	c.2225G>A	c.(2224-2226)AGA>AAA	p.R742K	LPHN3_uc003hcq.3_Missense_Mutation_p.R742K|LPHN3_uc003hct.2_Missense_Mutation_p.R135K	NM_015236	NP_056051	Q9HAR2	LPHN3_HUMAN	latrophilin 3 precursor	729	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity|sugar binding			lung(15)|ovary(1)|central_nervous_system(1)|pancreas(1)	18						GGAGAGATCAGAGTGGCCTTT	0.363													7	331	---	---	---	---	PASS
EPHA5	2044	broad.mit.edu	37	4	66213904	66213904	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:66213904G>C	uc003hcy.2	-	15	2719	c.2526C>G	c.(2524-2526)ATC>ATG	p.I842M	EPHA5_uc003hcx.2_Missense_Mutation_p.I774M|EPHA5_uc003hcz.2_Missense_Mutation_p.I820M|EPHA5_uc011cah.1_Missense_Mutation_p.I843M|EPHA5_uc011cai.1_Missense_Mutation_p.I821M|EPHA5_uc003hda.2_Missense_Mutation_p.I843M	NM_004439	NP_004430	P54756	EPHA5_HUMAN	ephrin receptor EphA5 isoform a precursor	842	Cytoplasmic (Potential).|Protein kinase.				cAMP-mediated signaling|neuron development	dendrite|external side of plasma membrane|integral to plasma membrane|neuronal cell body|perinuclear region of cytoplasm|rough endoplasmic reticulum	ATP binding|transmembrane-ephrin receptor activity			lung(19)|stomach(2)|ovary(2)|central_nervous_system(1)	24						CAGTCCATCTGATTGGAATTT	0.393										TSP Lung(17;0.13)			32	131	---	---	---	---	PASS
UBA6	55236	broad.mit.edu	37	4	68527924	68527924	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:68527924C>A	uc003hdg.3	-	13	1139	c.1087G>T	c.(1087-1089)GAA>TAA	p.E363*	UBA6_uc003hdi.2_Nonsense_Mutation_p.E363*	NM_018227	NP_060697	A0AVT1	UBA6_HUMAN	ubiquitin-activating enzyme E1-like 2	363					protein ubiquitination|ubiquitin-dependent protein catabolic process	cytoplasm	ATP binding|FAT10 activating enzyme activity|ligase activity|protein binding				0						TCCAAGGTTTCACTTATAGAT	0.323													25	117	---	---	---	---	PASS
UBA6	55236	broad.mit.edu	37	4	68544165	68544165	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:68544165C>G	uc003hdg.3	-	5	397	c.345G>C	c.(343-345)AAG>AAC	p.K115N	UBA6_uc003hdi.2_Missense_Mutation_p.K115N|UBA6_uc003hdj.2_Missense_Mutation_p.K115N	NM_018227	NP_060697	A0AVT1	UBA6_HUMAN	ubiquitin-activating enzyme E1-like 2	115					protein ubiquitination|ubiquitin-dependent protein catabolic process	cytoplasm	ATP binding|FAT10 activating enzyme activity|ligase activity|protein binding				0						ACCTGTTTCTCTTATTAACAA	0.284													15	111	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	4	69433678	69433678	+	IGR	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:69433678G>C								YTHDC1 (217854 upstream) : UGT2B15 (78638 downstream)																							AGCCAACAGAGAAGCGGAGAC	0.433													72	300	---	---	---	---	PASS
UGT2B4	7363	broad.mit.edu	37	4	70350951	70350951	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70350951G>T	uc003hek.3	-	5	1332	c.1285C>A	c.(1285-1287)CTG>ATG	p.L429M	UGT2B4_uc011cap.1_Missense_Mutation_p.L293M|UGT2B4_uc003hel.3_Intron	NM_021139	NP_066962	P06133	UD2B4_HUMAN	UDP glucuronosyltransferase 2B4 precursor	429					estrogen catabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glucuronosyltransferase activity			skin(2)	2						ACTGTCTTCAGTGCATTGAGT	0.388													18	251	---	---	---	---	PASS
SULT1B1	27284	broad.mit.edu	37	4	70620842	70620842	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70620842C>T	uc003hen.2	-	2	392	c.94G>A	c.(94-96)GAA>AAA	p.E32K		NM_014465	NP_055280	O43704	ST1B1_HUMAN	sulfotransferase family, cytosolic, 1B, member	32					3'-phosphoadenosine 5'-phosphosulfate metabolic process|cellular biogenic amine metabolic process|flavonoid metabolic process|steroid metabolic process|sulfation|thyroid hormone metabolic process|xenobiotic metabolic process	cytosol					0						TGGAACTGTTCAATTTTTTCC	0.403													7	306	---	---	---	---	PASS
ADAMTS3	9508	broad.mit.edu	37	4	73178122	73178122	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73178122C>T	uc003hgk.1	-	13	1844	c.1807G>A	c.(1807-1809)GAA>AAA	p.E603K	ADAMTS3_uc003hgl.2_5'Flank	NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	603	TSP type-1 1.				collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)			TGGCATTCTTCTGTGTTACAA	0.428													24	127	---	---	---	---	PASS
NAAA	27163	broad.mit.edu	37	4	76857356	76857356	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:76857356C>G	uc003hjb.2	-	3	468	c.404G>C	c.(403-405)AGA>ACA	p.R135T	NAAA_uc003hja.2_Missense_Mutation_p.R135T|NAAA_uc003hjc.3_Missense_Mutation_p.R135T|NAAA_uc003hjd.3_RNA|NAAA_uc011cbq.1_Missense_Mutation_p.R34T|NAAA_uc010iiz.1_Missense_Mutation_p.R135T	NM_014435	NP_055250	Q02083	NAAA_HUMAN	N-acylethanolamine acid amidase isoform 1	135					lipid metabolic process	lysosome	hydrolase activity			skin(1)	1						AATGTGGCCTCTGGAGTCTTG	0.393													8	242	---	---	---	---	PASS
FRAS1	80144	broad.mit.edu	37	4	79188522	79188522	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79188522G>A	uc003hlb.2	+	9	1357	c.917G>A	c.(916-918)TGC>TAC	p.C306Y	FRAS1_uc003hkw.2_Missense_Mutation_p.C306Y|FRAS1_uc003hky.1_Missense_Mutation_p.C10Y|FRAS1_uc003hkz.2_Missense_Mutation_p.C10Y	NM_025074	NP_079350	Q86XX4	FRAS1_HUMAN	Fraser syndrome 1	306	VWFC 5.|Extracellular (Potential).				cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5						TGTGAGTTCTGCATGTGTGAT	0.552													8	32	---	---	---	---	PASS
FRAS1	80144	broad.mit.edu	37	4	79366783	79366783	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79366783G>C	uc003hlb.2	+	42	6213	c.5773G>C	c.(5773-5775)GAG>CAG	p.E1925Q	FRAS1_uc003hkw.2_Missense_Mutation_p.E1925Q|FRAS1_uc010ijj.1_Missense_Mutation_p.E345Q	NM_025074	NP_079350	Q86XX4	FRAS1_HUMAN	Fraser syndrome 1	1924	CSPG 7.|Extracellular (Potential).				cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5						TGAAAGCATTGAGCCAACCCA	0.393													10	376	---	---	---	---	PASS
NAA11	84779	broad.mit.edu	37	4	80246623	80246623	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:80246623A>G	uc003hlt.3	-	1	549	c.409T>C	c.(409-411)TAC>CAC	p.Y137H		NM_032693	NP_116082	Q9BSU3	NAA11_HUMAN	alpha-N-acetyltransferase 1B	137	N-acetyltransferase.					cytoplasm|nucleus	peptide alpha-N-acetyltransferase activity|protein binding			ovary(1)|central_nervous_system(1)	2						TCTGCATAGTATTTAGGTTCC	0.493													23	81	---	---	---	---	PASS
SEC31A	22872	broad.mit.edu	37	4	83802003	83802003	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:83802003G>C	uc003hnf.2	-	3	316	c.152C>G	c.(151-153)TCT>TGT	p.S51C	SEC31A_uc011ccl.1_Missense_Mutation_p.S51C|SEC31A_uc003hnl.2_Missense_Mutation_p.S51C|SEC31A_uc003hng.2_Missense_Mutation_p.S51C|SEC31A_uc003hnh.2_Missense_Mutation_p.S51C|SEC31A_uc003hni.2_Missense_Mutation_p.S51C|SEC31A_uc003hnj.2_Missense_Mutation_p.S51C|SEC31A_uc011ccm.1_Missense_Mutation_p.S46C|SEC31A_uc011ccn.1_Missense_Mutation_p.S51C|SEC31A_uc003hnk.2_Missense_Mutation_p.S51C|SEC31A_uc003hnm.2_Missense_Mutation_p.S51C|SEC31A_uc003hnn.1_Missense_Mutation_p.S51C|SEC31A_uc003hno.2_Missense_Mutation_p.S51C	NM_001077207	NP_001070675	O94979	SC31A_HUMAN	SEC31 homolog A isoform 1	51					COPII vesicle coating|post-translational protein modification|protein N-linked glycosylation via asparagine|protein transport|response to calcium ion	COPII vesicle coat|cytosol|endoplasmic reticulum membrane|perinuclear region of cytoplasm	calcium-dependent protein binding		SEC31A/JAK2(4)|SEC31A/ALK(3)	haematopoietic_and_lymphoid_tissue(4)|soft_tissue(3)|breast(1)	8		Hepatocellular(203;0.114)				GGATGGATCAGAGAGGTCTAA	0.333													39	215	---	---	---	---	PASS
HELQ	113510	broad.mit.edu	37	4	84374925	84374925	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:84374925G>C	uc003hom.2	-	2	650	c.471C>G	c.(469-471)CTC>CTG	p.L157L	HELQ_uc010ikb.2_Silent_p.L157L|HELQ_uc003hol.3_RNA|HELQ_uc010ikc.2_RNA|HELQ_uc003hon.1_Silent_p.L51L|HELQ_uc003hoo.1_Silent_p.L120L|HELQ_uc003hop.1_Silent_p.L51L|HELQ_uc003hoq.1_Silent_p.L157L|MRPS18C_uc003hor.3_5'Flank|MRPS18C_uc011ccu.1_5'Flank	NM_133636	NP_598375	Q8TDG4	HELQ_HUMAN	DNA helicase HEL308	157							ATP binding|ATP-dependent helicase activity|nucleic acid binding			ovary(1)|breast(1)|skin(1)	3						TAGTAATGCTGAGTTTGTTTT	0.398								Direct_reversal_of_damage|Other_identified_genes_with_known_or_suspected_DNA_repair_function					96	407	---	---	---	---	PASS
PTPN13	5783	broad.mit.edu	37	4	87695598	87695598	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:87695598C>T	uc003hpz.2	+	33	5902	c.5422C>T	c.(5422-5424)CAG>TAG	p.Q1808*	PTPN13_uc003hpy.2_Nonsense_Mutation_p.Q1813*|PTPN13_uc003hqa.2_Nonsense_Mutation_p.Q1789*|PTPN13_uc003hqb.2_Nonsense_Mutation_p.Q1617*|PTPN13_uc003hqc.1_Nonsense_Mutation_p.Q174*	NM_080683	NP_542414	Q12923	PTN13_HUMAN	protein tyrosine phosphatase, non-receptor type	1808	PDZ 4.					cytoplasm|cytoskeleton|plasma membrane	protein binding|protein binding|protein tyrosine phosphatase activity			ovary(4)|breast(1)|kidney(1)	6		Hepatocellular(203;0.114)|all_hematologic(202;0.21)|Acute lymphoblastic leukemia(40;0.242)		OV - Ovarian serous cystadenocarcinoma(123;0.00082)		CAAAGGCAATCAGAGAATTGG	0.393													7	22	---	---	---	---	PASS
KLHL8	57563	broad.mit.edu	37	4	88116479	88116479	+	Silent	SNP	G	C	C	rs149338950	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:88116479G>C	uc011cdb.1	-	2	598	c.213C>G	c.(211-213)CTC>CTG	p.L71L	KLHL8_uc003hql.1_Silent_p.L71L|KLHL8_uc003hqm.1_Silent_p.L71L|KLHL8_uc003hqn.1_Silent_p.L71L|KLHL8_uc010ikj.1_5'UTR	NM_020803	NP_065854	Q9P2G9	KLHL8_HUMAN	kelch-like 8	71	BTB.										0		Hepatocellular(203;0.114)|all_hematologic(202;0.21)|Acute lymphoblastic leukemia(40;0.242)		OV - Ovarian serous cystadenocarcinoma(123;0.000603)		ATCTCACCTTGAGTGTGACAT	0.363													15	73	---	---	---	---	PASS
FAM13A	10144	broad.mit.edu	37	4	89668800	89668800	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:89668800G>A	uc003hse.1	-	18	2572	c.2364C>T	c.(2362-2364)AGC>AGT	p.S788S	FAM13A_uc003hsa.1_Silent_p.S259S|FAM13A_uc003hsb.1_Silent_p.S462S|FAM13A_uc003hsd.1_Silent_p.S462S|FAM13A_uc003hsc.1_Silent_p.S448S|FAM13A_uc011cdq.1_Silent_p.S434S|FAM13A_uc003hsf.1_Silent_p.S374S|FAM13A_uc003hsg.1_Silent_p.S259S	NM_014883	NP_055698	O94988	FA13A_HUMAN	family with sequence similarity 13, member A1	788					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(1)|liver(1)	2						CCTCAGGGCGGCTGCTTTCCG	0.502													5	278	---	---	---	---	PASS
GPRIN3	285513	broad.mit.edu	37	4	90169059	90169059	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:90169059T>C	uc003hsm.1	-	2	2722	c.2203A>G	c.(2203-2205)ATT>GTT	p.I735V		NM_198281	NP_938022	Q6ZVF9	GRIN3_HUMAN	G protein-regulated inducer of neurite outgrowth	735										ovary(3)	3		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;5.67e-05)		TCTGAGGAAATGGATCTCCGG	0.483													50	205	---	---	---	---	PASS
FAM190A	401145	broad.mit.edu	37	4	91549249	91549249	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:91549249A>T	uc003hsv.3	+	6	2138	c.1798A>T	c.(1798-1800)AGT>TGT	p.S600C	FAM190A_uc010ikv.2_RNA|FAM190A_uc003hsw.2_Missense_Mutation_p.S600C	NM_001145065	NP_001138537	Q9C0I3	F190A_HUMAN	KIAA1680 protein isoform 1	600										large_intestine(1)|ovary(1)	2						AATGCCCAACAGTCCATCTGC	0.448													24	104	---	---	---	---	PASS
FAM190A	401145	broad.mit.edu	37	4	91549337	91549337	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:91549337C>T	uc003hsv.3	+	6	2226	c.1886C>T	c.(1885-1887)ACG>ATG	p.T629M	FAM190A_uc010ikv.2_RNA|FAM190A_uc003hsw.2_Missense_Mutation_p.T629M	NM_001145065	NP_001138537	Q9C0I3	F190A_HUMAN	KIAA1680 protein isoform 1	629										large_intestine(1)|ovary(1)	2						CAGGACTGCACGGCAGTCAAG	0.428													6	113	---	---	---	---	PASS
GRID2	2895	broad.mit.edu	37	4	94006149	94006149	+	Missense_Mutation	SNP	G	T	T	rs78241610		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:94006149G>T	uc011cdt.1	+	3	506	c.248G>T	c.(247-249)TGT>TTT	p.C83F	GRID2_uc010ikx.2_Missense_Mutation_p.C83F|GRID2_uc011cdu.1_Intron|GRID2_uc011cdv.1_RNA	NM_001510	NP_001501	O43424	GRID2_HUMAN	glutamate receptor, ionotropic, delta 2	83	Extracellular (Potential).				glutamate signaling pathway	cell junction|integral to plasma membrane|outer membrane-bounded periplasmic space|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|ionotropic glutamate receptor activity			ovary(3)|skin(2)|large_intestine(1)	6		Hepatocellular(203;0.114)|all_hematologic(202;0.177)		OV - Ovarian serous cystadenocarcinoma(123;3.22e-06)|LUSC - Lung squamous cell carcinoma(81;0.185)|Lung(65;0.191)	L-Glutamic Acid(DB00142)	CTTGCAGCCTGTGAACTTATG	0.458													36	63	---	---	---	---	PASS
ANK2	287	broad.mit.edu	37	4	114276263	114276263	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:114276263G>A	uc003ibe.3	+	38	6589	c.6489G>A	c.(6487-6489)CAG>CAA	p.Q2163Q	ANK2_uc003ibd.3_Intron|ANK2_uc003ibf.3_Intron|ANK2_uc011cgc.1_Intron|ANK2_uc003ibg.3_Intron|ANK2_uc003ibh.3_Intron|ANK2_uc011cgd.1_5'Flank|ANK2_uc011cgb.1_Silent_p.Q2178Q	NM_001148	NP_001139	Q01484	ANK2_HUMAN	ankyrin 2 isoform 1	2130					axon guidance|signal transduction	apical plasma membrane|basolateral plasma membrane|cytoskeleton|cytosol|sarcomere	protein binding|protein binding			central_nervous_system(7)|ovary(3)|large_intestine(2)|breast(1)|skin(1)	14		Ovarian(17;0.0448)|Hepatocellular(203;0.218)		OV - Ovarian serous cystadenocarcinoma(123;4.92e-05)		AAAAGGCACAGCTTCACTTAG	0.443													53	65	---	---	---	---	PASS
NDST3	9348	broad.mit.edu	37	4	119035982	119035982	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:119035982G>C	uc003ibx.2	+	4	1494	c.1091G>C	c.(1090-1092)GGA>GCA	p.G364A	NDST3_uc011cgf.1_Intron	NM_004784	NP_004775	O95803	NDST3_HUMAN	N-deacetylase/N-sulfotransferase (heparan	364	Lumenal (Potential).|Heparan sulfate N-deacetylase 3.					Golgi membrane|integral to membrane	[heparan sulfate]-glucosamine N-sulfotransferase activity|hydrolase activity			large_intestine(1)	1						GAAGATGAAGGAGATGACTGT	0.423													8	119	---	---	---	---	PASS
PRSS12	8492	broad.mit.edu	37	4	119203131	119203131	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:119203131G>C	uc003ica.1	-	13	2635	c.2588C>G	c.(2587-2589)TCA>TGA	p.S863*		NM_003619	NP_003610	P56730	NETR_HUMAN	neurotrypsin precursor	863	Peptidase S1.					membrane	scavenger receptor activity			skin(1)	1						TACAAAGGCTGAGACTTTGGT	0.458													58	89	---	---	---	---	PASS
C4orf31	79625	broad.mit.edu	37	4	121958117	121958117	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:121958117C>T	uc003idq.1	-	4	1536	c.1009G>A	c.(1009-1011)GAA>AAA	p.E337K		NM_024574	NP_078850	Q8TB73	CD031_HUMAN	hypothetical protein LOC79625 precursor	337											0						TGTTTGGCTTCTTCCTTGGTC	0.438													91	129	---	---	---	---	PASS
FAT4	79633	broad.mit.edu	37	4	126371212	126371212	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:126371212G>T	uc003ifj.3	+	9	9041	c.9041G>T	c.(9040-9042)GGA>GTA	p.G3014V	FAT4_uc011cgp.1_Missense_Mutation_p.G1312V|FAT4_uc003ifi.1_Missense_Mutation_p.G492V	NM_024582	NP_078858	Q6V0I7	FAT4_HUMAN	FAT tumor suppressor homolog 4 precursor	3014	Extracellular (Potential).|Cadherin 29.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(9)|skin(5)|upper_aerodigestive_tract(2)|pancreas(2)	18						AAAGATTTTGGACTGAATTCA	0.348													51	109	---	---	---	---	PASS
NAA15	80155	broad.mit.edu	37	4	140291423	140291423	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:140291423G>A	uc003ihu.1	+	15	2068	c.1812G>A	c.(1810-1812)AAG>AAA	p.K604K		NM_057175	NP_476516	Q9BXJ9	NAA15_HUMAN	NMDA receptor regulated 1	604					angiogenesis|cell differentiation|N-terminal protein amino acid acetylation|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|transcription factor complex	protein binding			ovary(1)|skin(1)	2						GAGCTCAAAAGAAAGCCCAGA	0.184													3	26	---	---	---	---	PASS
INPP4B	8821	broad.mit.edu	37	4	143003189	143003189	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:143003189C>T	uc003iix.3	-	26	3232	c.2637G>A	c.(2635-2637)ATG>ATA	p.M879I	INPP4B_uc003iiw.3_Missense_Mutation_p.M879I|INPP4B_uc011chm.1_RNA|INPP4B_uc011chn.1_Missense_Mutation_p.M694I|INPP4B_uc011cho.1_RNA	NM_003866	NP_003857	O15327	INP4B_HUMAN	inositol polyphosphate-4-phosphatase, type II,	879					signal transduction		phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity|phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity			ovary(1)|lung(1)	2	all_hematologic(180;0.158)					GATACCTTCTCATGCAATCCA	0.343													40	61	---	---	---	---	PASS
INPP4B	8821	broad.mit.edu	37	4	143029291	143029291	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:143029291G>C	uc003iix.3	-	24	2924	c.2329C>G	c.(2329-2331)CTA>GTA	p.L777V	INPP4B_uc003iiw.3_Missense_Mutation_p.L777V|INPP4B_uc011chm.1_RNA|INPP4B_uc011chn.1_Missense_Mutation_p.L592V|INPP4B_uc011cho.1_RNA	NM_003866	NP_003857	O15327	INP4B_HUMAN	inositol polyphosphate-4-phosphatase, type II,	777					signal transduction		phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity|phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity			ovary(1)|lung(1)	2	all_hematologic(180;0.158)					TATTCTTGTAGAAGTTCGAAG	0.323													8	84	---	---	---	---	PASS
C4orf51	646603	broad.mit.edu	37	4	146617716	146617716	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:146617716C>G	uc003ikk.2	+	2	239	c.239C>G	c.(238-240)TCA>TGA	p.S80*		NM_001080531	NP_001074000	C9J302	CD051_HUMAN	chromosome 4 open reading frame 51	80											0						CTTAGGATGTCATTGACAAAC	0.403													40	75	---	---	---	---	PASS
PRMT10	90826	broad.mit.edu	37	4	148575157	148575157	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:148575157C>G	uc003ilc.2	-	9	2033	c.1891G>C	c.(1891-1893)GAA>CAA	p.E631Q	PRMT10_uc003ilb.2_Missense_Mutation_p.E275Q|PRMT10_uc003ild.2_Missense_Mutation_p.E518Q	NM_138364	NP_612373	Q6P2P2	ANM10_HUMAN	protein arginine methyltransferase 10	631						cytoplasm	binding|protein methyltransferase activity			ovary(1)|central_nervous_system(1)	2						TCAAGTGTTTCTTTAGGAAAG	0.418													21	198	---	---	---	---	PASS
DCLK2	166614	broad.mit.edu	37	4	151120233	151120233	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:151120233G>A	uc003ilm.3	+						DCLK2_uc003iln.3_Intron|DCLK2_uc003ilo.3_Intron|DCLK2_uc003ilp.3_Intron	NM_001040260	NP_001035350	Q8N568	DCLK2_HUMAN	doublecortin-like kinase 2 isoform a						intracellular signal transduction	cytoplasm|cytoskeleton	ATP binding|protein serine/threonine kinase activity			ovary(3)	3	all_hematologic(180;0.151)					ATCCCCAGGTGAGCCATGACT	0.453													11	12	---	---	---	---	PASS
FBXW7	55294	broad.mit.edu	37	4	153244124	153244124	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:153244124G>C	uc003ims.2	-	12	2182	c.2033C>G	c.(2032-2034)TCA>TGA	p.S678*	FBXW7_uc011cii.1_Nonsense_Mutation_p.S678*|FBXW7_uc003imt.2_Nonsense_Mutation_p.S678*|FBXW7_uc011cih.1_Nonsense_Mutation_p.S502*|FBXW7_uc003imq.2_Nonsense_Mutation_p.S598*|FBXW7_uc003imr.2_Nonsense_Mutation_p.S560*	NM_033632	NP_361014	Q969H0	FBXW7_HUMAN	F-box and WD repeat domain containing 7 isoform	678					interspecies interaction between organisms|lipid homeostasis|negative regulation of DNA endoreduplication|negative regulation of hepatocyte proliferation|negative regulation of Notch signaling pathway|negative regulation of triglyceride biosynthetic process|positive regulation of epidermal growth factor receptor activity|positive regulation of ERK1 and ERK2 cascade|positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process|protein stabilization|protein ubiquitination|regulation of lipid storage|regulation of protein localization|SCF-dependent proteasomal ubiquitin-dependent protein catabolic process|sister chromatid cohesion|vasculature development	nucleolus|nucleolus|nucleoplasm|nucleoplasm|SCF ubiquitin ligase complex	protein binding|protein binding			haematopoietic_and_lymphoid_tissue(125)|large_intestine(99)|stomach(16)|lung(14)|endometrium(13)|ovary(9)|biliary_tract(8)|upper_aerodigestive_tract(5)|central_nervous_system(3)|kidney(3)|skin(3)|pancreas(3)|breast(2)|prostate(2)|cervix(1)|NS(1)|bone(1)	308	all_hematologic(180;0.093)	Acute lymphoblastic leukemia(8;0.000629)|all_hematologic(8;0.067)				CTTTGTGTTTGAGGCTCTGAT	0.493			Mis|N|D|F		colorectal|endometrial|T-ALL								44	233	---	---	---	---	PASS
DCHS2	54798	broad.mit.edu	37	4	155157121	155157121	+	Missense_Mutation	SNP	C	G	G	rs145835627		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:155157121C>G	uc003inw.2	-	25	7318	c.7318G>C	c.(7318-7320)GAC>CAC	p.D2440H		NM_017639	NP_060109	Q6V1P9	PCD23_HUMAN	dachsous 2 isoform 1	2440	Cadherin 22.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|pancreas(1)	4	all_hematologic(180;0.208)	Renal(120;0.0854)		LUSC - Lung squamous cell carcinoma(193;0.107)		AACTGTCTGTCTTTATTCTTT	0.428													9	112	---	---	---	---	PASS
DCHS2	54798	broad.mit.edu	37	4	155254655	155254655	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:155254655G>C	uc003inw.2	-						DCHS2_uc003inx.2_Intron	NM_017639	NP_060109	Q6V1P9	PCD23_HUMAN	dachsous 2 isoform 1						homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|pancreas(1)	4	all_hematologic(180;0.208)	Renal(120;0.0854)		LUSC - Lung squamous cell carcinoma(193;0.107)		GTCTGAAAAAGAGAGAGGGGA	0.403													15	13	---	---	---	---	PASS
GLRB	2743	broad.mit.edu	37	4	158059978	158059978	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:158059978G>A	uc003ipj.2	+	7	830	c.628G>A	c.(628-630)GAT>AAT	p.D210N		NM_000824	NP_000815	P48167	GLRB_HUMAN	glycine receptor, beta isoform A precursor	210	Extracellular (Probable).				nervous system development|neuropeptide signaling pathway|startle response	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	extracellular-glycine-gated chloride channel activity|protein binding|receptor activity			skin(2)	2	all_hematologic(180;0.24)	Renal(120;0.0458)		KIRC - Kidney renal clear cell carcinoma(143;0.0564)|COAD - Colon adenocarcinoma(41;0.0642)|Kidney(143;0.0707)	Glycine(DB00145)	CACAACTGATGATTTACGATT	0.249													44	78	---	---	---	---	PASS
TRIM60	166655	broad.mit.edu	37	4	165962382	165962382	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:165962382G>A	uc003iqy.1	+	3	1328	c.1158G>A	c.(1156-1158)TGG>TGA	p.W386*	TRIM60_uc010iqx.1_Nonsense_Mutation_p.W386*	NM_152620	NP_689833	Q495X7	TRI60_HUMAN	ring finger protein 129	386	B30.2/SPRY.					intracellular	zinc ion binding			skin(1)	1	all_hematologic(180;0.221)	Prostate(90;0.0959)|Melanoma(52;0.18)		GBM - Glioblastoma multiforme(119;0.0844)		GCGGATTCTGGGCAATTGGGC	0.453													77	128	---	---	---	---	PASS
TMEM192	201931	broad.mit.edu	37	4	166006831	166006831	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:166006831C>A	uc003iqz.3	-	5	683	c.584G>T	c.(583-585)CGG>CTG	p.R195L		NM_001100389	NP_001093859	Q8IY95	TM192_HUMAN	transmembrane protein 192	195	Cytoplasmic (Potential).					Golgi apparatus|integral to membrane|late endosome|lysosomal membrane|nucleus				skin(1)	1	all_hematologic(180;0.221)	Prostate(90;0.0959)|Melanoma(52;0.18)		GBM - Glioblastoma multiforme(119;0.0926)		ATTAAATCTCCGGATTTTCAC	0.318													14	105	---	---	---	---	PASS
DDX60L	91351	broad.mit.edu	37	4	169369933	169369933	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:169369933G>C	uc003irq.3	-						DDX60L_uc003irr.1_Intron|DDX60L_uc003irs.1_Intron	NM_001012967	NP_001012985	Q5H9U9	DDX6L_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like								ATP binding|ATP-dependent helicase activity|RNA binding			ovary(1)	1		Prostate(90;0.00876)|Renal(120;0.0183)|all_neural(102;0.0837)|Melanoma(52;0.132)		GBM - Glioblastoma multiforme(119;0.175)		CACTTGTTCTGAAAATTAAAA	0.348													10	53	---	---	---	---	PASS
VEGFC	7424	broad.mit.edu	37	4	177608573	177608573	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:177608573C>G	uc003ius.1	-	6	1343	c.913G>C	c.(913-915)GGA>CGA	p.G305R		NM_005429	NP_005420	P49767	VEGFC_HUMAN	vascular endothelial growth factor C	305	4 X 16 AA repeats of C-X(10)-C-X-C- X(1,3)-C.|2.				angiogenesis|induction of positive chemotaxis|platelet activation|platelet degranulation|positive regulation of cell division|positive regulation of mast cell chemotaxis|substrate-dependent cell migration|vascular endothelial growth factor receptor signaling pathway	membrane|platelet alpha granule lumen	chemoattractant activity|growth factor activity			lung(5)	5		Breast(14;0.000223)|Renal(120;0.00988)|Prostate(90;0.00996)|Melanoma(52;0.0101)|all_hematologic(60;0.107)|all_neural(102;0.164)		all cancers(43;1.59e-18)|Epithelial(43;3.68e-16)|OV - Ovarian serous cystadenocarcinoma(60;8.52e-09)|GBM - Glioblastoma multiforme(59;0.000546)|STAD - Stomach adenocarcinoma(60;0.00308)|Colorectal(24;0.025)|COAD - Colon adenocarcinoma(29;0.0359)|LUSC - Lung squamous cell carcinoma(193;0.0397)		TTGTGGGGTCCACAGCTGGCA	0.507													90	120	---	---	---	---	PASS
ACSL1	2180	broad.mit.edu	37	4	185687114	185687114	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:185687114C>G	uc003iww.2	-	14	1584	c.1290G>C	c.(1288-1290)CTG>CTC	p.L430L	ACSL1_uc011ckm.1_Silent_p.L259L|ACSL1_uc003iwt.1_Silent_p.L430L|ACSL1_uc003iwu.1_Silent_p.L430L|ACSL1_uc011ckn.1_Silent_p.L396L|ACSL1_uc003iws.1_5'UTR	NM_001995	NP_001986	P33121	ACSL1_HUMAN	acyl-CoA synthetase long-chain family member 1	430	Cytoplasmic (Potential).				digestion|fatty acid metabolic process|long-chain fatty-acyl-CoA biosynthetic process|regulation of fatty acid oxidation|triglyceride biosynthetic process	endoplasmic reticulum membrane|integral to membrane|microsome|mitochondrial outer membrane|peroxisomal membrane	ATP binding|long-chain fatty acid-CoA ligase activity			ovary(2)	2		all_lung(41;7.57e-14)|Lung NSC(41;1.81e-13)|Colorectal(36;0.00172)|Hepatocellular(41;0.00826)|Renal(120;0.00988)|Prostate(90;0.0235)|all_hematologic(60;0.0315)|all_neural(102;0.107)|Medulloblastoma(177;0.146)		all cancers(43;1.33e-28)|Epithelial(43;5.3e-25)|OV - Ovarian serous cystadenocarcinoma(60;4.88e-11)|Colorectal(24;3.59e-06)|STAD - Stomach adenocarcinoma(60;2.72e-05)|GBM - Glioblastoma multiforme(59;2.83e-05)|BRCA - Breast invasive adenocarcinoma(30;7.66e-05)|COAD - Colon adenocarcinoma(29;0.000538)|LUSC - Lung squamous cell carcinoma(40;0.008)|READ - Rectum adenocarcinoma(43;0.0419)	Adenosine monophosphate(DB00131)|Adenosine triphosphate(DB00171)	CTGTCACCATCAGCCGGACTC	0.652													36	68	---	---	---	---	PASS
SORBS2	8470	broad.mit.edu	37	4	186533109	186533109	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:186533109C>T	uc003iyl.2	-	18	3767	c.2909G>A	c.(2908-2910)AGA>AAA	p.R970K	SORBS2_uc003iyh.2_Missense_Mutation_p.R694K|SORBS2_uc011ckw.1_Missense_Mutation_p.R531K|SORBS2_uc003iyi.2_Missense_Mutation_p.R601K|SORBS2_uc011ckx.1_Missense_Mutation_p.R536K|SORBS2_uc003iyk.2_Missense_Mutation_p.R514K|SORBS2_uc003iym.2_Missense_Mutation_p.R1070K|SORBS2_uc003iyn.1_Missense_Mutation_p.R561K|SORBS2_uc011cku.1_Missense_Mutation_p.R362K|SORBS2_uc011ckv.1_Missense_Mutation_p.R874K|SORBS2_uc003iyd.2_Missense_Mutation_p.R669K|SORBS2_uc003iye.2_Missense_Mutation_p.R543K|SORBS2_uc003iya.2_Missense_Mutation_p.R490K|SORBS2_uc003iyb.2_Missense_Mutation_p.R443K|SORBS2_uc003iyc.2_Missense_Mutation_p.R423K|SORBS2_uc003iyg.2_Missense_Mutation_p.R1084K|SORBS2_uc003iyf.2_Missense_Mutation_p.R506K|SORBS2_uc003iyo.1_Missense_Mutation_p.R419K	NM_021069	NP_066547	O94875	SRBS2_HUMAN	sorbin and SH3 domain containing 2 isoform 2	970	SH3 2.					actin cytoskeleton|nucleus|perinuclear region of cytoplasm|Z disc	cytoskeletal adaptor activity|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(1)	1		all_cancers(14;4.27e-52)|all_epithelial(14;6.58e-39)|all_lung(41;1.42e-13)|Lung NSC(41;3.73e-13)|Melanoma(20;1.91e-06)|Colorectal(36;0.00692)|Hepatocellular(41;0.00826)|Renal(120;0.00994)|Prostate(90;0.0101)|all_hematologic(60;0.0174)|all_neural(102;0.244)		OV - Ovarian serous cystadenocarcinoma(60;1.54e-09)|BRCA - Breast invasive adenocarcinoma(30;0.000232)|GBM - Glioblastoma multiforme(59;0.000385)|STAD - Stomach adenocarcinoma(60;0.00109)|LUSC - Lung squamous cell carcinoma(40;0.0205)		TTGATCAACTCTTTTAAGAAG	0.343													5	57	---	---	---	---	PASS
KLKB1	3818	broad.mit.edu	37	4	187178478	187178478	+	Missense_Mutation	SNP	G	A	A	rs61750344		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187178478G>A	uc003iyy.2	+	14	1755	c.1684G>A	c.(1684-1686)GTC>ATC	p.V562I	KLKB1_uc011clc.1_Missense_Mutation_p.V360I|KLKB1_uc011cld.1_Intron	NM_000892	NP_000883	P03952	KLKB1_HUMAN	plasma kallikrein B1 precursor	562	Peptidase S1.				blood coagulation, intrinsic pathway|Factor XII activation|fibrinolysis|plasminogen activation|positive regulation of fibrinolysis	cytoplasm|extracellular space|plasma membrane	serine-type endopeptidase activity			ovary(1)	1		all_cancers(14;1.55e-52)|all_epithelial(14;7.69e-39)|all_lung(41;1.34e-13)|Lung NSC(41;3.58e-13)|Melanoma(20;1.91e-06)|Colorectal(36;0.00664)|Hepatocellular(41;0.00886)|Renal(120;0.00988)|Prostate(90;0.00996)|all_hematologic(60;0.014)|all_neural(102;0.243)		OV - Ovarian serous cystadenocarcinoma(60;1.29e-10)|BRCA - Breast invasive adenocarcinoma(30;3.8e-05)|GBM - Glioblastoma multiforme(59;0.000131)|STAD - Stomach adenocarcinoma(60;0.000292)|LUSC - Lung squamous cell carcinoma(40;0.00241)|READ - Rectum adenocarcinoma(43;0.168)		CCAACGGATGGTCTGTGCTGG	0.328													9	214	---	---	---	---	PASS
F11	2160	broad.mit.edu	37	4	187207596	187207596	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187207596C>G	uc003iza.1	+	13	1841	c.1508C>G	c.(1507-1509)TCC>TGC	p.S503C	uc003izb.1_Intron	NM_000128	NP_000119	P03951	FA11_HUMAN	coagulation factor XI precursor	503	Peptidase S1.				blood coagulation, intrinsic pathway|plasminogen activation|positive regulation of fibrinolysis	extracellular space|plasma membrane	heparin binding|serine-type endopeptidase activity				0		all_cancers(14;6.2e-52)|all_epithelial(14;1.62e-38)|all_lung(41;1.34e-13)|Lung NSC(41;3.58e-13)|Melanoma(20;1.91e-06)|Hepatocellular(41;0.00886)|Renal(120;0.00988)|Prostate(90;0.00996)|all_hematologic(60;0.014)|Colorectal(36;0.0161)|all_neural(102;0.202)		OV - Ovarian serous cystadenocarcinoma(60;2.13e-11)|BRCA - Breast invasive adenocarcinoma(30;4.59e-06)|GBM - Glioblastoma multiforme(59;0.000149)|STAD - Stomach adenocarcinoma(60;0.000314)|LUSC - Lung squamous cell carcinoma(40;0.00112)|READ - Rectum adenocarcinoma(43;0.176)	Coagulation Factor IX(DB00100)	TGCCTGCCTTCCAAAGGAGAT	0.378													118	190	---	---	---	---	PASS
FAT1	2195	broad.mit.edu	37	4	187584725	187584725	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187584725G>A	uc003izf.2	-	3	3496	c.3308C>T	c.(3307-3309)TCC>TTC	p.S1103F		NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	1103	Extracellular (Potential).|Cadherin 9.				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12						CCAATAATGGGAGGTCGATTC	0.458										HNSCC(5;0.00058)			4	119	---	---	---	---	PASS
FRG1	2483	broad.mit.edu	37	4	190883087	190883087	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:190883087G>T	uc003izs.2	+	8	931	c.740G>T	c.(739-741)AGG>ATG	p.R247M		NM_004477	NP_004468	Q14331	FRG1_HUMAN	FSHD region gene 1	247	Bipartite nuclear localization signal (Potential).				rRNA processing	Cajal body|catalytic step 2 spliceosome|nuclear speck|nucleolus					0		all_cancers(14;1.44e-58)|all_epithelial(14;6.32e-41)|all_lung(41;8.13e-17)|Lung NSC(41;2.13e-16)|Breast(6;2.54e-06)|Melanoma(20;0.000263)|Hepatocellular(41;0.00213)|Renal(120;0.0183)|all_hematologic(60;0.0358)|Prostate(90;0.0421)|all_neural(102;0.147)		all cancers(3;1.73e-30)|Epithelial(3;5.85e-30)|OV - Ovarian serous cystadenocarcinoma(60;5.56e-15)|BRCA - Breast invasive adenocarcinoma(30;9.14e-06)|Lung(3;3.54e-05)|STAD - Stomach adenocarcinoma(60;8.83e-05)|LUSC - Lung squamous cell carcinoma(40;0.000198)|GBM - Glioblastoma multiforme(59;0.00892)|READ - Rectum adenocarcinoma(43;0.161)		CTTCTGGACAGGTAGCTATTT	0.328													4	119	---	---	---	---	PASS
PLEKHG4B	153478	broad.mit.edu	37	5	182199	182199	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:182199G>C	uc003jak.2	+	18	3627	c.3577G>C	c.(3577-3579)GAC>CAC	p.D1193H		NM_052909	NP_443141	Q96PX9	PKH4B_HUMAN	pleckstrin homology domain containing, family G	1193	Ser-rich.				regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			skin(2)	2			all cancers(22;0.0253)|Lung(60;0.113)	Kidney(1;0.119)		CACCATCTCAGACAGCAGCAC	0.627													7	125	---	---	---	---	PASS
ADAMTS16	170690	broad.mit.edu	37	5	5232531	5232531	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:5232531C>T	uc003jdl.2	+	12	1890	c.1752C>T	c.(1750-1752)CCC>CCT	p.P584P	ADAMTS16_uc003jdk.1_Silent_p.P584P|ADAMTS16_uc010itk.1_5'Flank	NM_139056	NP_620687	Q8TE57	ATS16_HUMAN	ADAM metallopeptidase with thrombospondin type 1	584	Disintegrin.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(3)|lung(2)|large_intestine(1)|breast(1)|pancreas(1)	8						GCCCCAAGCCCACCCATGGCC	0.527													9	207	---	---	---	---	PASS
ADAMTS16	170690	broad.mit.edu	37	5	5235206	5235206	+	Missense_Mutation	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:5235206A>C	uc003jdl.2	+	13	2068	c.1930A>C	c.(1930-1932)AGT>CGT	p.S644R	ADAMTS16_uc003jdk.1_Missense_Mutation_p.S644R|ADAMTS16_uc010itk.1_RNA	NM_139056	NP_620687	Q8TE57	ATS16_HUMAN	ADAM metallopeptidase with thrombospondin type 1	644	Cys-rich.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(3)|lung(2)|large_intestine(1)|breast(1)|pancreas(1)	8						TCCCCGGGACAGTGTTGACTT	0.522													43	99	---	---	---	---	PASS
PAPD7	11044	broad.mit.edu	37	5	6750603	6750603	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:6750603C>T	uc003jdx.1	+	10	1226	c.1097C>T	c.(1096-1098)TCT>TTT	p.S366F	PAPD7_uc011cmn.1_Missense_Mutation_p.S357F|PAPD7_uc010itl.1_Missense_Mutation_p.S186F	NM_006999	NP_008930	Q5XG87	PAPD7_HUMAN	DNA polymerase sigma	366	Ser-rich.				cell division|DNA replication|double-strand break repair|mitotic chromosome condensation|response to drug|sister chromatid cohesion	nucleus	DNA binding|DNA-directed DNA polymerase activity|metal ion binding|SMC protein binding			ovary(1)	1						TCTTCACTTTCTGGGAGTGAC	0.567													4	103	---	---	---	---	PASS
MYO10	4651	broad.mit.edu	37	5	16754996	16754996	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:16754996C>A	uc003jft.3	-	19	2338	c.1870G>T	c.(1870-1872)GCA>TCA	p.A624S	MYO10_uc010itx.2_Missense_Mutation_p.A247S	NM_012334	NP_036466	Q9HD67	MYO10_HUMAN	myosin X	624	Myosin head-like.				axon guidance|signal transduction	myosin complex	actin binding|ATP binding|motor activity			ovary(2)|pancreas(1)	3						CTTAGCGTTGCCATTAAGGAA	0.388													7	19	---	---	---	---	PASS
CDH18	1016	broad.mit.edu	37	5	19838895	19838895	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:19838895C>A	uc003jgc.2	-	2	578	c.201G>T	c.(199-201)ATG>ATT	p.M67I	CDH18_uc003jgd.2_Missense_Mutation_p.M67I|CDH18_uc011cnm.1_Missense_Mutation_p.M67I	NM_004934	NP_004925	Q13634	CAD18_HUMAN	cadherin 18, type 2 preproprotein	67	Extracellular (Potential).|Cadherin 1.				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(5)|large_intestine(1)|skin(1)	7	Lung NSC(1;0.00734)|all_lung(1;0.0197)					GATCTGGTCCCATATGTTCTT	0.393													24	109	---	---	---	---	PASS
CDH12	1010	broad.mit.edu	37	5	21975445	21975445	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:21975445G>C	uc010iuc.2	-	3	739	c.281C>G	c.(280-282)TCA>TGA	p.S94*	CDH12_uc011cno.1_Nonsense_Mutation_p.S94*|CDH12_uc003jgk.2_Nonsense_Mutation_p.S94*	NM_004061	NP_004052	P55289	CAD12_HUMAN	cadherin 12, type 2 preproprotein	94	Cadherin 1.|Extracellular (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2						GCCATCTCCTGAGAGGGTGTA	0.373										HNSCC(59;0.17)			29	259	---	---	---	---	PASS
PRDM9	56979	broad.mit.edu	37	5	23526672	23526672	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:23526672G>A	uc003jgo.2	+	11	1657	c.1475G>A	c.(1474-1476)AGA>AAA	p.R492K		NM_020227	NP_064612	Q9NQV7	PRDM9_HUMAN	PR domain containing 9	492					meiosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nucleoplasm	histone-lysine N-methyltransferase activity|nucleic acid binding|zinc ion binding			ovary(3)|large_intestine(2)|pancreas(1)	6						GTGGGAAAAAGAATAATGGAA	0.448										HNSCC(3;0.000094)			12	44	---	---	---	---	PASS
PRDM9	56979	broad.mit.edu	37	5	23527570	23527570	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:23527570C>A	uc003jgo.2	+	11	2555	c.2373C>A	c.(2371-2373)CTC>CTA	p.L791L		NM_020227	NP_064612	Q9NQV7	PRDM9_HUMAN	PR domain containing 9	791	C2H2-type 11.				meiosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nucleoplasm	histone-lysine N-methyltransferase activity|nucleic acid binding|zinc ion binding			ovary(3)|large_intestine(2)|pancreas(1)	6						AGTCAAACCTCCTCAGTCACC	0.562										HNSCC(3;0.000094)			45	197	---	---	---	---	PASS
CDH10	1008	broad.mit.edu	37	5	24498608	24498608	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:24498608G>T	uc003jgr.1	-	9	1746	c.1414C>A	c.(1414-1416)CGC>AGC	p.R472S	CDH10_uc011cnu.1_RNA	NM_006727	NP_006718	Q9Y6N8	CAD10_HUMAN	cadherin 10, type 2 preproprotein	472	Cadherin 4.|Extracellular (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|pancreas(4)|breast(2)	12				STAD - Stomach adenocarcinoma(35;0.0556)		ACAGCCACGCGTGTTGTCTCT	0.383										HNSCC(23;0.051)			45	120	---	---	---	---	PASS
ADAMTS12	81792	broad.mit.edu	37	5	33561194	33561194	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:33561194C>A	uc003jia.1	-	20	4226	c.4063G>T	c.(4063-4065)GAC>TAC	p.D1355Y	ADAMTS12_uc010iuq.1_Missense_Mutation_p.D1270Y	NM_030955	NP_112217	P58397	ATS12_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1355	TSP type-1 5.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|lung(1)|kidney(1)	9						TTTGCAGGGTCAGGTCTCTGG	0.572										HNSCC(64;0.19)			67	198	---	---	---	---	PASS
ADAMTS12	81792	broad.mit.edu	37	5	33576160	33576160	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:33576160T>A	uc003jia.1	-	19	4134	c.3971A>T	c.(3970-3972)GAG>GTG	p.E1324V	ADAMTS12_uc010iuq.1_Missense_Mutation_p.E1239V	NM_030955	NP_112217	P58397	ATS12_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1324	TSP type-1 5.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|lung(1)|kidney(1)	9						ATGTCTTACCTCGCTCCAGTT	0.418										HNSCC(64;0.19)			44	124	---	---	---	---	PASS
RAD1	5810	broad.mit.edu	37	5	34908871	34908871	+	Nonstop_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:34908871C>G	uc003jix.2	-	6	1177	c.848G>C	c.(847-849)TGA>TCA	p.*283S	RAD1_uc003jiw.2_Nonstop_Mutation_p.*174S|RAD1_uc003jiy.2_Nonstop_Mutation_p.*283S	NM_002853	NP_002844	O60671	RAD1_HUMAN	RAD1 homolog	283					DNA damage checkpoint|DNA repair|DNA replication|meiotic prophase I	nucleoplasm	3'-5' exonuclease activity|damaged DNA binding|exodeoxyribonuclease III activity|protein binding				0	all_lung(31;0.000107)	Lung NSC(810;5.19e-05)|Ovarian(839;0.0448)|Breast(839;0.198)	COAD - Colon adenocarcinoma(61;0.174)|Colorectal(62;0.229)			TTGTCATACTCAAGACTCAGA	0.313								Other_conserved_DNA_damage_response_genes					12	151	---	---	---	---	PASS
LMBRD2	92255	broad.mit.edu	37	5	36115160	36115160	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:36115160G>A	uc003jkb.1	-	12	1914	c.1499C>T	c.(1498-1500)TCA>TTA	p.S500L		NM_001007527	NP_001007528	Q68DH5	LMBD2_HUMAN	LMBR1 domain containing 2	500	Extracellular (Potential).					integral to membrane					0	all_lung(31;0.000146)		Epithelial(62;0.0396)|Lung(74;0.111)|all cancers(62;0.115)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			AGAGATAGATGAATCCATATG	0.338													11	74	---	---	---	---	PASS
NUP155	9631	broad.mit.edu	37	5	37293071	37293071	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37293071C>G	uc003jku.1	-	34	4065	c.3947G>C	c.(3946-3948)AGA>ACA	p.R1316T	NUP155_uc003jkt.1_Missense_Mutation_p.R1257T|NUP155_uc010iuz.1_Missense_Mutation_p.R1252T	NM_153485	NP_705618	O75694	NU155_HUMAN	nucleoporin 155kDa isoform 1	1316					carbohydrate metabolic process|glucose transport|mRNA transport|nucleocytoplasmic transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	nuclear membrane|nuclear pore	protein binding|structural constituent of nuclear pore|transporter activity			ovary(1)	1	all_lung(31;0.000137)		COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			CTTCTTCATTCTGTTCCAGAA	0.313													66	157	---	---	---	---	PASS
NUP155	9631	broad.mit.edu	37	5	37309381	37309381	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37309381G>T	uc003jku.1	-						NUP155_uc003jkt.1_Intron|NUP155_uc010iuz.1_Intron	NM_153485	NP_705618	O75694	NU155_HUMAN	nucleoporin 155kDa isoform 1						carbohydrate metabolic process|glucose transport|mRNA transport|nucleocytoplasmic transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	nuclear membrane|nuclear pore	protein binding|structural constituent of nuclear pore|transporter activity			ovary(1)	1	all_lung(31;0.000137)		COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			TAGAAGAGGAGATAACAAGAA	0.303													10	81	---	---	---	---	PASS
WDR70	55100	broad.mit.edu	37	5	37723010	37723010	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37723010C>T	uc003jkv.2	+	15	1629	c.1571C>T	c.(1570-1572)ACT>ATT	p.T524I		NM_018034	NP_060504	Q9NW82	WDR70_HUMAN	WD repeat domain 70	524										ovary(1)|central_nervous_system(1)	2	all_lung(31;0.000285)		COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			CAAGCTGAGACTCTAACTCAG	0.403													12	144	---	---	---	---	PASS
PLCXD3	345557	broad.mit.edu	37	5	41510613	41510613	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41510613C>T	uc003jmm.1	-	1	118	c.16G>A	c.(16-18)GGG>AGG	p.G6R		NM_001005473	NP_001005473	Q63HM9	PLCX3_HUMAN	phosphatidylinositol-specific phospholipase C, X	6					intracellular signal transduction|lipid catabolic process		phospholipase C activity|signal transducer activity			skin(2)|urinary_tract(1)|ovary(1)|lung(1)|central_nervous_system(1)	6						TCGTTTTTCCCCTGAGACGAG	0.607													5	40	---	---	---	---	PASS
ADAMTS6	11174	broad.mit.edu	37	5	64520828	64520828	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:64520828C>T	uc003jtp.2	-	17	2928	c.2114G>A	c.(2113-2115)AGA>AAA	p.R705K	ADAMTS6_uc003jto.2_RNA|ADAMTS6_uc003jtq.2_RNA|ADAMTS6_uc003jtr.1_Missense_Mutation_p.R326K	NM_197941	NP_922932	Q9UKP5	ATS6_HUMAN	ADAM metallopeptidase with thrombospondin type 1	705					proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding				0		Lung NSC(167;2.44e-06)|Prostate(74;0.014)|Ovarian(174;0.0549)|Breast(144;0.111)|Colorectal(97;0.235)		Lung(70;0.00942)		GACTCGACATCTATCTTCCCT	0.443													43	44	---	---	---	---	PASS
ADAMTS6	11174	broad.mit.edu	37	5	64766952	64766952	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:64766952G>C	uc003jtp.2	-	3	929	c.115C>G	c.(115-117)CTT>GTT	p.L39V	ADAMTS6_uc003jto.2_RNA|ADAMTS6_uc003jtq.2_RNA|ADAMTS6_uc003jtr.1_Translation_Start_Site	NM_197941	NP_922932	Q9UKP5	ATS6_HUMAN	ADAM metallopeptidase with thrombospondin type 1	39					proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding				0		Lung NSC(167;2.44e-06)|Prostate(74;0.014)|Ovarian(174;0.0549)|Breast(144;0.111)|Colorectal(97;0.235)		Lung(70;0.00942)		TAGTGTTCAAGATAAGTCAGG	0.358													5	92	---	---	---	---	PASS
MAST4	375449	broad.mit.edu	37	5	66055606	66055606	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:66055606C>A	uc003jur.3	+	2	741	c.433C>A	c.(433-435)CCT>ACT	p.P145T	MAST4_uc010iwz.2_Missense_Mutation_p.P145T	NM_198828	NP_942123	O15021	MAST4_HUMAN	microtubule associated serine/threonine kinase	145						cytoplasm	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			lung(6)|ovary(2)|kidney(2)|breast(2)|central_nervous_system(1)	13		Lung NSC(167;8.56e-06)|Prostate(74;0.00637)|Ovarian(174;0.0563)|Breast(144;0.0586)|Colorectal(97;0.245)		Lung(70;0.011)		GGCTTCTGGCCCTGGAAAATC	0.542													4	84	---	---	---	---	PASS
RGNEF	64283	broad.mit.edu	37	5	73163738	73163738	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:73163738C>T	uc011csq.1	+	18	2201	c.2190C>T	c.(2188-2190)TCC>TCT	p.S730S	RGNEF_uc003kcx.2_Silent_p.S730S|RGNEF_uc010izf.2_Silent_p.S730S|RGNEF_uc011csr.1_Silent_p.S417S	NM_001080479	NP_001073948	Q8N1W1	RGNEF_HUMAN	Rho-guanine nucleotide exchange factor	730					cell differentiation|intracellular signal transduction|regulation of Rho protein signal transduction	cytoplasm|plasma membrane	metal ion binding|Rho guanyl-nucleotide exchange factor activity|RNA binding				0		Lung NSC(167;0.0378)|all_lung(232;0.04)|Ovarian(174;0.0798)		OV - Ovarian serous cystadenocarcinoma(47;1.25e-51)		CTGGTCTCTCCTTGCACCCTT	0.493													39	67	---	---	---	---	PASS
POC5	134359	broad.mit.edu	37	5	74986241	74986241	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:74986241C>G	uc003keh.3	-	8	1139	c.942G>C	c.(940-942)CAG>CAC	p.Q314H	POC5_uc010izu.2_Missense_Mutation_p.Q197H|POC5_uc003keg.3_Missense_Mutation_p.Q289H	NM_001099271	NP_001092741	Q8NA72	POC5_HUMAN	proteome of centriole 5 isoform 1	314					cell cycle	centriole				lung(1)	1						CATTGGAAATCTGGATACAAA	0.368													14	24	---	---	---	---	PASS
CMYA5	202333	broad.mit.edu	37	5	79029970	79029970	+	Silent	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79029970A>T	uc003kgc.2	+	2	5454	c.5382A>T	c.(5380-5382)ACA>ACT	p.T1794T		NM_153610	NP_705838	Q8N3K9	CMYA5_HUMAN	cardiomyopathy associated 5	1794						perinuclear region of cytoplasm				ovary(6)|pancreas(2)|lung(1)	9		Lung NSC(167;0.00296)|all_lung(232;0.00327)|Ovarian(174;0.0262)		OV - Ovarian serous cystadenocarcinoma(54;9.85e-46)|Epithelial(54;3.38e-40)|all cancers(79;3.43e-35)		GTGAAGAAACAGGCCACCCAA	0.398													36	69	---	---	---	---	PASS
RASA1	5921	broad.mit.edu	37	5	86679528	86679528	+	Splice_Site	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:86679528A>G	uc003kiw.2	+	21	2809	c.2691_splice	c.e21-2	p.S897_splice	RASA1_uc010jav.2_Splice_Site|RASA1_uc003kix.2_Splice_Site_p.S720_splice|RASA1_uc011ctv.1_Splice_Site_p.S730_splice|RASA1_uc011ctw.1_Splice_Site_p.S731_splice|RASA1_uc010jaw.2_Splice_Site_p.S719_splice	NM_002890	NP_002881	P20936	RASA1_HUMAN	RAS p21 protein activator 1 isoform 1						cytokinesis|embryo development|intracellular signal transduction|negative regulation of cell-matrix adhesion|negative regulation of neuron apoptosis|negative regulation of Ras protein signal transduction|positive regulation of anti-apoptosis|regulation of actin filament polymerization|regulation of cell shape|regulation of RNA metabolic process|vasculogenesis	cytosol|intrinsic to internal side of plasma membrane	glycoprotein binding|GTPase binding|potassium channel inhibitor activity|Ras GTPase activator activity|receptor binding			upper_aerodigestive_tract(3)|ovary(1)|lung(1)	5		all_cancers(142;8.25e-07)|Lung NSC(167;0.000185)|all_lung(232;0.000222)|Colorectal(57;0.00542)|Ovarian(174;0.0423)		OV - Ovarian serous cystadenocarcinoma(54;4.72e-41)|Epithelial(54;1.51e-36)|all cancers(79;3.76e-31)		CCTCCCATTCAGTGGTTTTGT	0.294													31	37	---	---	---	---	PASS
MEF2C	4208	broad.mit.edu	37	5	88056937	88056937	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:88056937C>G	uc003kjj.2	-						MEF2C_uc003kji.2_Intron|MEF2C_uc003kjk.2_Intron|MEF2C_uc003kjm.2_Missense_Mutation_p.L88F|MEF2C_uc003kjl.2_Missense_Mutation_p.L108F	NM_002397	NP_002388	Q06413	MEF2C_HUMAN	myocyte enhancer factor 2C isoform 1						apoptosis|B cell proliferation|innate immune response|learning or memory|muscle cell differentiation|muscle organ development|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|neuron development|positive regulation of muscle cell differentiation|positive regulation of survival gene product expression|positive regulation of transcription from RNA polymerase II promoter|regulation of germinal center formation|regulation of megakaryocyte differentiation|regulation of synaptic activity|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	nuclear speck	activating transcription factor binding|protein heterodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			lung(3)|breast(2)|ovary(1)|large_intestine(1)	7		all_cancers(142;6.67e-05)|all_epithelial(76;7.77e-07)|Lung NSC(167;0.00566)|all_lung(232;0.00732)|Colorectal(57;0.0959)|Ovarian(174;0.1)		OV - Ovarian serous cystadenocarcinoma(54;1.04e-33)|Epithelial(54;1.6e-28)|all cancers(79;2.9e-25)		CTTTCTTGTTCAATGCCTGCC	0.388										HNSCC(66;0.2)			76	176	---	---	---	---	PASS
GPR98	84059	broad.mit.edu	37	5	89930986	89930986	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:89930986G>T	uc003kju.2	+	10	1991	c.1895G>T	c.(1894-1896)AGA>ATA	p.R632I	GPR98_uc003kjt.2_5'UTR	NM_032119	NP_115495	Q8WXG9	GPR98_HUMAN	G protein-coupled receptor 98 precursor	632	Extracellular (Potential).				cell communication|cell-cell adhesion|maintenance of organ identity|neuropeptide signaling pathway|photoreceptor cell maintenance	cell surface|cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(11)|central_nervous_system(3)|pancreas(2)	16		all_cancers(142;1.05e-09)|all_epithelial(76;1.81e-12)|all_lung(232;5.41e-06)|Lung NSC(167;1.72e-05)|Ovarian(174;0.00948)|Colorectal(57;0.133)|Breast(839;0.192)		OV - Ovarian serous cystadenocarcinoma(54;7.01e-30)|Epithelial(54;6.79e-25)|all cancers(79;1.88e-20)		ATAAGCCCTAGATTTGGGGAA	0.343													5	134	---	---	---	---	PASS
GPR98	84059	broad.mit.edu	37	5	90149175	90149175	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90149175G>A	uc003kju.2	+	80	17375	c.17279G>A	c.(17278-17280)GGA>GAA	p.G5760E	GPR98_uc003kjt.2_Missense_Mutation_p.G3466E|GPR98_uc003kjw.2_Missense_Mutation_p.G1421E	NM_032119	NP_115495	Q8WXG9	GPR98_HUMAN	G protein-coupled receptor 98 precursor	5760	Extracellular (Potential).				cell communication|cell-cell adhesion|maintenance of organ identity|neuropeptide signaling pathway|photoreceptor cell maintenance	cell surface|cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(11)|central_nervous_system(3)|pancreas(2)	16		all_cancers(142;1.05e-09)|all_epithelial(76;1.81e-12)|all_lung(232;5.41e-06)|Lung NSC(167;1.72e-05)|Ovarian(174;0.00948)|Colorectal(57;0.133)|Breast(839;0.192)		OV - Ovarian serous cystadenocarcinoma(54;7.01e-30)|Epithelial(54;6.79e-25)|all cancers(79;1.88e-20)		CAAATCAATGGACACAAGTTT	0.408													116	102	---	---	---	---	PASS
ELL2	22936	broad.mit.edu	37	5	95226858	95226858	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:95226858G>C	uc003klr.3	-	10	2060	c.1710C>G	c.(1708-1710)ATC>ATG	p.I570M		NM_012081	NP_036213	O00472	ELL2_HUMAN	elongation factor, RNA polymerase II, 2	570					regulation of transcription, DNA-dependent|transcription elongation from RNA polymerase II promoter	transcription elongation factor complex				central_nervous_system(1)	1		all_cancers(142;2.04e-06)|all_epithelial(76;3.1e-09)|all_lung(232;0.00309)|Lung NSC(167;0.00454)|Ovarian(225;0.0165)|Colorectal(57;0.0343)|Breast(839;0.198)		all cancers(79;2.16e-15)		CATCTAGTTTGATAAATCTTC	0.403													28	438	---	---	---	---	PASS
ST8SIA4	7903	broad.mit.edu	37	5	100147594	100147594	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:100147594C>G	uc003knk.2	-	5	1365	c.1037G>C	c.(1036-1038)AGA>ACA	p.R346T		NM_005668	NP_005659	Q92187	SIA8D_HUMAN	ST8 alpha-N-acetyl-neuraminide	346	Lumenal (Potential).				axon guidance|N-glycan processing	integral to Golgi membrane	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity			large_intestine(1)|central_nervous_system(1)	2		all_cancers(142;1.5e-07)|all_epithelial(76;1.43e-10)|Prostate(80;0.000644)|Lung NSC(167;0.0059)|all_lung(232;0.00914)|Ovarian(225;0.024)|Colorectal(57;0.09)|Breast(839;0.203)		COAD - Colon adenocarcinoma(37;0.00402)		TAGAGCTCCTCTATTATGTAG	0.318													10	99	---	---	---	---	PASS
PPIP5K2	23262	broad.mit.edu	37	5	102465360	102465360	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:102465360C>T	uc003kod.3	+	2	586	c.67C>T	c.(67-69)CAT>TAT	p.H23Y	PPIP5K2_uc011cva.1_RNA|PPIP5K2_uc003koe.2_Missense_Mutation_p.H23Y|PPIP5K2_uc010jbo.1_Intron	NM_015216	NP_056031	O43314	VIP2_HUMAN	Histidine acid phosphatase domain containing 1	23					inositol metabolic process	cytosol	acid phosphatase activity|ATP binding|diphosphoinositol-pentakisphosphate kinase activity|inositol 1,3,4,5,6-pentakisphosphate kinase activity|inositol hexakisphosphate 5-kinase activity			ovary(1)|skin(1)	2						AAATTATCGACATTTCTTCCA	0.363													9	72	---	---	---	---	PASS
PPIP5K2	23262	broad.mit.edu	37	5	102522026	102522026	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:102522026C>T	uc003kod.3	+	27	3694	c.3175C>T	c.(3175-3177)CAC>TAC	p.H1059Y	PPIP5K2_uc011cva.1_RNA|PPIP5K2_uc003koe.2_Missense_Mutation_p.H1059Y|PPIP5K2_uc003kof.2_Intron	NM_015216	NP_056031	O43314	VIP2_HUMAN	Histidine acid phosphatase domain containing 1	1059					inositol metabolic process	cytosol	acid phosphatase activity|ATP binding|diphosphoinositol-pentakisphosphate kinase activity|inositol 1,3,4,5,6-pentakisphosphate kinase activity|inositol hexakisphosphate 5-kinase activity			ovary(1)|skin(1)	2						ATCAGGGTCTCACTGTGCGGG	0.478													5	70	---	---	---	---	PASS
APC	324	broad.mit.edu	37	5	112178500	112178500	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112178500G>C	uc010jby.2	+	16	7589	c.7209G>C	c.(7207-7209)CAG>CAC	p.Q2403H	APC_uc011cvt.1_Missense_Mutation_p.Q2385H|APC_uc003kpz.3_Missense_Mutation_p.Q2403H|APC_uc003kpy.3_Missense_Mutation_p.Q2403H|APC_uc010jbz.2_Missense_Mutation_p.Q2120H|APC_uc010jca.2_Missense_Mutation_p.Q1703H	NM_001127511	NP_001120983	P25054	APC_HUMAN	adenomatous polyposis coli	2403	Ser-rich.				canonical Wnt receptor signaling pathway|cell adhesion|cell cycle arrest|cell migration|cellular component disassembly involved in apoptosis|cytokinesis after mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cyclin-dependent protein kinase activity|negative regulation of microtubule depolymerization|positive regulation of apoptosis|positive regulation of cell migration|positive regulation of pseudopodium assembly|protein complex assembly|regulation of attachment of spindle microtubules to kinetochore|response to DNA damage stimulus|tight junction assembly	adherens junction|APC-Axin-1-beta-catenin complex|Axin-APC-beta-catenin-GSK3B complex|beta-catenin destruction complex|centrosome|cytosol|kinetochore|lamellipodium|lateral plasma membrane|nucleus|ruffle membrane|tight junction	beta-catenin binding|gamma-catenin binding|microtubule plus-end binding|protein kinase binding|protein kinase regulator activity	p.?(1)		large_intestine(2123)|stomach(123)|soft_tissue(55)|small_intestine(34)|breast(26)|pancreas(25)|urinary_tract(20)|lung(19)|thyroid(18)|liver(13)|central_nervous_system(10)|ovary(9)|skin(7)|upper_aerodigestive_tract(6)|adrenal_gland(6)|bone(6)|NS(5)|prostate(4)|endometrium(3)|kidney(1)|oesophagus(1)|biliary_tract(1)	2515		all_cancers(142;3.01e-27)|all_epithelial(76;2.3e-18)|all_hematologic(541;4.32e-09)|Ovarian(225;1.78e-06)|Lung NSC(167;0.000195)|Breast(839;0.000231)|all_lung(232;0.000247)|Colorectal(10;0.000355)|Prostate(80;0.00133)		OV - Ovarian serous cystadenocarcinoma(64;1.09e-113)|Epithelial(69;3.79e-112)|all cancers(49;1.67e-104)|BRCA - Breast invasive adenocarcinoma(61;0.00136)|COAD - Colon adenocarcinoma(37;0.00155)|Colorectal(14;0.00191)		GACTAAATCAGATGAATAATG	0.378		12	D|Mis|N|F|S		colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS	colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS			Hereditary_Desmoid_Disease|Familial_Adenomatous_Polyposis|Turcot_syndrome	TSP Lung(16;0.13)			14	116	---	---	---	---	PASS
MCC	4163	broad.mit.edu	37	5	112720775	112720775	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112720775C>G	uc003kql.3	-	2	721	c.305G>C	c.(304-306)CGA>CCA	p.R102P	MCC_uc003kqk.3_RNA	NM_001085377	NP_001078846	P23508	CRCM_HUMAN	mutated in colorectal cancers isoform 1	Error:Variant_position_missing_in_P23508_after_alignment					negative regulation of canonical Wnt receptor signaling pathway|negative regulation of epithelial cell migration|negative regulation of epithelial cell proliferation|Wnt receptor signaling pathway	cytoplasm|nucleus|plasma membrane	protein binding|receptor activity			ovary(1)	1		all_cancers(142;5.89e-08)|all_epithelial(76;3.57e-11)|all_lung(232;0.000605)|Lung NSC(810;0.000697)|Colorectal(10;0.00146)|Prostate(80;0.00174)|Ovarian(225;0.0175)|Breast(839;0.198)		OV - Ovarian serous cystadenocarcinoma(64;2.04e-54)|Epithelial(69;9.69e-49)|all cancers(49;6.25e-44)|COAD - Colon adenocarcinoma(37;0.0432)|Colorectal(14;0.0766)		CCTAATTTCTCGAACAAGCTG	0.463													46	232	---	---	---	---	PASS
CCDC112	153733	broad.mit.edu	37	5	114611184	114611184	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:114611184G>A	uc003kqy.2	-	6	911	c.398C>T	c.(397-399)TCA>TTA	p.S133L	CCDC112_uc003kqz.2_Missense_Mutation_p.S216L|CCDC112_uc003kra.2_Missense_Mutation_p.S216L	NM_152549	NP_689762	Q8NEF3	CC112_HUMAN	coiled-coil domain containing 112 isoform 2	133											0		all_cancers(142;0.000523)|all_epithelial(76;6.44e-06)|Prostate(80;0.00955)|Ovarian(225;0.0443)|all_lung(232;0.132)|Breast(839;0.195)		OV - Ovarian serous cystadenocarcinoma(64;4.09e-08)|Epithelial(69;5.28e-08)|all cancers(49;7.06e-06)		AACTTTGCTTGAGATTGCTCT	0.403													50	255	---	---	---	---	PASS
DMXL1	1657	broad.mit.edu	37	5	118485784	118485784	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:118485784C>G	uc003ksd.2	+	18	4443	c.4262C>G	c.(4261-4263)TCA>TGA	p.S1421*	DMXL1_uc010jcl.1_Nonsense_Mutation_p.S1421*	NM_005509	NP_005500	Q9Y485	DMXL1_HUMAN	Dmx-like 1	1421										ovary(2)	2		all_cancers(142;0.0314)|all_epithelial(76;0.00559)|Prostate(80;0.11)|Breast(839;0.231)		OV - Ovarian serous cystadenocarcinoma(64;0.000563)|Epithelial(69;0.00179)|all cancers(49;0.0243)		AGCTGTTACTCATCTTTGGAG	0.343													44	186	---	---	---	---	PASS
DMXL1	1657	broad.mit.edu	37	5	118503367	118503367	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:118503367G>C	uc003ksd.2	+	23	5387	c.5206G>C	c.(5206-5208)GAT>CAT	p.D1736H	DMXL1_uc010jcl.1_Missense_Mutation_p.D1736H	NM_005509	NP_005500	Q9Y485	DMXL1_HUMAN	Dmx-like 1	1736										ovary(2)	2		all_cancers(142;0.0314)|all_epithelial(76;0.00559)|Prostate(80;0.11)|Breast(839;0.231)		OV - Ovarian serous cystadenocarcinoma(64;0.000563)|Epithelial(69;0.00179)|all cancers(49;0.0243)		GTCTGAATTTGATACATCTGC	0.299													24	76	---	---	---	---	PASS
PHAX	51808	broad.mit.edu	37	5	125952978	125952978	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:125952978C>G	uc003kua.1	+	4	890	c.868C>G	c.(868-870)CTG>GTG	p.L290V		NM_032177	NP_115553	Q9H814	PHAX_HUMAN	RNA U, small nuclear RNA export adaptor	290	Necessary for interaction with CBP80 (By similarity).|Sufficient for poly U RNA-binding.				ncRNA metabolic process|protein transport|snRNA export from nucleus|spliceosomal snRNP assembly	Cajal body|cytosol	RNA binding				0						TGGAGTTTTTCTGAATCTCTT	0.378													34	87	---	---	---	---	PASS
SLC12A2	6558	broad.mit.edu	37	5	127469886	127469886	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:127469886C>G	uc003kus.2	+	6	1382	c.1218C>G	c.(1216-1218)ATC>ATG	p.I406M	SLC12A2_uc010jdf.2_RNA|SLC12A2_uc010jdg.2_Missense_Mutation_p.I406M	NM_001046	NP_001037	P55011	S12A2_HUMAN	solute carrier family 12	406	Extracellular (Potential).				potassium ion transport|sodium ion transport|transepithelial ammonium transport|transepithelial chloride transport	integral to plasma membrane|membrane fraction	ammonia transmembrane transporter activity|sodium:potassium:chloride symporter activity			ovary(3)	3		all_cancers(142;0.0972)|Prostate(80;0.151)	KIRC - Kidney renal clear cell carcinoma(527;0.0268)|Kidney(363;0.0488)	Epithelial(69;0.0433)|OV - Ovarian serous cystadenocarcinoma(64;0.0978)	Bumetanide(DB00887)|Potassium Chloride(DB00761)	TAGATGAAATCAATGATATCC	0.318													57	187	---	---	---	---	PASS
CATSPER3	347732	broad.mit.edu	37	5	134345085	134345085	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:134345085G>A	uc003lag.2	+	6	909	c.841G>A	c.(841-843)GAG>AAG	p.E281K		NM_178019	NP_821138	Q86XQ3	CTSR3_HUMAN	cation channel, sperm associated 3	281					cell differentiation|multicellular organismal development|spermatogenesis	cilium|flagellar membrane|integral to membrane	calcium channel activity|voltage-gated ion channel activity			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0233)			GTTTGAGCGAGAGCTGATGTT	0.547													45	109	---	---	---	---	PASS
HSPA9	3313	broad.mit.edu	37	5	137906704	137906704	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137906704C>T	uc003ldf.2	-	4	463	c.355G>A	c.(355-357)GCT>ACT	p.A119T	HSPA9_uc011cyw.1_Missense_Mutation_p.A50T	NM_004134	NP_004125	P38646	GRP75_HUMAN	heat shock 70kDa protein 9 precursor	119					anti-apoptosis|protein folding	cell surface|mitochondrial nucleoid	ATP binding|unfolded protein binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00325)			CGCTTGGTAGCATAAAATGTA	0.458													19	228	---	---	---	---	PASS
ANKHD1-EIF4EBP3	404734	broad.mit.edu	37	5	139909089	139909089	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:139909089G>C	uc003lfs.1	+	29	6682	c.6558G>C	c.(6556-6558)ATG>ATC	p.M2186I	ANKHD1_uc003lfr.2_Missense_Mutation_p.M2186I|ANKHD1-EIF4EBP3_uc011czh.1_Missense_Mutation_p.M925I|ANKHD1_uc003lfw.2_Missense_Mutation_p.M824I|ANKHD1_uc010jfl.2_Missense_Mutation_p.M621I|ANKHD1-EIF4EBP3_uc003lfx.1_Missense_Mutation_p.M323I	NM_020690	NP_065741	Q8IWZ2	Q8IWZ2_HUMAN	ANKHD1-EIF4EBP3 protein	2186						cytoplasm|nucleus	RNA binding			ovary(6)	6			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			TGAACATTATGAATGGTTCTC	0.438													7	263	---	---	---	---	PASS
PCDHA12	56137	broad.mit.edu	37	5	140256033	140256033	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140256033G>C	uc003lic.2	+	1	1103	c.976G>C	c.(976-978)GGG>CGG	p.G326R	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc003lhq.2_Intron|PCDHA8_uc003lhs.2_Intron|PCDHA9_uc003lhu.2_Intron|PCDHA10_uc003lhw.2_Intron|PCDHA10_uc003lhx.2_Intron|PCDHA11_uc003lia.2_Intron|PCDHA12_uc011daf.1_Missense_Mutation_p.G326R	NM_018903	NP_061726	Q9UN75	PCDAC_HUMAN	protocadherin alpha 12 isoform 1 precursor	326	Cadherin 3.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding|protein binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			CATTGATAAAGGGATTCCTTC	0.418													107	94	---	---	---	---	PASS
PCDHB3	56132	broad.mit.edu	37	5	140482129	140482129	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140482129G>A	uc003lio.2	+	1	1896	c.1896G>A	c.(1894-1896)GAG>GAA	p.E632E	uc003lin.2_5'Flank	NM_018937	NP_061760	Q9Y5E6	PCDB3_HUMAN	protocadherin beta 3 precursor	632	Extracellular (Potential).|Cadherin 6.				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to plasma membrane	calcium ion binding			ovary(1)|pancreas(1)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)			TGCTGAGCGAGCGCGACGCGG	0.697													55	60	---	---	---	---	PASS
PCDHB12	56124	broad.mit.edu	37	5	140589877	140589877	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140589877C>A	uc003liz.2	+	1	1587	c.1398C>A	c.(1396-1398)CCC>CCA	p.P466P	PCDHB12_uc011dak.1_Silent_p.P129P	NM_018932	NP_061755	Q9Y5F1	PCDBC_HUMAN	protocadherin beta 12 precursor	466	Extracellular (Potential).|Cadherin 5.				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding			skin(2)|ovary(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)			ACAACAGCCCCGCCCTGCACA	0.642													66	63	---	---	---	---	PASS
PCDHGA4	56111	broad.mit.edu	37	5	140735937	140735937	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140735937G>T	uc003ljq.1	+	1	1170	c.1170G>T	c.(1168-1170)CTG>CTT	p.L390L	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljp.1_Silent_p.L390L	NM_018917	NP_061740	Q9Y5G9	PCDG4_HUMAN	protocadherin gamma subfamily A, 4 isoform 1	390	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			cagataatctgccattcacac	0.313													5	5	---	---	---	---	PASS
PCDHGA8	9708	broad.mit.edu	37	5	140774445	140774445	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140774445C>T	uc003lkd.1	+	1	2963	c.2065C>T	c.(2065-2067)CTT>TTT	p.L689F	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkb.3_Missense_Mutation_p.L689F	NM_032088	NP_114477	Q9Y5G5	PCDG8_HUMAN	protocadherin gamma subfamily A, 8 isoform 1	689	Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			CGATTCGAGCCTTACACTCTA	0.612													12	28	---	---	---	---	PASS
PCDHGB7	56099	broad.mit.edu	37	5	140798363	140798363	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140798363G>C	uc003lkn.1	+	1	1082	c.937G>C	c.(937-939)GAA>CAA	p.E313Q	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc003lkf.1_Intron|PCDHGA9_uc003lkh.1_Intron|PCDHGB6_uc003lkj.1_Intron|PCDHGA10_uc003lkl.1_Intron|PCDHGB7_uc003lkm.2_Missense_Mutation_p.E313Q|PCDHGA11_uc003lko.1_5'Flank|PCDHGA11_uc003lkp.1_5'Flank|PCDHGA11_uc003lkq.1_5'Flank	NM_018927	NP_061750	Q9Y5F8	PCDGJ_HUMAN	protocadherin gamma subfamily B, 7 isoform 1	313	Extracellular (Potential).|Cadherin 3.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			TGAAGAAGTAGAAAGATATAC	0.413													13	40	---	---	---	---	PASS
PCDHGB7	56099	broad.mit.edu	37	5	140799720	140799720	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140799720T>G	uc003lkn.1	+	1	2439	c.2294T>G	c.(2293-2295)TTT>TGT	p.F765C	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc003lkf.1_Intron|PCDHGA9_uc003lkh.1_Intron|PCDHGB6_uc003lkj.1_Intron|PCDHGA10_uc003lkl.1_Intron|PCDHGB7_uc003lkm.2_Missense_Mutation_p.F765C|PCDHGA11_uc003lko.1_5'Flank|PCDHGA11_uc003lkp.1_5'Flank|PCDHGA11_uc003lkq.1_5'Flank	NM_018927	NP_061750	Q9Y5F8	PCDGJ_HUMAN	protocadherin gamma subfamily B, 7 isoform 1	765	Cytoplasmic (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			AATCCAGAATTTAATTTTTTC	0.453													65	56	---	---	---	---	PASS
PCDHGA11	56105	broad.mit.edu	37	5	140801496	140801496	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140801496C>T	uc003lkq.1	+	1	960	c.702C>T	c.(700-702)CTC>CTT	p.L234L	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc003lkf.1_Intron|PCDHGA9_uc003lkh.1_Intron|PCDHGB6_uc003lkj.1_Intron|PCDHGA10_uc003lkl.1_Intron|PCDHGB7_uc003lkn.1_Intron|PCDHGA11_uc003lko.1_Silent_p.L234L|PCDHGA11_uc003lkp.1_Silent_p.L234L	NM_018914	NP_061737	Q9Y5H2	PCDGB_HUMAN	protocadherin gamma subfamily A, 11 isoform 1	234	Extracellular (Potential).|Cadherin 2.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			TGGTGGTCCTCGATGTAAATG	0.517													64	140	---	---	---	---	PASS
DPYSL3	1809	broad.mit.edu	37	5	146773613	146773613	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:146773613G>C	uc003lon.1	-	14	1808	c.1698C>G	c.(1696-1698)ATC>ATG	p.I566M	DPYSL3_uc003loo.2_Missense_Mutation_p.I680M	NM_001387	NP_001378	Q14195	DPYL3_HUMAN	dihydropyrimidinase-like 3	566					axon guidance|pyrimidine base catabolic process|signal transduction	cytosol|growth cone	dihydropyrimidinase activity			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			TCAGAGATGTGATATTAGAAC	0.507													20	138	---	---	---	---	PASS
TNIP1	10318	broad.mit.edu	37	5	150416412	150416412	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:150416412C>A	uc003ltf.2	-	13	1923	c.1334G>T	c.(1333-1335)GGA>GTA	p.G445V	TNIP1_uc011dcn.1_5'Flank|TNIP1_uc010jhl.2_RNA|TNIP1_uc010jhm.2_Missense_Mutation_p.G445V|TNIP1_uc010jhn.2_Missense_Mutation_p.G445V|TNIP1_uc011dco.1_Missense_Mutation_p.G445V|TNIP1_uc003lth.2_RNA|TNIP1_uc003lti.2_Missense_Mutation_p.G445V|TNIP1_uc003ltg.2_Missense_Mutation_p.G392V|TNIP1_uc003ltj.2_Missense_Mutation_p.G445V|TNIP1_uc010jho.1_RNA|TNIP1_uc010jhq.1_Missense_Mutation_p.G392V|TNIP1_uc010jhp.1_Missense_Mutation_p.G392V|TNIP1_uc010jhr.1_Missense_Mutation_p.G445V|TNIP1_uc003ltk.2_Missense_Mutation_p.G445V	NM_006058	NP_006049	Q15025	TNIP1_HUMAN	TNFAIP3 interacting protein 1	445	Potential.				defense response|glycoprotein biosynthetic process|negative regulation of viral genome replication|translation	cytoplasm|nucleus	protein binding			ovary(1)|central_nervous_system(1)	2		Medulloblastoma(196;0.0911)|all_hematologic(541;0.207)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)			GGCCCCTGCTCCTTCTGGGCT	0.572													30	112	---	---	---	---	PASS
FAT2	2196	broad.mit.edu	37	5	150925111	150925111	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:150925111G>A	uc003lue.3	-	9	5590	c.5577C>T	c.(5575-5577)ATC>ATT	p.I1859I	GM2A_uc011dcs.1_Intron	NM_001447	NP_001438	Q9NYQ8	FAT2_HUMAN	FAT tumor suppressor 2 precursor	1859	Extracellular (Potential).|Cadherin 16.				epithelial cell migration|homophilic cell adhesion	cell-cell adherens junction|integral to membrane|nucleus	calcium ion binding			ovary(4)|upper_aerodigestive_tract(1)|skin(1)	6		Medulloblastoma(196;0.0912)|all_hematologic(541;0.104)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)			TGACATGAATGATGACTTGGG	0.468													55	137	---	---	---	---	PASS
FAM114A2	10827	broad.mit.edu	37	5	153372613	153372613	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:153372613C>G	uc003lvb.2	-	14	2029	c.1441G>C	c.(1441-1443)GAG>CAG	p.E481Q	FAM114A2_uc003lvc.2_Missense_Mutation_p.E481Q|FAM114A2_uc003lvd.2_Missense_Mutation_p.E481Q|FAM114A2_uc003lve.2_Missense_Mutation_p.E297Q|FAM114A2_uc011dda.1_Missense_Mutation_p.E411Q	NM_018691	NP_061161	Q9NRY5	F1142_HUMAN	hypothetical protein LOC10827	481							purine nucleotide binding				0						AGAGAGATCTCTAGCACAGGT	0.418													47	152	---	---	---	---	PASS
C5orf4	10826	broad.mit.edu	37	5	154199911	154199911	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:154199911C>A	uc003lvs.3	-	9	1138	c.967G>T	c.(967-969)GAG>TAG	p.E323*	C5orf4_uc003lvq.2_5'Flank|C5orf4_uc003lvr.2_Silent_p.L62L|C5orf4_uc011dde.1_Nonsense_Mutation_p.E300*	NM_032385	NP_115761	Q96IV6	CE004_HUMAN	hypothetical protein LOC10826	323					fatty acid biosynthetic process	integral to membrane	iron ion binding|oxidoreductase activity			ovary(1)	1	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.0999)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)			GGGATGCTCTCAGAGAGCGGG	0.582													6	47	---	---	---	---	PASS
KIF4B	285643	broad.mit.edu	37	5	154393886	154393886	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:154393886G>T	uc010jih.1	+	1	627	c.467G>T	c.(466-468)CGT>CTT	p.R156L		NM_001099293	NP_001092763	Q2VIQ3	KIF4B_HUMAN	kinesin family member 4B	156	Kinesin-motor.				axon guidance|blood coagulation|microtubule-based movement	cytosol|microtubule|nuclear matrix	ATP binding|DNA binding|microtubule motor activity			ovary(1)	1	Renal(175;0.00488)	Medulloblastoma(196;0.0523)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)			TGCCCATCTCGTGAGAAAGCT	0.358													200	183	---	---	---	---	PASS
ITK	3702	broad.mit.edu	37	5	156679693	156679693	+	3'UTR	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156679693G>C	uc003lwo.1	+	17						NM_005546	NP_005537	Q08881	ITK_HUMAN	IL2-inducible T-cell kinase						cellular defense response|intracellular signal transduction|T cell receptor signaling pathway	cytosol|plasma membrane	ATP binding|metal ion binding|non-membrane spanning protein tyrosine kinase activity|protein binding			lung(12)|ovary(8)|skin(4)|stomach(1)|central_nervous_system(1)	26	Renal(175;0.00212)	Medulloblastoma(196;0.0354)|all_neural(177;0.1)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)			CTTTAGTAGAGACTGAGTACC	0.522			T	SYK	peripheral T-cell lymphoma								63	66	---	---	---	---	PASS
CYFIP2	26999	broad.mit.edu	37	5	156747723	156747723	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156747723T>A	uc003lwq.2	+	17	1722	c.1584T>A	c.(1582-1584)AAT>AAA	p.N528K	CYFIP2_uc011ddn.1_Missense_Mutation_p.N502K|CYFIP2_uc011ddo.1_Missense_Mutation_p.N332K|CYFIP2_uc003lwr.2_Missense_Mutation_p.N528K|CYFIP2_uc003lws.2_Missense_Mutation_p.N528K|CYFIP2_uc003lwt.2_Missense_Mutation_p.N406K|CYFIP2_uc011ddp.1_Missense_Mutation_p.N262K	NM_001037333	NP_001032410	Q96F07	CYFP2_HUMAN	cytoplasmic FMR1 interacting protein 2	528					apoptosis|cell-cell adhesion	cell junction|perinuclear region of cytoplasm|synapse|synaptosome	protein binding				0	Renal(175;0.00212)	Medulloblastoma(196;0.0306)|all_neural(177;0.0897)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)			AGCCCCCTAATGACCCATGCT	0.567													31	46	---	---	---	---	PASS
THG1L	54974	broad.mit.edu	37	5	157159883	157159883	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:157159883G>A	uc003lxd.2	+	2	325	c.199G>A	c.(199-201)GAG>AAG	p.E67K	THG1L_uc011ddu.1_5'UTR	NM_017872	NP_060342	Q9NWX6	THG1_HUMAN	interphase cytoplasmic foci protein 45	67					protein homotetramerization|tRNA modification	mitochondrion	GTP binding|metal ion binding|tRNA guanylyltransferase activity				0	Renal(175;0.00488)	Medulloblastoma(196;0.0523)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)			AAGGTTTGCTGAGAAGCACAA	0.473													26	109	---	---	---	---	PASS
GABRA1	2554	broad.mit.edu	37	5	161300180	161300180	+	Nonsense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:161300180A>T	uc010jiw.2	+	6	781	c.313A>T	c.(313-315)AAA>TAA	p.K105*	GABRA1_uc010jix.2_Nonsense_Mutation_p.K105*|GABRA1_uc010jiy.2_Nonsense_Mutation_p.K105*|GABRA1_uc003lyx.3_Nonsense_Mutation_p.K105*|GABRA1_uc010jiz.2_Nonsense_Mutation_p.K105*|GABRA1_uc010jja.2_Nonsense_Mutation_p.K105*|GABRA1_uc010jjb.2_Nonsense_Mutation_p.K105*	NM_000806	NP_000797	P14867	GBRA1_HUMAN	gamma-aminobutyric acid (GABA) A receptor, alpha	105	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)|pancreas(1)	3	Renal(175;0.00259)	Medulloblastoma(196;0.0208)|all_neural(177;0.0672)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.228)	Alprazolam(DB00404)|Butabarbital(DB00237)|Butalbital(DB00241)|Butethal(DB01353)|Chlordiazepoxide(DB00475)|Clobazam(DB00349)|Clonazepam(DB01068)|Clorazepate(DB00628)|Desflurane(DB01189)|Diazepam(DB00829)|Enflurane(DB00228)|Ethanol(DB00898)|Ethchlorvynol(DB00189)|Etomidate(DB00292)|Flumazenil(DB01205)|Flurazepam(DB00690)|Halazepam(DB00801)|Halothane(DB01159)|Hexobarbital(DB01355)|Isoflurane(DB00753)|Lorazepam(DB00186)|Meprobamate(DB00371)|Metharbital(DB00463)|Methohexital(DB00474)|Methoxyflurane(DB01028)|Methylphenobarbital(DB00849)|Methyprylon(DB01107)|Midazolam(DB00683)|Nitrazepam(DB01595)|Oxazepam(DB00842)|Pentobarbital(DB00312)|Phenobarbital(DB01174)|Picrotoxin(DB00466)|Prazepam(DB01588)|Primidone(DB00794)|Progabide(DB00837)|Propofol(DB00818)|Quazepam(DB01589)|Secobarbital(DB00418)|Sevoflurane(DB01236)|Talbutal(DB00306)|Thiamylal(DB01154)|Thiopental(DB00599)|Topiramate(DB00273)|Zaleplon(DB00962)|Zolpidem(DB00425)	GTTAAAATTTAAAGGACCTAT	0.383													52	220	---	---	---	---	PASS
GABRG2	2566	broad.mit.edu	37	5	161576592	161576592	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:161576592G>A	uc003lyz.3	+						GABRG2_uc010jjc.2_Intron|GABRG2_uc003lyy.3_Intron|GABRG2_uc011dej.1_Intron	NM_000816	NP_000807	P18507	GBRG2_HUMAN	gamma-aminobutyric acid A receptor, gamma 2						gamma-aminobutyric acid signaling pathway	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	benzodiazepine receptor activity|chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity|protein binding			ovary(4)|skin(1)	5	Renal(175;0.000319)	Medulloblastoma(196;0.0208)|all_neural(177;0.0672)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.0734)|OV - Ovarian serous cystadenocarcinoma(192;0.135)|Epithelial(171;0.136)		TTTGAGAAATGTGACCTTCTT	0.244													4	36	---	---	---	---	PASS
LMAN2	10960	broad.mit.edu	37	5	176778302	176778302	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176778302G>A	uc003mge.2	-						LMAN2_uc003mgd.2_Intron	NM_006816	NP_006807	Q12907	LMAN2_HUMAN	lectin, mannose-binding 2 precursor						protein transport	endoplasmic reticulum membrane|ER-Golgi intermediate compartment membrane|Golgi membrane|integral to membrane	metal ion binding|sugar binding				0	all_cancers(89;2.04e-05)|Renal(175;0.000269)|Lung NSC(126;0.000832)|all_lung(126;0.00152)	all_neural(177;0.00802)|Medulloblastoma(196;0.0145)|all_hematologic(541;0.248)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)			CCTGTGGGAAGAGACAGGTGC	0.622													13	105	---	---	---	---	PASS
COL23A1	91522	broad.mit.edu	37	5	177733903	177733903	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:177733903C>T	uc003mje.2	-	3	737	c.379G>A	c.(379-381)GGC>AGC	p.G127S		NM_173465	NP_775736	Q86Y22	CONA1_HUMAN	collagen, type XXIII, alpha 1	127	Extracellular (Potential).|Collagen-like 1.|Gly-rich.					collagen|integral to membrane|plasma membrane	protein binding			central_nervous_system(1)|skin(1)	2	all_cancers(89;0.00188)|Renal(175;0.000159)|Lung NSC(126;0.00814)|all_lung(126;0.0129)	all_neural(177;0.00802)|Medulloblastoma(196;0.0145)|all_hematologic(541;0.248)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	OV - Ovarian serous cystadenocarcinoma(192;0.153)|all cancers(165;0.172)		CCAGGCTTGCCGCGCCGTCCA	0.617													3	25	---	---	---	---	PASS
GRM6	2916	broad.mit.edu	37	5	178416114	178416114	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:178416114G>A	uc003mjr.2	-	6	1355	c.1176C>T	c.(1174-1176)GAC>GAT	p.D392D	GRM6_uc010jla.1_Intron|GRM6_uc003mjs.1_Silent_p.D12D	NM_000843	NP_000834	O15303	GRM6_HUMAN	glutamate receptor, metabotropic 6 precursor	392	Extracellular (Potential).				detection of visible light|visual perception	integral to plasma membrane				lung(4)|ovary(2)|breast(1)|pancreas(1)	8	all_cancers(89;0.000828)|Renal(175;0.000159)|all_epithelial(37;0.000167)|Lung NSC(126;0.00199)|all_lung(126;0.00351)	all_cancers(40;0.0156)|all_neural(177;0.00409)|Medulloblastoma(196;0.00498)|all_hematologic(541;0.21)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	all cancers(165;0.245)		CGTAGGTGGAGTCCCGGCCGA	0.617													15	19	---	---	---	---	PASS
ZNF354C	30832	broad.mit.edu	37	5	178505850	178505850	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:178505850G>C	uc003mju.2	+	5	532	c.417G>C	c.(415-417)GAG>GAC	p.E139D		NM_014594	NP_055409	Q86Y25	Z354C_HUMAN	zinc finger protein 354C	139					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1	all_cancers(89;0.00065)|all_epithelial(37;0.000153)|Renal(175;0.000159)|Lung NSC(126;0.00175)|all_lung(126;0.00309)	all_cancers(40;0.19)|all_neural(177;0.00802)|Medulloblastoma(196;0.0145)|all_hematologic(541;0.248)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	all cancers(165;0.247)		AAGAGCAAGAGAAGAAACCTC	0.378													7	213	---	---	---	---	PASS
ADAMTS2	9509	broad.mit.edu	37	5	178562931	178562931	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:178562931G>C	uc003mjw.2	-	13	2064	c.2064C>G	c.(2062-2064)CTC>CTG	p.L688L		NM_014244	NP_055059	O95450	ATS2_HUMAN	ADAM metallopeptidase with thrombospondin type 1	688	Cys-rich.				collagen catabolic process	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			large_intestine(1)|lung(1)|ovary(1)|pancreas(1)	4	all_cancers(89;0.000456)|all_epithelial(37;0.000138)|Renal(175;0.000159)|Lung NSC(126;0.00184)|all_lung(126;0.00326)	all_cancers(40;0.00604)|all_neural(177;0.00411)|Medulloblastoma(196;0.00508)|Lung NSC(249;0.0569)|all_lung(500;0.129)|all_hematologic(541;0.211)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	GBM - Glioblastoma multiforme(465;0.0473)		CGCGCACACAGAGGCTGAAGG	0.527													32	93	---	---	---	---	PASS
RREB1	6239	broad.mit.edu	37	6	7247378	7247378	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:7247378G>T	uc003mxc.2	+	11	4920	c.4530G>T	c.(4528-4530)AGG>AGT	p.R1510S	RREB1_uc003mxb.2_Missense_Mutation_p.R1565S|RREB1_uc010jnx.2_Intron	NM_001003698	NP_001003698	Q92766	RREB1_HUMAN	ras responsive element binding protein 1 isoform	1510					multicellular organismal development|positive regulation of transcription, DNA-dependent|Ras protein signal transduction|transcription from RNA polymerase II promoter	cytoplasm|nuclear speck	DNA binding|zinc ion binding			ovary(4)|large_intestine(2)|pancreas(2)|skin(2)|breast(1)	11	Ovarian(93;0.0398)	all_hematologic(90;0.0384)|Prostate(151;0.191)				CAGACAAGAGGAAGAAGGTCT	0.607													19	25	---	---	---	---	PASS
RANBP9	10048	broad.mit.edu	37	6	13625971	13625971	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:13625971G>A	uc003nbb.2	-	13	2032	c.1973C>T	c.(1972-1974)TCA>TTA	p.S658L	RANBP9_uc003nba.2_Missense_Mutation_p.S317L	NM_005493	NP_005484	Q96S59	RANB9_HUMAN	RAN binding protein 9	658	Interaction with FMR1.				axon guidance|microtubule nucleation|protein complex assembly	cytosol|microtubule associated complex|nucleus	Ran GTPase binding			lung(1)|skin(1)	2	Breast(50;0.00669)|Ovarian(93;0.0634)	all_hematologic(90;0.117)	Epithelial(50;0.223)			CCAGGGATCTGAATATGCTAG	0.393													18	287	---	---	---	---	PASS
DTNBP1	84062	broad.mit.edu	37	6	15627678	15627678	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:15627678G>C	uc003nbm.2	-	5	422	c.251C>G	c.(250-252)TCT>TGT	p.S84C	DTNBP1_uc003nbl.2_Missense_Mutation_p.S3C|DTNBP1_uc003nbn.2_RNA|DTNBP1_uc003nbo.2_RNA|DTNBP1_uc003nbp.2_Missense_Mutation_p.S84C|DTNBP1_uc010jph.2_Missense_Mutation_p.S71C	NM_032122	NP_115498	Q96EV8	DTBP1_HUMAN	dystrobrevin binding protein 1 isoform a	84					actin cytoskeleton reorganization|cellular membrane organization|neuron projection morphogenesis|post-Golgi vesicle-mediated transport|regulation of dopamine receptor signaling pathway	axon part|BLOC-1 complex|cell junction|dendritic spine|endoplasmic reticulum membrane|endosome membrane|growth cone|melanosome membrane|nucleus|postsynaptic density|postsynaptic membrane|sarcolemma|synaptic vesicle membrane|synaptosome	identical protein binding				0	Breast(50;0.0289)|Ovarian(93;0.103)	all_hematologic(90;0.0895)	Epithelial(50;0.211)			CCAGTGCGCAGAAAGCATGAC	0.488									Hermansky-Pudlak_syndrome				31	38	---	---	---	---	PASS
SLC17A1	6568	broad.mit.edu	37	6	25811766	25811766	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:25811766G>C	uc003nfh.3	-	10	1154	c.1038C>G	c.(1036-1038)CTC>CTG	p.L346L	SLC17A1_uc011djy.1_RNA|SLC17A1_uc010jqb.1_Silent_p.L344L|SLC17A1_uc010jqc.1_Silent_p.L290L	NM_005074	NP_005065	Q14916	NPT1_HUMAN	solute carrier family 17 (sodium phosphate),	346	Helical; (Potential).				sodium ion transport|urate metabolic process	integral to plasma membrane|membrane fraction	sodium-dependent phosphate transmembrane transporter activity|symporter activity			ovary(3)|pancreas(1)	4						TTGCAGGAAGGAGAAATCCTG	0.463													22	108	---	---	---	---	PASS
HIST1H4B	8366	broad.mit.edu	37	6	26027306	26027306	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26027306G>A	uc003nfr.2	-	1	175	c.175C>T	c.(175-177)CTC>TTC	p.L59F		NM_003544	NP_003535	P62805	H4_HUMAN	histone cluster 1, H4b	59					CenH3-containing nucleosome assembly at centromere|negative regulation of megakaryocyte differentiation|phosphatidylinositol-mediated signaling|telomere maintenance	nucleoplasm|nucleosome	DNA binding|protein binding			ovary(2)	2						AACACCTTGAGAACGCCACGA	0.552											OREG0017238	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	24	89	---	---	---	---	PASS
HIST1H2AE	3012	broad.mit.edu	37	6	26217427	26217427	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26217427G>C	uc003nha.1	+	1	280	c.225G>C	c.(223-225)AAG>AAC	p.K75N	HIST1H2BG_uc003ngz.2_5'Flank	NM_021052	NP_066390	P04908	H2A1B_HUMAN	histone cluster 1, H2ae	75					nucleosome assembly	nucleosome|nucleus	DNA binding			ovary(1)|skin(1)	2		all_hematologic(11;0.196)				GCGACAATAAGAAGACCCGCA	0.617													5	67	---	---	---	---	PASS
HIST1H3F	8968	broad.mit.edu	37	6	26250597	26250597	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26250597G>C	uc003nhg.1	-	1	239	c.237C>G	c.(235-237)TTC>TTG	p.F79L	HIST1H2BH_uc003nhh.2_5'Flank	NM_021018	NP_066298	P68431	H31_HUMAN	histone cluster 1, H3f	79					blood coagulation|nucleosome assembly|regulation of gene silencing|S phase	nucleoplasm|nucleosome	DNA binding|protein binding				0						GGTCGGTCTTGAAGTCCTGCG	0.587											OREG0017241	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	70	99	---	---	---	---	PASS
BTN3A2	11118	broad.mit.edu	37	6	26370746	26370746	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26370746G>A	uc010jqh.1	+	5	889	c.630G>A	c.(628-630)ATG>ATA	p.M210I	BTN3A2_uc003nho.1_Missense_Mutation_p.M208I|BTN3A2_uc003nhp.2_Missense_Mutation_p.M210I|BTN3A2_uc011dkd.1_Missense_Mutation_p.M168I|BTN3A2_uc011dke.1_Missense_Mutation_p.M187I|BTN3A2_uc010jqi.1_Missense_Mutation_p.M208I	NM_007047	NP_008978	P78410	BT3A2_HUMAN	butyrophilin, subfamily 3, member A2 precursor	210	Extracellular (Potential).					integral to membrane					0						CTGTGATCATGAGAGGCGGCT	0.547													10	219	---	---	---	---	PASS
PGBD1	84547	broad.mit.edu	37	6	28254933	28254933	+	Silent	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28254933A>T	uc003nky.2	+	4	1000	c.630A>T	c.(628-630)CCA>CCT	p.P210P	PGBD1_uc003nkz.2_Silent_p.P210P	NM_032507	NP_115896	Q96JS3	PGBD1_HUMAN	piggyBac transposable element derived 1	210					viral reproduction	membrane|nucleus	scavenger receptor activity|sequence-specific DNA binding transcription factor activity			ovary(4)	4						TGTTTAACCCAGTCAGGTCCC	0.522													27	71	---	---	---	---	PASS
HLA-A	3105	broad.mit.edu	37	6	29912276	29912276	+	Splice_Site	SNP	G	C	C	rs45540334		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29912276G>C	uc003nol.2	+	5	896	c.896_splice	c.e5-1	p.E299_splice	HLA-G_uc011dmb.1_Intron|HCG4P6_uc003nog.1_5'Flank|HLA-A_uc010jrq.2_Splice_Site_p.E178_splice|HLA-A_uc003nok.2_Splice_Site_p.E178_splice|HLA-A_uc003non.2_Splice_Site_p.E299_splice|HLA-A_uc003noo.2_Splice_Site_p.E299_splice|HLA-A_uc010jrr.2_Intron|HLA-A_uc003nom.2_Splice_Site_p.E178_splice|HLA-A_uc010klp.2_Intron|HLA-A_uc011dmc.1_Splice_Site_p.E178_splice|HLA-A_uc011dmd.1_Splice_Site_p.E178_splice	NM_002116	NP_002107	P30443	1A01_HUMAN	major histocompatibility complex, class I, A						antigen processing and presentation of peptide antigen via MHC class I|interferon-gamma-mediated signaling pathway|interspecies interaction between organisms|regulation of immune response|type I interferon-mediated signaling pathway	integral to plasma membrane|MHC class I protein complex	MHC class I receptor activity			upper_aerodigestive_tract(1)|ovary(1)	2						TCTTTTCCCAGAGCTGTCTTC	0.587									Melanoma_Familial_Clustering_of|Lichen_Sclerosis_et_Atrophicus_Familial_Clustering_of|Osteosarcoma_Familial_Clustering_of|Naso-/Oropharyngeal/Laryngeal_Cancer_Familial_Clustering_of	Multiple Myeloma(9;0.094)			18	53	---	---	---	---	PASS
NFKBIL1	4795	broad.mit.edu	37	6	31525984	31525984	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31525984G>A	uc003nub.2	+	4	861	c.742G>A	c.(742-744)GAG>AAG	p.E248K	NFKBIL1_uc011dnr.1_Missense_Mutation_p.E210K|NFKBIL1_uc011dns.1_Missense_Mutation_p.E225K|NFKBIL1_uc011dnt.1_RNA|NFKBIL1_uc003nuc.2_Missense_Mutation_p.E233K	NM_005007	NP_004998	Q9UBC1	IKBL1_HUMAN	nuclear factor of kappa light polypeptide gene	248					cytoplasmic sequestering of transcription factor		protein binding				0						GCTCTTCAGGGAGCGAGCCCG	0.697													5	7	---	---	---	---	PASS
BAT4	7918	broad.mit.edu	37	6	31631710	31631710	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31631710C>A	uc003nvn.2	-	2	1191	c.546G>T	c.(544-546)CAG>CAT	p.Q182H	BAT4_uc003nvo.3_Missense_Mutation_p.Q182H|BAT4_uc003nvp.3_Missense_Mutation_p.Q182H|BAT4_uc003nvq.2_Missense_Mutation_p.Q182H|CSNK2B_uc010jsz.1_5'Flank|CSNK2B_uc010jta.1_5'Flank|CSNK2B_uc003nvr.1_5'Flank|CSNK2B_uc003nvs.1_5'Flank	NM_033177	NP_149417	O95872	GPAN1_HUMAN	HLA-B associated transcript 4	182						intracellular	nucleic acid binding				0						CTTCAGCGAGCTGAGCCGCAT	0.642													25	32	---	---	---	---	PASS
DDAH2	23564	broad.mit.edu	37	6	31695431	31695431	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31695431C>G	uc003nwp.2	-	5	1261	c.630G>C	c.(628-630)CTG>CTC	p.L210L	DDAH2_uc003nwq.2_Silent_p.L210L	NM_013974	NP_039268	O95865	DDAH2_HUMAN	dimethylarginine dimethylaminohydrolase 2	210					anti-apoptosis|arginine catabolic process|citrulline metabolic process|nitric oxide biosynthetic process|nitric oxide mediated signal transduction	cytoplasm	dimethylargininase activity|protein binding				0					L-Citrulline(DB00155)	CTGGGAGGGTCAGGGAGGCAT	0.577													6	164	---	---	---	---	PASS
DDAH2	23564	broad.mit.edu	37	6	31696795	31696795	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31696795C>A	uc003nwp.2	-	1	775	c.144G>T	c.(142-144)CTG>CTT	p.L48L	DDAH2_uc003nwq.2_Silent_p.L48L	NM_013974	NP_039268	O95865	DDAH2_HUMAN	dimethylarginine dimethylaminohydrolase 2	48					anti-apoptosis|arginine catabolic process|citrulline metabolic process|nitric oxide biosynthetic process|nitric oxide mediated signal transduction	cytoplasm	dimethylargininase activity|protein binding				0					L-Citrulline(DB00155)	GTTTACCTCCCAGCACCCCGT	0.652													7	91	---	---	---	---	PASS
MSH5	4439	broad.mit.edu	37	6	31709041	31709041	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31709041G>C	uc003nwv.1	+	3	328	c.249G>C	c.(247-249)GAG>GAC	p.E83D	MSH5_uc003nwt.1_Missense_Mutation_p.E83D|MSH5_uc003nwu.1_Missense_Mutation_p.E83D|MSH5_uc003nww.1_Missense_Mutation_p.E83D|MSH5_uc003nwx.1_Missense_Mutation_p.E83D	NM_172166	NP_751898	O43196	MSH5_HUMAN	mutS homolog 5 isoform c	83					chiasma assembly|homologous chromosome segregation|meiotic prophase II|mismatch repair|reciprocal meiotic recombination	synaptonemal complex	ATP binding|DNA-dependent ATPase activity|mismatched DNA binding			ovary(2)|breast(1)	3						CAGACCACGAGAGCCTCAAGC	0.433								Direct_reversal_of_damage|MMR					73	152	---	---	---	---	PASS
NOTCH4	4855	broad.mit.edu	37	6	32163487	32163487	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32163487G>A	uc003obb.2	-	30	5878	c.5739C>T	c.(5737-5739)GGC>GGT	p.G1913G	GPSM3_uc003oax.3_5'Flank|GPSM3_uc003oay.3_5'Flank|GPSM3_uc003oaz.2_5'Flank|NOTCH4_uc011dpt.1_3'UTR|NOTCH4_uc003oba.2_Silent_p.G573G|NOTCH4_uc011dpu.1_RNA|NOTCH4_uc011dpv.1_RNA	NM_004557	NP_004548	Q99466	NOTC4_HUMAN	notch4 preproprotein	1913	Cytoplasmic (Potential).				cell fate determination|embryo development|hemopoiesis|mammary gland development|negative regulation of endothelial cell differentiation|Notch receptor processing|Notch signaling pathway|patterning of blood vessels|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cell surface|cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to plasma membrane|nucleoplasm	calcium ion binding|protein heterodimerization activity|receptor activity			lung(8)|ovary(5)|breast(4)|central_nervous_system(3)|upper_aerodigestive_tract(1)|skin(1)	22						AAAACCTACGGCCGCGAGGGG	0.682													42	45	---	---	---	---	PASS
NOTCH4	4855	broad.mit.edu	37	6	32169850	32169850	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32169850C>G	uc003obb.2	-						NOTCH4_uc003oba.2_5'UTR|NOTCH4_uc011dpu.1_Intron|NOTCH4_uc011dpv.1_Intron	NM_004557	NP_004548	Q99466	NOTC4_HUMAN	notch4 preproprotein						cell fate determination|embryo development|hemopoiesis|mammary gland development|negative regulation of endothelial cell differentiation|Notch receptor processing|Notch signaling pathway|patterning of blood vessels|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cell surface|cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to plasma membrane|nucleoplasm	calcium ion binding|protein heterodimerization activity|receptor activity			lung(8)|ovary(5)|breast(4)|central_nervous_system(3)|upper_aerodigestive_tract(1)|skin(1)	22						ATTTCAGGCTCACGTGCAGGC	0.592													4	110	---	---	---	---	PASS
RPS18	6222	broad.mit.edu	37	6	33244195	33244195	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33244195G>C	uc003odp.1	+	6	456	c.411G>C	c.(409-411)AAG>AAC	p.K137N	RPS18_uc010jum.1_RNA|RPS18_uc003odq.1_RNA|B3GALT4_uc003odr.2_5'Flank	NM_022551	NP_072045	P62269	RS18_HUMAN	ribosomal protein S18	137					endocrine pancreas development|ribosome biogenesis|translational elongation|translational termination|viral transcription	cytosolic small ribosomal subunit	rRNA binding|structural constituent of ribosome				0						AGCACACCAAGACCACTGGCC	0.493													13	12	---	---	---	---	PASS
WDR46	9277	broad.mit.edu	37	6	33256129	33256129	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33256129A>T	uc003ods.2	-						WDR46_uc011dra.1_Intron|WDR46_uc010juo.1_Intron|PFDN6_uc003odt.1_5'Flank|PFDN6_uc010jup.1_5'Flank	NM_005452	NP_005443	O15213	WDR46_HUMAN	WD repeat domain 46 isoform 1												0						ATTAGGGCTCACTCACCCAGG	0.483													162	233	---	---	---	---	PASS
RGL2	5863	broad.mit.edu	37	6	33261388	33261388	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33261388A>G	uc003odv.2	-	14	1730	c.1597T>C	c.(1597-1599)TGG>CGG	p.W533R	RGL2_uc003odu.2_Missense_Mutation_p.W93R|RGL2_uc010jur.2_Missense_Mutation_p.W93R|RGL2_uc003odw.2_Missense_Mutation_p.W451R|RGL2_uc011drb.1_3'UTR	NM_004761	NP_004752	O15211	RGL2_HUMAN	ral guanine nucleotide dissociation	533					Ras protein signal transduction|regulation of small GTPase mediated signal transduction	intracellular	Ras guanyl-nucleotide exchange factor activity			skin(3)|lung(1)|breast(1)|pancreas(1)	6						CACTCTGTCCACTGCGAGATG	0.582													15	81	---	---	---	---	PASS
TAPBP	6892	broad.mit.edu	37	6	33281611	33281611	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33281611G>C	uc003odx.1	-	2	239	c.68C>G	c.(67-69)GCG>GGG	p.A23G	TAPBP_uc010jus.1_Missense_Mutation_p.A23G|TAPBP_uc003ody.2_Missense_Mutation_p.A23G|TAPBP_uc003odz.2_Missense_Mutation_p.A23G|TAPBP_uc010jut.1_Missense_Mutation_p.A23G|TAPBP_uc011drc.1_Missense_Mutation_p.A23G	NM_003190	NP_003181	O15533	TPSN_HUMAN	tapasin isoform 1 precursor	23	Lumenal (Potential).				antigen processing and presentation of endogenous peptide antigen via MHC class I|immune response|peptide antigen stabilization|protein complex assembly|retrograde vesicle-mediated transport, Golgi to ER	Golgi membrane|MHC class I peptide loading complex|microsome	MHC class I protein binding|peptide antigen binding|peptide antigen-transporting ATPase activity|TAP1 binding|TAP2 binding|unfolded protein binding			ovary(1)	1						CTCGATCACCGCGGGTCCTGC	0.672													25	37	---	---	---	---	PASS
C6orf106	64771	broad.mit.edu	37	6	34574439	34574439	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34574439G>A	uc003ojr.2	-	4	999	c.754C>T	c.(754-756)CCT>TCT	p.P252S	C6orf106_uc003ojs.2_Missense_Mutation_p.P186S	NM_024294	NP_077270	Q9H6K1	CF106_HUMAN	chromosome 6 open reading frame 106 isoform a	252										skin(2)|ovary(1)	3						TCAGGAGCAGGAGCCCATGTG	0.483													18	137	---	---	---	---	PASS
SLC26A8	116369	broad.mit.edu	37	6	35919038	35919038	+	Missense_Mutation	SNP	C	T	T	rs115071158	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35919038C>T	uc003olm.2	-	19	2485	c.2374G>A	c.(2374-2376)GTG>ATG	p.V792M	SLC26A8_uc010jwa.2_RNA|SLC26A8_uc003olk.2_Missense_Mutation_p.V374M|SLC26A8_uc003oln.2_Missense_Mutation_p.V792M|SLC26A8_uc003oll.2_Missense_Mutation_p.V687M	NM_052961	NP_443193	Q96RN1	S26A8_HUMAN	solute carrier family 26, member 8 isoform a	792	Interaction with RACGAP1.|STAS.|Cytoplasmic (Potential).				cell differentiation|meiosis|multicellular organismal development|spermatogenesis	integral to membrane|plasma membrane	anion:anion antiporter activity|chloride channel activity|oxalate transmembrane transporter activity|protein binding|sulfate transmembrane transporter activity			ovary(2)	2						GCAAACAGCACGGCGTCGTGA	0.488													55	65	---	---	---	---	PASS
BRPF3	27154	broad.mit.edu	37	6	36168502	36168502	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:36168502G>C	uc003olv.3	+	2	627	c.403G>C	c.(403-405)GCT>CCT	p.A135P	BRPF3_uc010jwb.2_Missense_Mutation_p.A135P|BRPF3_uc011dtj.1_RNA|BRPF3_uc010jwc.2_RNA|BRPF3_uc011dtk.1_Missense_Mutation_p.A135P	NM_015695	NP_056510	Q9ULD4	BRPF3_HUMAN	bromodomain and PHD finger containing, 3	135					histone H3 acetylation|platelet activation|platelet degranulation	cytosol|extracellular region|MOZ/MORF histone acetyltransferase complex	protein binding|zinc ion binding			ovary(1)|skin(1)	2						CCCGCTGCCTGCTGCCTACTA	0.567													63	80	---	---	---	---	PASS
DNAH8	1769	broad.mit.edu	37	6	38840393	38840393	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38840393C>G	uc003ooe.1	+	48	7021	c.6421C>G	c.(6421-6423)CTA>GTA	p.L2141V		NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21						TATCACGATTCTAATGAAGGC	0.458													78	120	---	---	---	---	PASS
TREM2	54209	broad.mit.edu	37	6	41129307	41129307	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41129307C>T	uc003opy.2	-	2	187	c.85G>A	c.(85-87)GGC>AGC	p.G29S	TREM2_uc003opz.2_Missense_Mutation_p.G59S|TREM2_uc010jxl.1_Missense_Mutation_p.G59S	NM_018965	NP_061838	Q9NZC2	TREM2_HUMAN	triggering receptor expressed on myeloid cells 2	29	Ig-like V-type.|Extracellular (Potential).				axon guidance|humoral immune response	extracellular region|integral to membrane|plasma membrane	receptor activity			ovary(1)	1	Ovarian(28;0.0418)|Colorectal(47;0.196)					AGGGACTGGCCCGCCACGCCC	0.517													3	33	---	---	---	---	PASS
BYSL	705	broad.mit.edu	37	6	41897925	41897925	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41897925G>C	uc003orl.2	+	3	823	c.487G>C	c.(487-489)GAG>CAG	p.E163Q		NM_004053	NP_004044	Q13895	BYST_HUMAN	bystin	163					cell adhesion|female pregnancy|ribosome biogenesis	cytoplasm|nucleolus					0	Colorectal(47;0.121)		STAD - Stomach adenocarcinoma(11;0.000204)|Epithelial(12;0.000473)|Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)			GACAGAGGTTGAGACAGTCAT	0.607													23	83	---	---	---	---	PASS
CCND3	896	broad.mit.edu	37	6	41908702	41908702	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41908702G>T	uc003orn.2	-						CCND3_uc003orp.2_Intron|CCND3_uc011duk.1_Intron|CCND3_uc011dum.1_Intron|CCND3_uc003orm.2_Silent_p.L12L|CCND3_uc003oro.2_Intron|CCND3_uc011dul.1_Intron	NM_001760	NP_001751	P30281	CCND3_HUMAN	cyclin D3 isoform 2						cell division|positive regulation of cyclin-dependent protein kinase activity|positive regulation of protein phosphorylation	cyclin-dependent protein kinase holoenzyme complex|cytoplasm|membrane|nucleus	protein kinase binding				0	Colorectal(47;0.121)		Epithelial(12;0.000178)|STAD - Stomach adenocarcinoma(11;0.000204)|Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)			GAGGGGAAGGGAGGAGGCTCC	0.672			T	IGH@	MM								9	60	---	---	---	---	PASS
C6orf226	441150	broad.mit.edu	37	6	42858370	42858370	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42858370G>C	uc003osw.2	-	1	185	c.157C>G	c.(157-159)CGG>GGG	p.R53G		NM_001008739	NP_001008739	Q5I0X4	CF226_HUMAN	hypothetical protein LOC441150	53											0						CGCGGCAGCCGGGACGCTGTG	0.711													9	65	---	---	---	---	PASS
PPP2R5D	5528	broad.mit.edu	37	6	42975936	42975936	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42975936C>G	uc003oth.2	+						MEA1_uc010jyc.1_Intron|PPP2R5D_uc003otg.2_Intron|PPP2R5D_uc010jyd.2_Intron|PPP2R5D_uc011dva.1_Intron|PPP2R5D_uc003oti.2_Intron|PPP2R5D_uc003otj.2_Intron	NM_006245	NP_006236	Q14738	2A5D_HUMAN	delta isoform of regulatory subunit B56, protein						nervous system development|signal transduction	cytoplasm|nucleus|protein phosphatase type 2A complex	protein binding|protein phosphatase type 2A regulator activity			breast(1)|central_nervous_system(1)	2			Colorectal(64;0.00237)|all cancers(41;0.00411)|COAD - Colon adenocarcinoma(64;0.00473)|OV - Ovarian serous cystadenocarcinoma(102;0.0664)|KIRC - Kidney renal clear cell carcinoma(15;0.133)|Kidney(15;0.188)			TTTCTTCCCTCAGGTTCATCT	0.582													11	296	---	---	---	---	PASS
CUL9	23113	broad.mit.edu	37	6	43156308	43156308	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43156308C>G	uc003ouk.2	+	8	2110	c.2035C>G	c.(2035-2037)CAG>GAG	p.Q679E	CUL9_uc003ouj.1_3'UTR|CUL9_uc003oul.2_Missense_Mutation_p.Q679E|CUL9_uc010jyk.2_Translation_Start_Site|CUL9_uc003oum.1_3'UTR	NM_015089	NP_055904	Q8IWT3	CUL9_HUMAN	p53-associated parkin-like cytoplasmic protein	679					ubiquitin-dependent protein catabolic process	cullin-RING ubiquitin ligase complex|cytoplasm	ATP binding|ubiquitin protein ligase binding|zinc ion binding			ovary(5)|lung(3)|skin(2)|breast(1)|central_nervous_system(1)	12						CTCCCTGGATCAGCATGTGGC	0.567													9	74	---	---	---	---	PASS
TJAP1	93643	broad.mit.edu	37	6	43472568	43472568	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43472568C>G	uc003ovd.2	+	11	1025	c.649C>G	c.(649-651)CCT>GCT	p.P217A	TJAP1_uc003ovf.2_Missense_Mutation_p.P207A|TJAP1_uc003ove.2_Missense_Mutation_p.P207A|TJAP1_uc003ovc.2_Missense_Mutation_p.P207A|TJAP1_uc010jyp.2_Missense_Mutation_p.P176A|TJAP1_uc011dvh.1_Missense_Mutation_p.P207A|TJAP1_uc003ovg.2_Missense_Mutation_p.P83A|TJAP1_uc011dvi.1_Missense_Mutation_p.P217A|TJAP1_uc011dvj.1_Missense_Mutation_p.P17A|TJAP1_uc003ovi.2_Missense_Mutation_p.P83A	NM_001146016	NP_001139488	Q5JTD0	TJAP1_HUMAN	tight junction associated protein 1 isoform a	217						Golgi apparatus|tight junction	protein binding				0	all_lung(25;0.00536)		Colorectal(64;0.00245)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.0122)|OV - Ovarian serous cystadenocarcinoma(102;0.0804)			CAGCCCAGGTCCTGCTCCCAG	0.572													4	258	---	---	---	---	PASS
CDC5L	988	broad.mit.edu	37	6	44360434	44360434	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44360434G>T	uc003oxl.2	+	3	439	c.180G>T	c.(178-180)AAG>AAT	p.K60N		NM_001253	NP_001244	Q99459	CDC5L_HUMAN	CDC5-like	60	HTH myb-type 2.				cell cycle|regulation of transcription, DNA-dependent|transcription, DNA-dependent	catalytic step 2 spliceosome|cytoplasm|nuclear speck|nucleolus	DNA binding|RNA binding			lung(3)|ovary(1)|kidney(1)|skin(1)	6	all_lung(25;0.00433)|Ovarian(13;0.0273)|all_hematologic(164;0.208)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)			GCATTAAGAAGACAGAATGGT	0.393													11	53	---	---	---	---	PASS
PLA2G7	7941	broad.mit.edu	37	6	46678382	46678382	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:46678382G>T	uc010jzf.2	-	8	946	c.677C>A	c.(676-678)GCA>GAA	p.A226E	PLA2G7_uc010jzg.1_Missense_Mutation_p.A226E|PLA2G7_uc011dwd.1_Missense_Mutation_p.A181E|PLA2G7_uc011dwe.1_Missense_Mutation_p.A99E	NM_005084	NP_005075	Q13093	PAFA_HUMAN	phospholipase A2, group VII	226					inflammatory response|lipid catabolic process	extracellular space	1-alkyl-2-acetylglycerophosphocholine esterase activity|phospholipid binding				0			Lung(136;0.192)			ACATTCTTTTGCTCTTTGCCG	0.323													61	160	---	---	---	---	PASS
MEP1A	4224	broad.mit.edu	37	6	46777263	46777263	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:46777263A>G	uc010jzh.1	+	6	411	c.369A>G	c.(367-369)CAA>CAG	p.Q123Q	MEP1A_uc011dwg.1_5'UTR|MEP1A_uc011dwh.1_Silent_p.Q151Q|MEP1A_uc011dwi.1_Silent_p.Q23Q	NM_005588	NP_005579	Q16819	MEP1A_HUMAN	meprin A alpha precursor	123	Extracellular (Potential).|Metalloprotease.				digestion|proteolysis	extracellular space|integral to plasma membrane|soluble fraction	metalloendopeptidase activity|zinc ion binding			pancreas(2)|ovary(1)	3			Lung(136;0.192)			TCATATTTCAACAGTTTGATG	0.333													108	224	---	---	---	---	PASS
MEP1A	4224	broad.mit.edu	37	6	46800903	46800903	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:46800903C>T	uc010jzh.1	+	11	1279	c.1237C>T	c.(1237-1239)CAG>TAG	p.Q413*	MEP1A_uc011dwg.1_Nonsense_Mutation_p.Q135*|MEP1A_uc011dwh.1_Nonsense_Mutation_p.Q441*|MEP1A_uc011dwi.1_Nonsense_Mutation_p.Q313*	NM_005588	NP_005579	Q16819	MEP1A_HUMAN	meprin A alpha precursor	413	Extracellular (Potential).|MAM.				digestion|proteolysis	extracellular space|integral to plasma membrane|soluble fraction	metalloendopeptidase activity|zinc ion binding			pancreas(2)|ovary(1)	3			Lung(136;0.192)			AGGCGACCCTCAGAACTCAAC	0.507													76	137	---	---	---	---	PASS
OPN5	221391	broad.mit.edu	37	6	47779408	47779408	+	Splice_Site	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47779408A>G	uc003ozc.2	+	6	1004	c.999_splice	c.e6-2	p.R333_splice	OPN5_uc003ozd.2_Splice_Site_p.R168_splice	NM_181744	NP_859528	Q6U736	OPN5_HUMAN	opsin 5 isoform 1						phototransduction|protein-chromophore linkage|visual perception	integral to membrane	G-protein coupled receptor activity|photoreceptor activity			ovary(1)	1						TCCTATATCTAGGCTGCACAC	0.308													43	84	---	---	---	---	PASS
C6orf138	442213	broad.mit.edu	37	6	47847149	47847149	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47847149G>C	uc011dwm.1	-	3	1465	c.1380C>G	c.(1378-1380)TTC>TTG	p.F460L	C6orf138_uc011dwn.1_Missense_Mutation_p.F224L	NM_001013732	NP_001013754	Q6ZW05	CF138_HUMAN	hypothetical protein LOC442213	477	Helical; (Potential).					integral to membrane	hedgehog receptor activity			central_nervous_system(1)	1						CCATGAAGGAGAAGGAGGCAT	0.418													3	74	---	---	---	---	PASS
PGK2	5232	broad.mit.edu	37	6	49754844	49754844	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49754844G>A	uc003ozu.2	-	1	164	c.57C>T	c.(55-57)GTC>GTT	p.V19V		NM_138733	NP_620061	P07205	PGK2_HUMAN	phosphoglycerate kinase 2	19					glycolysis	cytosol	ATP binding|phosphoglycerate kinase activity			ovary(1)	1	Lung NSC(77;0.0402)					CTCTCATGATGACTCGCTTCC	0.418													8	228	---	---	---	---	PASS
DEFB110	245913	broad.mit.edu	37	6	49986831	49986831	+	Missense_Mutation	SNP	C	G	G	rs140171603		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49986831C>G	uc003pac.2	-	2	109	c.63G>C	c.(61-63)AAG>AAC	p.K21N	DEFB110_uc011dwr.1_Intron	NM_001037497	NP_001032586	Q30KQ9	DB110_HUMAN	beta-defensin 110 isoform a	21					defense response to bacterium	extracellular region				ovary(1)	1	Lung NSC(77;0.042)					CAGGATATTTCTTTTTGGCTG	0.353													24	237	---	---	---	---	PASS
TFAP2B	7021	broad.mit.edu	37	6	50791467	50791467	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:50791467G>C	uc003pag.2	+	2	595	c.429G>C	c.(427-429)TCG>TCC	p.S143S		NM_003221	NP_003212	Q92481	AP2B_HUMAN	transcription factor AP-2 beta	143					nervous system development|positive regulation of transcription from RNA polymerase II promoter		protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity				0	Lung NSC(77;0.156)					ACTACCACTCGGTCCGCCGGC	0.716													3	8	---	---	---	---	PASS
TFAP2B	7021	broad.mit.edu	37	6	50791468	50791468	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:50791468G>A	uc003pag.2	+	2	596	c.430G>A	c.(430-432)GTC>ATC	p.V144I		NM_003221	NP_003212	Q92481	AP2B_HUMAN	transcription factor AP-2 beta	144					nervous system development|positive regulation of transcription from RNA polymerase II promoter		protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity				0	Lung NSC(77;0.156)					CTACCACTCGGTCCGCCGGCC	0.716													3	6	---	---	---	---	PASS
PKHD1	5314	broad.mit.edu	37	6	51917955	51917955	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51917955G>C	uc003pah.1	-	21	2335	c.2059C>G	c.(2059-2061)CAG>GAG	p.Q687E	PKHD1_uc003pai.2_Missense_Mutation_p.Q687E	NM_138694	NP_619639	P08F94	PKHD1_HUMAN	fibrocystin isoform 1	687	Extracellular (Potential).				cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity			lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)					AGGTTGATCTGATGAACCAGC	0.512													39	79	---	---	---	---	PASS
IL17A	3605	broad.mit.edu	37	6	52054091	52054091	+	3'UTR	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:52054091G>C	uc003pak.1	+	3						NM_002190	NP_002181	Q16552	IL17_HUMAN	interleukin 17A precursor						apoptosis|cell-cell signaling|fibroblast activation|immune response|inflammatory response|positive regulation of interleukin-23 production|positive regulation of osteoclast differentiation|positive regulation of transcription from RNA polymerase II promoter|protein glycosylation	extracellular space	cytokine activity				0	Lung NSC(77;0.116)					TGTGGCCTAAGAGCTCTGGGG	0.592													21	57	---	---	---	---	PASS
GSTA1	2938	broad.mit.edu	37	6	52659012	52659012	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:52659012G>A	uc003paz.2	-	5	437	c.325C>T	c.(325-327)CTG>TTG	p.L109L		NM_145740	NP_665683	P08263	GSTA1_HUMAN	glutathione S-transferase alpha 1	109	GST C-terminal.				glutathione metabolic process|xenobiotic metabolic process	cytosol	glutathione transferase activity			ovary(1)	1	Lung NSC(77;0.118)				Amsacrine(DB00276)|Busulfan(DB01008)|Glutathione(DB00143)	CATACGGGCAGAAGGAGGATC	0.388													73	338	---	---	---	---	PASS
COL21A1	81578	broad.mit.edu	37	6	56044530	56044530	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56044530C>G	uc003pcs.2	-	3	718	c.486G>C	c.(484-486)AAG>AAC	p.K162N	COL21A1_uc003pct.1_RNA|COL21A1_uc011dxi.1_Missense_Mutation_p.K162N|COL21A1_uc003pcu.1_Missense_Mutation_p.K162N	NM_030820	NP_110447	Q96P44	COLA1_HUMAN	collagen, type XXI, alpha 1 precursor	162	VWFA.				cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(2)	2	Lung NSC(77;0.0483)		LUSC - Lung squamous cell carcinoma(124;0.181)			ATAATGTTATCTTACTATCTC	0.423													39	64	---	---	---	---	PASS
DST	667	broad.mit.edu	37	6	56346973	56346973	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56346973C>G	uc003pdf.2	-	84	15077	c.15049G>C	c.(15049-15051)GAG>CAG	p.E5017Q	DST_uc003pcz.3_Missense_Mutation_p.E4839Q|DST_uc011dxj.1_Missense_Mutation_p.E4868Q|DST_uc011dxk.1_Missense_Mutation_p.E4879Q|DST_uc003pcy.3_Missense_Mutation_p.E4513Q	NM_001144769	NP_001138241	Q03001	DYST_HUMAN	dystonin isoform 2	6925	Spectrin 20.				cell adhesion|cell cycle arrest|cell motility|hemidesmosome assembly|integrin-mediated signaling pathway|intermediate filament cytoskeleton organization|maintenance of cell polarity|microtubule cytoskeleton organization|response to wounding	actin cytoskeleton|axon|axon part|basement membrane|cell cortex|cell leading edge|cytoplasmic membrane-bounded vesicle|endoplasmic reticulum membrane|hemidesmosome|hemidesmosome|integral to membrane|intermediate filament|intermediate filament cytoskeleton|microtubule cytoskeleton|microtubule plus end|nuclear envelope|sarcomere|Z disc	actin binding|calcium ion binding|integrin binding|microtubule plus-end binding|protein binding|protein C-terminus binding|protein homodimerization activity			ovary(7)|central_nervous_system(6)|upper_aerodigestive_tract(1)	14	Lung NSC(77;0.103)		LUSC - Lung squamous cell carcinoma(124;0.0485)|Lung(124;0.0956)			TGGAATTCCTCTGCCTAAGAG	0.483													13	53	---	---	---	---	PASS
DST	667	broad.mit.edu	37	6	56497772	56497772	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56497772C>T	uc003pdf.2	-	27	3614	c.3586G>A	c.(3586-3588)GAT>AAT	p.D1196N	DST_uc003pcz.3_Missense_Mutation_p.D1018N|DST_uc011dxj.1_Missense_Mutation_p.D1047N|DST_uc011dxk.1_Missense_Mutation_p.D1058N|DST_uc003pcy.3_Missense_Mutation_p.D692N|DST_uc003pdb.2_Missense_Mutation_p.D692N|DST_uc003pdc.3_Missense_Mutation_p.D692N|DST_uc003pdd.3_Missense_Mutation_p.D692N	NM_001144769	NP_001138241	Q03001	DYST_HUMAN	dystonin isoform 2	1018					cell adhesion|cell cycle arrest|cell motility|hemidesmosome assembly|integrin-mediated signaling pathway|intermediate filament cytoskeleton organization|maintenance of cell polarity|microtubule cytoskeleton organization|response to wounding	actin cytoskeleton|axon|axon part|basement membrane|cell cortex|cell leading edge|cytoplasmic membrane-bounded vesicle|endoplasmic reticulum membrane|hemidesmosome|hemidesmosome|integral to membrane|intermediate filament|intermediate filament cytoskeleton|microtubule cytoskeleton|microtubule plus end|nuclear envelope|sarcomere|Z disc	actin binding|calcium ion binding|integrin binding|microtubule plus-end binding|protein binding|protein C-terminus binding|protein homodimerization activity			ovary(7)|central_nervous_system(6)|upper_aerodigestive_tract(1)	14	Lung NSC(77;0.103)		LUSC - Lung squamous cell carcinoma(124;0.0485)|Lung(124;0.0956)			TCCAGAAAATCTTCAAAACGA	0.358													25	151	---	---	---	---	PASS
PHF3	23469	broad.mit.edu	37	6	64401664	64401664	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:64401664C>T	uc003pep.1	+	4	2253	c.2227C>T	c.(2227-2229)CAT>TAT	p.H743Y	PHF3_uc010kaf.1_Missense_Mutation_p.H743Y|PHF3_uc003pem.2_Missense_Mutation_p.H696Y|PHF3_uc010kag.1_Missense_Mutation_p.H655Y|PHF3_uc010kah.1_Missense_Mutation_p.H557Y|PHF3_uc003pen.2_Missense_Mutation_p.H655Y|PHF3_uc011dxs.1_Missense_Mutation_p.H12Y	NM_015153	NP_055968	Q92576	PHF3_HUMAN	PHD finger protein 3	743	PHD-type.				multicellular organismal development|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(3)|lung(1)|skin(1)	5	all_cancers(3;0.0241)|all_epithelial(2;0.00306)|Lung NSC(77;0.121)		LUSC - Lung squamous cell carcinoma(74;0.0644)|Lung(124;0.148)			TGACTGGTTTCATGGTGATTG	0.373													48	495	---	---	---	---	PASS
PHF3	23469	broad.mit.edu	37	6	64401686	64401686	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:64401686G>T	uc003pep.1	+	4	2275	c.2249G>T	c.(2248-2250)AGT>ATT	p.S750I	PHF3_uc010kaf.1_Missense_Mutation_p.S750I|PHF3_uc003pem.2_Missense_Mutation_p.S703I|PHF3_uc010kag.1_Missense_Mutation_p.S662I|PHF3_uc010kah.1_Missense_Mutation_p.S564I|PHF3_uc003pen.2_Missense_Mutation_p.S662I|PHF3_uc011dxs.1_Missense_Mutation_p.S19I	NM_015153	NP_055968	Q92576	PHF3_HUMAN	PHD finger protein 3	750	PHD-type.				multicellular organismal development|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(3)|lung(1)|skin(1)	5	all_cancers(3;0.0241)|all_epithelial(2;0.00306)|Lung NSC(77;0.121)		LUSC - Lung squamous cell carcinoma(74;0.0644)|Lung(124;0.148)			GTTGGGTTAAGTCTTTCTCAA	0.388													62	449	---	---	---	---	PASS
PHF3	23469	broad.mit.edu	37	6	64408361	64408361	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:64408361G>T	uc003pep.1	+	7	2874	c.2848G>T	c.(2848-2850)GTA>TTA	p.V950L	PHF3_uc010kah.1_Missense_Mutation_p.V764L|PHF3_uc003pen.2_Missense_Mutation_p.V862L|PHF3_uc011dxs.1_Missense_Mutation_p.V219L	NM_015153	NP_055968	Q92576	PHF3_HUMAN	PHD finger protein 3	950	TFIIS central.				multicellular organismal development|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(3)|lung(1)|skin(1)	5	all_cancers(3;0.0241)|all_epithelial(2;0.00306)|Lung NSC(77;0.121)		LUSC - Lung squamous cell carcinoma(74;0.0644)|Lung(124;0.148)			AAATTTGAAGGTACCAGAGGA	0.274													14	172	---	---	---	---	PASS
BAI3	577	broad.mit.edu	37	6	70071177	70071177	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70071177G>T	uc003pev.3	+	29	4460	c.4012G>T	c.(4012-4014)GAA>TAA	p.E1338*	BAI3_uc010kak.2_Nonsense_Mutation_p.E1338*|BAI3_uc011dxx.1_Nonsense_Mutation_p.E544*	NM_001704	NP_001695	O60242	BAI3_HUMAN	brain-specific angiogenesis inhibitor 3	1338	Cytoplasmic (Potential).				negative regulation of angiogenesis|neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(27)|ovary(8)|skin(6)|pancreas(4)|central_nervous_system(3)|urinary_tract(1)|breast(1)	50		all_lung(197;0.212)				CTTGCCGCATGAAAGGCTATT	0.408													21	119	---	---	---	---	PASS
KHDC1	80759	broad.mit.edu	37	6	73951780	73951780	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:73951780C>G	uc003pgo.2	-	4	1013	c.512G>C	c.(511-513)CGA>CCA	p.R171P	KHDC1_uc011dyl.1_RNA|KHDC1_uc003pgn.3_Missense_Mutation_p.R98P	NM_030568	NP_085045	Q4VXA5	KHDC1_HUMAN	KH homology domain containing 1	171						integral to membrane	RNA binding			skin(1)	1						ATACCTACCTCGAGCATGATG	0.517													4	62	---	---	---	---	PASS
COL12A1	1303	broad.mit.edu	37	6	75814930	75814930	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:75814930C>A	uc003phs.2	-	54	8423	c.8257G>T	c.(8257-8259)GGC>TGC	p.G2753C	COL12A1_uc003pht.2_Missense_Mutation_p.G1589C	NM_004370	NP_004361	Q99715	COCA1_HUMAN	collagen, type XII, alpha 1 long isoform	2753	Triple-helical region (COL2) with 1 imperfection.				cell adhesion|collagen fibril organization|skeletal system development	collagen type XII|extracellular space	extracellular matrix structural constituent conferring tensile strength			ovary(6)|large_intestine(1)|breast(1)|skin(1)	9						ACTGCAGGGCCTGGAGGTCCT	0.388													15	87	---	---	---	---	PASS
IMPG1	3617	broad.mit.edu	37	6	76715065	76715065	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76715065C>T	uc003pik.1	-	10	1204	c.1074G>A	c.(1072-1074)CTG>CTA	p.L358L		NM_001563	NP_001554	Q17R60	IMPG1_HUMAN	interphotoreceptor matrix proteoglycan 1	358					visual perception	proteinaceous extracellular matrix	extracellular matrix structural constituent|receptor activity			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(125;0.0418)|all_hematologic(105;0.222)				CTTTGCTGATCAGCCTTTTGA	0.403													42	269	---	---	---	---	PASS
IMPG1	3617	broad.mit.edu	37	6	76715170	76715170	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76715170C>T	uc003pik.1	-	10	1099	c.969G>A	c.(967-969)CTG>CTA	p.L323L		NM_001563	NP_001554	Q17R60	IMPG1_HUMAN	interphotoreceptor matrix proteoglycan 1	323	SEA 1.				visual perception	proteinaceous extracellular matrix	extracellular matrix structural constituent|receptor activity			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(125;0.0418)|all_hematologic(105;0.222)				AATCAAAAGACAGGAGGTCAC	0.448													11	212	---	---	---	---	PASS
DOPEY1	23033	broad.mit.edu	37	6	83847593	83847593	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:83847593G>C	uc003pjs.1	+	21	4092	c.3832G>C	c.(3832-3834)GAA>CAA	p.E1278Q	DOPEY1_uc011dyy.1_Missense_Mutation_p.E1269Q|DOPEY1_uc010kbl.1_Missense_Mutation_p.E1269Q|DOPEY1_uc003pjt.2_RNA	NM_015018	NP_055833	Q5JWR5	DOP1_HUMAN	dopey family member 1	1278					protein transport					ovary(2)|breast(1)|central_nervous_system(1)	4		all_cancers(76;2.29e-06)|Acute lymphoblastic leukemia(125;3.41e-06)|all_hematologic(105;0.000865)|all_epithelial(107;0.00203)		BRCA - Breast invasive adenocarcinoma(397;0.053)		AAAATTATCAGAAAAAGTTTC	0.363													14	94	---	---	---	---	PASS
PRSS35	167681	broad.mit.edu	37	6	84233922	84233922	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:84233922C>G	uc003pjz.2	+	2	925	c.762C>G	c.(760-762)GTC>GTG	p.V254V	PRSS35_uc010kbm.2_Silent_p.V254V	NM_153362	NP_699193	Q8N3Z0	PRS35_HUMAN	protease, serine, 35 precursor	254	Peptidase S1.				proteolysis	extracellular region	serine-type endopeptidase activity			ovary(1)	1		all_cancers(76;0.000113)|Acute lymphoblastic leukemia(125;1.09e-08)|all_hematologic(105;3.12e-05)|all_epithelial(107;0.0575)		BRCA - Breast invasive adenocarcinoma(397;0.0768)		GGACCCGGGTCAAGAATACCC	0.562													12	94	---	---	---	---	PASS
RARS2	57038	broad.mit.edu	37	6	88240595	88240595	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:88240595G>C	uc003pme.2	-	9	738	c.678C>G	c.(676-678)TTC>TTG	p.F226L	RARS2_uc003pmb.2_Missense_Mutation_p.F51L|RARS2_uc003pmc.2_Missense_Mutation_p.F51L|RARS2_uc003pmd.2_5'UTR|RARS2_uc003pmf.2_RNA	NM_020320	NP_064716	Q5T160	SYRM_HUMAN	arginyl-tRNA synthetase 2, mitochondrial	226					arginyl-tRNA aminoacylation	mitochondrial matrix	arginine-tRNA ligase activity|ATP binding|protein binding			ovary(2)|central_nervous_system(1)	3		all_cancers(76;3.93e-06)|Acute lymphoblastic leukemia(125;3.55e-10)|Prostate(29;3.51e-09)|all_hematologic(105;3.29e-06)|all_epithelial(107;0.00575)		BRCA - Breast invasive adenocarcinoma(108;0.0456)		ATCGTTGGAAGAACTCCTGTG	0.383													14	208	---	---	---	---	PASS
UBE2J1	51465	broad.mit.edu	37	6	90039657	90039657	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90039657G>A	uc010kcb.2	-	9	871	c.698C>T	c.(697-699)TCA>TTA	p.S233L	UBE2J1_uc003pnc.2_Missense_Mutation_p.S233L	NM_016021	NP_057105	Q9Y385	UB2J1_HUMAN	ubiquitin-conjugating enzyme E2, J1	233	Cytoplasmic (Potential).					endoplasmic reticulum membrane|integral to membrane	ATP binding|ubiquitin-protein ligase activity				0		all_cancers(76;1.65e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.45e-10)|all_hematologic(105;7.74e-07)|all_epithelial(107;2.5e-05)|Lung NSC(302;0.238)		BRCA - Breast invasive adenocarcinoma(108;0.0139)		GGATGCTGCTGAGGAATTCTG	0.433													8	157	---	---	---	---	PASS
MDN1	23195	broad.mit.edu	37	6	90380769	90380769	+	Missense_Mutation	SNP	G	A	A	rs139168257		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90380769G>A	uc003pnn.1	-	83	13941	c.13825C>T	c.(13825-13827)CGC>TGC	p.R4609C		NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	4609					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)		GGCACCAGGCGCACCAGCAAG	0.428													4	76	---	---	---	---	PASS
GPR63	81491	broad.mit.edu	37	6	97246936	97246936	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:97246936G>A	uc010kcl.2	-	3	1150	c.672C>T	c.(670-672)TCC>TCT	p.S224S	GPR63_uc003pou.2_Silent_p.S224S	NM_001143957	NP_001137429	Q9BZJ6	GPR63_HUMAN	G protein-coupled receptor 63	224	Extracellular (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity|protein binding			upper_aerodigestive_tract(1)|ovary(1)	2		all_cancers(76;6.89e-05)|Acute lymphoblastic leukemia(125;7.02e-10)|all_hematologic(75;1.23e-06)|all_epithelial(107;0.0618)|Colorectal(196;0.0721)		BRCA - Breast invasive adenocarcinoma(108;0.0912)		GGGGAGCTCGGGAAGGTATCT	0.458													29	183	---	---	---	---	PASS
KLHL32	114792	broad.mit.edu	37	6	97423865	97423865	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:97423865C>A	uc010kcm.1	+						KLHL32_uc003poy.2_Intron|KLHL32_uc011ead.1_Intron|KLHL32_uc003poz.2_Intron|KLHL32_uc011eae.1_Intron	NM_052904	NP_443136	Q96NJ5	KLH32_HUMAN	kelch-like 32											ovary(3)|skin(1)	4		all_cancers(76;1.19e-06)|Acute lymphoblastic leukemia(125;5.83e-10)|all_hematologic(75;3.67e-07)|all_epithelial(107;0.00778)|Colorectal(196;0.122)		BRCA - Breast invasive adenocarcinoma(108;0.0558)		GATTGCTCTCCTTTGTAGTAT	0.517													8	71	---	---	---	---	PASS
FBXL4	26235	broad.mit.edu	37	6	99347141	99347141	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:99347141C>G	uc003ppf.1	-						FBXL4_uc003ppg.1_Intron|FBXL4_uc003pph.1_Intron|FBXL4_uc010kcp.2_Intron	NM_012160	NP_036292	Q9UKA2	FBXL4_HUMAN	F-box and leucine-rich repeat protein 4						ubiquitin-dependent protein catabolic process	cytoplasm|nucleus|ubiquitin ligase complex				skin(2)	2		all_cancers(76;1.56e-06)|Acute lymphoblastic leukemia(125;4.93e-10)|all_hematologic(75;3.55e-07)|all_epithelial(107;0.00893)|Colorectal(196;0.069)|Lung NSC(302;0.197)		BRCA - Breast invasive adenocarcinoma(108;0.0413)		GAATTACTCTCACCTCTACTT	0.343													7	174	---	---	---	---	PASS
PRDM13	59336	broad.mit.edu	37	6	100062341	100062341	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:100062341C>G	uc003pqg.1	+	4	2091	c.1830C>G	c.(1828-1830)TTC>TTG	p.F610L		NM_021620	NP_067633	Q9H4Q3	PRD13_HUMAN	PR domain containing 13	610	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(76;1.64e-05)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0128)|Colorectal(196;0.069)|Lung NSC(302;0.186)		BRCA - Breast invasive adenocarcinoma(108;0.0598)		TGCGGCCCTTCGGCGACCCCA	0.617													12	49	---	---	---	---	PASS
ASCC3	10973	broad.mit.edu	37	6	101296127	101296127	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:101296127G>A	uc003pqk.2	-	4	1027	c.698C>T	c.(697-699)TCA>TTA	p.S233L	ASCC3_uc011eai.1_Missense_Mutation_p.S135L|ASCC3_uc003pql.2_Missense_Mutation_p.S233L|ASCC3_uc010kcv.2_Missense_Mutation_p.S233L	NM_006828	NP_006819	Q8N3C0	HELC1_HUMAN	activating signal cointegrator 1 complex subunit	233					regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|microtubule cytoskeleton	ATP binding|ATP-dependent helicase activity|nucleic acid binding			ovary(5)|skin(1)	6		all_cancers(76;1.45e-07)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(87;0.00149)|Hepatocellular(1;0.0893)|Colorectal(196;0.13)		BRCA - Breast invasive adenocarcinoma(108;0.0539)|all cancers(137;0.103)|GBM - Glioblastoma multiforme(226;0.199)		CTTCAAAGTTGAATTTAGGTA	0.393													11	142	---	---	---	---	PASS
SEC63	11231	broad.mit.edu	37	6	108225923	108225923	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:108225923G>A	uc003psc.3	-	11	1233	c.964C>T	c.(964-966)CAG>TAG	p.Q322*	SEC63_uc003psb.3_Nonsense_Mutation_p.Q182*	NM_007214	NP_009145	Q9UGP8	SEC63_HUMAN	SEC63-like protein	322	SEC63 1.|Cytoplasmic (Potential).				protein folding|protein targeting to membrane	endoplasmic reticulum membrane|integral to membrane	heat shock protein binding|receptor activity|unfolded protein binding			ovary(1)|skin(1)	2		all_cancers(87;5.35e-06)|Acute lymphoblastic leukemia(125;2.66e-08)|all_hematologic(75;1.13e-06)|all_epithelial(87;0.00225)|Colorectal(196;0.0294)		BRCA - Breast invasive adenocarcinoma(108;0.0079)|Epithelial(106;0.0356)|all cancers(137;0.0525)|OV - Ovarian serous cystadenocarcinoma(136;0.054)		ATGAATTGCTGATCTGCAAAA	0.363													102	182	---	---	---	---	PASS
CDK19	23097	broad.mit.edu	37	6	110953259	110953259	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:110953259C>A	uc003puh.1	-	6	693	c.620G>T	c.(619-621)GGT>GTT	p.G207V	CDK19_uc003pui.1_Missense_Mutation_p.G147V|CDK19_uc011eax.1_Missense_Mutation_p.G83V	NM_015076	NP_055891	Q9BWU1	CDK19_HUMAN	cell division cycle 2-like 6 (CDK8-like)	207	Protein kinase.						ATP binding|cyclin-dependent protein kinase activity|protein binding			ovary(2)|central_nervous_system(1)|skin(1)	4						ATGCCTTGCACCAAGCAAAAG	0.358													35	144	---	---	---	---	PASS
RFPL4B	442247	broad.mit.edu	37	6	112671663	112671663	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112671663A>G	uc003pvx.1	+	3	1065	c.753A>G	c.(751-753)GGA>GGG	p.G251G		NM_001013734	NP_001013756	Q6ZWI9	RFPLB_HUMAN	ret finger protein-like 4B	251	B30.2/SPRY.						zinc ion binding				0		all_cancers(87;9.44e-05)|all_hematologic(75;0.000114)|all_epithelial(87;0.00265)|Colorectal(196;0.0209)		all cancers(137;0.0202)|OV - Ovarian serous cystadenocarcinoma(136;0.0477)|Epithelial(106;0.0646)|GBM - Glioblastoma multiforme(226;0.0866)|BRCA - Breast invasive adenocarcinoma(108;0.244)		AGCTCTTGGGAGAAGGGGAGA	0.448													45	131	---	---	---	---	PASS
NT5DC1	221294	broad.mit.edu	37	6	116565164	116565164	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:116565164G>C	uc003pwj.2	+	12	1440	c.1345G>C	c.(1345-1347)GAT>CAT	p.D449H	NT5DC1_uc003pwk.2_Missense_Mutation_p.D441H|NT5DC1_uc003pwl.2_Missense_Mutation_p.D399H	NM_152729	NP_689942	Q5TFE4	NT5D1_HUMAN	5'-nucleotidase, cytosolic II-like 1 protein	449							hydrolase activity|metal ion binding				0		all_cancers(87;0.00367)|all_epithelial(87;0.00449)|Colorectal(196;0.0469)		all cancers(137;0.0327)|OV - Ovarian serous cystadenocarcinoma(136;0.0445)|GBM - Glioblastoma multiforme(226;0.0719)|Epithelial(106;0.112)		CTTATCAAGTGATGAGACACT	0.333													17	88	---	---	---	---	PASS
DSE	29940	broad.mit.edu	37	6	116758235	116758235	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:116758235G>A	uc003pws.2	+	6	2798	c.2604G>A	c.(2602-2604)GAG>GAA	p.E868E	DSE_uc011ebg.1_Silent_p.E887E|DSE_uc003pwt.2_Silent_p.E868E|DSE_uc003pwu.2_Silent_p.E535E	NM_001080976	NP_001074445	Q9UL01	DSE_HUMAN	dermatan sulfate epimerase precursor	868					dermatan sulfate biosynthetic process	endoplasmic reticulum|Golgi apparatus|integral to membrane	chondroitin-glucuronate 5-epimerase activity			ovary(1)	1		all_cancers(87;0.00019)|all_epithelial(87;0.000416)|Ovarian(999;0.133)|Colorectal(196;0.234)		Epithelial(106;0.00915)|OV - Ovarian serous cystadenocarcinoma(136;0.0149)|GBM - Glioblastoma multiforme(226;0.0189)|all cancers(137;0.0262)		TAACATACGAGAAACATAAAA	0.428													9	158	---	---	---	---	PASS
ROS1	6098	broad.mit.edu	37	6	117609813	117609813	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:117609813C>T	uc003pxp.1	-	43	7085	c.6886G>A	c.(6886-6888)GAA>AAA	p.E2296K	ROS1_uc011ebi.1_RNA	NM_002944	NP_002935	P08922	ROS_HUMAN	proto-oncogene c-ros-1 protein precursor	2296	Cytoplasmic (Potential).				transmembrane receptor protein tyrosine kinase signaling pathway	membrane fraction|sodium:potassium-exchanging ATPase complex	ATP binding|transmembrane receptor protein tyrosine kinase activity			lung(8)|ovary(6)|central_nervous_system(3)|skin(3)|stomach(2)|breast(2)|large_intestine(1)	25		all_cancers(87;0.00846)|all_epithelial(87;0.0242)		GBM - Glioblastoma multiforme(226;0.0387)|OV - Ovarian serous cystadenocarcinoma(136;0.0954)|all cancers(137;0.137)		GATTCAGATTCCTGGGAGCCT	0.453			T	GOPC|ROS1	glioblastoma|NSCLC								49	108	---	---	---	---	PASS
ROS1	6098	broad.mit.edu	37	6	117706937	117706937	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:117706937T>C	uc003pxp.1	-	15	2412	c.2213A>G	c.(2212-2214)GAG>GGG	p.E738G	ROS1_uc011ebi.1_RNA|GOPC_uc003pxq.1_Intron	NM_002944	NP_002935	P08922	ROS_HUMAN	proto-oncogene c-ros-1 protein precursor	738	Extracellular (Potential).				transmembrane receptor protein tyrosine kinase signaling pathway	membrane fraction|sodium:potassium-exchanging ATPase complex	ATP binding|transmembrane receptor protein tyrosine kinase activity			lung(8)|ovary(6)|central_nervous_system(3)|skin(3)|stomach(2)|breast(2)|large_intestine(1)	25		all_cancers(87;0.00846)|all_epithelial(87;0.0242)		GBM - Glioblastoma multiforme(226;0.0387)|OV - Ovarian serous cystadenocarcinoma(136;0.0954)|all cancers(137;0.137)		GTGATAATTCTCTGAGATATC	0.458			T	GOPC|ROS1	glioblastoma|NSCLC								26	162	---	---	---	---	PASS
TRDN	10345	broad.mit.edu	37	6	123600204	123600204	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:123600204G>A	uc003pzj.1	-	25	1556	c.1534C>T	c.(1534-1536)CCA>TCA	p.P512S	TRDN_uc010kem.1_Missense_Mutation_p.P13S	NM_006073	NP_006064	Q13061	TRDN_HUMAN	triadin	512	Lumenal.				muscle contraction	integral to membrane|plasma membrane|sarcoplasmic reticulum membrane	receptor binding			ovary(1)	1				GBM - Glioblastoma multiforme(226;0.184)		AACATACGTGGAGGTTTAGGC	0.249													13	76	---	---	---	---	PASS
ECHDC1	55862	broad.mit.edu	37	6	127637624	127637624	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:127637624G>A	uc003qax.2	-	4	441	c.405C>T	c.(403-405)TTC>TTT	p.F135F	ECHDC1_uc003qaz.3_Silent_p.F129F|ECHDC1_uc010key.2_Silent_p.F54F|ECHDC1_uc003qay.3_Intron|ECHDC1_uc010kez.2_Intron|ECHDC1_uc010kex.2_Intron	NM_001139510	NP_001132982	Q9NTX5	ECHD1_HUMAN	enoyl Coenzyme A hydratase domain containing 1	135							catalytic activity				0				GBM - Glioblastoma multiforme(226;0.0423)|all cancers(137;0.156)		TGTTTTGCATGAACATGCATA	0.264													7	204	---	---	---	---	PASS
THEMIS	387357	broad.mit.edu	37	6	128150625	128150625	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:128150625C>A	uc003qbi.2	-	4	1024	c.705G>T	c.(703-705)ATG>ATT	p.M235I	THEMIS_uc010kfa.2_Missense_Mutation_p.M138I|THEMIS_uc011ebt.1_Missense_Mutation_p.M235I|THEMIS_uc010kfb.2_Missense_Mutation_p.M200I	NM_001010923	NP_001010923	Q8N1K5	THMS1_HUMAN	thymocyte selection pathway associated isoform	235	CABIT 1.				negative T cell selection|positive T cell selection|T cell receptor signaling pathway	cytoplasm|nucleus				ovary(2)|skin(2)	4						ACTCACATTTCATCACACCTT	0.373													25	126	---	---	---	---	PASS
C6orf191	253582	broad.mit.edu	37	6	130152459	130152459	+	3'UTR	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:130152459A>G	uc003qbs.2	-	5						NM_001010876	NP_001010876	Q5VVB8	CF191_HUMAN	hypothetical protein LOC253582							integral to membrane				large_intestine(1)	1				GBM - Glioblastoma multiforme(226;0.0387)|all cancers(137;0.115)|OV - Ovarian serous cystadenocarcinoma(155;0.131)		TGTGCATTAGAGAATCTAAAC	0.264													6	115	---	---	---	---	PASS
L3MBTL3	84456	broad.mit.edu	37	6	130392204	130392204	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:130392204G>T	uc003qbt.2	+	13	1346	c.1176G>T	c.(1174-1176)ACG>ACT	p.T392T	L3MBTL3_uc003qbu.2_Silent_p.T367T	NM_032438	NP_115814	Q96JM7	LMBL3_HUMAN	l(3)mbt-like 3 isoform a	392	MBT 2.				chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(5)|skin(1)	6				GBM - Glioblastoma multiforme(226;0.0266)|OV - Ovarian serous cystadenocarcinoma(155;0.154)		GTGTTGCTACGGTAACAGATA	0.418													84	431	---	---	---	---	PASS
SAMD3	154075	broad.mit.edu	37	6	130466548	130466548	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:130466548T>C	uc003qbv.2	-	12	1541	c.1215A>G	c.(1213-1215)ACA>ACG	p.T405T	SAMD3_uc003qbx.2_Silent_p.T405T|SAMD3_uc003qbw.2_Silent_p.T405T	NM_001017373	NP_001017373	Q8N6K7	SAMD3_HUMAN	sterile alpha motif domain containing 3 isoform	405										ovary(1)	1				GBM - Glioblastoma multiforme(226;0.00594)|OV - Ovarian serous cystadenocarcinoma(155;0.128)		GGAGTAAACATGTGGCTGTCA	0.368													16	38	---	---	---	---	PASS
EPB41L2	2037	broad.mit.edu	37	6	131186730	131186730	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:131186730T>C	uc003qch.2	-	17	2957	c.2775A>G	c.(2773-2775)GCA>GCG	p.A925A	EPB41L2_uc003qce.1_Silent_p.A303A|EPB41L2_uc003qcf.1_Intron|EPB41L2_uc003qcg.1_Silent_p.A667A|EPB41L2_uc011eby.1_Intron|EPB41L2_uc003qci.2_Silent_p.A772A|EPB41L2_uc010kfk.2_Intron|EPB41L2_uc003qcd.1_Silent_p.A86A	NM_001431	NP_001422	O43491	E41L2_HUMAN	erythrocyte membrane protein band 4.1-like 2	925	Carboxyl-terminal (CTD).				cortical actin cytoskeleton organization	extrinsic to membrane|plasma membrane|spectrin	actin binding|structural molecule activity			central_nervous_system(1)|skin(1)	2	Breast(56;0.0639)			OV - Ovarian serous cystadenocarcinoma(155;0.0271)|GBM - Glioblastoma multiforme(226;0.0355)		TGATGGTTTGTGCGGTCAGTA	0.458													55	102	---	---	---	---	PASS
EPB41L2	2037	broad.mit.edu	37	6	131225642	131225642	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:131225642G>A	uc003qch.2	-	6	1074	c.892C>T	c.(892-894)CCT>TCT	p.P298S	EPB41L2_uc003qcg.1_Missense_Mutation_p.P298S|EPB41L2_uc011eby.1_Missense_Mutation_p.P298S|EPB41L2_uc003qci.2_Missense_Mutation_p.P298S|EPB41L2_uc010kfk.2_Missense_Mutation_p.P298S|EPB41L2_uc010kfl.1_Missense_Mutation_p.P298S	NM_001431	NP_001422	O43491	E41L2_HUMAN	erythrocyte membrane protein band 4.1-like 2	298	FERM.				cortical actin cytoskeleton organization	extrinsic to membrane|plasma membrane|spectrin	actin binding|structural molecule activity			central_nervous_system(1)|skin(1)	2	Breast(56;0.0639)			OV - Ovarian serous cystadenocarcinoma(155;0.0271)|GBM - Glioblastoma multiforme(226;0.0355)		GGATCAGGAGGATAAAACTTC	0.328													26	128	---	---	---	---	PASS
TAAR9	134860	broad.mit.edu	37	6	132859711	132859711	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132859711G>T	uc011eci.1	+	2	285	c.283G>T	c.(283-285)GAG>TAG	p.E95*		NM_175057	NP_778227	Q96RI9	TAAR9_HUMAN	trace amine associated receptor 9	95	Extracellular (Potential).					plasma membrane	G-protein coupled receptor activity				0	Breast(56;0.112)			OV - Ovarian serous cystadenocarcinoma(155;0.0042)|GBM - Glioblastoma multiforme(226;0.00816)		GAGGTCTGTGGAGAGCTGTTG	0.448													40	162	---	---	---	---	PASS
TAAR8	83551	broad.mit.edu	37	6	132874080	132874080	+	Silent	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132874080T>A	uc011ecj.1	+	1	249	c.249T>A	c.(247-249)ACT>ACA	p.T83T		NM_053278	NP_444508	Q969N4	TAAR8_HUMAN	trace amine associated receptor 8	83	Helical; Name=2; (Potential).					plasma membrane	G-protein coupled receptor activity			ovary(1)	1	Breast(56;0.112)			OV - Ovarian serous cystadenocarcinoma(155;0.00412)|GBM - Glioblastoma multiforme(226;0.00792)		TAGGTGTGACTGTGATGCTTT	0.443													47	256	---	---	---	---	PASS
TAAR2	9287	broad.mit.edu	37	6	132939116	132939116	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132939116G>C	uc003qdl.1	-	2	229	c.229C>G	c.(229-231)CCA>GCA	p.P77A	TAAR2_uc010kfr.1_Missense_Mutation_p.P32A	NM_001033080	NP_001028252	Q9P1P5	TAAR2_HUMAN	trace amine associated receptor 2 isoform 1	77	Cytoplasmic (Potential).					plasma membrane	G-protein coupled receptor activity			ovary(1)	1	Breast(56;0.135)			OV - Ovarian serous cystadenocarcinoma(155;0.00608)|GBM - Glioblastoma multiforme(226;0.0151)		AAGTTGGTTGGTGTGTGAAGC	0.428													30	137	---	---	---	---	PASS
VNN3	55350	broad.mit.edu	37	6	133044865	133044865	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:133044865C>A	uc003qdp.2	-						VNN3_uc010kfs.2_Intron|VNN3_uc011ecl.1_Intron|VNN3_uc011ecm.1_Intron|VNN3_uc011ecn.1_Intron|VNN3_uc010kfu.2_Intron|VNN3_uc010kfv.2_Intron|VNN3_uc010kfw.2_Intron|VNN3_uc010kfx.2_Intron|VNN3_uc010kfy.2_Intron|VNN3_uc010kfz.2_Missense_Mutation_p.G170V	NM_078625	NP_523239			SubName: Full=PAGEL-beta;												0	Breast(56;0.135)			OV - Ovarian serous cystadenocarcinoma(155;0.00242)|GBM - Glioblastoma multiforme(226;0.0168)		ATCCTGCACACCTCCTACCTC	0.423													3	43	---	---	---	---	PASS
C6orf192	116843	broad.mit.edu	37	6	133100505	133100505	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:133100505C>G	uc003qdw.1	-	7	849	c.697G>C	c.(697-699)GCT>CCT	p.A233P	C6orf192_uc010kgd.1_RNA|C6orf192_uc011eco.1_Missense_Mutation_p.A107P	NM_052831	NP_439896	Q6NT16	CF192_HUMAN	hypothetical protein LOC116843	233	Helical; (Potential).				transmembrane transport	integral to membrane				ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(155;0.00303)|GBM - Glioblastoma multiforme(226;0.0265)		TTGGGTAAAGCGATCAGTTTC	0.373													57	153	---	---	---	---	PASS
AHI1	54806	broad.mit.edu	37	6	135769471	135769471	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:135769471G>A	uc003qgi.2	-	12	1967	c.1583C>T	c.(1582-1584)TCA>TTA	p.S528L	AHI1_uc003qgg.2_5'UTR|AHI1_uc003qgh.2_Missense_Mutation_p.S528L|AHI1_uc003qgj.2_Missense_Mutation_p.S528L|AHI1_uc003qgk.3_RNA|AHI1_uc003qgl.3_Missense_Mutation_p.S528L	NM_001134831	NP_001128303	Q8N157	AHI1_HUMAN	Abelson helper integration site 1 isoform a	528						adherens junction|cilium|microtubule basal body				ovary(1)|kidney(1)|central_nervous_system(1)	3	Breast(56;0.239)|Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00904)|OV - Ovarian serous cystadenocarcinoma(155;0.00991)		GTACAGTGTTGATGGGTAATG	0.383													10	76	---	---	---	---	PASS
HECA	51696	broad.mit.edu	37	6	139487561	139487561	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:139487561G>C	uc003qin.2	+	2	697	c.412G>C	c.(412-414)GAG>CAG	p.E138Q		NM_016217	NP_057301	Q9UBI9	HDC_HUMAN	headcase	138					respiratory tube development						0				GBM - Glioblastoma multiforme(68;0.000252)|OV - Ovarian serous cystadenocarcinoma(155;0.000387)		CTACGAGTGGGAGAGCAGCAT	0.602													16	131	---	---	---	---	PASS
HIVEP2	3097	broad.mit.edu	37	6	143092476	143092476	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:143092476C>A	uc003qjd.2	-	5	4143	c.3400G>T	c.(3400-3402)GAC>TAC	p.D1134Y		NM_006734	NP_006725	P31629	ZEP2_HUMAN	human immunodeficiency virus type I enhancer	1134					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)|skin(2)|central_nervous_system(1)	6				OV - Ovarian serous cystadenocarcinoma(155;1.61e-05)|GBM - Glioblastoma multiforme(68;0.0102)		TTCCCTGGGTCCTCTTGCTGA	0.642													40	83	---	---	---	---	PASS
LTV1	84946	broad.mit.edu	37	6	144183253	144183253	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144183253G>A	uc003qjs.2	+	8	1043	c.936G>A	c.(934-936)TTG>TTA	p.L312L	LTV1_uc003qju.1_Silent_p.L97L|C6orf94_uc010khj.2_Intron|C6orf94_uc010khk.2_5'Flank|C6orf94_uc011edy.1_5'Flank	NM_032860	NP_116249	Q96GA3	LTV1_HUMAN	LTV1 homolog	312										ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(155;2.72e-06)|GBM - Glioblastoma multiforme(68;0.0372)		GTGTAAAATTGAATACCCTTG	0.373													42	88	---	---	---	---	PASS
UTRN	7402	broad.mit.edu	37	6	144835108	144835108	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144835108C>G	uc003qkt.2	+	35	5100	c.5008C>G	c.(5008-5010)CAA>GAA	p.Q1670E		NM_007124	NP_009055	P46939	UTRO_HUMAN	utrophin	1670	Interaction with SYNM.|Spectrin 12.				muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)		CTGGCTTTATCAAGCTGAAGC	0.368													20	136	---	---	---	---	PASS
UTRN	7402	broad.mit.edu	37	6	144843120	144843120	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144843120T>G	uc003qkt.2	+	39	5638	c.5546T>G	c.(5545-5547)ATC>AGC	p.I1849S		NM_007124	NP_009055	P46939	UTRO_HUMAN	utrophin	1849					muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)		TTGTAGGCAATCCCTATTCAA	0.299													8	191	---	---	---	---	PASS
PLEKHG1	57480	broad.mit.edu	37	6	151121996	151121996	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151121996C>G	uc003qny.1	+	7	1083	c.771C>G	c.(769-771)CTC>CTG	p.L257L	PLEKHG1_uc011eel.1_Silent_p.L297L|PLEKHG1_uc011eem.1_Silent_p.L316L|PLEKHG1_uc003qnz.2_Silent_p.L257L	NM_001029884	NP_001025055	Q9ULL1	PKHG1_HUMAN	pleckstrin homology domain containing, family G	257	DH.				regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			ovary(2)	2			BRCA - Breast invasive adenocarcinoma(37;0.0923)	OV - Ovarian serous cystadenocarcinoma(155;6.69e-13)		AGTATCATCTCCTTCTGCATG	0.453													18	177	---	---	---	---	PASS
PLEKHG1	57480	broad.mit.edu	37	6	151161515	151161515	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151161515C>G	uc003qny.1	+	17	3953	c.3641C>G	c.(3640-3642)TCA>TGA	p.S1214*	PLEKHG1_uc011eem.1_Nonsense_Mutation_p.S1273*	NM_001029884	NP_001025055	Q9ULL1	PKHG1_HUMAN	pleckstrin homology domain containing, family G	1214					regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			ovary(2)	2			BRCA - Breast invasive adenocarcinoma(37;0.0923)	OV - Ovarian serous cystadenocarcinoma(155;6.69e-13)		CACAGAAGTTCAAGGTGTGAG	0.468													14	251	---	---	---	---	PASS
ZBTB2	57621	broad.mit.edu	37	6	151686676	151686676	+	Missense_Mutation	SNP	C	T	T	rs143773461		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151686676C>T	uc003qoh.2	-	3	1660	c.1525G>A	c.(1525-1527)GAA>AAA	p.E509K		NM_020861	NP_065912	Q8N680	ZBTB2_HUMAN	zinc finger and BTB domain containing 2	509					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding	p.E509K(1)		skin(1)	1			BRCA - Breast invasive adenocarcinoma(37;0.175)	OV - Ovarian serous cystadenocarcinoma(155;2.63e-11)		AAGACGGTTTCTTGTTCCTTT	0.443													49	249	---	---	---	---	PASS
C6orf97	80129	broad.mit.edu	37	6	151936728	151936728	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151936728A>G	uc003qol.2	+	10	1950	c.1861A>G	c.(1861-1863)AGG>GGG	p.R621G		NM_025059	NP_079335	Q8IYT3	CF097_HUMAN	hypothetical protein LOC80129	621	Potential.										0		Ovarian(120;0.126)	BRCA - Breast invasive adenocarcinoma(37;0.111)	OV - Ovarian serous cystadenocarcinoma(155;1.48e-10)		GAATAAAGAAAGGGCCAGAAA	0.408													40	178	---	---	---	---	PASS
SYNE1	23345	broad.mit.edu	37	6	152614876	152614876	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152614876C>T	uc010kiw.2	-	95	18461	c.17859G>A	c.(17857-17859)GAG>GAA	p.E5953E	SYNE1_uc010kiv.2_Silent_p.E477E|SYNE1_uc003qos.3_Silent_p.E477E|SYNE1_uc003qot.3_Silent_p.E5882E|SYNE1_uc003qou.3_Silent_p.E5953E|SYNE1_uc010kiy.1_Silent_p.E128E	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	5953	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)		TGCGCTGCTTCTCACTGATCT	0.473										HNSCC(10;0.0054)			82	152	---	---	---	---	PASS
SYNE1	23345	broad.mit.edu	37	6	152671299	152671299	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152671299G>C	uc010kiw.2	-						SYNE1_uc003qot.3_Intron|SYNE1_uc003qou.3_Intron|SYNE1_uc010kja.1_Intron	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1						cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)		AAGGTCAGGGGTACCTTGTGG	0.438										HNSCC(10;0.0054)			14	98	---	---	---	---	PASS
SYNE1	23345	broad.mit.edu	37	6	152697651	152697651	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152697651C>A	uc010kiw.2	-	58	9791	c.9189G>T	c.(9187-9189)CAG>CAT	p.Q3063H	SYNE1_uc003qot.3_Missense_Mutation_p.Q3070H|SYNE1_uc003qou.3_Missense_Mutation_p.Q3063H|SYNE1_uc010kja.1_5'UTR|SYNE1_uc003qov.2_Missense_Mutation_p.Q141H|SYNE1_uc010kjb.1_3'UTR	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	3063	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)		GCTGTAAAATCTGTTCTTTAT	0.383										HNSCC(10;0.0054)			51	78	---	---	---	---	PASS
SYNE1	23345	broad.mit.edu	37	6	152831423	152831423	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152831423C>T	uc010kiw.2	-	8	1088	c.486G>A	c.(484-486)GAG>GAA	p.E162E	SYNE1_uc003qot.3_Silent_p.E169E|SYNE1_uc003qou.3_Silent_p.E162E|SYNE1_uc010kjb.1_Silent_p.E162E|SYNE1_uc003qpa.1_Silent_p.E162E	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	162	Actin-binding.|Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)		GGCTGGGAGTCTCAGAGCTAA	0.493										HNSCC(10;0.0054)			50	229	---	---	---	---	PASS
CLDN20	49861	broad.mit.edu	37	6	155597295	155597295	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:155597295C>T	uc003qql.1	+	2	822	c.442C>T	c.(442-444)CTG>TTG	p.L148L	TFB1M_uc003qqj.3_Intron|TFB1M_uc003qqk.2_Intron	NM_001001346	NP_001001346	P56880	CLD20_HUMAN	claudin 20	148	Extracellular (Potential).				calcium-independent cell-cell adhesion|tight junction assembly	integral to membrane|tight junction	identical protein binding|structural molecule activity				0				OV - Ovarian serous cystadenocarcinoma(155;7.82e-13)|BRCA - Breast invasive adenocarcinoma(81;0.0114)		AGCAAACTTTCTGGATCTGAC	0.423													8	164	---	---	---	---	PASS
ARID1B	57492	broad.mit.edu	37	6	157511333	157511333	+	Missense_Mutation	SNP	G	T	T	rs149389876		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:157511333G>T	uc003qqn.2	+	15	3949	c.3797G>T	c.(3796-3798)GGA>GTA	p.G1266V	ARID1B_uc003qqo.2_Missense_Mutation_p.G1226V|ARID1B_uc003qqp.2_Missense_Mutation_p.G1213V	NM_017519	NP_059989	Q8NFD5	ARI1B_HUMAN	AT rich interactive domain 1B (SWI1-like)	1271					chromatin-mediated maintenance of transcription|nervous system development|transcription, DNA-dependent	SWI/SNF complex	DNA binding|protein binding|transcription coactivator activity			ovary(1)|breast(1)	2		Breast(66;0.000162)|Ovarian(120;0.0265)		OV - Ovarian serous cystadenocarcinoma(65;3.19e-17)|BRCA - Breast invasive adenocarcinoma(81;1.01e-05)		CCCTTTGGGGGAATGAGAAAA	0.562													4	137	---	---	---	---	PASS
ARID1B	57492	broad.mit.edu	37	6	157527676	157527676	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:157527676G>C	uc003qqn.2	+	20	5499	c.5347G>C	c.(5347-5349)GAC>CAC	p.D1783H	ARID1B_uc003qqo.2_Missense_Mutation_p.D1743H|ARID1B_uc003qqp.2_Missense_Mutation_p.D1730H	NM_017519	NP_059989	Q8NFD5	ARI1B_HUMAN	AT rich interactive domain 1B (SWI1-like)	1788					chromatin-mediated maintenance of transcription|nervous system development|transcription, DNA-dependent	SWI/SNF complex	DNA binding|protein binding|transcription coactivator activity			ovary(1)|breast(1)	2		Breast(66;0.000162)|Ovarian(120;0.0265)		OV - Ovarian serous cystadenocarcinoma(65;3.19e-17)|BRCA - Breast invasive adenocarcinoma(81;1.01e-05)		GTTTGTTGTTGACCGATCTGA	0.537													134	349	---	---	---	---	PASS
IGF2R	3482	broad.mit.edu	37	6	160469408	160469408	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:160469408C>G	uc003qta.2	+	18	2495	c.2347C>G	c.(2347-2349)CTG>GTG	p.L783V		NM_000876	NP_000867	P11717	MPRI_HUMAN	insulin-like growth factor 2 receptor precursor	783	5.|Lumenal (Potential).				receptor-mediated endocytosis	cell surface|endocytic vesicle|endosome|integral to plasma membrane|lysosomal membrane|trans-Golgi network transport vesicle	glycoprotein binding|insulin-like growth factor receptor activity|phosphoprotein binding|transporter activity			ovary(3)	3		Breast(66;0.000777)|Ovarian(120;0.0305)		OV - Ovarian serous cystadenocarcinoma(65;2.45e-17)|BRCA - Breast invasive adenocarcinoma(81;1.09e-05)		AAATTTTAGTCTGGCAAAATC	0.393													7	126	---	---	---	---	PASS
C6orf118	168090	broad.mit.edu	37	6	165715321	165715321	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:165715321G>C	uc003qum.3	-	2	526	c.490C>G	c.(490-492)CCT>GCT	p.P164A	C6orf118_uc011egi.1_RNA	NM_144980	NP_659417	Q5T5N4	CF118_HUMAN	hypothetical protein LOC168090	164											0		Breast(66;6.27e-05)|Ovarian(120;0.0228)|Prostate(117;0.0906)|all_neural(5;0.157)		OV - Ovarian serous cystadenocarcinoma(33;3.23e-18)|BRCA - Breast invasive adenocarcinoma(81;3.11e-06)|GBM - Glioblastoma multiforme(31;0.000313)		CCCCGTCCAGGAGGGCCTCCT	0.617													46	108	---	---	---	---	PASS
PRKAR1B	5575	broad.mit.edu	37	7	590102	590102	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:590102G>T	uc003siu.1	-	12	1217	c.1111C>A	c.(1111-1113)CAG>AAG	p.Q371K	PRKAR1B_uc003siv.2_Missense_Mutation_p.Q371K|PRKAR1B_uc003siw.1_Missense_Mutation_p.Q371K	NM_002735	NP_002726	P31321	KAP1_HUMAN	protein kinase, cAMP-dependent, regulatory, type	371	cAMP 2.				activation of phospholipase C activity|activation of protein kinase A activity|blood coagulation|cellular response to glucagon stimulus|energy reserve metabolic process|nerve growth factor receptor signaling pathway|protein phosphorylation|regulation of insulin secretion|transmembrane transport|water transport	cAMP-dependent protein kinase complex|cytosol	cAMP binding|cAMP-dependent protein kinase regulator activity				0		Ovarian(82;0.0779)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0181)|Epithelial(4;5.75e-19)|OV - Ovarian serous cystadenocarcinoma(56;2.01e-18)|all cancers(6;3.96e-16)|BRCA - Breast invasive adenocarcinoma(126;0.152)		TTGTAACGCTGAATGTTCCTC	0.652													10	17	---	---	---	---	PASS
C7orf50	84310	broad.mit.edu	37	7	1040111	1040111	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:1040111C>A	uc003sju.2	-	4	470	c.400G>T	c.(400-402)GAC>TAC	p.D134Y	C7orf50_uc003sjs.2_RNA|C7orf50_uc011jvt.1_Missense_Mutation_p.D134Y|C7orf50_uc011jvu.1_Missense_Mutation_p.D134Y	NM_032350	NP_115726	Q9BRJ6	CG050_HUMAN	hypothetical protein LOC84310	134							protein binding				0		Ovarian(82;0.0779)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0216)|OV - Ovarian serous cystadenocarcinoma(56;1.3e-15)		CACACCTTGTCACTGTCATAC	0.612													12	23	---	---	---	---	PASS
CHST12	55501	broad.mit.edu	37	7	2472883	2472883	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2472883G>A	uc003smc.2	+	2	744	c.609G>A	c.(607-609)CCG>CCA	p.P203P	CHST12_uc003smd.2_Silent_p.P203P	NM_018641	NP_061111	Q9NRB3	CHSTC_HUMAN	carbohydrate sulfotransferase 12	203	Lumenal (Potential).				dermatan sulfate biosynthetic process	integral to Golgi membrane	3'-phosphoadenosine 5'-phosphosulfate binding|chondroitin 4-sulfotransferase activity|protein binding			kidney(1)	1		Ovarian(82;0.0253)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0847)|OV - Ovarian serous cystadenocarcinoma(56;2.25e-13)		TGCGCATCCCGCGCGAGCACG	0.657													35	68	---	---	---	---	PASS
GNA12	2768	broad.mit.edu	37	7	2771177	2771177	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2771177T>G	uc003smu.2	-	4	948	c.784A>C	c.(784-786)ATG>CTG	p.M262L	GNA12_uc011jwb.1_Missense_Mutation_p.M245L|GNA12_uc003smt.2_Missense_Mutation_p.M203L	NM_007353	NP_031379	Q03113	GNA12_HUMAN	guanine nucleotide binding protein (G protein)	262					G-protein signaling, coupled to cAMP nucleotide second messenger|platelet activation|Rho protein signal transduction	brush border membrane|heterotrimeric G-protein complex	D5 dopamine receptor binding|G-protein beta/gamma-subunit complex binding|GTP binding|GTPase activity|signal transducer activity			ovary(1)	1		Ovarian(82;0.0112)		OV - Ovarian serous cystadenocarcinoma(56;1.02e-13)		CTGTCCTCCATGAGGACCTGG	0.577													82	243	---	---	---	---	PASS
THSD7A	221981	broad.mit.edu	37	7	11485806	11485806	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:11485806C>A	uc003ssf.3	-	13	3198	c.2946G>T	c.(2944-2946)TTG>TTT	p.L982F		NM_015204	NP_056019	Q9UPZ6	THS7A_HUMAN	thrombospondin, type I, domain containing 7A	982	TSP type-1 10.|Extracellular (Potential).					integral to membrane				ovary(3)	3				UCEC - Uterine corpus endometrioid carcinoma (126;0.163)		TCATTCCCAGCAACACTTCCA	0.443										HNSCC(18;0.044)			16	310	---	---	---	---	PASS
KLHL7	55975	broad.mit.edu	37	7	23163419	23163419	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:23163419C>T	uc003svs.3	+	2	437	c.144C>T	c.(142-144)CTC>CTT	p.L48L	KLHL7_uc003svr.3_Silent_p.L26L|KLHL7_uc011jys.1_Intron|KLHL7_uc011jyt.1_Intron|KLHL7_uc003svt.2_5'UTR|KLHL7_uc003svp.2_Silent_p.L26L|KLHL7_uc003svq.2_Silent_p.L48L|KLHL7_uc011jyu.1_Silent_p.L26L	NM_001031710	NP_001026880	Q8IXQ5	KLHL7_HUMAN	kelch-like 7 isoform 1	48	BTB.					Golgi apparatus|nucleolus|plasma membrane					0						ACGTGATCCTCATGGTCCAGG	0.368													8	123	---	---	---	---	PASS
STK31	56164	broad.mit.edu	37	7	23854829	23854829	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:23854829C>G	uc003sws.3	+	23	2894	c.2827C>G	c.(2827-2829)CTG>GTG	p.L943V	STK31_uc003swt.3_Missense_Mutation_p.L920V|STK31_uc011jze.1_Intron|STK31_uc010kuq.2_Missense_Mutation_p.L920V|STK31_uc003swv.1_Missense_Mutation_p.L109V	NM_031414	NP_113602	Q9BXU1	STK31_HUMAN	serine/threonine kinase 31 isoform a	943	Protein kinase.						ATP binding|nucleic acid binding|protein serine/threonine kinase activity			skin(3)|lung(2)|ovary(2)|stomach(2)	9						TCAGTTTCATCTGGTATGTGA	0.338													4	97	---	---	---	---	PASS
SNX10	29887	broad.mit.edu	37	7	26411513	26411513	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:26411513A>T	uc003sxx.2	+	6	599	c.384A>T	c.(382-384)GAA>GAT	p.E128D	SNX10_uc011jzg.1_Missense_Mutation_p.E151D|SNX10_uc010kuu.2_Missense_Mutation_p.E128D|SNX10_uc010kuv.2_Missense_Mutation_p.E124D|SNX10_uc010kuw.2_Missense_Mutation_p.E44D	NM_013322	NP_037454	Q9Y5X0	SNX10_HUMAN	sorting nexin 10	128					cell communication|endosome organization|protein transport	extrinsic to endosome membrane	1-phosphatidylinositol binding				0						TGAATTCAGAAGACATTGAGG	0.383													155	139	---	---	---	---	PASS
HOXA3	3200	broad.mit.edu	37	7	27148056	27148056	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27148056G>A	uc011jzl.1	-	3	1010	c.810C>T	c.(808-810)CCC>CCT	p.P270P	HOXA3_uc011jzk.1_Silent_p.P112P|HOXA3_uc003syk.2_Silent_p.P270P	NM_030661	NP_109377	O43365	HXA3_HUMAN	homeobox A3 isoform a	270					angiogenesis	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			breast(2)	2						CGGCTCCGGGGGGCACGGGGC	0.617													70	74	---	---	---	---	PASS
CHN2	1124	broad.mit.edu	37	7	29407588	29407588	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:29407588C>G	uc003szz.2	+	3	566	c.129C>G	c.(127-129)ATC>ATG	p.I43M	CHN2_uc011jzs.1_Missense_Mutation_p.I118M|CHN2_uc010kva.2_Intron|CHN2_uc010kvb.2_RNA|CHN2_uc010kvc.2_Intron|CHN2_uc011jzt.1_Missense_Mutation_p.I56M|CHN2_uc010kvd.2_Missense_Mutation_p.I43M|CHN2_uc011jzu.1_Missense_Mutation_p.I28M	NM_004067	NP_004058	P52757	CHIO_HUMAN	beta chimerin isoform 2	43					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|membrane	GTPase activator activity|metal ion binding|SH3/SH2 adaptor activity			ovary(2)	2						CCAAGAGAATCATTTGTCCTC	0.403													7	104	---	---	---	---	PASS
FAM188B	84182	broad.mit.edu	37	7	30890105	30890105	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30890105G>A	uc003tbt.2	+	10	1558	c.1481G>A	c.(1480-1482)TGC>TAC	p.C494Y	FAM188B_uc010kwe.2_Missense_Mutation_p.C465Y|AQP1_uc011kac.1_5'Flank	NM_032222	NP_115598	Q4G0A6	F188B_HUMAN	hypothetical protein LOC84182	494											0						CGGACCCGCTGCCTCGTCCTG	0.602													4	30	---	---	---	---	PASS
BMPER	168667	broad.mit.edu	37	7	34125511	34125511	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:34125511G>C	uc011kap.1	+	13	1666	c.1552G>C	c.(1552-1554)GAT>CAT	p.D518H		NM_133468	NP_597725	Q8N8U9	BMPER_HUMAN	BMP-binding endothelial regulator precursor	518	VWFD.				blood vessel endothelial cell proliferation involved in sprouting angiogenesis|endothelial cell activation|negative regulation of BMP signaling pathway|positive regulation of ERK1 and ERK2 cascade|regulation of endothelial cell migration|regulation of pathway-restricted SMAD protein phosphorylation	extracellular space				ovary(2)|central_nervous_system(1)	3						CTTCAAGTTTGATGTGGATGA	0.483													12	107	---	---	---	---	PASS
CDK13	8621	broad.mit.edu	37	7	40102671	40102671	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:40102671C>G	uc003thh.3	+	9	3034	c.2752C>G	c.(2752-2754)CAG>GAG	p.Q918E	CDK13_uc003thi.3_Missense_Mutation_p.Q918E|CDK13_uc011kbf.1_Missense_Mutation_p.Q304E|CDK13_uc003thj.2_Translation_Start_Site	NM_003718	NP_003709	Q14004	CDK13_HUMAN	cell division cycle 2-like 5 isoform 1	918	Protein kinase.				alternative nuclear mRNA splicing, via spliceosome|hemopoiesis|interspecies interaction between organisms|phosphorylation of RNA polymerase II C-terminal domain|positive regulation of cell proliferation|regulation of mitosis	nuclear cyclin-dependent protein kinase holoenzyme complex|nuclear speck	ATP binding|cyclin-dependent protein kinase activity|protein binding|RNA polymerase II carboxy-terminal domain kinase activity			lung(2)|skin(2)|ovary(1)	5						TCAAGCAAATCAGGAACTTGC	0.353													61	82	---	---	---	---	PASS
CDK13	8621	broad.mit.edu	37	7	40134200	40134200	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:40134200C>T	uc003thh.3	+	14	4442	c.4160C>T	c.(4159-4161)TCT>TTT	p.S1387F	CDK13_uc003thi.3_Missense_Mutation_p.S1327F|CDK13_uc003thj.2_Missense_Mutation_p.S438F|CDK13_uc003thk.2_Missense_Mutation_p.S320F	NM_003718	NP_003709	Q14004	CDK13_HUMAN	cell division cycle 2-like 5 isoform 1	1387					alternative nuclear mRNA splicing, via spliceosome|hemopoiesis|interspecies interaction between organisms|phosphorylation of RNA polymerase II C-terminal domain|positive regulation of cell proliferation|regulation of mitosis	nuclear cyclin-dependent protein kinase holoenzyme complex|nuclear speck	ATP binding|cyclin-dependent protein kinase activity|protein binding|RNA polymerase II carboxy-terminal domain kinase activity			lung(2)|skin(2)|ovary(1)	5						TCATCTCATTCTGGTGGTCCA	0.443													191	260	---	---	---	---	PASS
ADCY1	107	broad.mit.edu	37	7	45688386	45688386	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:45688386G>A	uc003tne.3	+	5	1156	c.1138G>A	c.(1138-1140)GAT>AAT	p.D380N	ADCY1_uc003tnd.2_Missense_Mutation_p.D155N	NM_021116	NP_066939	Q08828	ADCY1_HUMAN	adenylate cyclase 1	380	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|synaptic transmission|transmembrane transport|water transport	integral to membrane|plasma membrane	ATP binding|calcium- and calmodulin-responsive adenylate cyclase activity|calmodulin binding|metal ion binding			ovary(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	6					Adenosine(DB00640)|Adenosine monophosphate(DB00131)|Adenosine triphosphate(DB00171)	CGACATGATTGATACCATCAC	0.567													4	70	---	---	---	---	PASS
PKD1L1	168507	broad.mit.edu	37	7	47840425	47840425	+	Missense_Mutation	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:47840425A>C	uc003tny.1	-	54	8015	c.8015T>G	c.(8014-8016)CTC>CGC	p.L2672R	C7orf69_uc003tnz.3_Intron|C7orf69_uc003toa.1_Intron	NM_138295	NP_612152	Q8TDX9	PK1L1_HUMAN	polycystin-1L1	2672	Extracellular (Potential).				cell-cell adhesion	integral to membrane				ovary(8)|upper_aerodigestive_tract(2)|breast(1)	11						CCACATAGAGAGCAGAAATCG	0.552													23	137	---	---	---	---	PASS
EGFR	1956	broad.mit.edu	37	7	55220237	55220237	+	Splice_Site	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:55220237A>G	uc003tqk.2	+	6	875	c.629_splice	c.e6-2	p.L210_splice	EGFR_uc003tqh.2_Splice_Site_p.L210_splice|EGFR_uc003tqi.2_Splice_Site_p.L210_splice|EGFR_uc003tqj.2_Splice_Site_p.L210_splice|EGFR_uc010kzg.1_Splice_Site_p.L165_splice|EGFR_uc011kco.1_Splice_Site_p.L157_splice|EGFR_uc003tql.1_RNA	NM_005228	NP_005219	P00533	EGFR_HUMAN	epidermal growth factor receptor isoform a						activation of phospholipase A2 activity by calcium-mediated signaling|activation of phospholipase C activity|axon guidance|cell proliferation|cell-cell adhesion|negative regulation of apoptosis|negative regulation of epidermal growth factor receptor signaling pathway|ossification|positive regulation of catenin import into nucleus|positive regulation of cell migration|positive regulation of cyclin-dependent protein kinase activity involved in G1/S|positive regulation of epithelial cell proliferation|positive regulation of MAP kinase activity|positive regulation of nitric oxide biosynthetic process|positive regulation of phosphorylation|positive regulation of protein kinase B signaling cascade|protein autophosphorylation|protein insertion into membrane|regulation of nitric-oxide synthase activity|regulation of peptidyl-tyrosine phosphorylation|response to stress|response to UV-A	basolateral plasma membrane|endoplasmic reticulum membrane|endosome|extracellular space|Golgi membrane|integral to membrane|nuclear membrane|Shc-EGFR complex	actin filament binding|ATP binding|double-stranded DNA binding|epidermal growth factor receptor activity|identical protein binding|MAP/ERK kinase kinase activity|protein heterodimerization activity|protein phosphatase binding|receptor signaling protein tyrosine kinase activity			lung(9213)|central_nervous_system(103)|stomach(41)|upper_aerodigestive_tract(39)|prostate(32)|ovary(31)|thyroid(24)|breast(11)|peritoneum(9)|oesophagus(9)|salivary_gland(9)|large_intestine(8)|kidney(8)|urinary_tract(6)|skin(5)|adrenal_gland(5)|soft_tissue(4)|bone(3)|NS(2)|pancreas(2)|haematopoietic_and_lymphoid_tissue(2)|thymus(2)|liver(2)|eye(1)	9571	all_cancers(1;1.57e-46)|all_epithelial(1;5.62e-37)|Lung NSC(1;9.29e-25)|all_lung(1;4.39e-23)|Esophageal squamous(2;7.55e-08)|Breast(14;0.0318)		GBM - Glioblastoma multiforme(1;0)|all cancers(1;2.19e-314)|Lung(13;4.65e-05)|LUSC - Lung squamous cell carcinoma(13;0.000168)|STAD - Stomach adenocarcinoma(5;0.00164)|Epithelial(13;0.0607)		Cetuximab(DB00002)|Erlotinib(DB00530)|Gefitinib(DB00317)|Lapatinib(DB01259)|Lidocaine(DB00281)|Panitumumab(DB01269)|Trastuzumab(DB00072)	GCTCTTTTTCAGTGACCAAAA	0.547		8	A|O|Mis		glioma|NSCLC	NSCLC			Lung_Cancer_Familial_Clustering_of	TCGA GBM(3;<1E-08)|TSP Lung(4;<1E-08)			32	754	---	---	---	---	PASS
SUMF2	25870	broad.mit.edu	37	7	56142379	56142379	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:56142379G>C	uc003trv.2	+	5	573	c.542G>C	c.(541-543)CGA>CCA	p.R181P	PSPH_uc003trj.2_Intron|SUMF2_uc011kcv.1_Intron|SUMF2_uc011kcw.1_Missense_Mutation_p.R181P|SUMF2_uc011kcx.1_Intron|SUMF2_uc003trt.2_Missense_Mutation_p.R74P|SUMF2_uc011kcy.1_Missense_Mutation_p.R166P|SUMF2_uc011kcz.1_Intron|SUMF2_uc003tru.2_Intron|SUMF2_uc011kda.1_Intron|SUMF2_uc003trx.2_Intron	NM_001130069	NP_001123541	Q8NBJ7	SUMF2_HUMAN	sulfatase modifying factor 2 isoform e	162						endoplasmic reticulum lumen	metal ion binding			ovary(1)|skin(1)	2	Breast(14;0.214)		Lung(13;0.00024)|LUSC - Lung squamous cell carcinoma(13;0.00099)			CGGGGAAAACGACTGCCCACG	0.587											OREG0018081	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	8	371	---	---	---	---	PASS
ZNF479	90827	broad.mit.edu	37	7	57188291	57188291	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:57188291G>T	uc010kzo.2	-	5	1102	c.831C>A	c.(829-831)GCC>GCA	p.A277A		NM_033273	NP_150376	Q96JC4	ZN479_HUMAN	zinc finger protein 479	277	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)|skin(1)	4			GBM - Glioblastoma multiforme(1;9.18e-12)			AGCGCCTAAAGGCTTGGCCAC	0.453													34	132	---	---	---	---	PASS
ZNF479	90827	broad.mit.edu	37	7	57188292	57188292	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:57188292G>T	uc010kzo.2	-	5	1101	c.830C>A	c.(829-831)GCC>GAC	p.A277D		NM_033273	NP_150376	Q96JC4	ZN479_HUMAN	zinc finger protein 479	277	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)|skin(1)	4			GBM - Glioblastoma multiforme(1;9.18e-12)			GCGCCTAAAGGCTTGGCCACA	0.458													34	129	---	---	---	---	PASS
ZNF107	51427	broad.mit.edu	37	7	64167219	64167219	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:64167219G>A	uc003ttd.2	+	7	1323	c.537G>A	c.(535-537)AAG>AAA	p.K179K	ZNF107_uc003tte.2_Silent_p.K179K	NM_016220	NP_057304	Q9UII5	ZN107_HUMAN	zinc finger protein 107	179	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Lung NSC(55;0.00948)|all_lung(88;0.0249)				CTAGGCATAAGATAATTCATA	0.373													7	128	---	---	---	---	PASS
ZNF117	51351	broad.mit.edu	37	7	64453338	64453338	+	5'Flank	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:64453338C>T	uc003ttr.2	-						ZNF117_uc011kdr.1_Missense_Mutation_p.E20K	NM_015852	NP_056936	Q03924	ZN117_HUMAN	zinc finger protein 117							nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(1)	1		Lung NSC(55;0.0295)|all_lung(88;0.0691)				tcccagggttctccttttaac	0.000													11	113	---	---	---	---	PASS
KCTD7	154881	broad.mit.edu	37	7	66104107	66104107	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:66104107C>T	uc003tve.2	+	4	920	c.758C>T	c.(757-759)TCG>TTG	p.S253L	RABGEF1_uc003tvf.2_Intron|KCTD7_uc003tvd.3_Missense_Mutation_p.S253L	NM_153033	NP_694578	Q96MP8	KCTD7_HUMAN	potassium channel tetramerisation domain	253						voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(2)|central_nervous_system(1)	3						ACGGACCTCTCGGCCCAGGGT	0.567													20	214	---	---	---	---	PASS
POM121	9883	broad.mit.edu	37	7	72416716	72416716	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72416716G>C	uc003twj.2	+	15	3875	c.2898G>C	c.(2896-2898)AAG>AAC	p.K966N	POM121_uc010lam.1_Intron	NM_172020	NP_742017	Q96HA1	P121A_HUMAN	nuclear pore membrane protein 121	1231	Pore side (Potential).				carbohydrate metabolic process|glucose transport|mRNA transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	endoplasmic reticulum membrane|nuclear membrane|nuclear pore					0		Lung NSC(55;0.163)				CGGGATCCAAGACCCCAGGGG	0.582													13	87	---	---	---	---	PASS
CLIP2	7461	broad.mit.edu	37	7	73803425	73803425	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:73803425G>A	uc003uam.2	+						CLIP2_uc003uan.2_Intron	NM_003388	NP_003379	Q9UDT6	CLIP2_HUMAN	CAP-GLY domain containing linker protein 2							microtubule associated complex				skin(3)	3						CCTGCCGGCTGACCCCAGCGC	0.627													11	82	---	---	---	---	PASS
POM121C	100101267	broad.mit.edu	37	7	75066877	75066877	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:75066877C>G	uc010lde.1	-	5	1122	c.1122G>C	c.(1120-1122)TTG>TTC	p.L374F	POM121C_uc003udk.3_Missense_Mutation_p.L132F			A8CG34	P121C_HUMAN	Homo sapiens POM121-2 mRNA for nuclear pore membrane protein 121-2, partial cds.	374	Required for targeting to the nucleus and nuclear pore complex.|Pore side (Potential).|Ser-rich.				mRNA transport|protein transport|transmembrane transport	endoplasmic reticulum membrane|nuclear membrane|nuclear pore	protein binding				0						AAGCGCCTGTCAAGGAGCTCA	0.507													67	471	---	---	---	---	PASS
POR	5447	broad.mit.edu	37	7	75608797	75608797	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:75608797C>G	uc003udy.2	+	4	348	c.266C>G	c.(265-267)TCC>TGC	p.S89C	POR_uc011kgb.1_RNA|POR_uc011kgc.1_5'Flank|POR_uc011kgd.1_5'Flank|POR_uc011kge.1_5'Flank	NM_000941	NP_000932	P16435	NCPR_HUMAN	cytochrome P450 reductase	86	Flavodoxin-like.				cellular organofluorine metabolic process|positive regulation of monooxygenase activity	endoplasmic reticulum membrane	iron ion binding|NADPH-hemoprotein reductase activity			central_nervous_system(1)	1					Benzphetamine(DB00865)|Daunorubicin(DB00694)|Lipoic Acid(DB00166)|Menadione(DB00170)|Methoxyflurane(DB01028)|Mitomycin(DB00305)|Nilutamide(DB00665)	TTCTACGGCTCCCAGACGGGG	0.627													11	24	---	---	---	---	PASS
CCDC146	57639	broad.mit.edu	37	7	76871150	76871150	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:76871150C>G	uc003uga.2	+	4	509	c.382C>G	c.(382-384)CTC>GTC	p.L128V		NM_020879	NP_065930	Q8IYE0	CC146_HUMAN	coiled-coil domain containing 146	128	Potential.									ovary(1)|central_nervous_system(1)	2		all_cancers(73;0.128)|all_lung(88;0.0986)|all_epithelial(88;0.163)|Myeloproliferative disorder(862;0.205)				AGAACAACTTCTCAAGTATCA	0.398													20	235	---	---	---	---	PASS
RSBN1L	222194	broad.mit.edu	37	7	77408043	77408043	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:77408043C>T	uc010ldt.1	+	8	2143	c.2099C>T	c.(2098-2100)TCT>TTT	p.S700F	RSBN1L_uc003ugm.2_Missense_Mutation_p.S482F	NM_198467	NP_940869	Q6PCB5	RSBNL_HUMAN	round spermatid basic protein 1-like	700						nucleus				ovary(1)	1						GAGGACACTTCTCAGAATACA	0.418													13	427	---	---	---	---	PASS
CD36	948	broad.mit.edu	37	7	80300319	80300319	+	Missense_Mutation	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:80300319A>C	uc003uhc.2	+	13	1529	c.845A>C	c.(844-846)GAC>GCC	p.D282A	CD36_uc003uhd.3_Missense_Mutation_p.D282A|CD36_uc011kgv.1_Missense_Mutation_p.D206A|CD36_uc003uhe.3_Missense_Mutation_p.D282A|CD36_uc003uhf.3_Missense_Mutation_p.D282A|CD36_uc003uhg.3_Missense_Mutation_p.D282A|CD36_uc003uhh.3_Missense_Mutation_p.D282A	NM_001127444	NP_001120916	P16671	CD36_HUMAN	CD36 antigen	282	Extracellular (Potential).				cell adhesion|cGMP-mediated signaling|cholesterol transport|lipid metabolic process|lipid storage|lipoprotein transport|low-density lipoprotein particle clearance|nitric oxide mediated signal transduction|plasma membrane long-chain fatty acid transport|platelet activation|platelet degranulation|positive regulation of cell-matrix adhesion|positive regulation of macrophage derived foam cell differentiation	integral to plasma membrane|membrane fraction|platelet alpha granule membrane	lipid binding|low-density lipoprotein receptor activity|thrombospondin receptor activity|transforming growth factor beta binding			ovary(1)	1						TTTGAATCCGACGTTAATCTG	0.383													227	344	---	---	---	---	PASS
SEMA3C	10512	broad.mit.edu	37	7	80387646	80387646	+	Splice_Site	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:80387646C>T	uc003uhj.2	-	15	2205	c.1643_splice	c.e15+1	p.R548_splice	SEMA3C_uc011kgw.1_Splice_Site_p.R566_splice	NM_006379	NP_006370	Q99985	SEM3C_HUMAN	semaphorin 3C precursor						immune response|response to drug	membrane	receptor activity			ovary(1)	1						TTAGTGCTCACCGTTTCCCAG	0.473													15	221	---	---	---	---	PASS
CACNA2D1	781	broad.mit.edu	37	7	81596982	81596982	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:81596982G>A	uc003uhr.1	-						CACNA2D1_uc011kgy.1_Intron	NM_000722	NP_000713	P54289	CA2D1_HUMAN	calcium channel, voltage-dependent, alpha							voltage-gated calcium channel complex	metal ion binding			ovary(5)|pancreas(1)	6					Felodipine(DB01023)|Gabapentin(DB00996)|Ibutilide(DB00308)|Isradipine(DB00270)|Magnesium Sulfate(DB00653)|Nifedipine(DB01115)	TCCAACAACTGAAAAATTAAT	0.259													11	12	---	---	---	---	PASS
PCLO	27445	broad.mit.edu	37	7	82453631	82453631	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82453631G>A	uc003uhx.2	-	19	14806	c.14517C>T	c.(14515-14517)TCC>TCT	p.S4839S	PCLO_uc003uhv.2_Silent_p.S4839S|PCLO_uc003uht.1_Silent_p.S281S|PCLO_uc003uhu.1_Silent_p.S260S	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	4701	Ser-rich.				cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7						TGCTCTGACTGGAATGAGACT	0.423													12	65	---	---	---	---	PASS
PCLO	27445	broad.mit.edu	37	7	82580618	82580618	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82580618G>C	uc003uhx.2	-	6	9575	c.9286C>G	c.(9286-9288)CCA>GCA	p.P3096A	PCLO_uc003uhv.2_Missense_Mutation_p.P3096A|PCLO_uc010lec.2_Missense_Mutation_p.P61A	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	3027					cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7						GAGGGTGTTGGAGTTGCTACT	0.473													3	47	---	---	---	---	PASS
PCLO	27445	broad.mit.edu	37	7	82785233	82785233	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82785233G>C	uc003uhx.2	-	2	1013	c.724C>G	c.(724-726)CAA>GAA	p.Q242E	PCLO_uc003uhv.2_Missense_Mutation_p.Q242E	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	242	Gln-rich.|Pro-rich.				cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7						TCTGGTTGTTGAGAAGATATT	0.478													3	115	---	---	---	---	PASS
KIAA1324L	222223	broad.mit.edu	37	7	86539300	86539300	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:86539300G>A	uc011kha.1	-	16	2372	c.2187C>T	c.(2185-2187)CTC>CTT	p.L729L	KIAA1324L_uc003uif.1_Silent_p.L489L|KIAA1324L_uc011kgz.1_Silent_p.L615L|KIAA1324L_uc003uie.2_Silent_p.L562L	NM_001142749	NP_001136221	A8MWY0	K132L_HUMAN	hypothetical protein LOC222223 isoform 1	729	Extracellular (Potential).					integral to membrane				ovary(6)|skin(1)	7	Esophageal squamous(14;0.0058)					TGTTGGTACAGAGAGCCATCT	0.363													9	140	---	---	---	---	PASS
CROT	54677	broad.mit.edu	37	7	86990850	86990850	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:86990850C>T	uc003uit.2	+	5	630	c.385C>T	c.(385-387)CTT>TTT	p.L129F	CROT_uc003uiu.2_Missense_Mutation_p.L157F	NM_021151	NP_066974	Q9UKG9	OCTC_HUMAN	peroxisomal carnitine O-octanoyltransferase	129					fatty acid beta-oxidation using acyl-CoA oxidase|generation of precursor metabolites and energy|transport	peroxisomal matrix	carnitine O-octanoyltransferase activity			ovary(2)|lung(1)	3	Esophageal squamous(14;0.0058)|all_lung(186;0.201)|Lung NSC(181;0.203)				L-Carnitine(DB00583)	AAGTATAACTCTTTGGCATAA	0.413													11	203	---	---	---	---	PASS
ABCB1	5243	broad.mit.edu	37	7	87174204	87174204	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87174204A>T	uc003uiz.1	-	17	2417	c.1999T>A	c.(1999-2001)TCA>ACA	p.S667T	ABCB1_uc011khc.1_Missense_Mutation_p.S603T	NM_000927	NP_000918	P08183	MDR1_HUMAN	ATP-binding cassette, subfamily B, member 1	667	Cytoplasmic (Potential).				G2/M transition of mitotic cell cycle|stem cell proliferation	apical plasma membrane|cell surface|Golgi membrane|integral to membrane|intercellular canaliculus|membrane fraction	ATP binding|protein binding|xenobiotic-transporting ATPase activity			ovary(4)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	Esophageal squamous(14;0.00164)				Adenosine triphosphate(DB00171)|Alfentanil(DB00802)|Arsenic trioxide(DB01169)|Atazanavir(DB01072)|Carvedilol(DB01136)|Colchicine(DB01394)|Cyclosporine(DB00091)|Daunorubicin(DB00694)|Dipyridamole(DB00975)|Estramustine(DB01196)|Flupenthixol(DB00875)|Imatinib(DB00619)|Itraconazole(DB01167)|Nicardipine(DB00622)|Propafenone(DB01182)|Quinacrine(DB01103)|Quinidine(DB00908)|Ranolazine(DB00243)|Rifampin(DB01045)|Roxithromycin(DB00778)|Saquinavir(DB01232)|Tamoxifen(DB00675)|Vinblastine(DB00570)	CTACGAGTTGATCTTTTTCTT	0.393													7	290	---	---	---	---	PASS
ABCB1	5243	broad.mit.edu	37	7	87190643	87190643	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87190643C>G	uc003uiz.1	-	9	1181	c.763G>C	c.(763-765)GAA>CAA	p.E255Q	ABCB1_uc011khc.1_Missense_Mutation_p.E191Q	NM_000927	NP_000918	P08183	MDR1_HUMAN	ATP-binding cassette, subfamily B, member 1	255	ABC transmembrane type-1 1.				G2/M transition of mitotic cell cycle|stem cell proliferation	apical plasma membrane|cell surface|Golgi membrane|integral to membrane|intercellular canaliculus|membrane fraction	ATP binding|protein binding|xenobiotic-transporting ATPase activity			ovary(4)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	Esophageal squamous(14;0.00164)				Adenosine triphosphate(DB00171)|Alfentanil(DB00802)|Arsenic trioxide(DB01169)|Atazanavir(DB01072)|Carvedilol(DB01136)|Colchicine(DB01394)|Cyclosporine(DB00091)|Daunorubicin(DB00694)|Dipyridamole(DB00975)|Estramustine(DB01196)|Flupenthixol(DB00875)|Imatinib(DB00619)|Itraconazole(DB01167)|Nicardipine(DB00622)|Propafenone(DB01182)|Quinacrine(DB01103)|Quinidine(DB00908)|Ranolazine(DB00243)|Rifampin(DB01045)|Roxithromycin(DB00778)|Saquinavir(DB01232)|Tamoxifen(DB00675)|Vinblastine(DB00570)	AAGACCTCTTCAGCTACTGCT	0.328													19	88	---	---	---	---	PASS
ABCB1	5243	broad.mit.edu	37	7	87195509	87195509	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87195509G>C	uc003uiz.1	-	8	997	c.579C>G	c.(577-579)TTC>TTG	p.F193L	ABCB1_uc011khc.1_Missense_Mutation_p.F129L	NM_000927	NP_000918	P08183	MDR1_HUMAN	ATP-binding cassette, subfamily B, member 1	193	Helical; (Potential).|ABC transmembrane type-1 1.				G2/M transition of mitotic cell cycle|stem cell proliferation	apical plasma membrane|cell surface|Golgi membrane|integral to membrane|intercellular canaliculus|membrane fraction	ATP binding|protein binding|xenobiotic-transporting ATPase activity			ovary(4)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	Esophageal squamous(14;0.00164)				Adenosine triphosphate(DB00171)|Alfentanil(DB00802)|Arsenic trioxide(DB01169)|Atazanavir(DB01072)|Carvedilol(DB01136)|Colchicine(DB01394)|Cyclosporine(DB00091)|Daunorubicin(DB00694)|Dipyridamole(DB00975)|Estramustine(DB01196)|Flupenthixol(DB00875)|Imatinib(DB00619)|Itraconazole(DB01167)|Nicardipine(DB00622)|Propafenone(DB01182)|Quinacrine(DB01103)|Quinidine(DB00908)|Ranolazine(DB00243)|Rifampin(DB01045)|Roxithromycin(DB00778)|Saquinavir(DB01232)|Tamoxifen(DB00675)|Vinblastine(DB00570)	TTGACTGAAAGAACATTCCAA	0.368													41	162	---	---	---	---	PASS
SLC25A40	55972	broad.mit.edu	37	7	87470972	87470972	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87470972G>C	uc003uje.2	-	10	1150	c.799C>G	c.(799-801)CTT>GTT	p.L267V		NM_018843	NP_061331	Q8TBP6	S2540_HUMAN	mitochondrial carrier family protein	267	Solcar 3.				transmembrane transport	integral to membrane|mitochondrial inner membrane	binding			haematopoietic_and_lymphoid_tissue(1)	1	Esophageal squamous(14;0.00202)					TATGTCCAAAGTTGTGTCTGC	0.264													6	29	---	---	---	---	PASS
ZNF804B	219578	broad.mit.edu	37	7	88963232	88963232	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:88963232G>C	uc011khi.1	+	4	1474	c.936G>C	c.(934-936)GAG>GAC	p.E312D		NM_181646	NP_857597	A4D1E1	Z804B_HUMAN	zinc finger protein 804B	312						intracellular	zinc ion binding			ovary(5)|skin(3)|pancreas(2)|upper_aerodigestive_tract(1)	11	all_hematologic(106;0.125)|Lung NSC(181;0.15)|all_lung(186;0.151)		STAD - Stomach adenocarcinoma(171;0.0513)			CTATTGATGAGACACTAGAAG	0.343										HNSCC(36;0.09)			10	116	---	---	---	---	PASS
CLDN12	9069	broad.mit.edu	37	7	90042442	90042442	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:90042442C>G	uc003ukp.2	+	5	1088	c.452C>G	c.(451-453)TCT>TGT	p.S151C	CLDN12_uc003ukq.2_Missense_Mutation_p.S151C|CLDN12_uc010leq.2_Missense_Mutation_p.S151C|CLDN12_uc003ukr.2_Missense_Mutation_p.S151C|CLDN12_uc003uks.2_Missense_Mutation_p.S151C	NM_012129	NP_036261	P56749	CLD12_HUMAN	claudin 12	151	Helical; (Potential).				calcium-independent cell-cell adhesion|tight junction assembly	integral to membrane|tight junction	identical protein binding|structural molecule activity				0						CTCTCCCCATCTATCTGGGTC	0.483													21	383	---	---	---	---	PASS
AKAP9	10142	broad.mit.edu	37	7	91736685	91736685	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:91736685G>T	uc003ulg.2	+	48	11720	c.11495G>T	c.(11494-11496)CGC>CTC	p.R3832L	AKAP9_uc003ulf.2_Missense_Mutation_p.R3824L|AKAP9_uc003uli.2_Missense_Mutation_p.R3455L|AKAP9_uc003ulj.2_Missense_Mutation_p.R1602L|AKAP9_uc003ull.2_Missense_Mutation_p.R728L	NM_005751	NP_005742	Q99996	AKAP9_HUMAN	A-kinase anchor protein 9 isoform 2	3836					G2/M transition of mitotic cell cycle|signal transduction|synaptic transmission|transport	centrosome|cytosol|Golgi apparatus	receptor binding			breast(7)|ovary(6)|lung(5)|skin(3)|large_intestine(2)|prostate(2)|central_nervous_system(1)	26	all_cancers(62;2.46e-09)|all_epithelial(64;4.42e-08)|Breast(17;0.00206)|all_lung(186;0.185)|all_hematologic(106;0.215)|Lung NSC(181;0.249)		STAD - Stomach adenocarcinoma(171;6.16e-05)|Lung(22;0.123)|LUSC - Lung squamous cell carcinoma(200;0.225)			ACTACGTATCGCTCAAGATCA	0.363			T	BRAF	papillary thyroid								5	249	---	---	---	---	PASS
CYP51A1	1595	broad.mit.edu	37	7	91755662	91755662	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:91755662G>C	uc003ulm.3	-	5	837	c.675C>G	c.(673-675)CTC>CTG	p.L225L	CYP51A1_uc011khn.1_Silent_p.L120L|CYP51A1_uc003uln.3_Silent_p.L162L	NM_000786	NP_000777	Q16850	CP51A_HUMAN	cytochrome P450, family 51, subfamily A,	219					cholesterol biosynthetic process|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	electron carrier activity|heme binding|sterol 14-demethylase activity				0	all_cancers(62;2.16e-09)|all_epithelial(64;3.86e-08)|Breast(17;0.00206)|all_lung(186;0.169)|all_hematologic(106;0.215)|Lung NSC(181;0.227)		STAD - Stomach adenocarcinoma(171;6.16e-05)|Lung(22;0.123)|LUSC - Lung squamous cell carcinoma(200;0.225)		Fluconazole(DB00196)|Itraconazole(DB01167)|Ketoconazole(DB01026)|Miconazole(DB01110)|Terconazole(DB00251)	CCTTTTCATTGAGTTGACTTC	0.423													27	62	---	---	---	---	PASS
SAMD9	54809	broad.mit.edu	37	7	92735412	92735412	+	5'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92735412C>T	uc003umf.2	-	3					SAMD9_uc003umg.2_5'UTR	NM_017654	NP_060124	Q5K651	SAMD9_HUMAN	sterile alpha motif domain containing 9							cytoplasm				ovary(3)|skin(2)|breast(1)|central_nervous_system(1)	7	all_cancers(62;5.71e-11)|all_epithelial(64;3.25e-10)|Breast(17;0.000675)|Lung NSC(181;0.0969)|all_lung(186;0.125)		STAD - Stomach adenocarcinoma(171;0.000302)			CTTTGCCATTCTGATACCTAT	0.214													41	205	---	---	---	---	PASS
SAMD9L	219285	broad.mit.edu	37	7	92764686	92764686	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92764686T>A	uc003umh.1	-	5	1815	c.599A>T	c.(598-600)AAA>ATA	p.K200I	SAMD9L_uc003umj.1_Missense_Mutation_p.K200I|SAMD9L_uc003umi.1_Missense_Mutation_p.K200I|SAMD9L_uc010lfb.1_Missense_Mutation_p.K200I|SAMD9L_uc003umk.1_Missense_Mutation_p.K200I|SAMD9L_uc010lfc.1_Missense_Mutation_p.K200I|SAMD9L_uc010lfd.1_Missense_Mutation_p.K200I|SAMD9L_uc011khx.1_Intron	NM_152703	NP_689916	Q8IVG5	SAM9L_HUMAN	sterile alpha motif domain containing 9-like	200										ovary(4)	4	all_cancers(62;4.15e-11)|all_epithelial(64;2.29e-10)|Breast(17;0.000675)|Lung NSC(181;0.0755)|all_lung(186;0.0989)		STAD - Stomach adenocarcinoma(171;0.000302)			TGTGAGAGCTTTGAACTCATG	0.413													112	261	---	---	---	---	PASS
PON2	5445	broad.mit.edu	37	7	95039417	95039417	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:95039417A>T	uc003unv.2	-						PON2_uc003unu.2_Intron|PON2_uc010lfk.2_Intron|PON2_uc003unw.2_Intron	NM_000305	NP_000296	Q15165	PON2_HUMAN	paraoxonase 2 isoform 1						aromatic compound catabolic process	extracellular region|plasma membrane	arylesterase activity|identical protein binding|metal ion binding				0	all_cancers(62;9.35e-11)|all_epithelial(64;3.37e-09)		STAD - Stomach adenocarcinoma(171;0.0151)			ATTCACACTGAAAAAGAAAAA	0.343													4	85	---	---	---	---	PASS
NPTX2	4885	broad.mit.edu	37	7	98254457	98254457	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98254457C>T	uc003upl.2	+	3	1044	c.867C>T	c.(865-867)ATC>ATT	p.I289I		NM_002523	NP_002514	P47972	NPTX2_HUMAN	neuronal pentraxin II precursor	289	Pentaxin.				synaptic transmission	extracellular region	metal ion binding|sugar binding			central_nervous_system(2)|skin(1)	3	all_cancers(62;2.28e-09)|all_epithelial(64;4.86e-10)|Esophageal squamous(72;0.00918)|Lung NSC(181;0.0128)|all_lung(186;0.0142)		STAD - Stomach adenocarcinoma(171;0.215)			ACAACCCCATCGAGCTGCTCA	0.662													12	103	---	---	---	---	PASS
TRRAP	8295	broad.mit.edu	37	7	98554094	98554094	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98554094C>A	uc003upp.2	+	42	6357	c.6148C>A	c.(6148-6150)CTG>ATG	p.L2050M	TRRAP_uc011kis.1_Missense_Mutation_p.L2032M|TRRAP_uc003upr.2_Missense_Mutation_p.L1749M	NM_003496	NP_003487	Q9Y4A5	TRRAP_HUMAN	transformation/transcription domain-associated	2050	Interaction with TP53.|Bipartite nuclear localization signal (Potential).				histone deubiquitination|histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	NuA4 histone acetyltransferase complex|PCAF complex|STAGA complex|transcription factor TFTC complex	phosphotransferase activity, alcohol group as acceptor|protein binding|transcription cofactor activity			ovary(9)|large_intestine(8)|central_nervous_system(6)|skin(6)|stomach(5)|upper_aerodigestive_tract(1)|lung(1)|liver(1)	37	all_cancers(62;6.96e-09)|all_epithelial(64;4.86e-09)|Lung NSC(181;0.01)|all_lung(186;0.016)|Esophageal squamous(72;0.0274)		STAD - Stomach adenocarcinoma(171;0.215)			TAAGAGAGGCCTGTCCGTGGA	0.502													4	231	---	---	---	---	PASS
CYP3A5	1577	broad.mit.edu	37	7	99250244	99250244	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99250244C>T	uc003urq.2	-	11	1272	c.1185G>A	c.(1183-1185)GTG>GTA	p.V395V	ZNF498_uc003urn.2_Intron|CYP3A5_uc003urp.2_Silent_p.V215V|CYP3A5_uc003urr.2_Silent_p.V282V|CYP3A5_uc011kiy.1_Silent_p.V385V|CYP3A5_uc003urs.2_Silent_p.V43V|CYP3A5_uc010lgg.2_Intron	NM_000777	NP_000768	P20815	CP3A5_HUMAN	cytochrome P450, family 3, subfamily A,	395					alkaloid catabolic process|drug catabolic process|oxidative demethylation|steroid metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	aromatase activity|electron carrier activity|heme binding|oxygen binding				0	all_epithelial(64;2.77e-08)|Lung NSC(181;0.00396)|all_lung(186;0.00659)|Esophageal squamous(72;0.0166)				Alfentanil(DB00802)|Clopidogrel(DB00758)|Cyclosporine(DB00091)|Daunorubicin(DB00694)|Indinavir(DB00224)|Irinotecan(DB00762)|Ketoconazole(DB01026)|Lapatinib(DB01259)|Mephenytoin(DB00532)|Midazolam(DB00683)|Mifepristone(DB00834)|Phenytoin(DB00252)|Quinine(DB00468)|Saquinavir(DB01232)|Tacrolimus(DB00864)|Troleandomycin(DB01361)|Verapamil(DB00661)|Vincristine(DB00541)	AAGTTGGAATCACCACCATTG	0.458													50	162	---	---	---	---	PASS
MBLAC1	255374	broad.mit.edu	37	7	99725743	99725743	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99725743C>T	uc003utp.2	+	2	1124	c.725C>T	c.(724-726)TCG>TTG	p.S242L		NM_203397	NP_981942	A4D2B0	MBLC1_HUMAN	metallo-beta-lactamase domain containing 1	242							hydrolase activity|metal ion binding			breast(1)	1						AGGGAAGCCTCGCAGCCCGAG	0.677													7	16	---	---	---	---	PASS
STAG3	10734	broad.mit.edu	37	7	99780374	99780374	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99780374G>A	uc003utx.1	+	4	403	c.248G>A	c.(247-249)CGA>CAA	p.R83Q	STAG3_uc010lgs.1_5'UTR|STAG3_uc011kjk.1_Missense_Mutation_p.R83Q	NM_012447	NP_036579	Q9UJ98	STAG3_HUMAN	stromal antigen 3	83					chromosome segregation|synaptonemal complex assembly	chromosome, centromeric region|meiotic cohesin complex|synaptonemal complex	binding			ovary(4)|skin(2)|lung(1)|kidney(1)	8	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)					AAAGGGTCCCGAGTGGTACAT	0.403													23	455	---	---	---	---	PASS
GATS	352954	broad.mit.edu	37	7	99869507	99869507	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99869507A>T	uc003uua.3	-	1	349	c.100T>A	c.(100-102)TCA>ACA	p.S34T	GATS_uc003uty.3_RNA|GATS_uc003utz.3_RNA|GATS_uc010lgt.2_RNA|GATS_uc010lgu.2_RNA	NM_178831	NP_849153	Q8NAP1	GATS_HUMAN	GATS, stromal antigen 3 opposite strand	34											0	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)					CCCGTAGGTGAACAGCGGGAT	0.667													24	55	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	7	100606729	100606729	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100606729G>C	uc003uxk.1	+						uc003uxl.1_Intron|uc010lhn.1_5'Flank					Homo sapiens MUC3B mRNA for intestinal mucin, partial cds.																		GGGATCCTTGGTGTTTCAGAT	0.562													3	26	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	7	100606800	100606800	+	RNA	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100606800G>A	uc003uxk.1	+	3		c.2274G>A			uc003uxl.1_Silent_p.L530L|uc010lhn.1_5'Flank					Homo sapiens MUC3B mRNA for intestinal mucin, partial cds.																		TCCTGTCCCTGAGGTAGGAGA	0.498													12	12	---	---	---	---	PASS
MLL5	55904	broad.mit.edu	37	7	104752711	104752711	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:104752711C>T	uc003vcm.2	+	27	5042	c.4508C>T	c.(4507-4509)GCA>GTA	p.A1503V	MLL5_uc010ljc.2_Missense_Mutation_p.A1503V|MLL5_uc010ljf.1_Intron|MLL5_uc010ljg.2_Missense_Mutation_p.A237V	NM_182931	NP_891847	Q8IZD2	MLL5_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 5	1503	Pro-rich.				cell cycle arrest|cellular response to retinoic acid|DNA methylation|erythrocyte differentiation|neutrophil activation|neutrophil mediated immunity|positive regulation of granulocyte differentiation|positive regulation of transcription, DNA-dependent|retinoic acid receptor signaling pathway|transcription, DNA-dependent	MLL5-L complex|nuclear speck	enzyme binding|histone methyltransferase activity (H3-K4 specific)|transcription coactivator activity|zinc ion binding			ovary(2)|pancreas(1)	3						TATCCAGCAGCACAGAACCTT	0.463													11	71	---	---	---	---	PASS
PIK3CG	5294	broad.mit.edu	37	7	106513217	106513217	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:106513217A>T	uc003vdv.3	+	4	2206	c.2121A>T	c.(2119-2121)AGA>AGT	p.R707S	PIK3CG_uc003vdu.2_Missense_Mutation_p.R707S|PIK3CG_uc003vdw.2_Missense_Mutation_p.R707S	NM_002649	NP_002640	P48736	PK3CG_HUMAN	phosphoinositide-3-kinase, catalytic, gamma	707					G-protein coupled receptor protein signaling pathway|phosphatidylinositol-mediated signaling|platelet activation	phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity|protein binding			lung(16)|central_nervous_system(8)|breast(5)|pancreas(3)|stomach(2)|ovary(2)|upper_aerodigestive_tract(1)|skin(1)	38						CCCAGTCCAGACACTATCAGC	0.443													50	106	---	---	---	---	PASS
ASZ1	136991	broad.mit.edu	37	7	117003719	117003719	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117003719C>T	uc003vjb.2	-	13	1422	c.1359G>A	c.(1357-1359)AGG>AGA	p.R453R	ASZ1_uc011kno.1_Silent_p.R444R|ASZ1_uc011knp.1_Silent_p.R245R	NM_130768	NP_570124	Q8WWH4	ASZ1_HUMAN	ankyrin repeat, SAM and basic leucine zipper	453					cell differentiation|DNA methylation involved in gamete generation|gene silencing by RNA|male meiosis|multicellular organismal development|piRNA metabolic process|spermatogenesis	pi-body	signal transducer activity			central_nervous_system(2)|ovary(1)	3	Lung NSC(10;0.00156)|all_lung(10;0.00175)		STAD - Stomach adenocarcinoma(10;0.000512)			TAATAGCTGTCCTCTTCAAAA	0.313													49	103	---	---	---	---	PASS
CFTR	1080	broad.mit.edu	37	7	117175451	117175451	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117175451G>A	uc003vjd.2	+	6	861	c.729G>A	c.(727-729)ATG>ATA	p.M243I	CFTR_uc011knq.1_5'UTR	NM_000492	NP_000483	P13569	CFTR_HUMAN	cystic fibrosis transmembrane conductance	243	Cytoplasmic (Potential).|ABC transmembrane type-1 1.				respiratory gaseous exchange	apical plasma membrane|basolateral plasma membrane|chloride channel complex|early endosome membrane	ATP binding|ATP-binding and phosphorylation-dependent chloride channel activity|channel-conductance-controlling ATPase activity|chloride channel regulator activity|enzyme binding|PDZ domain binding			central_nervous_system(2)|skin(2)|ovary(1)	5	Lung NSC(10;0.00148)|all_lung(10;0.00171)		STAD - Stomach adenocarcinoma(10;0.000534)		Bumetanide(DB00887)|Glibenclamide(DB01016)	TAGGGAGAATGATGATGAAGT	0.423									Cystic_Fibrosis				9	210	---	---	---	---	PASS
PTPRZ1	5803	broad.mit.edu	37	7	121652898	121652898	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:121652898T>C	uc003vjy.2	+	12	4193	c.3798T>C	c.(3796-3798)AGT>AGC	p.S1266S	PTPRZ1_uc003vjz.2_Intron|PTPRZ1_uc011knt.1_Intron	NM_002851	NP_002842	P23471	PTPRZ_HUMAN	protein tyrosine phosphatase, receptor-type,	1266	Extracellular (Potential).				central nervous system development	integral to plasma membrane	protein binding|protein tyrosine/threonine phosphatase activity|transmembrane receptor protein tyrosine phosphatase activity			ovary(3)|large_intestine(2)|lung(2)|central_nervous_system(1)|kidney(1)	9						CCTATGCAAGTGAGAAATATG	0.398													55	223	---	---	---	---	PASS
AASS	10157	broad.mit.edu	37	7	121756770	121756770	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:121756770G>C	uc003vka.2	-	7	907	c.811C>G	c.(811-813)CTT>GTT	p.L271V	AASS_uc011knu.1_RNA|AASS_uc011knv.1_RNA|AASS_uc003vkb.2_Missense_Mutation_p.L271V|AASS_uc011knw.1_Intron	NM_005763	NP_005754	Q9UDR5	AASS_HUMAN	aminoadipate-semialdehyde synthase precursor	271	Lysine-ketoglutarate reductase.				protein tetramerization	mitochondrial matrix	binding|saccharopine dehydrogenase (NAD+, L-glutamate-forming) activity|saccharopine dehydrogenase (NADP+, L-lysine-forming) activity			upper_aerodigestive_tract(1)|ovary(1)	2					L-Glutamic Acid(DB00142)|NADH(DB00157)	TTCCTGACAAGATGATGATGA	0.373													20	109	---	---	---	---	PASS
SLC13A1	6561	broad.mit.edu	37	7	122765725	122765725	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:122765725G>A	uc003vkm.2	-	11	1163	c.1138C>T	c.(1138-1140)CCT>TCT	p.P380S	SLC13A1_uc010lks.2_Missense_Mutation_p.P256S	NM_022444	NP_071889	Q9BZW2	S13A1_HUMAN	solute carrier family 13 (sodium/sulfate	380						integral to membrane|plasma membrane	sodium:sulfate symporter activity			ovary(2)	2					Succinic acid(DB00139)	GCAAAACCAGGGTACCTGTAA	0.338													44	219	---	---	---	---	PASS
HYAL4	23553	broad.mit.edu	37	7	123509056	123509056	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:123509056G>A	uc003vlc.2	+	3	1367	c.729G>A	c.(727-729)TTG>TTA	p.L243L	HYAL4_uc011knz.1_Silent_p.L243L	NM_012269	NP_036401	Q2M3T9	HYAL4_HUMAN	hyaluronoglucosaminidase 4	243	Extracellular (Potential).				fusion of sperm to egg plasma membrane|glycosaminoglycan catabolic process	integral to membrane	hyalurononglucosaminidase activity			skin(1)	1						ACGAAGTCTTGAGGAACAATG	0.448													4	160	---	---	---	---	PASS
PAX4	5078	broad.mit.edu	37	7	127254951	127254951	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127254951G>T	uc010lld.1	-	2	525	c.319C>A	c.(319-321)CAG>AAG	p.Q107K	PAX4_uc003vmf.2_Missense_Mutation_p.Q105K|PAX4_uc003vmg.1_Missense_Mutation_p.Q107K|PAX4_uc003vmh.2_Missense_Mutation_p.Q105K	NM_006193	NP_006184	O43316	PAX4_HUMAN	paired box 4	115	Paired.				cell differentiation|endocrine pancreas development|organ morphogenesis	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1						GTCTTGTCCTGGGTGCAAAGC	0.552													23	80	---	---	---	---	PASS
EXOC4	60412	broad.mit.edu	37	7	133622811	133622811	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:133622811C>T	uc003vrk.2	+	14	2230	c.2195C>T	c.(2194-2196)TCT>TTT	p.S732F	EXOC4_uc011kpo.1_Missense_Mutation_p.S631F|EXOC4_uc003vrl.2_Missense_Mutation_p.S342F|EXOC4_uc011kpp.1_Missense_Mutation_p.S264F|EXOC4_uc011kpq.1_Missense_Mutation_p.S20F	NM_021807	NP_068579	Q96A65	EXOC4_HUMAN	SEC8 protein isoform a	732					vesicle docking involved in exocytosis	exocyst	protein N-terminus binding			ovary(4)|large_intestine(3)|upper_aerodigestive_tract(1)|skin(1)	9		Esophageal squamous(399;0.129)				TCCAATCTTTCTACATCCCAG	0.463													20	116	---	---	---	---	PASS
LRGUK	136332	broad.mit.edu	37	7	133812168	133812168	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:133812168C>A	uc003vrm.1	+	1	64	c.48C>A	c.(46-48)CTC>CTA	p.L16L		NM_144648	NP_653249	Q96M69	LRGUK_HUMAN	leucine-rich repeats and guanylate kinase domain	16							ATP binding|kinase activity			lung(2)|skin(2)|kidney(1)	5						CTGCCTCTCTCCTGAGAGGCT	0.597													32	118	---	---	---	---	PASS
AKR1B10	57016	broad.mit.edu	37	7	134221806	134221806	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:134221806G>C	uc003vrr.2	+	6	876	c.556G>C	c.(556-558)GAG>CAG	p.E186Q		NM_020299	NP_064695	O60218	AK1BA_HUMAN	aldo-keto reductase family 1, member B10	186					cellular aldehyde metabolic process|digestion|steroid metabolic process	cytoplasm	aldo-keto reductase (NADP) activity|protein binding			skin(5)	5						GTTGCAGGTTGAGTGTCACCC	0.527													31	60	---	---	---	---	PASS
ATP6V0A4	50617	broad.mit.edu	37	7	138447711	138447711	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138447711C>G	uc003vuf.2	-	5	589	c.351G>C	c.(349-351)TTG>TTC	p.L117F	ATP6V0A4_uc003vug.2_Missense_Mutation_p.L117F|ATP6V0A4_uc003vuh.2_Missense_Mutation_p.L117F	NM_130841	NP_570856	Q9HBG4	VPP4_HUMAN	ATPase, H+ transporting, lysosomal V0 subunit	117	Cytoplasmic (Potential).				cellular iron ion homeostasis|excretion|insulin receptor signaling pathway|ossification|regulation of pH|sensory perception of sound|transferrin transport	apical plasma membrane|brush border membrane|endosome membrane|integral to membrane|proton-transporting two-sector ATPase complex, proton-transporting domain	ATPase binding|hydrogen ion transmembrane transporter activity			pancreas(1)	1						AGCTTTGTTTCAAGGCCTGCT	0.463													49	200	---	---	---	---	PASS
MGAM	8972	broad.mit.edu	37	7	141740571	141740571	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141740571G>T	uc003vwy.2	+	21	2477	c.2423G>T	c.(2422-2424)GGA>GTA	p.G808V		NM_004668	NP_004659	O43451	MGA_HUMAN	maltase-glucoamylase	808	Lumenal (Potential).|Maltase.				polysaccharide digestion|starch catabolic process	apical plasma membrane|integral to membrane	carbohydrate binding|glucan 1,4-alpha-glucosidase activity|maltose alpha-glucosidase activity			ovary(2)	2	Melanoma(164;0.0272)				Acarbose(DB00284)|Miglitol(DB00491)|Voglibose(DB04878)	GAACTTCCTGGAGACAAAATT	0.483													27	45	---	---	---	---	PASS
CASP2	835	broad.mit.edu	37	7	143000960	143000960	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143000960G>T	uc003wco.2	+	9	1198	c.1051G>T	c.(1051-1053)GAA>TAA	p.E351*	CASP2_uc003wcp.2_3'UTR|CASP2_uc011kta.1_Nonsense_Mutation_p.E235*|CASP2_uc003wcq.2_RNA|CASP2_uc011ktb.1_Nonsense_Mutation_p.E101*	NM_032982	NP_116764	P42575	CASP2_HUMAN	caspase 2 isoform 1 preproprotein	351					apoptosis|cellular response to mechanical stimulus|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|protein maturation by peptide bond cleavage	cytosol	cysteine-type endopeptidase activity|enzyme binding|protein binding|protein domain specific binding			lung(2)|ovary(1)	3	Melanoma(164;0.059)					TGCCGGTAAAGAAAAGTTGCC	0.488													16	30	---	---	---	---	PASS
CNTNAP2	26047	broad.mit.edu	37	7	146805423	146805423	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:146805423G>A	uc003weu.1	+	5	1251	c.735G>A	c.(733-735)CTG>CTA	p.L245L		NM_014141	NP_054860	Q9UHC6	CNTP2_HUMAN	cell recognition molecule Caspr2 precursor	245	Laminin G-like 1.|Extracellular (Potential).				behavior|cell adhesion|clustering of voltage-gated potassium channels|limbic system development|neuron recognition|signal transduction|striatum development|superior temporal gyrus development|thalamus development|transmission of nerve impulse	axolemma|cell body fiber|dendrite|juxtaparanode region of axon|voltage-gated potassium channel complex	receptor binding			ovary(9)|central_nervous_system(1)|pancreas(1)	11	Melanoma(164;0.153)	all_cancers(3;3.51e-10)|all_epithelial(3;1.4e-05)|Myeloproliferative disorder(3;0.00452)|Lung NSC(3;0.0067)|all_lung(3;0.00794)	OV - Ovarian serous cystadenocarcinoma(82;0.0319)			AAGCCAAGCTGGTCCTCAGTT	0.398										HNSCC(39;0.1)			11	72	---	---	---	---	PASS
KRBA1	84626	broad.mit.edu	37	7	149418625	149418625	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149418625C>T	uc003wfz.2	+	5	864	c.465C>T	c.(463-465)ATC>ATT	p.I155I	KRBA1_uc010lpj.2_RNA|KRBA1_uc003wga.2_RNA|KRBA1_uc003wgb.2_5'Flank	NM_032534	NP_115923	A5PL33	KRBA1_HUMAN	KRAB A domain containing 1	155										ovary(1)|central_nervous_system(1)	2	Melanoma(164;0.165)|Ovarian(565;0.177)		OV - Ovarian serous cystadenocarcinoma(82;0.00625)			CTCTCCCCATCAGTGAGTCTG	0.602													7	22	---	---	---	---	PASS
ZNF467	168544	broad.mit.edu	37	7	149467534	149467534	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149467534C>G	uc003wgd.2	-	3	287	c.146G>C	c.(145-147)TGC>TCC	p.C49S	ZNF467_uc003wgc.2_Missense_Mutation_p.C49S	NM_207336	NP_997219	Q7Z7K2	ZN467_HUMAN	zinc finger protein 467	49					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	Melanoma(164;0.165)|Ovarian(565;0.177)		OV - Ovarian serous cystadenocarcinoma(82;0.00625)			CCTACCTGAGCACACCCCCAG	0.428													6	122	---	---	---	---	PASS
RARRES2	5919	broad.mit.edu	37	7	150037244	150037244	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150037244G>C	uc003wha.2	-	3	341	c.224C>G	c.(223-225)ACA>AGA	p.T75R	RARRES2_uc010lpp.1_Missense_Mutation_p.T75R	NM_002889	NP_002880	Q99969	RARR2_HUMAN	chemerin preproprotein	75					embryonic digestive tract development|in utero embryonic development|positive regulation of macrophage chemotaxis|retinoid metabolic process	extracellular matrix	receptor binding			pancreas(1)	1			OV - Ovarian serous cystadenocarcinoma(82;0.011)			CCGGCAGCTTGTCTGCTGCAG	0.587													13	708	---	---	---	---	PASS
GIMAP7	168537	broad.mit.edu	37	7	150217087	150217087	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150217087C>T	uc003whk.2	+	2	155	c.25C>T	c.(25-27)CTG>TTG	p.L9L		NM_153236	NP_694968	Q8NHV1	GIMA7_HUMAN	GTPase, IMAP family member 7	9							GTP binding			pancreas(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(82;0.0218)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)		GGACCGCTCCCTGAGGATCGT	0.502													44	84	---	---	---	---	PASS
MLL3	58508	broad.mit.edu	37	7	151921142	151921142	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151921142T>C	uc003wla.2	-	20	3500	c.3281A>G	c.(3280-3282)TAT>TGT	p.Y1094C	MLL3_uc003wkz.2_Missense_Mutation_p.Y155C	NM_170606	NP_733751	Q8NEZ4	MLL3_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 3	1094	PHD-type 6.				intracellular signal transduction|regulation of transcription, DNA-dependent|transcription, DNA-dependent		DNA binding|protein binding|zinc ion binding			large_intestine(27)|pancreas(13)|ovary(9)|central_nervous_system(8)|breast(3)|upper_aerodigestive_tract(1)|urinary_tract(1)|skin(1)	63	all_neural(206;0.187)	all_hematologic(28;0.0592)|Prostate(32;0.0906)	OV - Ovarian serous cystadenocarcinoma(82;0.00715)	UCEC - Uterine corpus endometrioid carcinoma (81;0.0597)|BRCA - Breast invasive adenocarcinoma(188;0.0462)		TTCTTCTCTATAGTTTCGATA	0.373			N		medulloblastoma								35	93	---	---	---	---	PASS
DPP6	1804	broad.mit.edu	37	7	154379763	154379763	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:154379763G>T	uc003wlk.2	+						DPP6_uc003wli.2_Intron|DPP6_uc003wlj.2_Missense_Mutation_p.R344M|DPP6_uc003wlm.2_Intron|DPP6_uc011kvq.1_Intron	NM_130797	NP_570629	P42658	DPP6_HUMAN	dipeptidyl-peptidase 6 isoform 1						cell death|proteolysis	integral to membrane	dipeptidyl-peptidase activity|serine-type peptidase activity			pancreas(3)|breast(1)	4	all_neural(206;0.181)	all_hematologic(28;0.0044)|all_lung(21;0.0176)|Lung NSC(21;0.0204)	OV - Ovarian serous cystadenocarcinoma(82;0.0562)			AGCAGCTACAGGCAGATTTCG	0.587													8	95	---	---	---	---	PASS
PTPRN2	5799	broad.mit.edu	37	7	157396756	157396756	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:157396756G>A	uc003wno.2	-	16	2477	c.2356C>T	c.(2356-2358)CGG>TGG	p.R786W	PTPRN2_uc003wnp.2_Missense_Mutation_p.R769W|PTPRN2_uc003wnq.2_Missense_Mutation_p.R757W|PTPRN2_uc003wnr.2_Missense_Mutation_p.R748W|PTPRN2_uc011kwa.1_Missense_Mutation_p.R809W	NM_002847	NP_002838	Q92932	PTPR2_HUMAN	protein tyrosine phosphatase, receptor type, N	786	Cytoplasmic (Potential).|Tyrosine-protein phosphatase.					integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(4)|large_intestine(1)|pleura(1)|skin(1)	7	all_neural(206;0.181)	all_cancers(7;8.99e-13)|all_epithelial(9;2.4e-06)|all_hematologic(28;0.0155)|Breast(660;0.132)	OV - Ovarian serous cystadenocarcinoma(82;0.00463)	STAD - Stomach adenocarcinoma(7;0.0875)		AGCAGGACCCGGGAGTGGTCA	0.642													29	52	---	---	---	---	PASS
PTPRN2	5799	broad.mit.edu	37	7	157985113	157985113	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:157985113C>T	uc003wno.2	-	5	576	c.455G>A	c.(454-456)CGA>CAA	p.R152Q	PTPRN2_uc003wnp.2_Missense_Mutation_p.R135Q|PTPRN2_uc003wnq.2_Missense_Mutation_p.R152Q|PTPRN2_uc003wnr.2_Missense_Mutation_p.R114Q|PTPRN2_uc011kwa.1_Missense_Mutation_p.R175Q	NM_002847	NP_002838	Q92932	PTPR2_HUMAN	protein tyrosine phosphatase, receptor type, N	152	Extracellular (Potential).					integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(4)|large_intestine(1)|pleura(1)|skin(1)	7	all_neural(206;0.181)	all_cancers(7;8.99e-13)|all_epithelial(9;2.4e-06)|all_hematologic(28;0.0155)|Breast(660;0.132)	OV - Ovarian serous cystadenocarcinoma(82;0.00463)	STAD - Stomach adenocarcinoma(7;0.0875)		CAGGTGGCGTCGGAGGGCGTT	0.652													31	50	---	---	---	---	PASS
VIPR2	7434	broad.mit.edu	37	7	158827350	158827350	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:158827350G>T	uc003woh.2	-						VIPR2_uc010lqx.2_Intron|VIPR2_uc010lqy.2_Intron	NM_003382	NP_003373	P41587	VIPR2_HUMAN	vasoactive intestinal peptide receptor 2						cell-cell signaling	integral to plasma membrane				lung(1)|central_nervous_system(1)	2	Ovarian(565;0.152)	all_cancers(7;1.13e-11)|all_epithelial(9;0.000545)|all_hematologic(28;0.00603)	OV - Ovarian serous cystadenocarcinoma(82;0.00231)	UCEC - Uterine corpus endometrioid carcinoma (81;0.2)|STAD - Stomach adenocarcinoma(7;0.18)		AACTGTCAGAGAGAGATGGGA	0.507													32	46	---	---	---	---	PASS
FBXO25	26260	broad.mit.edu	37	8	401300	401300	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:401300C>G	uc003wox.2	+	7	773	c.507C>G	c.(505-507)ATC>ATG	p.I169M	FBXO25_uc003woy.2_Missense_Mutation_p.I169M|FBXO25_uc003woz.2_Missense_Mutation_p.I102M|FBXO25_uc003wpa.2_Translation_Start_Site	NM_183421	NP_904357	Q8TCJ0	FBX25_HUMAN	F-box only protein 25 isoform 1	169						nucleus|SCF ubiquitin ligase complex	actin binding|ubiquitin-protein ligase activity			lung(1)	1		Ovarian(12;0.00965)|Colorectal(14;0.0815)|Myeloproliferative disorder(644;0.116)|all_neural(12;0.122)		Epithelial(5;3.14e-14)|OV - Ovarian serous cystadenocarcinoma(5;1.56e-07)|BRCA - Breast invasive adenocarcinoma(11;1.88e-06)		CTCGCTTAATCAAAGATCTTC	0.353													38	130	---	---	---	---	PASS
CSMD1	64478	broad.mit.edu	37	8	2966125	2966125	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:2966125C>G	uc011kwk.1	-	44	7147	c.6757G>C	c.(6757-6759)GCA>CCA	p.A2253P	CSMD1_uc011kwj.1_Missense_Mutation_p.A1645P|CSMD1_uc010lrg.2_Missense_Mutation_p.A321P	NM_033225	NP_150094	Q96PZ7	CSMD1_HUMAN	CUB and Sushi multiple domains 1 precursor	2253	Extracellular (Potential).|CUB 13.					integral to membrane				breast(20)|large_intestine(5)	25		all_cancers(1;5.7e-41)|all_epithelial(1;2.54e-36)|Lung NSC(1;7.54e-11)|all_lung(1;3.2e-10)|Hepatocellular(1;3.78e-05)|Breast(1;0.000196)|Myeloproliferative disorder(4;0.000374)|Esophageal squamous(1;0.0157)|Ovarian(12;0.091)|Renal(68;0.144)|Colorectal(14;0.234)		all cancers(1;5.03e-41)|Epithelial(1;4.78e-31)|Lung(1;1.14e-14)|LUSC - Lung squamous cell carcinoma(1;2.34e-14)|GBM - Glioblastoma multiforme(1;4.49e-10)|Colorectal(4;1.18e-07)|OV - Ovarian serous cystadenocarcinoma(1;3.2e-07)|BRCA - Breast invasive adenocarcinoma(1;6.17e-07)|COAD - Colon adenocarcinoma(4;0.000539)|READ - Rectum adenocarcinoma(4;0.00896)|Kidney(5;0.00957)|KIRC - Kidney renal clear cell carcinoma(5;0.0689)		ATCAACTGACCGTGGAAATTG	0.473													4	24	---	---	---	---	PASS
CSMD1	64478	broad.mit.edu	37	8	4495078	4495078	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:4495078G>A	uc011kwk.1	-	2	478	c.88C>T	c.(88-90)CAG>TAG	p.Q30*		NM_033225	NP_150094	Q96PZ7	CSMD1_HUMAN	CUB and Sushi multiple domains 1 precursor	30	Extracellular (Potential).					integral to membrane				breast(20)|large_intestine(5)	25		all_cancers(1;5.7e-41)|all_epithelial(1;2.54e-36)|Lung NSC(1;7.54e-11)|all_lung(1;3.2e-10)|Hepatocellular(1;3.78e-05)|Breast(1;0.000196)|Myeloproliferative disorder(4;0.000374)|Esophageal squamous(1;0.0157)|Ovarian(12;0.091)|Renal(68;0.144)|Colorectal(14;0.234)		all cancers(1;5.03e-41)|Epithelial(1;4.78e-31)|Lung(1;1.14e-14)|LUSC - Lung squamous cell carcinoma(1;2.34e-14)|GBM - Glioblastoma multiforme(1;4.49e-10)|Colorectal(4;1.18e-07)|OV - Ovarian serous cystadenocarcinoma(1;3.2e-07)|BRCA - Breast invasive adenocarcinoma(1;6.17e-07)|COAD - Colon adenocarcinoma(4;0.000539)|READ - Rectum adenocarcinoma(4;0.00896)|Kidney(5;0.00957)|KIRC - Kidney renal clear cell carcinoma(5;0.0689)		CCACAGTTCTGACCTGGAAGA	0.403													7	66	---	---	---	---	PASS
MCPH1	79648	broad.mit.edu	37	8	6372186	6372186	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:6372186G>C	uc003wqi.2	+						ANGPT2_uc003wqj.3_Intron|ANGPT2_uc003wqk.3_Intron|ANGPT2_uc010lri.2_Intron|ANGPT2_uc003wql.3_Intron	NM_024596	NP_078872	Q8NEM0	MCPH1_HUMAN	microcephalin							microtubule organizing center				central_nervous_system(1)|skin(1)	2		Hepatocellular(245;0.0663)		Colorectal(4;0.0505)		ATGCCTTAAAGAATGTCCTTA	0.428													102	136	---	---	---	---	PASS
ANGPT2	285	broad.mit.edu	37	8	6378765	6378765	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:6378765G>A	uc003wqj.3	-	4	1062	c.733C>T	c.(733-735)CAG>TAG	p.Q245*	MCPH1_uc003wqi.2_Intron|ANGPT2_uc003wqk.3_Nonsense_Mutation_p.Q245*|ANGPT2_uc010lri.2_Nonsense_Mutation_p.Q193*|ANGPT2_uc003wql.3_Nonsense_Mutation_p.Q245*	NM_001147	NP_001138	O15123	ANGP2_HUMAN	angiopoietin 2 isoform a precursor	245	Potential.				angiogenesis|blood coagulation|leukocyte migration|negative regulation of blood vessel endothelial cell migration|negative regulation of positive chemotaxis|Tie receptor signaling pathway	extracellular space	metal ion binding|receptor tyrosine kinase binding			upper_aerodigestive_tract(1)	1		Hepatocellular(245;0.0663)		Colorectal(4;0.0142)|READ - Rectum adenocarcinoma(4;0.19)|COAD - Colon adenocarcinoma(4;0.226)		TGCTGCTTCTGAAGAACTGAA	0.358													16	158	---	---	---	---	PASS
RHOBTB2	23221	broad.mit.edu	37	8	22874894	22874894	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22874894G>A	uc003xcq.2	+	10	2633	c.2096G>A	c.(2095-2097)CGG>CAG	p.R699Q	RHOBTB2_uc003xcp.2_Missense_Mutation_p.R721Q|RHOBTB2_uc011kzp.1_Missense_Mutation_p.R706Q|uc003xcr.2_Intron	NM_015178	NP_055993	Q9BYZ6	RHBT2_HUMAN	Rho-related BTB domain containing 2 isoform 3	699					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|plasma membrane	GTP binding			ovary(1)|lung(1)	2		Prostate(55;0.0513)|Breast(100;0.214)		Colorectal(74;0.0157)|COAD - Colon adenocarcinoma(73;0.064)		CAGCCCAAACGGCGTTGGCTC	0.448													11	43	---	---	---	---	PASS
TNFRSF10B	8795	broad.mit.edu	37	8	22888388	22888388	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22888388G>A	uc003xcu.2	-						TNFRSF10B_uc003xcs.1_5'Flank|TNFRSF10B_uc003xct.2_Intron|TNFRSF10B_uc011kzq.1_Intron|TNFRSF10B_uc003xcv.2_Intron	NM_003842	NP_003833	O14763	TR10B_HUMAN	tumor necrosis factor receptor superfamily,						activation of NF-kappaB-inducing kinase activity|activation of pro-apoptotic gene products|cell surface receptor linked signaling pathway|cellular response to mechanical stimulus|induction of apoptosis via death domain receptors|positive regulation of I-kappaB kinase/NF-kappaB cascade	plasma membrane	caspase activator activity|receptor activity|TRAIL binding				0		Prostate(55;0.0421)|Breast(100;0.067)		Colorectal(74;0.0179)|COAD - Colon adenocarcinoma(73;0.0703)		ATGGTGTCCTGGGAGGGGAGA	0.517													3	25	---	---	---	---	PASS
LOXL2	4017	broad.mit.edu	37	8	23225700	23225700	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:23225700C>A	uc003xdh.1	-	2	504	c.165G>T	c.(163-165)AAG>AAT	p.K55N		NM_002318	NP_002309	Q9Y4K0	LOXL2_HUMAN	lysyl oxidase-like 2 precursor	55					aging|cell adhesion|protein modification process	extracellular space|membrane	copper ion binding|electron carrier activity|oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor|scavenger receptor activity			breast(2)|ovary(1)	3		Prostate(55;0.0453)|Breast(100;0.143)		Colorectal(74;0.0288)|COAD - Colon adenocarcinoma(73;0.096)		GCAGCTGAATCTTGGCCACGT	0.627													4	77	---	---	---	---	PASS
ADAM7	8756	broad.mit.edu	37	8	24304766	24304766	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:24304766T>G	uc003xeb.2	+	3	337	c.224T>G	c.(223-225)CTA>CGA	p.L75R	ADAM7_uc003xea.1_Missense_Mutation_p.L75R	NM_003817	NP_003808	Q9H2U9	ADAM7_HUMAN	a disintegrin and metalloproteinase domain 7	75	Extracellular (Potential).				proteolysis	integral to membrane	metalloendopeptidase activity|zinc ion binding			skin(3)|ovary(1)|kidney(1)	5		Prostate(55;0.0181)		Colorectal(74;0.0199)|COAD - Colon adenocarcinoma(73;0.0754)|BRCA - Breast invasive adenocarcinoma(99;0.182)		CTTCATCTTCTAAGATCCAGG	0.328													66	91	---	---	---	---	PASS
DOCK5	80005	broad.mit.edu	37	8	25224446	25224446	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:25224446G>C	uc003xeg.2	+	31	3321	c.3184G>C	c.(3184-3186)GAA>CAA	p.E1062Q	DOCK5_uc010luf.1_RNA|DOCK5_uc003xeh.1_Missense_Mutation_p.E776Q|DOCK5_uc003xei.2_Missense_Mutation_p.E632Q|DOCK5_uc003xej.2_RNA	NM_024940	NP_079216	Q9H7D0	DOCK5_HUMAN	dedicator of cytokinesis 5	1062						cytoplasm	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(3)	3		all_cancers(63;0.0361)|Ovarian(32;0.000711)|all_epithelial(46;0.0153)|Hepatocellular(4;0.115)|Prostate(55;0.13)|Breast(100;0.143)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0267)|Epithelial(17;1.07e-11)|Colorectal(74;0.0276)|COAD - Colon adenocarcinoma(73;0.0828)		CCTTCAGCTTGAAACCTTCTC	0.383													26	50	---	---	---	---	PASS
PXDNL	137902	broad.mit.edu	37	8	52258506	52258506	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:52258506G>T	uc003xqu.3	-	20	4004	c.3903C>A	c.(3901-3903)GAC>GAA	p.D1301E	PXDNL_uc003xqt.3_Intron	NM_144651	NP_653252	A1KZ92	PXDNL_HUMAN	peroxidasin homolog-like precursor	1301					hydrogen peroxide catabolic process	extracellular space	heme binding|peroxidase activity			ovary(1)|pancreas(1)	2		all_cancers(86;0.107)|Lung NSC(129;0.00641)|all_epithelial(80;0.00716)|all_lung(136;0.015)				TACTCCTACAGTCTGTGGGGA	0.433													42	90	---	---	---	---	PASS
RP1	6101	broad.mit.edu	37	8	55541405	55541405	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:55541405C>T	uc003xsd.1	+	4	5111	c.4963C>T	c.(4963-4965)CAG>TAG	p.Q1655*	RP1_uc011ldy.1_Intron	NM_006269	NP_006260	P56715	RP1_HUMAN	retinitis pigmentosa RP1 protein	1655					axoneme assembly|intracellular signal transduction|photoreceptor cell maintenance|photoreceptor cell outer segment organization|phototransduction, visible light|retinal cone cell development|retinal rod cell development	cilium axoneme|cytoplasm|microtubule|microtubule associated complex|photoreceptor connecting cilium|photoreceptor inner segment|photoreceptor outer segment	microtubule binding			skin(7)|ovary(4)|pancreas(1)	12		all_lung(136;0.0831)|Lung NSC(129;0.109)|all_epithelial(80;0.123)	OV - Ovarian serous cystadenocarcinoma(7;4.4e-07)|Epithelial(17;3.37e-05)|all cancers(17;0.000285)			CCGCAAATCTCAGGTTTGTCC	0.373													72	383	---	---	---	---	PASS
ASPH	444	broad.mit.edu	37	8	62556543	62556543	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:62556543G>A	uc003xuj.2	-	8	939	c.670C>T	c.(670-672)CAG>TAG	p.Q224*	ASPH_uc011leg.1_Nonsense_Mutation_p.Q195*|ASPH_uc003xuo.2_Intron|ASPH_uc011leh.1_Intron|ASPH_uc003xul.2_Nonsense_Mutation_p.Q210*|ASPH_uc011lei.1_Nonsense_Mutation_p.Q210*|ASPH_uc011lej.1_Nonsense_Mutation_p.Q167*|ASPH_uc003xun.2_Nonsense_Mutation_p.Q181*|ASPH_uc011lek.1_Intron|ASPH_uc003xum.2_Nonsense_Mutation_p.Q224*	NM_004318	NP_004309	Q12797	ASPH_HUMAN	aspartate beta-hydroxylase isoform a	224	Glu-rich.|Lumenal (Potential).				muscle contraction	integral to endoplasmic reticulum membrane	calcium ion binding|electron carrier activity|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|peptide-aspartate beta-dioxygenase activity|structural constituent of muscle			ovary(3)	3	Lung SC(2;0.153)	Lung NSC(129;0.0358)|all_lung(136;0.0654)|all_epithelial(80;0.101)			L-Aspartic Acid(DB00128)|Succinic acid(DB00139)	TCCATATCCTGATTACAGTCT	0.333													23	56	---	---	---	---	PASS
TTPA	7274	broad.mit.edu	37	8	63976762	63976762	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:63976762C>T	uc003xux.1	-							NM_000370	NP_000361	P49638	TTPA_HUMAN	tocopherol (alpha) transfer protein						lipid metabolic process		transporter activity|vitamin E binding				0	Breast(64;0.0716)	all_cancers(86;0.145)|Lung NSC(129;0.0324)|all_lung(136;0.0593)|all_epithelial(80;0.123)			Vitamin E(DB00163)	ATATTTTACTCACCCGTTCCT	0.363													10	51	---	---	---	---	PASS
VCPIP1	80124	broad.mit.edu	37	8	67547206	67547206	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:67547206T>C	uc003xwn.2	-	3	3458	c.3199A>G	c.(3199-3201)ACA>GCA	p.T1067A		NM_025054	NP_079330	Q96JH7	VCIP1_HUMAN	valosin containing protein (p97)/p47 complex	1067					protein ubiquitination	endoplasmic reticulum|Golgi stack	ubiquitin-specific protease activity			lung(2)|ovary(2)|central_nervous_system(1)|breast(1)|skin(1)|kidney(1)	8		Lung NSC(129;0.142)|all_lung(136;0.227)	Epithelial(68;0.000771)|OV - Ovarian serous cystadenocarcinoma(28;0.00248)|all cancers(69;0.00296)|BRCA - Breast invasive adenocarcinoma(89;0.149)			GAAGGCTCTGTTTTAGTGGAA	0.423													86	238	---	---	---	---	PASS
C8orf44	56260	broad.mit.edu	37	8	67590034	67590034	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:67590034G>A	uc003xwo.1	+	2	244	c.91G>A	c.(91-93)GAA>AAA	p.E31K	SGK3_uc003xwp.2_Intron|C8orf44_uc003xwq.1_Missense_Mutation_p.E31K	NM_019607	NP_062553	Q96CB5	CH044_HUMAN	hypothetical protein LOC56260	31											0	Breast(64;0.186)		Epithelial(68;0.000959)|OV - Ovarian serous cystadenocarcinoma(28;0.00318)|all cancers(69;0.00363)|BRCA - Breast invasive adenocarcinoma(89;0.149)			GGAGCACTTCGAAAACCACTG	0.294													32	56	---	---	---	---	PASS
ZFHX4	79776	broad.mit.edu	37	8	77767033	77767033	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77767033C>T	uc003yav.2	+	10	8128	c.7741C>T	c.(7741-7743)CTG>TTG	p.L2581L	ZFHX4_uc003yau.1_Silent_p.L2626L|ZFHX4_uc003yaw.1_Silent_p.L2581L	NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	2581	Homeobox 3.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)			AAAATACTTGCTGGATTCCAA	0.473										HNSCC(33;0.089)			12	63	---	---	---	---	PASS
IMPA1	3612	broad.mit.edu	37	8	82592931	82592931	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:82592931C>G	uc003ych.2	-	3	278	c.151G>C	c.(151-153)GAA>CAA	p.E51Q	IMPA1_uc011lfq.1_Missense_Mutation_p.E110Q|IMPA1_uc011lfr.1_Missense_Mutation_p.E51Q	NM_005536	NP_005527	P29218	IMPA1_HUMAN	inositol(myo)-1(or 4)-monophosphatase 1 isoform	51					inositol phosphate dephosphorylation|phosphatidylinositol biosynthetic process|signal transduction	cytoplasm	inositol-1(or 4)-monophosphatase activity|metal ion binding|protein homodimerization activity			skin(1)	1					Lithium(DB01356)	AGCATTTTTTCAACTTTTTGG	0.264													6	148	---	---	---	---	PASS
LRRCC1	85444	broad.mit.edu	37	8	86047240	86047240	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:86047240G>A	uc003ycw.2	+	13	2281	c.2127G>A	c.(2125-2127)TTG>TTA	p.L709L	LRRCC1_uc010maa.1_Silent_p.L410L|LRRCC1_uc003ycx.2_Silent_p.L616L|LRRCC1_uc003ycy.2_Silent_p.L689L	NM_033402	NP_208325	Q9C099	LRCC1_HUMAN	sodium channel associated protein 2 isoform a	709					cell division|mitosis	centriole|nucleus					0						TTTCTAAATTGAAACAAGAAA	0.289													12	206	---	---	---	---	PASS
CPNE3	8895	broad.mit.edu	37	8	87543376	87543376	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:87543376C>G	uc003ydv.2	+							NM_003909	NP_003900	O75131	CPNE3_HUMAN	copine III						lipid metabolic process|vesicle-mediated transport	cytosol	calcium-dependent phospholipid binding|protein serine/threonine kinase activity|transporter activity			ovary(1)|skin(1)	2						CTTTCTAATTCTAACAGATTG	0.353													12	65	---	---	---	---	PASS
TMEM67	91147	broad.mit.edu	37	8	94777642	94777642	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:94777642G>A	uc011lgk.1	+	5	586	c.515G>A	c.(514-516)CGA>CAA	p.R172Q	TMEM67_uc010mat.1_Missense_Mutation_p.R87Q|TMEM67_uc010maw.2_Intron|TMEM67_uc003yga.3_Missense_Mutation_p.R91Q	NM_153704	NP_714915	Q5HYA8	MKS3_HUMAN	meckelin isoform 1	172			R -> Q (in COACHS).		cilium assembly|ER-associated protein catabolic process|negative regulation of centrosome duplication	centrosome|cilium membrane|cytoplasmic vesicle membrane|endoplasmic reticulum membrane|integral to membrane|microtubule basal body	unfolded protein binding			ovary(2)	2	Breast(36;4.14e-07)		BRCA - Breast invasive adenocarcinoma(8;0.00896)			AGGTGCGTCCGATGTGAGCCA	0.279													5	111	---	---	---	---	PASS
GEM	2669	broad.mit.edu	37	8	95272461	95272461	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95272461G>A	uc003ygj.2	-	2	520	c.271C>T	c.(271-273)CTG>TTG	p.L91L	GEM_uc003ygi.2_Silent_p.L91L	NM_005261	NP_005252	P55040	GEM_HUMAN	GTP-binding mitogen-induced T-cell protein	91					cell surface receptor linked signaling pathway|immune response|small GTPase mediated signal transduction	internal side of plasma membrane	calmodulin binding|GDP binding|GTP binding|GTPase activity|magnesium ion binding			lung(1)	1	Breast(36;4.65e-06)	Myeloproliferative disorder(644;0.204)	BRCA - Breast invasive adenocarcinoma(8;0.00691)			ATGTTGGCCAGAGTGGACTTG	0.597													33	112	---	---	---	---	PASS
PKHD1L1	93035	broad.mit.edu	37	8	110420406	110420406	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110420406C>A	uc003yne.2	+	18	2046	c.1942C>A	c.(1942-1944)CCA>ACA	p.P648T		NM_177531	NP_803875	Q86WI1	PKHL1_HUMAN	fibrocystin L precursor	648	Extracellular (Potential).				immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)			CGCTTCTAAGCCACTCACTCT	0.443										HNSCC(38;0.096)			33	98	---	---	---	---	PASS
CSMD3	114788	broad.mit.edu	37	8	113275877	113275877	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113275877G>T	uc003ynu.2	-	61	10012	c.9853C>A	c.(9853-9855)CAG>AAG	p.Q3285K	CSMD3_uc003yns.2_Missense_Mutation_p.Q2487K|CSMD3_uc003ynt.2_Missense_Mutation_p.Q3245K|CSMD3_uc011lhx.1_Missense_Mutation_p.Q3116K	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	3285	Sushi 25.|Extracellular (Potential).					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63						CGTAAGCACTGCGGTACTTCA	0.393										HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			26	41	---	---	---	---	PASS
CSMD3	114788	broad.mit.edu	37	8	113569139	113569139	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113569139C>A	uc003ynu.2	-	25	4246	c.4087G>T	c.(4087-4089)GGA>TGA	p.G1363*	CSMD3_uc003yns.2_Nonsense_Mutation_p.G635*|CSMD3_uc003ynt.2_Nonsense_Mutation_p.G1323*|CSMD3_uc011lhx.1_Nonsense_Mutation_p.G1259*	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	1363	Extracellular (Potential).|Sushi 7.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63						ATCTTGTATCCAAATTGTGGA	0.413										HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			36	106	---	---	---	---	PASS
COL14A1	7373	broad.mit.edu	37	8	121322262	121322262	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:121322262C>T	uc003yox.2	+	37	4681	c.4416C>T	c.(4414-4416)CTC>CTT	p.L1472L	COL14A1_uc003yoz.2_Silent_p.L437L	NM_021110	NP_066933	Q05707	COEA1_HUMAN	collagen, type XIV, alpha 1 precursor	1472	Triple-helical region 1 (COL2).				cell-cell adhesion|collagen fibril organization	collagen type XIV|extracellular space	collagen binding|extracellular matrix structural constituent|protein binding, bridging			ovary(4)|kidney(4)|skin(2)|pancreas(1)|central_nervous_system(1)	12	Lung NSC(37;6.52e-07)|Ovarian(258;0.00769)|Hepatocellular(40;0.161)		OV - Ovarian serous cystadenocarcinoma(1;6.47e-38)|STAD - Stomach adenocarcinoma(47;0.00503)			GTCCAGGACTCCGAGGACCAA	0.338													45	116	---	---	---	---	PASS
ZHX2	22882	broad.mit.edu	37	8	123964707	123964707	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:123964707C>T	uc003ypk.1	+	3	1524	c.957C>T	c.(955-957)ATC>ATT	p.I319I		NM_014943	NP_055758	Q9Y6X8	ZHX2_HUMAN	zinc fingers and homeoboxes 2	319	Required for interaction with NFYA.|Required for homodimerization.|Required for repressor activity.|Required for nuclear localization.|Homeobox 1.					cytoplasm|nucleus|plasma membrane	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|skin(1)	2	Lung NSC(37;2e-09)|Ovarian(258;0.0205)|Hepatocellular(40;0.105)		STAD - Stomach adenocarcinoma(47;0.00527)			AGCATGGCATCAGCTGGTCCC	0.597													12	198	---	---	---	---	PASS
ATAD2	29028	broad.mit.edu	37	8	124359338	124359338	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124359338C>G	uc003yqh.3	-	16	2314	c.2206G>C	c.(2206-2208)GAC>CAC	p.D736H	ATAD2_uc011lii.1_Missense_Mutation_p.D527H|ATAD2_uc003yqi.3_RNA|ATAD2_uc003yqj.2_Missense_Mutation_p.D736H	NM_014109	NP_054828	Q6PL18	ATAD2_HUMAN	ATPase family, AAA domain containing 2	736					regulation of transcription, DNA-dependent|transcription, DNA-dependent	mitochondrion|nucleus	ATP binding|ATPase activity			ovary(2)	2	Lung NSC(37;1.25e-09)|Ovarian(258;0.00838)		STAD - Stomach adenocarcinoma(47;0.00288)			ATACCTGAGTCTAATGTTTTA	0.318													34	161	---	---	---	---	PASS
WDYHV1	55093	broad.mit.edu	37	8	124453564	124453564	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124453564A>G	uc003yqn.1	+	6	652	c.527A>G	c.(526-528)AAC>AGC	p.N176S	WDYHV1_uc011lij.1_Missense_Mutation_p.N116S|WDYHV1_uc003yqo.1_RNA	NM_018024	NP_060494	Q96HA8	NTAQ1_HUMAN	WDYHV motif containing 1	176					protein modification process	cytosol|nucleus	protein binding|protein N-terminal glutamine amidohydrolase activity			ovary(1)|skin(1)	2						ATGAACCTGAACGATTTCATC	0.368													12	27	---	---	---	---	PASS
FAM91A1	157769	broad.mit.edu	37	8	124818395	124818395	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124818395G>A	uc003yqv.2	+	20	2019	c.1958G>A	c.(1957-1959)TGT>TAT	p.C653Y	FAM91A1_uc011lik.1_Missense_Mutation_p.C653Y|FAM91A1_uc011lil.1_Missense_Mutation_p.C411Y	NM_144963	NP_659400	Q658Y4	F91A1_HUMAN	hypothetical protein LOC157769	653										ovary(1)|central_nervous_system(1)	2	Lung NSC(37;8.76e-13)|Ovarian(258;0.00744)|all_neural(195;0.0741)		STAD - Stomach adenocarcinoma(47;0.00192)			CAGCATCTCTGTGGATATGTC	0.418													18	389	---	---	---	---	PASS
FER1L6	654463	broad.mit.edu	37	8	124992974	124992974	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124992974G>A	uc003yqw.2	+	11	1539	c.1333G>A	c.(1333-1335)GAT>AAT	p.D445N		NM_001039112	NP_001034201	Q2WGJ9	FR1L6_HUMAN	fer-1-like 6	445	Cytoplasmic (Potential).					integral to membrane				ovary(5)|skin(5)|central_nervous_system(1)	11	Lung NSC(37;4.1e-12)|Ovarian(258;0.00438)|all_neural(195;0.0741)		STAD - Stomach adenocarcinoma(47;0.00186)			CAAAACTGAAGATGGAAAATC	0.468											OREG0018964	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	26	101	---	---	---	---	PASS
MYC	4609	broad.mit.edu	37	8	128750739	128750739	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:128750739C>G	uc003ysh.1	+	3	744	c.231C>G	c.(229-231)GTC>GTG	p.V77V	MYC_uc003ysi.2_Silent_p.V92V	NM_002467	NP_002458	P01106	MYC_HUMAN	myc proto-oncogene protein	77					branching involved in ureteric bud morphogenesis|cell cycle arrest|cell proliferation|cellular iron ion homeostasis|positive regulation of metanephric cap mesenchymal cell proliferation|positive regulation of transcription, DNA-dependent|regulation of telomere maintenance|regulation of transcription from RNA polymerase II promoter|response to drug	nucleolus|nucleoplasm	E-box binding|protein binding|sequence-specific DNA binding transcription factor activity			lung(3)|ovary(1)|central_nervous_system(1)|pancreas(1)	6	all_cancers(1;6.19e-134)|all_epithelial(1;1.75e-119)|all_lung(1;5.66e-51)|Breast(1;1.08e-22)|all_neural(1;4.45e-21)|Medulloblastoma(1;1.88e-20)|Colorectal(1;1.92e-09)|Lung SC(1;4.52e-07)|Ovarian(5;0.000122)|Esophageal squamous(12;0.000995)|Renal(1;0.0921)|Hepatocellular(40;0.108)|Myeloproliferative disorder(2;0.135)|Melanoma(291;0.185)	Myeloproliferative disorder(644;0.0255)|Ovarian(118;0.0654)|Breast(495;0.212)|Acute lymphoblastic leukemia(644;0.22)	Epithelial(1;1.63e-94)|all cancers(1;5.82e-87)|OV - Ovarian serous cystadenocarcinoma(1;2.12e-71)|BRCA - Breast invasive adenocarcinoma(1;4.3e-14)|Lung(2;0.000381)|Colorectal(2;0.0102)|LUAD - Lung adenocarcinoma(14;0.0172)|READ - Rectum adenocarcinoma(2;0.0723)|LUSC - Lung squamous cell carcinoma(258;0.151)	KIRC - Kidney renal clear cell carcinoma(542;0.248)		ACGTTGCGGTCACACCCTTCT	0.672		3	A|T	IGK@|BCL5|BCL7A |BTG1|TRA@|IGH@	Burkitt lymphoma| amplified in other cancers|B-CLL						OREG0018982	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	3	43	---	---	---	---	PASS
ADCY8	114	broad.mit.edu	37	8	131826458	131826458	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:131826458G>A	uc003ytd.3	-	14	3026	c.2770C>T	c.(2770-2772)CGC>TGC	p.R924C	ADCY8_uc010mds.2_Missense_Mutation_p.R793C	NM_001115	NP_001106	P40145	ADCY8_HUMAN	adenylate cyclase 8	924	Cytoplasmic (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|synaptic transmission|transmembrane transport|water transport	integral to membrane|membrane fraction|plasma membrane	ATP binding|calcium- and calmodulin-responsive adenylate cyclase activity|metal ion binding			skin(4)|large_intestine(1)|central_nervous_system(1)	6	Esophageal squamous(12;0.00693)|Ovarian(258;0.00707)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.000538)			AAGTCCAGGCGGGCTGTGTAC	0.507										HNSCC(32;0.087)			36	159	---	---	---	---	PASS
FAM135B	51059	broad.mit.edu	37	8	139149383	139149383	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139149383A>T	uc003yuy.2	-						FAM135B_uc003yux.2_Intron|FAM135B_uc003yuz.2_Intron	NM_015912	NP_056996	Q49AJ0	F135B_HUMAN	hypothetical protein LOC51059											ovary(7)|skin(2)	9	all_epithelial(106;8.29e-14)|Lung NSC(106;6.88e-06)|all_lung(105;1.44e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0805)			AATTAAATGTAGCTTACCTGT	0.418										HNSCC(54;0.14)			19	75	---	---	---	---	PASS
FAM135B	51059	broad.mit.edu	37	8	139164351	139164351	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139164351C>A	uc003yuy.2	-	13	2538	c.2367G>T	c.(2365-2367)AAG>AAT	p.K789N	FAM135B_uc003yux.2_Missense_Mutation_p.K690N|FAM135B_uc003yuz.2_RNA|FAM135B_uc003yva.2_Missense_Mutation_p.K351N|FAM135B_uc003yvb.2_Missense_Mutation_p.K351N	NM_015912	NP_056996	Q49AJ0	F135B_HUMAN	hypothetical protein LOC51059	789										ovary(7)|skin(2)	9	all_epithelial(106;8.29e-14)|Lung NSC(106;6.88e-06)|all_lung(105;1.44e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0805)			CATCTTGCTGCTTGGTGTCCG	0.522										HNSCC(54;0.14)			37	76	---	---	---	---	PASS
FAM135B	51059	broad.mit.edu	37	8	139165196	139165196	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139165196G>A	uc003yuy.2	-	13	1693	c.1522C>T	c.(1522-1524)CAA>TAA	p.Q508*	FAM135B_uc003yux.2_Nonsense_Mutation_p.Q409*|FAM135B_uc003yuz.2_RNA|FAM135B_uc003yva.2_Nonsense_Mutation_p.Q70*|FAM135B_uc003yvb.2_Nonsense_Mutation_p.Q70*	NM_015912	NP_056996	Q49AJ0	F135B_HUMAN	hypothetical protein LOC51059	508										ovary(7)|skin(2)	9	all_epithelial(106;8.29e-14)|Lung NSC(106;6.88e-06)|all_lung(105;1.44e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0805)			GCTTTGTTTTGAAATTCACCA	0.438										HNSCC(54;0.14)			14	253	---	---	---	---	PASS
COL22A1	169044	broad.mit.edu	37	8	139638430	139638430	+	Intron	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139638430T>C	uc003yvd.2	-						COL22A1_uc011ljo.1_Intron	NM_152888	NP_690848	Q8NFW1	COMA1_HUMAN	collagen, type XXII, alpha 1						cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)			AAAAGCCACTTACTGGGATTC	0.408										HNSCC(7;0.00092)			7	116	---	---	---	---	PASS
COL22A1	169044	broad.mit.edu	37	8	139675958	139675958	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139675958T>C	uc003yvd.2	-	42	3623	c.3176A>G	c.(3175-3177)AAA>AGA	p.K1059R	COL22A1_uc011ljo.1_Missense_Mutation_p.K339R	NM_152888	NP_690848	Q8NFW1	COMA1_HUMAN	collagen, type XXII, alpha 1	1059	Pro-rich.|Gly-rich.|Collagen-like 9.				cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)			CGGGGATCCTTTGTCTCCTGG	0.423										HNSCC(7;0.00092)			8	168	---	---	---	---	PASS
COL22A1	169044	broad.mit.edu	37	8	139890135	139890135	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139890135G>C	uc003yvd.2	-	3	963	c.516C>G	c.(514-516)ATC>ATG	p.I172M		NM_152888	NP_690848	Q8NFW1	COMA1_HUMAN	collagen, type XXII, alpha 1	172	VWFA.				cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)			CCACGGCAAAGATGCGGATGC	0.682										HNSCC(7;0.00092)			4	9	---	---	---	---	PASS
ZC3H3	23144	broad.mit.edu	37	8	144620616	144620616	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144620616C>T	uc003yyd.2	-	2	950	c.921G>A	c.(919-921)CGG>CGA	p.R307R		NM_015117	NP_055932	Q8IXZ2	ZC3H3_HUMAN	zinc finger CCCH-type containing 3	307					mRNA polyadenylation|poly(A)+ mRNA export from nucleus|regulation of mRNA export from nucleus	nucleus	nucleic acid binding|zinc ion binding			skin(1)	1	all_cancers(97;8.64e-11)|all_epithelial(106;6.43e-09)|Lung NSC(106;0.000202)|all_lung(105;0.000548)|Ovarian(258;0.0212)|Acute lymphoblastic leukemia(118;0.155)		Colorectal(110;0.107)|BRCA - Breast invasive adenocarcinoma(115;0.107)			AGTTGTTTTTCCGGAACTTGT	0.632													13	274	---	---	---	---	PASS
OPLAH	26873	broad.mit.edu	37	8	145112832	145112832	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145112832G>A	uc003zar.3	-						OPLAH_uc003zas.1_5'Flank|OPLAH_uc003zat.1_Intron	NM_017570	NP_060040	O14841	OPLA_HUMAN	5-oxoprolinase (ATP-hydrolysing)								5-oxoprolinase (ATP-hydrolyzing) activity|ATP binding				0	all_cancers(97;1.06e-10)|all_epithelial(106;1.5e-09)|Lung NSC(106;5.89e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;6.79e-41)|Epithelial(56;1.02e-39)|all cancers(56;2.24e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)		L-Glutamic Acid(DB00142)	CAGACCTAGGGGAAGGAAGGG	0.647													10	52	---	---	---	---	PASS
HEATR7A	727957	broad.mit.edu	37	8	145246714	145246714	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145246714C>T	uc003zbk.3	+	9	1048	c.811C>T	c.(811-813)CTC>TTC	p.L271F	HEATR7A_uc003zbg.2_Missense_Mutation_p.L271F|HEATR7A_uc003zbh.3_Missense_Mutation_p.L271F|HEATR7A_uc003zbi.3_Missense_Mutation_p.L271F|HEATR7A_uc011lla.1_Missense_Mutation_p.L271F|HEATR7A_uc010mft.2_Missense_Mutation_p.L271F	NM_032450	NP_115826	Q8NDA8	HTR7A_HUMAN	HEAT repeat containing 7A isoform 1	271							binding				0						CCCTGGGATTCTCGCCCTCTA	0.607													10	24	---	---	---	---	PASS
CYHR1	50626	broad.mit.edu	37	8	145689597	145689597	+	Intron	SNP	C	T	T	rs77204173	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145689597C>T	uc003zcv.2	-						CYHR1_uc003zcw.2_Silent_p.P164P|CYHR1_uc003zcx.2_Silent_p.P164P|CYHR1_uc003zcy.2_Silent_p.P164P|KIFC2_uc003zcz.2_5'Flank	NM_138496	NP_612505	Q6ZMK1	CYHR1_HUMAN	cysteine/histidine-rich 1 isoform 1							perinuclear region of cytoplasm	zinc ion binding				0	all_cancers(97;4.61e-11)|all_epithelial(106;2.89e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.08e-41)|Epithelial(56;8.67e-41)|all cancers(56;1.1e-35)|BRCA - Breast invasive adenocarcinoma(115;0.035)|Colorectal(110;0.055)			CATCCTCCTTCGGTAGCAGCA	0.637											OREG0019056	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	14	99	---	---	---	---	PASS
ZNF250	58500	broad.mit.edu	37	8	146108105	146108105	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:146108105C>T	uc003zeq.3	-	6	595	c.478G>A	c.(478-480)GAA>AAA	p.E160K	COMMD5_uc010mgf.2_Intron|ZNF250_uc003zer.3_Missense_Mutation_p.E155K|ZNF250_uc010mgg.2_Missense_Mutation_p.E155K	NM_021061	NP_066405	P15622	ZN250_HUMAN	zinc finger protein 250 isoform a	160					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(97;8.72e-12)|all_epithelial(106;1.07e-10)|Lung NSC(106;7.18e-05)|all_lung(105;0.00021)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		Epithelial(56;2.53e-38)|OV - Ovarian serous cystadenocarcinoma(54;4.07e-38)|all cancers(56;2.27e-33)|BRCA - Breast invasive adenocarcinoma(115;0.0355)|Colorectal(110;0.055)	GBM - Glioblastoma multiforme(99;0.0654)		TGCTTTGTTTCATTATTTTCT	0.458													42	327	---	---	---	---	PASS
JAK2	3717	broad.mit.edu	37	9	5126787	5126787	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:5126787G>C	uc010mhm.2	+	24	3508	c.3395G>C	c.(3394-3396)GGA>GCA	p.G1132A	JAK2_uc003ziw.2_Missense_Mutation_p.G1132A	NM_004972	NP_004963	O60674	JAK2_HUMAN	Janus kinase 2	1132					actin filament polymerization|activation of caspase activity by protein phosphorylation|activation of JAK2 kinase activity|blood coagulation|cellular component movement|erythrocyte differentiation|interferon-gamma-mediated signaling pathway|interleukin-12-mediated signaling pathway|JAK-STAT cascade involved in growth hormone signaling pathway|mammary gland epithelium development|mesoderm development|negative regulation of cell proliferation|negative regulation of DNA binding|positive regulation of apoptosis|positive regulation of cell-substrate adhesion|positive regulation of growth hormone receptor signaling pathway|positive regulation of nitric-oxide synthase 2 biosynthetic process|positive regulation of phosphatidylinositol 3-kinase cascade|positive regulation of tumor necrosis factor production|positive regulation of tyrosine phosphorylation of Stat3 protein|positive regulation of tyrosine phosphorylation of Stat5 protein|protein autophosphorylation|regulation of inflammatory response|regulation of interferon-gamma-mediated signaling pathway|response to antibiotic|response to lipopolysaccharide|STAT protein import into nucleus|tumor necrosis factor-mediated signaling pathway|tyrosine phosphorylation of STAT protein	caveola|cytoskeleton|cytosol|endomembrane system|nucleus	ATP binding|growth hormone receptor binding|heme binding|histone binding|histone kinase activity (H3-Y41 specific)|interleukin-12 receptor binding|non-membrane spanning protein tyrosine kinase activity|protein kinase binding|SH2 domain binding		PCM1/JAK2(30)|PAX5/JAK2(18)|ETV6/JAK2(11)|BCR/JAK2(6)|SSBP2/JAK2(4)|SEC31A/JAK2(4)	haematopoietic_and_lymphoid_tissue(28629)|lung(5)|breast(5)|ovary(1)|liver(1)	28641	all_hematologic(13;0.137)	Acute lymphoblastic leukemia(23;0.0198)|Breast(48;0.147)		GBM - Glioblastoma multiforme(50;0.0237)|Lung(218;0.133)		AACATGGCTGGATGAAAGAAA	0.343		1	T|Mis|O	ETV6|PCM1|BCR	ALL|AML|MPD| CML				Polycythemia_Vera_Familial				4	112	---	---	---	---	PASS
KIAA1432	57589	broad.mit.edu	37	9	5756368	5756368	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:5756368G>A	uc003zji.2	+	15	1705	c.1612G>A	c.(1612-1614)GAT>AAT	p.D538N	KIAA1432_uc003zjh.2_Missense_Mutation_p.D538N|KIAA1432_uc003zjl.3_Missense_Mutation_p.D501N|KIAA1432_uc003zjj.1_Missense_Mutation_p.D80N	NM_020829	NP_065880	Q4ADV7	RIC1_HUMAN	connexin 43-interacting protein 150 isoform a	617						integral to membrane					0		Acute lymphoblastic leukemia(23;0.154)		GBM - Glioblastoma multiforme(50;0.000525)|Lung(218;0.122)		AAGAAAATCTGATGGGTAAGT	0.348													58	96	---	---	---	---	PASS
PSIP1	11168	broad.mit.edu	37	9	15468837	15468837	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:15468837C>G	uc003zlv.3	-	14	1541	c.1211G>C	c.(1210-1212)CGG>CCG	p.R404P	PSIP1_uc003zlw.3_Missense_Mutation_p.R404P	NM_033222	NP_150091	O75475	PSIP1_HUMAN	PC4 and SFRS1 interacting protein 1 isoform 2	404					initiation of viral infection|interspecies interaction between organisms|nuclear mRNA 5'-splice site recognition|provirus integration|regulation of transcription, DNA-dependent|response to heat|response to oxidative stress|transcription, DNA-dependent	cytosol|nuclear heterochromatin|nuclear periphery|nucleoplasm|nucleoplasm|transcriptionally active chromatin	activating transcription factor binding|chromatin binding|DNA secondary structure binding|RNA polymerase II transcription coactivator activity			breast(1)	1				GBM - Glioblastoma multiforme(50;2.38e-06)		TTTGAATCGCCGTATCTGAGA	0.303													38	58	---	---	---	---	PASS
ADAMTSL1	92949	broad.mit.edu	37	9	18639245	18639245	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:18639245C>T	uc003zne.3	+						ADAMTSL1_uc003znb.2_Intron|ADAMTSL1_uc003znc.3_Intron	NM_001040272	NP_001035362	Q8N6G6	ATL1_HUMAN	ADAMTS-like 1 isoform 4 precursor							proteinaceous extracellular matrix	metallopeptidase activity|zinc ion binding			ovary(3)|upper_aerodigestive_tract(1)|lung(1)	5				GBM - Glioblastoma multiforme(50;1.29e-17)		CGTGTTTGATCATATAGATCT	0.443													3	51	---	---	---	---	PASS
IFNB1	3456	broad.mit.edu	37	9	21077455	21077455	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:21077455C>G	uc003zok.2	-	1	489	c.414G>C	c.(412-414)ATG>ATC	p.M138I		NM_002176	NP_002167	P01574	IFNB_HUMAN	interferon, beta 1, fibroblast precursor	138					activation of caspase activity|B cell proliferation|blood coagulation|cellular response to exogenous dsRNA|defense response to virus|induction of apoptosis|natural killer cell activation|negative regulation of cell proliferation|negative regulation of T cell differentiation|negative regulation of T-helper 2 cell cytokine production|negative regulation of viral genome replication|negative regulation of viral transcription|negative regulation of virion penetration into host cell|positive regulation of innate immune response|positive regulation of transcription from RNA polymerase II promoter|regulation of MHC class I biosynthetic process|regulation of type I interferon-mediated signaling pathway|type I interferon-mediated signaling pathway	extracellular space	cytokine activity|interferon-alpha/beta receptor binding|transcription corepressor activity			ovary(1)|breast(1)|kidney(1)	3				GBM - Glioblastoma multiforme(5;7.45e-142)|Lung(24;2.42e-17)|LUSC - Lung squamous cell carcinoma(38;7.17e-11)	Interferon beta-1a(DB00060)|Interferon beta-1b(DB00068)	GCAGACTGCTCATGAGTTTTC	0.448													50	327	---	---	---	---	PASS
IFNA14	3448	broad.mit.edu	37	9	21239788	21239788	+	Silent	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:21239788A>T	uc010mis.2	-	1	191	c.147T>A	c.(145-147)CCT>CCA	p.P49P	IFNA14_uc003zoo.1_RNA	NM_002172	NP_002163	P01570	IFN14_HUMAN	interferon, alpha 14 precursor	49					blood coagulation|regulation of type I interferon-mediated signaling pathway|response to virus|type I interferon-mediated signaling pathway	extracellular space	cytokine activity|cytokine receptor binding				0				Lung(24;2.12e-22)|LUSC - Lung squamous cell carcinoma(38;1.4e-13)		GGCAGGAGAAAGGAGAGATTC	0.483													79	121	---	---	---	---	PASS
CDKN2A	1029	broad.mit.edu	37	9	21970910	21970910	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:21970910C>T	uc003zpk.2	-	2	660	c.448G>A	c.(448-450)GGT>AGT	p.G150S	MTAP_uc003zpi.1_Intron|CDKN2A_uc003zpj.2_3'UTR|CDKN2A_uc010miu.2_RNA|CDKN2A_uc003zpl.2_3'UTR	NM_000077	NP_000068	P42771	CD2A1_HUMAN	cyclin-dependent kinase inhibitor 2A isoform 1	150			G -> V (in non-small cell lung carcinoma).		cell cycle arrest|cell cycle checkpoint|G1 phase of mitotic cell cycle|G1/S transition of mitotic cell cycle|induction of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of cell-matrix adhesion|negative regulation of cyclin-dependent protein kinase activity|negative regulation of NF-kappaB transcription factor activity|positive regulation of macrophage apoptosis|positive regulation of smooth muscle cell apoptosis|Ras protein signal transduction|replicative senescence	cytosol|nucleus	cyclin-dependent protein kinase inhibitor activity|NF-kappaB binding|protein binding|protein binding|protein kinase binding	p.0?(1112)|p.?(13)|p.R128fs*12(3)|p.G150V(1)|p.G150G(1)		haematopoietic_and_lymphoid_tissue(647)|skin(419)|upper_aerodigestive_tract(414)|central_nervous_system(381)|lung(325)|pancreas(244)|oesophagus(230)|urinary_tract(225)|pleura(94)|liver(91)|soft_tissue(79)|bone(77)|ovary(76)|biliary_tract(71)|stomach(46)|breast(46)|kidney(39)|NS(28)|thyroid(24)|cervix(23)|meninges(18)|genital_tract(15)|endometrium(13)|prostate(11)|autonomic_ganglia(10)|salivary_gland(10)|large_intestine(9)|adrenal_gland(6)|eye(4)|vulva(2)|small_intestine(1)	3678		all_cancers(5;0)|Acute lymphoblastic leukemia(3;0)|all_hematologic(3;0)|all_epithelial(2;2.37e-290)|Lung NSC(2;1.26e-139)|all_lung(2;4.48e-131)|Glioma(2;3.26e-60)|all_neural(2;2.1e-52)|Renal(3;1.07e-46)|Esophageal squamous(3;3.83e-46)|Melanoma(2;2.74e-34)|Breast(3;1.14e-11)|Ovarian(3;0.000128)|Hepatocellular(5;0.00162)|Colorectal(97;0.172)		all cancers(2;0)|GBM - Glioblastoma multiforme(3;0)|Lung(2;4.07e-74)|Epithelial(2;1.08e-61)|LUSC - Lung squamous cell carcinoma(2;3.82e-48)|LUAD - Lung adenocarcinoma(2;4.56e-26)|OV - Ovarian serous cystadenocarcinoma(39;7.64e-10)|BRCA - Breast invasive adenocarcinoma(2;5.01e-09)|STAD - Stomach adenocarcinoma(4;4.63e-07)|Kidney(2;5.79e-07)|KIRC - Kidney renal clear cell carcinoma(2;7.27e-07)|COAD - Colon adenocarcinoma(8;5.15e-05)		CCTGAGGGACCTTCCGCGGCA	0.597		17							Uveal_Melanoma_Familial|Familial_Malignant_Melanoma_and_Tumors_of_the_Nervous_System|Hereditary_Melanoma	HNSCC(2;<9.43e_08)|TSP Lung(5;3.83e-07)			25	44	---	---	---	---	PASS
SMC5	23137	broad.mit.edu	37	9	72961531	72961531	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:72961531C>T	uc004ahr.2	+	19	2651	c.2534C>T	c.(2533-2535)ACC>ATC	p.T845I	SMC5_uc011lry.1_5'UTR	NM_015110	NP_055925	Q8IY18	SMC5_HUMAN	SMC5 protein	845					DNA recombination|DNA repair	chromosome|nucleus	ATP binding			ovary(2)|central_nervous_system(1)	3						CAAGTACCCACCATTCCAAAT	0.438													30	267	---	---	---	---	PASS
VPS13A	23230	broad.mit.edu	37	9	79875048	79875048	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:79875048G>C	uc004akr.2	+	23	2595	c.2335G>C	c.(2335-2337)GAT>CAT	p.D779H	VPS13A_uc004akp.3_Missense_Mutation_p.D779H|VPS13A_uc004akq.3_Missense_Mutation_p.D779H|VPS13A_uc004aks.2_Missense_Mutation_p.D779H	NM_033305	NP_150648	Q96RL7	VP13A_HUMAN	vacuolar protein sorting 13A isoform A	779					Golgi to endosome transport|protein transport	intracellular	protein binding			pancreas(3)|skin(3)|ovary(2)|large_intestine(1)|central_nervous_system(1)	10						ACGAATCTCAGATAAAAAACT	0.299													18	94	---	---	---	---	PASS
VPS13A	23230	broad.mit.edu	37	9	79933188	79933188	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:79933188C>A	uc004akr.2	+	41	5254	c.4994C>A	c.(4993-4995)ACT>AAT	p.T1665N	VPS13A_uc004akp.3_Missense_Mutation_p.T1665N|VPS13A_uc004akq.3_Missense_Mutation_p.T1665N|VPS13A_uc004aks.2_Missense_Mutation_p.T1626N|VPS13A_uc004akt.2_Missense_Mutation_p.T5N|VPS13A_uc010mpo.1_Missense_Mutation_p.T261N	NM_033305	NP_150648	Q96RL7	VP13A_HUMAN	vacuolar protein sorting 13A isoform A	1665					Golgi to endosome transport|protein transport	intracellular	protein binding			pancreas(3)|skin(3)|ovary(2)|large_intestine(1)|central_nervous_system(1)	10						ATTACCATAACTTCAGCACTG	0.313													35	110	---	---	---	---	PASS
TLE4	7091	broad.mit.edu	37	9	82264734	82264734	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:82264734G>C	uc004ald.2	+						TLE4_uc004alc.2_Intron|TLE4_uc010mpr.2_Intron|TLE4_uc004ale.2_Intron|TLE4_uc011lsq.1_Intron|TLE4_uc010mps.2_Intron|TLE4_uc004alf.2_Intron	NM_007005	NP_008936	O60756	BCE1_HUMAN	transducin-like enhancer protein 4											lung(2)|ovary(1)|breast(1)|skin(1)	5						TTATCCTGTAGGAGAAAAAGA	0.323													12	40	---	---	---	---	PASS
FRMD3	257019	broad.mit.edu	37	9	85862922	85862922	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:85862922C>G	uc004ams.1	-	14	1907	c.1705G>C	c.(1705-1707)GAG>CAG	p.E569Q	FRMD3_uc004amr.1_Intron|FRMD3_uc004amq.1_Intron	NM_174938	NP_777598	A2A2Y4	FRMD3_HUMAN	FERM domain containing 3	569						cytoplasm|cytoskeleton|extrinsic to membrane|integral to membrane	cytoskeletal protein binding			ovary(1)|central_nervous_system(1)	2						TGAAACTGCTCAAACTCTGGT	0.493													6	188	---	---	---	---	PASS
C9orf64	84267	broad.mit.edu	37	9	86559728	86559728	+	Silent	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:86559728T>A	uc004anb.2	-	3	1022	c.774A>T	c.(772-774)CTA>CTT	p.L258L	C9orf64_uc004anc.2_Silent_p.L117L	NM_032307	NP_115683	Q5T6V5	CI064_HUMAN	hypothetical protein LOC84267	258											0						GCTTCTTCAGTAGGTCATCAG	0.388													31	121	---	---	---	---	PASS
ZCCHC6	79670	broad.mit.edu	37	9	88955023	88955023	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88955023G>C	uc004aoq.2	-						ZCCHC6_uc011ltf.1_Intron|ZCCHC6_uc004aor.2_Intron|ZCCHC6_uc004aos.2_Intron|ZCCHC6_uc004aot.2_Intron|ZCCHC6_uc004aou.2_Intron|ZCCHC6_uc004aov.2_Intron|ZCCHC6_uc004aow.2_Intron	NM_024617	NP_078893	Q5VYS8	TUT7_HUMAN	zinc finger, CCHC domain containing 6						RNA 3'-end processing		nucleic acid binding|RNA uridylyltransferase activity|zinc ion binding			ovary(2)	2						AAAGGAGTCTGAGGAAAGAAG	0.373													48	199	---	---	---	---	PASS
CTSL1	1514	broad.mit.edu	37	9	90345939	90345939	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:90345939G>A	uc004aph.2	+	8	1269	c.919G>A	c.(919-921)GGC>AGC	p.G307S	CTSL1_uc004api.2_Missense_Mutation_p.G307S|CTSL1_uc004apj.2_Missense_Mutation_p.G252S|CTSL1_uc010mqh.2_Missense_Mutation_p.G125S|CTSL1_uc004apk.2_Missense_Mutation_p.G307S|CTSL1_uc004apl.2_Missense_Mutation_p.G307S	NM_001912	NP_001903	P07711	CATL1_HUMAN	cathepsin L1 preproprotein	307					macrophage apoptosis|proteolysis	extracellular region|lysosome|nucleus	cysteine-type endopeptidase activity|histone binding			ovary(3)	3					Glucagon recombinant(DB00040)	TGAAGAATGGGGCATGGGTGG	0.488													6	55	---	---	---	---	PASS
GADD45G	10912	broad.mit.edu	37	9	92220039	92220039	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:92220039G>A	uc004aqq.2	+	1	113	c.3G>A	c.(1-3)ATG>ATA	p.M1I	GADD45G_uc004aqr.2_5'Flank	NM_006705	NP_006696	O95257	GA45G_HUMAN	growth arrest and DNA-damage-inducible, gamma	1					activation of MAPKKK activity|apoptosis|cell differentiation|DNA repair|multicellular organismal development		protein binding				0						ATCGCACTATGACTCTGGAAG	0.642													4	27	---	---	---	---	PASS
CENPP	401541	broad.mit.edu	37	9	95107999	95107999	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95107999T>A	uc004arz.2	+	4	937	c.397T>A	c.(397-399)TCT>ACT	p.S133T	CENPP_uc010mqx.2_Missense_Mutation_p.S21T|CENPP_uc004ary.1_Missense_Mutation_p.S133T	NM_001012267	NP_001012267	Q6IPU0	CENPP_HUMAN	centromere protein P	133					CenH3-containing nucleosome assembly at centromere|mitotic prometaphase	chromosome, centromeric region|cytosol|nucleoplasm				ovary(2)	2						GAGATTATCTTCTGCTGTTAC	0.289													14	73	---	---	---	---	PASS
ZNF169	169841	broad.mit.edu	37	9	97062288	97062288	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:97062288G>A	uc004aum.1	+	5	553	c.448G>A	c.(448-450)GAC>AAC	p.D150N		NM_194320	NP_919301	Q14929	ZN169_HUMAN	zinc finger protein 169	150						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2		Acute lymphoblastic leukemia(62;0.136)				AGAAGGCCCCGACAGCTCATT	0.488													20	56	---	---	---	---	PASS
NCBP1	4686	broad.mit.edu	37	9	100416152	100416152	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:100416152G>A	uc004axq.2	+	11	1591	c.1132G>A	c.(1132-1134)GAA>AAA	p.E378K		NM_002486	NP_002477	Q09161	NCBP1_HUMAN	nuclear cap binding protein subunit 1, 80kDa	378					gene silencing by RNA|histone mRNA metabolic process|mRNA 3'-end processing|mRNA capping|mRNA cleavage|mRNA export from nucleus|ncRNA metabolic process|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|positive regulation of mRNA 3'-end processing|positive regulation of viral transcription|regulation of translational initiation|spliceosomal snRNP assembly|termination of RNA polymerase II transcription|transcription elongation from RNA polymerase II promoter|viral reproduction	cytosol|mRNA cap binding complex|nucleoplasm|ribonucleoprotein complex	protein binding|RNA cap binding			central_nervous_system(1)	1		Acute lymphoblastic leukemia(62;0.158)				ACTCCTCATTGAACTGTGCAA	0.378													12	150	---	---	---	---	PASS
GALNT12	79695	broad.mit.edu	37	9	101611249	101611249	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:101611249C>T	uc004ayz.2	+	10	1621	c.1621C>T	c.(1621-1623)CAC>TAC	p.H541Y		NM_024642	NP_078918	Q8IXK2	GLT12_HUMAN	N-acetylgalactosaminyltransferase 12	541	Ricin B-type lectin.|Lumenal (Potential).					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			upper_aerodigestive_tract(1)|ovary(1)	2		Acute lymphoblastic leukemia(62;0.0559)				ATCTTTATTTCACGAACAGTC	0.423											OREG0019361	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	16	75	---	---	---	---	PASS
COL15A1	1306	broad.mit.edu	37	9	101751484	101751484	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:101751484C>T	uc004azb.1	+	5	954	c.748C>T	c.(748-750)CAG>TAG	p.Q250*		NM_001855	NP_001846	P39059	COFA1_HUMAN	alpha 1 type XV collagen precursor	250	Nonhelical region 1 (NC1).				angiogenesis|cell differentiation|signal transduction	collagen type XV|extracellular space|integral to membrane	binding			ovary(6)	6		Acute lymphoblastic leukemia(62;0.0562)				CAGTGGGCTGCAGGAGGCAGA	0.552													14	93	---	---	---	---	PASS
COL15A1	1306	broad.mit.edu	37	9	101832050	101832050	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:101832050C>T	uc004azb.1	+	42	4255	c.4049C>T	c.(4048-4050)ACG>ATG	p.T1350M		NM_001855	NP_001846	P39059	COFA1_HUMAN	alpha 1 type XV collagen precursor	1350	Nonhelical region 10 (NC10).				angiogenesis|cell differentiation|signal transduction	collagen type XV|extracellular space|integral to membrane	binding			ovary(6)	6		Acute lymphoblastic leukemia(62;0.0562)				ACAGCGGTCACGGGACTTGCC	0.542													46	154	---	---	---	---	PASS
OR13D1	286365	broad.mit.edu	37	9	107456754	107456754	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:107456754C>A	uc011lvs.1	+	1	52	c.52C>A	c.(52-54)CAT>AAT	p.H18N		NM_001004484	NP_001004484	Q8NGV5	O13D1_HUMAN	olfactory receptor, family 13, subfamily D,	18	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2						TTACCTGAATCATGTCCTTTT	0.363													18	76	---	---	---	---	PASS
FKTN	2218	broad.mit.edu	37	9	108380229	108380229	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:108380229C>G	uc004bcr.2	+						FKTN_uc011lvx.1_Intron|FKTN_uc004bcs.2_Intron|FKTN_uc011lvy.1_Intron|FKTN_uc010mtm.2_Intron	NM_001079802	NP_001073270	O75072	FKTN_HUMAN	fukutin						muscle organ development|negative regulation of cell proliferation|negative regulation of JNK cascade|nervous system development|regulation of protein glycosylation	cis-Golgi network|endoplasmic reticulum|extracellular space|Golgi membrane|integral to membrane|nucleus	transferase activity			breast(2)|ovary(1)	3						AAAATTTAATCTTCTTTTTAG	0.199													11	51	---	---	---	---	PASS
ZNF462	58499	broad.mit.edu	37	9	109687003	109687003	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:109687003C>G	uc004bcz.2	+	3	1099	c.810C>G	c.(808-810)GTC>GTG	p.V270V	ZNF462_uc010mto.2_Silent_p.V118V|ZNF462_uc004bda.2_Silent_p.V118V	NM_021224	NP_067047	Q96JM2	ZN462_HUMAN	zinc finger protein 462	270					transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(5)	5						GCAGTATGGTCAAGATCCTTT	0.522													30	91	---	---	---	---	PASS
PALM2-AKAP2	445815	broad.mit.edu	37	9	112899041	112899041	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:112899041A>T	uc004bei.2	+	9	2105	c.1913A>T	c.(1912-1914)AAG>ATG	p.K638M	PALM2-AKAP2_uc004bek.3_Missense_Mutation_p.K406M|PALM2-AKAP2_uc004bej.3_Missense_Mutation_p.K406M|PALM2-AKAP2_uc004bel.1_Missense_Mutation_p.K216M|AKAP2_uc011lwi.1_Missense_Mutation_p.K264M|AKAP2_uc004bem.2_Missense_Mutation_p.K264M|PALM2-AKAP2_uc010mtw.1_Missense_Mutation_p.K224M|AKAP2_uc011lwj.1_Missense_Mutation_p.K175M|PALM2-AKAP2_uc004ben.2_Missense_Mutation_p.K175M	NM_001136562	NP_001130034	Q9Y2D5	AKAP2_HUMAN	A kinase (PRKA) anchor protein 2 isoform 2	175							enzyme binding			ovary(3)|central_nervous_system(2)|skin(1)	6						ACACTGAAAAAGGAGGCCAAG	0.537													15	55	---	---	---	---	PASS
MUSK	4593	broad.mit.edu	37	9	113550000	113550000	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:113550000C>T	uc004bey.2	+	13	1907	c.1809C>T	c.(1807-1809)TTC>TTT	p.F603F	MUSK_uc004bez.1_Silent_p.F183F	NM_005592	NP_005583	O15146	MUSK_HUMAN	skeletal muscle receptor tyrosine kinase	603	Protein kinase.|Cytoplasmic (Potential).				transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|transmembrane receptor protein tyrosine kinase activity			lung(3)|ovary(2)|central_nervous_system(1)	6						ATGAACCTTTCACTATGGTGG	0.438													4	87	---	---	---	---	PASS
KIAA1958	158405	broad.mit.edu	37	9	115336509	115336509	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:115336509G>A	uc004bgf.1	+	2	324	c.149G>A	c.(148-150)TGT>TAT	p.C50Y	KIAA1958_uc011lwx.1_Missense_Mutation_p.C50Y	NM_133465	NP_597722	Q8N8K9	K1958_HUMAN	hypothetical protein LOC158405	50										skin(1)	1						ATGTGGGGCTGTAGTGCTGGC	0.502													14	48	---	---	---	---	PASS
KIAA1958	158405	broad.mit.edu	37	9	115336775	115336775	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:115336775G>A	uc004bgf.1	+	2	590	c.415G>A	c.(415-417)GAA>AAA	p.E139K	KIAA1958_uc011lwx.1_Missense_Mutation_p.E139K	NM_133465	NP_597722	Q8N8K9	K1958_HUMAN	hypothetical protein LOC158405	139										skin(1)	1						TGAAGAATATGAAGATGAGAA	0.453													56	157	---	---	---	---	PASS
SLC46A2	57864	broad.mit.edu	37	9	115649615	115649615	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:115649615G>C	uc004bgk.2	-	2	1440	c.1208C>G	c.(1207-1209)TCT>TGT	p.S403C		NM_033051	NP_149040	Q9BY10	TSCOT_HUMAN	solute carrier family 46, member 2	403	Cytoplasmic (Potential).					integral to membrane|plasma membrane	symporter activity			central_nervous_system(1)	1						CTCACCATAAGAGGAGCCCTT	0.502													7	18	---	---	---	---	PASS
TRAF1	7185	broad.mit.edu	37	9	123675837	123675837	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:123675837C>A	uc004bku.1	-	5	1046	c.474G>T	c.(472-474)GGG>GGT	p.G158G	TRAF1_uc011lyg.1_Silent_p.G36G|TRAF1_uc010mvl.1_Silent_p.G158G	NM_005658	NP_005649	Q13077	TRAF1_HUMAN	TNF receptor-associated factor 1	158					apoptosis|positive regulation of NF-kappaB transcription factor activity|protein complex assembly|regulation of apoptosis|signal transduction	cytoplasm	protein binding|zinc ion binding			skin(2)|ovary(1)	3						CCTCCAGGTCCCCCGCCACTT	0.662													11	85	---	---	---	---	PASS
GSN	2934	broad.mit.edu	37	9	124074660	124074660	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:124074660G>C	uc004blf.1	+	5	771	c.710G>C	c.(709-711)AGA>ACA	p.R237T	GSN_uc004bld.1_Missense_Mutation_p.R186T|GSN_uc010mvq.1_Missense_Mutation_p.R197T|GSN_uc010mvr.1_Missense_Mutation_p.R197T|GSN_uc010mvu.1_Missense_Mutation_p.R186T|GSN_uc010mvt.1_Missense_Mutation_p.R186T|GSN_uc010mvs.1_Missense_Mutation_p.R186T|GSN_uc004ble.1_Missense_Mutation_p.R186T|GSN_uc010mvv.1_Missense_Mutation_p.R186T|GSN_uc011lyh.1_Missense_Mutation_p.R203T|GSN_uc011lyi.1_Missense_Mutation_p.R186T|GSN_uc011lyj.1_Missense_Mutation_p.R210T|GSN_uc004blg.1_5'UTR	NM_000177	NP_000168	P06396	GELS_HUMAN	gelsolin isoform a precursor	237	Gelsolin-like 2.				actin filament polymerization|actin filament severing|barbed-end actin filament capping|cellular component disassembly involved in apoptosis|cilium morphogenesis	actin cytoskeleton|cytosol	actin binding|calcium ion binding|protein binding			breast(2)|ovary(1)	3						CGGTATGAAAGACTGAAGGCC	0.617													29	225	---	---	---	---	PASS
OR1B1	347169	broad.mit.edu	37	9	125391335	125391335	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:125391335C>A	uc011lyz.1	-	1	480	c.480G>T	c.(478-480)TTG>TTT	p.L160F		NM_001004450	NP_001004450	Q8NGR6	OR1B1_HUMAN	olfactory receptor, family 1, subfamily B,	160	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						GTCCCACACGCAACATGGTGT	0.557													13	40	---	---	---	---	PASS
OR1L4	254973	broad.mit.edu	37	9	125486533	125486533	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:125486533G>C	uc004bmu.1	+	1	265	c.265G>C	c.(265-267)GAG>CAG	p.E89Q		NM_001005235	NP_001005235	Q8NGR5	OR1L4_HUMAN	olfactory receptor, family 1, subfamily L,	89	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						TTTTCTATCAGAGACAAAGAT	0.448													6	180	---	---	---	---	PASS
LMX1B	4010	broad.mit.edu	37	9	129455528	129455528	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:129455528C>G	uc004bqj.2	+	4	648	c.598C>G	c.(598-600)CGG>GGG	p.R200G	LMX1B_uc004bqi.2_Missense_Mutation_p.R200G|LMX1B_uc011maa.1_Missense_Mutation_p.R200G	NM_002316	NP_002307	O60663	LMX1B_HUMAN	LIM homeobox transcription factor 1, beta	200	Homeobox.				dorsal/ventral pattern formation|in utero embryonic development	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0						CAAGCGACCCCGGACCATCCT	0.577									Nail-Patella_Syndrome				5	16	---	---	---	---	PASS
GARNL3	84253	broad.mit.edu	37	9	130100413	130100413	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130100413G>A	uc011mae.1	+	12	1402	c.1001G>A	c.(1000-1002)AGA>AAA	p.R334K	GARNL3_uc011mad.1_Missense_Mutation_p.R312K|GARNL3_uc004bqt.1_Missense_Mutation_p.R115K	NM_032293	NP_115669	Q5VVW2	GARL3_HUMAN	GTPase activating Rap/RanGAP domain-like 3	334	Rap-GAP.				regulation of small GTPase mediated signal transduction	intracellular	GTPase activator activity|small GTPase regulator activity			ovary(1)|central_nervous_system(1)|skin(1)	3						GCCTTAGTGAGATACAATCAA	0.383													53	203	---	---	---	---	PASS
SPTAN1	6709	broad.mit.edu	37	9	131383448	131383448	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131383448G>A	uc004bvl.3	+	44	5843	c.5730G>A	c.(5728-5730)AAG>AAA	p.K1910K	SPTAN1_uc004bvm.3_Silent_p.K1915K|SPTAN1_uc004bvn.3_Silent_p.K1890K	NM_003127	NP_003118	Q13813	SPTA2_HUMAN	spectrin, alpha, non-erythrocytic 1	1910	Spectrin 20.				actin filament capping|axon guidance|cellular component disassembly involved in apoptosis	cytosol|intracellular membrane-bounded organelle|membrane fraction|microtubule cytoskeleton|spectrin	actin binding|calcium ion binding|calmodulin binding|structural constituent of cytoskeleton			breast(5)|ovary(4)|pancreas(1)	10						GCTTACTGAAGAAACATGAAG	0.343													19	87	---	---	---	---	PASS
CRAT	1384	broad.mit.edu	37	9	131860614	131860614	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131860614G>A	uc004bxh.2	-	10	1524	c.1242C>T	c.(1240-1242)TTC>TTT	p.F414F	CRAT_uc004bxg.2_Silent_p.F393F|CRAT_uc004bxk.3_Silent_p.F393F	NM_000755	NP_000746	P43155	CACP_HUMAN	carnitine acetyltransferase precursor	414					energy derivation by oxidation of organic compounds|fatty acid beta-oxidation using acyl-CoA oxidase|transport	endoplasmic reticulum|mitochondrial inner membrane|peroxisomal matrix	carnitine O-acetyltransferase activity			central_nervous_system(1)	1				UCEC - Uterine corpus endometrioid carcinoma (4;0.0178)	L-Carnitine(DB00583)	CAAAATGGTGGAACACCATCA	0.597													33	119	---	---	---	---	PASS
ABL1	25	broad.mit.edu	37	9	133760253	133760253	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:133760253C>G	uc004bzw.2	+	11	2579	c.2576C>G	c.(2575-2577)TCA>TGA	p.S859*	ABL1_uc004bzv.2_Nonsense_Mutation_p.S878*	NM_005157	NP_005148	P00519	ABL1_HUMAN	c-abl oncogene 1, receptor tyrosine kinase	859	Pro-rich.				actin cytoskeleton organization|axon guidance|blood coagulation|cell adhesion|DNA damage induced protein phosphorylation|DNA damage response, signal transduction resulting in induction of apoptosis|mismatch repair|muscle cell differentiation|negative regulation of protein serine/threonine kinase activity|peptidyl-tyrosine phosphorylation|positive regulation of muscle cell differentiation|positive regulation of oxidoreductase activity|regulation of transcription involved in S phase of mitotic cell cycle	cytoskeleton|cytosol|nuclear membrane|nucleolus|perinuclear region of cytoplasm	ATP binding|DNA binding|magnesium ion binding|manganese ion binding|mitogen-activated protein kinase binding|non-membrane spanning protein tyrosine kinase activity|proline-rich region binding|protein C-terminus binding|SH3 domain binding			haematopoietic_and_lymphoid_tissue(807)|lung(5)|stomach(2)|central_nervous_system(1)|breast(1)|skin(1)	817		all_hematologic(13;0.0361)|Acute lymphoblastic leukemia(5;0.0543)|Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;5.4e-05)	Adenosine triphosphate(DB00171)|Dasatinib(DB01254)|Imatinib(DB00619)	AAAGCAGGCTCAGGTGCACCA	0.652			T|Mis	BCR|ETV6|NUP214	CML|ALL|T-ALL								18	23	---	---	---	---	PASS
BAT2L1	84726	broad.mit.edu	37	9	134321843	134321843	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134321843G>C	uc004can.3	+	6	724	c.669G>C	c.(667-669)CTG>CTC	p.L223L	BAT2L1_uc010mzj.1_5'Flank|BAT2L1_uc004cam.1_Silent_p.L223L	NM_013318	NP_037450	Q5JSZ5	PRC2B_HUMAN	HLA-B associated transcript 2-like	223							protein binding				0						CCACGTCTCTGAGCACCTCCC	0.602													10	76	---	---	---	---	PASS
RAPGEF1	2889	broad.mit.edu	37	9	134501478	134501478	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134501478C>G	uc004cbc.2	-	10	1612	c.1482G>C	c.(1480-1482)CAG>CAC	p.Q494H	RAPGEF1_uc004cbb.2_Missense_Mutation_p.Q512H|RAPGEF1_uc010mzm.2_RNA|RAPGEF1_uc010mzn.2_Missense_Mutation_p.Q499H|RAPGEF1_uc004cbd.2_Missense_Mutation_p.Q499H	NM_005312	NP_005303	Q13905	RPGF1_HUMAN	guanine nucleotide-releasing factor 2 isoform a	494					activation of MAPKK activity|nerve growth factor receptor signaling pathway|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|endosome	guanyl-nucleotide exchange factor activity|SH3 domain binding			lung(3)|ovary(2)|breast(1)|skin(1)	7		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;2.19e-05)|Epithelial(140;0.000364)		GGGCTGTGCTCTGCAGGTCCT	0.622													8	76	---	---	---	---	PASS
MED27	9442	broad.mit.edu	37	9	134814846	134814846	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134814846C>T	uc004cbe.1	-	4	517	c.495G>A	c.(493-495)GTG>GTA	p.V165V	MED27_uc004cbf.1_Silent_p.V165V|MED27_uc011mco.1_Silent_p.V165V|MED27_uc004cbg.3_Silent_p.V165V	NM_004269	NP_004260	Q6P2C8	MED27_HUMAN	mediator complex subunit 27	165					regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	cytoplasm|nucleolus|transcription factor complex	protein binding|transcription coactivator activity			skin(1)	1		Myeloproliferative disorder(178;0.206)		OV - Ovarian serous cystadenocarcinoma(145;6.82e-06)|Epithelial(140;0.000193)		TGCGGCTGATCACATCATCAA	0.373													7	138	---	---	---	---	PASS
RPL7A	6130	broad.mit.edu	37	9	136217331	136217331	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136217331C>T	uc004cde.1	+						MED22_uc004cdc.2_5'Flank|MED22_uc004cdd.2_5'Flank|RPL7A_uc004cdf.1_Intron|SNORD36A_uc010naj.2_RNA|SNORD36C_uc010nak.2_5'Flank	NM_000972	NP_000963	P62424	RL7A_HUMAN	ribosomal protein L7a						endocrine pancreas development|ribosome biogenesis|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit|membrane fraction|polysomal ribosome	RNA binding|structural constituent of ribosome				0				OV - Ovarian serous cystadenocarcinoma(145;4.93e-07)|Epithelial(140;4.09e-06)|all cancers(34;3.78e-05)		GTGAATCTCTCACTGAATTCA	0.438													106	120	---	---	---	---	PASS
OLFM1	10439	broad.mit.edu	37	9	137967606	137967606	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:137967606C>T	uc004cfl.3	+	1	518	c.54C>T	c.(52-54)CTC>CTT	p.L18L	OLFM1_uc010naq.1_Silent_p.L8L|OLFM1_uc004cfk.3_Silent_p.L18L	NM_014279	NP_055094	Q99784	NOE1_HUMAN	olfactomedin related ER localized protein	Error:Variant_position_missing_in_Q99784_after_alignment					nervous system development	endoplasmic reticulum lumen	protein binding			ovary(1)|skin(1)	2		Myeloproliferative disorder(178;0.0333)		Epithelial(140;5.49e-08)|OV - Ovarian serous cystadenocarcinoma(145;9.68e-08)|all cancers(34;1.88e-07)		GGAAGCTCCTCAGCCTCCTCT	0.687													6	35	---	---	---	---	PASS
SNAPC4	6621	broad.mit.edu	37	9	139289860	139289860	+	Missense_Mutation	SNP	C	T	T	rs145005705		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139289860C>T	uc004chh.2	-	4	370	c.361G>A	c.(361-363)GAT>AAT	p.D121N		NM_003086	NP_003077	Q5SXM2	SNPC4_HUMAN	small nuclear RNA activating complex,	121	SNAPC5-binding.				snRNA transcription from RNA polymerase II promoter|snRNA transcription from RNA polymerase III promoter	snRNA-activating protein complex	DNA binding|sequence-specific DNA binding transcription factor activity				0		Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;5.31e-06)|Epithelial(140;7.13e-06)		CCAGCCAGATCCCTCATGAGT	0.572													4	119	---	---	---	---	PASS
NOTCH1	4851	broad.mit.edu	37	9	139397647	139397647	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139397647G>A	uc004chz.2	-	27	5154	c.5154C>T	c.(5152-5154)ATC>ATT	p.I1718I	NOTCH1_uc004cia.1_Silent_p.I948I	NM_017617	NP_060087	P46531	NOTC1_HUMAN	notch1 preproprotein	1718	Extracellular (Potential).				aortic valve morphogenesis|immune response|negative regulation of BMP signaling pathway|negative regulation of cell-substrate adhesion|negative regulation of myoblast differentiation|negative regulation of osteoblast differentiation|negative regulation of transcription, DNA-dependent|Notch receptor processing	cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to membrane|nucleoplasm|plasma membrane	calcium ion binding|protein binding|receptor activity	p.1719_1720>QKGPLAAFLGALASLGSLTIPYLI(1)		haematopoietic_and_lymphoid_tissue(791)|upper_aerodigestive_tract(29)|lung(13)|central_nervous_system(10)|breast(9)|large_intestine(1)|skin(1)|oesophagus(1)|pancreas(1)	856	all_cancers(76;0.223)	Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;5.34e-06)|Epithelial(140;7.77e-06)		GCACGGCCTCGATCTTGTAGG	0.667			T|Mis|O	TRB@	T-ALL					HNSCC(8;0.001)			11	78	---	---	---	---	PASS
EHMT1	79813	broad.mit.edu	37	9	140685343	140685343	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140685343C>T	uc011mfc.1	+	16	2463	c.2426C>T	c.(2425-2427)CCG>CTG	p.P809L	EHMT1_uc004cob.1_Missense_Mutation_p.P778L	NM_024757	NP_079033	Q9H9B1	EHMT1_HUMAN	euchromatic histone-lysine N-methyltransferase 1	809	ANK 3.				DNA methylation|embryo development|peptidyl-lysine dimethylation|peptidyl-lysine monomethylation	chromosome|nucleus	histone methyltransferase activity (H3-K27 specific)|histone methyltransferase activity (H3-K9 specific)|p53 binding|zinc ion binding			breast(2)|pancreas(1)	3	all_cancers(76;0.164)			OV - Ovarian serous cystadenocarcinoma(145;0.000183)|Epithelial(140;0.000728)		CAGAGGACCCCGTTGATGGAA	0.557													54	237	---	---	---	---	PASS
CACNA1B	774	broad.mit.edu	37	9	140809200	140809200	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140809200C>T	uc004cog.2	+	5	862	c.717C>T	c.(715-717)ATC>ATT	p.I239I		NM_000718	NP_000709	Q00975	CAC1B_HUMAN	calcium channel, voltage-dependent, N type,	239	Helical; Name=S5 of repeat I; (Potential).|I.				membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	ATP binding|protein C-terminus binding|voltage-gated calcium channel activity			breast(3)|large_intestine(2)|ovary(1)	6	all_cancers(76;0.166)			OV - Ovarian serous cystadenocarcinoma(145;1.16e-05)|Epithelial(140;0.000476)	Amlodipine(DB00381)|Gabapentin(DB00996)	TGTTTGCCATCATTGGCCTGG	0.567													14	89	---	---	---	---	PASS
CACNA1B	774	broad.mit.edu	37	9	140948447	140948447	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140948447G>C	uc004cog.2	+	26	4102	c.3957G>C	c.(3955-3957)GAG>GAC	p.E1319D	CACNA1B_uc011mfd.1_Missense_Mutation_p.E849D|CACNA1B_uc004coi.2_Missense_Mutation_p.E533D	NM_000718	NP_000709	Q00975	CAC1B_HUMAN	calcium channel, voltage-dependent, N type,	1319	III.|Extracellular (Potential).				membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	ATP binding|protein C-terminus binding|voltage-gated calcium channel activity			breast(3)|large_intestine(2)|ovary(1)	6	all_cancers(76;0.166)			OV - Ovarian serous cystadenocarcinoma(145;1.16e-05)|Epithelial(140;0.000476)	Amlodipine(DB00381)|Gabapentin(DB00996)	AGGAGCTGGAGAGGGACTGCA	0.517													6	179	---	---	---	---	PASS
IDI2	91734	broad.mit.edu	37	10	1065729	1065729	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:1065729C>T	uc001ifv.1	-	5	477	c.412G>A	c.(412-414)GCA>ACA	p.A138T	C10orf110_uc010qaf.1_5'Flank|C10orf110_uc001ifx.3_5'Flank|C10orf110_uc001ifw.3_5'Flank|C10orf110_uc001ify.3_5'Flank	NM_033261	NP_150286	Q9BXS1	IDI2_HUMAN	isopentenyl-diphosphate delta isomerase 2	138	Nudix hydrolase.				carotenoid biosynthetic process|cholesterol biosynthetic process	cytosol|peroxisome	hydrolase activity|isopentenyl-diphosphate delta-isomerase activity|metal ion binding				0		Colorectal(49;0.235)	OV - Ovarian serous cystadenocarcinoma(33;0.143)	Epithelial(11;0.067)|OV - Ovarian serous cystadenocarcinoma(14;0.169)|all cancers(11;0.192)		TCTGATTTTGCCTTGTGGTGA	0.398													4	205	---	---	---	---	PASS
CELF2	10659	broad.mit.edu	37	10	11259437	11259437	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:11259437G>A	uc001iki.3	+	3	392	c.300G>A	c.(298-300)CAG>CAA	p.Q100Q	CELF2_uc010qbi.1_Intron|CELF2_uc010qbj.1_Silent_p.Q100Q|CELF2_uc001ikk.2_Silent_p.Q107Q|CELF2_uc001ikl.3_Silent_p.Q107Q|CELF2_uc010qbk.1_RNA|CELF2_uc010qbl.1_Silent_p.Q76Q|CELF2_uc010qbm.1_Intron|CELF2_uc001iko.3_Silent_p.Q76Q|CELF2_uc001ikp.3_Silent_p.Q76Q|CELF2_uc010qbn.1_Silent_p.Q84Q|CELF2_uc009xiw.1_Intron|CELF2_uc010qbo.1_Intron|CELF2_uc010qbp.1_Intron	NM_001025077	NP_001020248	O95319	CELF2_HUMAN	CUG triplet repeat, RNA binding protein 2	100	Necessary for RNA-binding, TNNT2 exon 5 and NMDA R1 exon 21 inclusion.|RRM 1.				mRNA processing|regulation of heart contraction	cytoplasm|nucleus	nucleotide binding|protein binding|RNA binding				0						TTGAGGCCCAGAATGCACTGC	0.363													7	128	---	---	---	---	PASS
CUBN	8029	broad.mit.edu	37	10	17026276	17026276	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:17026276G>A	uc001ioo.2	-	30	4405	c.4353C>T	c.(4351-4353)ATC>ATT	p.I1451I		NM_001081	NP_001072	O60494	CUBN_HUMAN	cubilin precursor	1451	CUB 9.				cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)	GGCCTCCATAGATCTAACATG	0.473													5	135	---	---	---	---	PASS
CUBN	8029	broad.mit.edu	37	10	17087132	17087132	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:17087132C>G	uc001ioo.2	-	25	3598	c.3546G>C	c.(3544-3546)CCG>CCC	p.P1182P		NM_001081	NP_001072	O60494	CUBN_HUMAN	cubilin precursor	1182	CUB 7.				cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)	AATAGGGCATCGGGTAGTTGG	0.493													53	64	---	---	---	---	PASS
NSUN6	221078	broad.mit.edu	37	10	18834947	18834947	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18834947G>T	uc010qcp.1	-	11	1743	c.1325C>A	c.(1324-1326)GCC>GAC	p.A442D	NSUN6_uc001iqb.2_5'Flank	NM_182543	NP_872349	Q8TEA1	NSUN6_HUMAN	NOL1/NOP2/Sun domain family, member 6	442							methyltransferase activity|RNA binding			ovary(2)	2						TTCTCTTCTGGCCTCTCTAAG	0.458													53	393	---	---	---	---	PASS
ARMC3	219681	broad.mit.edu	37	10	23248443	23248443	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:23248443G>A	uc001irm.3	+	6	560	c.477G>A	c.(475-477)CTG>CTA	p.L159L	ARMC3_uc010qcv.1_Silent_p.L159L|ARMC3_uc010qcw.1_Intron|ARMC3_uc001irn.1_Silent_p.L71L	NM_173081	NP_775104	Q5W041	ARMC3_HUMAN	armadillo repeat containing 3	159	ARM 4.						binding				0						TCAGACTACTGAGTAGCCCTG	0.403													17	122	---	---	---	---	PASS
ARHGAP21	57584	broad.mit.edu	37	10	24886905	24886905	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:24886905G>A	uc001isb.2	-	15	3653	c.3166C>T	c.(3166-3168)CGA>TGA	p.R1056*	ARHGAP21_uc010qdb.1_RNA|ARHGAP21_uc009xkl.1_Nonsense_Mutation_p.R1056*|ARHGAP21_uc010qdc.1_Nonsense_Mutation_p.R891*	NM_020824	NP_065875	Q5T5U3	RHG21_HUMAN	Rho GTPase activating protein 21	1055	Interaction with ARF1 and ARF6.				signal transduction	cell junction|cytoplasmic vesicle membrane|cytoskeleton|Golgi membrane	GTPase activator activity|protein binding			ovary(7)|pancreas(1)	8						TTTATTCTTCGACTAATTAGA	0.279													27	210	---	---	---	---	PASS
BAMBI	25805	broad.mit.edu	37	10	28970465	28970465	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:28970465G>A	uc001iuj.1	+	2	758	c.355G>A	c.(355-357)GAG>AAG	p.E119K	BAMBI_uc001iui.2_Missense_Mutation_p.E119K	NM_012342	NP_036474	Q13145	BAMBI_HUMAN	BMP and activin membrane-bound inhibitor	119	Extracellular (Potential).				cell migration|negative regulation of transforming growth factor beta receptor signaling pathway|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of catenin import into nucleus|positive regulation of cell proliferation|positive regulation of epithelial to mesenchymal transition|positive regulation of protein binding|positive regulation of transcription, DNA-dependent|regulation of cell shape	cytoplasm|integral to membrane|plasma membrane	frizzled binding|type II transforming growth factor beta receptor binding			central_nervous_system(4)	4						TCCCAGGGGTGAGGCCTCAGG	0.498													6	143	---	---	---	---	PASS
C10orf68	79741	broad.mit.edu	37	10	33015711	33015711	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:33015711C>G	uc001iwn.3	+	8	1013	c.540C>G	c.(538-540)CTC>CTG	p.L180L	C10orf68_uc001iwl.1_Silent_p.L188L|C10orf68_uc001iwm.1_Silent_p.L156L|C10orf68_uc010qei.1_Silent_p.L107L|C10orf68_uc001iwo.3_5'Flank	NM_024688	NP_078964	Q9H943	CJ068_HUMAN	chromosome 10 open reading frame 68	180										skin(2)|ovary(1)	3						TGTCAAAACTCCAAATGCAAG	0.274													6	76	---	---	---	---	PASS
ANKRD30A	91074	broad.mit.edu	37	10	37508127	37508127	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:37508127C>T	uc001iza.1	+	34	3418	c.3319C>T	c.(3319-3321)CAA>TAA	p.Q1107*		NM_052997	NP_443723	Q9BXX3	AN30A_HUMAN	ankyrin repeat domain 30A	1163	Potential.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(7)|breast(1)|skin(1)	9						AAGGGCATCTCAATATAGTGG	0.328													148	224	---	---	---	---	PASS
ZNF485	220992	broad.mit.edu	37	10	44104188	44104188	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:44104188G>T	uc010qfc.1	+	3	345	c.151G>T	c.(151-153)GGG>TGG	p.G51W	ZNF485_uc010qfd.1_Intron	NM_145312	NP_660355	Q8NCK3	ZN485_HUMAN	zinc finger protein 485	51	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						GGTGTCTGTGGGTGAGGATGG	0.498													9	92	---	---	---	---	PASS
OR13A1	79290	broad.mit.edu	37	10	45799724	45799724	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:45799724G>A	uc001jcc.1	-	4	456	c.147C>T	c.(145-147)TTC>TTT	p.F49F	OR13A1_uc001jcd.1_Silent_p.F45F	NM_001004297	NP_001004297	Q8NGR1	O13A1_HUMAN	olfactory receptor, family 13, subfamily A,	49	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						AGAGGAAGAGGAAACAGCTGA	0.517													11	94	---	---	---	---	PASS
ANUBL1	93550	broad.mit.edu	37	10	46121658	46121658	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:46121658G>A	uc001jcp.3	-	7	1855	c.1613C>T	c.(1612-1614)TCT>TTT	p.S538F	ANUBL1_uc001jcl.3_Missense_Mutation_p.S58F|ANUBL1_uc001jcm.3_Missense_Mutation_p.S538F|ANUBL1_uc009xmu.2_Missense_Mutation_p.S464F|ANUBL1_uc001jcn.3_Missense_Mutation_p.S464F|ANUBL1_uc001jco.3_Intron	NM_001128324	NP_001121796	Q86XD8	ANUB1_HUMAN	AN1, ubiquitin-like, homolog	538							zinc ion binding				0						AATAACATCAGATCTTTTCCC	0.378													22	230	---	---	---	---	PASS
SYT15	83849	broad.mit.edu	37	10	46968611	46968611	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:46968611G>A	uc001jea.2	-	3	478	c.325C>T	c.(325-327)CTG>TTG	p.L109L	SYT15_uc001jdz.2_Silent_p.L109L|SYT15_uc001jeb.2_5'UTR|SYT15_uc010qfp.1_5'Flank	NM_031912	NP_114118	Q9BQS2	SYT15_HUMAN	synaptotagmin XV isoform a	109	Cytoplasmic (Potential).					integral to membrane|plasma membrane					0						TGAGGCAGCAGCTCTGATGCC	0.667													5	52	---	---	---	---	PASS
FRMPD2	143162	broad.mit.edu	37	10	49393641	49393641	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:49393641C>T	uc001jgi.2	-	18	2421	c.2314G>A	c.(2314-2316)GAA>AAA	p.E772K	FRMPD2_uc001jgh.2_Missense_Mutation_p.E740K|FRMPD2_uc001jgj.2_Missense_Mutation_p.E750K	NM_001018071	NP_001018081	Q68DX3	FRPD2_HUMAN	FERM and PDZ domain containing 2 isoform 3	772					tight junction assembly	basolateral plasma membrane|cytoplasm|cytoskeleton|tight junction	1-phosphatidylinositol binding|protein binding			large_intestine(1)	1				Kidney(211;0.201)		CGTACAATTTCTCGGCCCGGT	0.493													9	121	---	---	---	---	PASS
FRMPD2	143162	broad.mit.edu	37	10	49400861	49400861	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:49400861C>G	uc001jgi.2	-	16	2138	c.2031G>C	c.(2029-2031)CAG>CAC	p.Q677H	FRMPD2_uc001jgh.2_Missense_Mutation_p.Q645H|FRMPD2_uc001jgj.2_Missense_Mutation_p.Q655H	NM_001018071	NP_001018081	Q68DX3	FRPD2_HUMAN	FERM and PDZ domain containing 2 isoform 3	677					tight junction assembly	basolateral plasma membrane|cytoplasm|cytoskeleton|tight junction	1-phosphatidylinositol binding|protein binding			large_intestine(1)	1				Kidney(211;0.201)		ATGACAATCTCTGAATCCAAA	0.473													30	121	---	---	---	---	PASS
PCDH15	65217	broad.mit.edu	37	10	55568917	55568917	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55568917G>A	uc010qhs.1	-	37	5303	c.4908C>T	c.(4906-4908)CCC>CCT	p.P1636P	PCDH15_uc010qhq.1_Intron|PCDH15_uc010qhr.1_Intron|PCDH15_uc010qht.1_Silent_p.P1629P|PCDH15_uc010qhu.1_3'UTR	NM_001142769	NP_001136241	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD2-1 precursor	Error:Variant_position_missing_in_Q96QU1_after_alignment					equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				CCTCCTCAGAGGGTGTCTCTG	0.463										HNSCC(58;0.16)			12	103	---	---	---	---	PASS
PCDH15	65217	broad.mit.edu	37	10	55663038	55663038	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55663038C>T	uc001jju.1	-	26	3861	c.3466G>A	c.(3466-3468)GAT>AAT	p.D1156N	PCDH15_uc010qhq.1_Missense_Mutation_p.D1161N|PCDH15_uc010qhr.1_Missense_Mutation_p.D1156N|PCDH15_uc010qhs.1_Missense_Mutation_p.D1168N|PCDH15_uc010qht.1_Missense_Mutation_p.D1163N|PCDH15_uc010qhu.1_Missense_Mutation_p.D1156N|PCDH15_uc001jjv.1_Intron|PCDH15_uc010qhv.1_Missense_Mutation_p.D1156N|PCDH15_uc010qhw.1_Missense_Mutation_p.D1119N|PCDH15_uc010qhx.1_Missense_Mutation_p.D1085N|PCDH15_uc010qhy.1_Missense_Mutation_p.D1161N|PCDH15_uc010qhz.1_Missense_Mutation_p.D1156N|PCDH15_uc010qia.1_Missense_Mutation_p.D1134N|PCDH15_uc010qib.1_Missense_Mutation_p.D1134N	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	1156	Cadherin 11.|Extracellular (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				ATTCTTGCATCTTCAGATACA	0.363										HNSCC(58;0.16)			32	88	---	---	---	---	PASS
PCDH15	65217	broad.mit.edu	37	10	55944935	55944935	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55944935G>A	uc001jju.1	-	12	1794	c.1399C>T	c.(1399-1401)CAA>TAA	p.Q467*	PCDH15_uc010qhq.1_Nonsense_Mutation_p.Q472*|PCDH15_uc010qhr.1_Nonsense_Mutation_p.Q467*|PCDH15_uc010qhs.1_Nonsense_Mutation_p.Q479*|PCDH15_uc010qht.1_Nonsense_Mutation_p.Q474*|PCDH15_uc010qhu.1_Nonsense_Mutation_p.Q467*|PCDH15_uc001jjv.1_Nonsense_Mutation_p.Q445*|PCDH15_uc010qhv.1_Nonsense_Mutation_p.Q467*|PCDH15_uc010qhw.1_Nonsense_Mutation_p.Q430*|PCDH15_uc010qhx.1_Nonsense_Mutation_p.Q467*|PCDH15_uc010qhy.1_Nonsense_Mutation_p.Q472*|PCDH15_uc010qhz.1_Nonsense_Mutation_p.Q467*|PCDH15_uc010qia.1_Nonsense_Mutation_p.Q445*|PCDH15_uc010qib.1_Nonsense_Mutation_p.Q445*|PCDH15_uc001jjw.2_Nonsense_Mutation_p.Q467*	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	467	Cadherin 4.|Extracellular (Potential).			Q -> L (in Ref. 1; AAK31581).	equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				TCCACTGGTTGAAGTAAGGTG	0.353										HNSCC(58;0.16)			24	144	---	---	---	---	PASS
ANK3	288	broad.mit.edu	37	10	61833437	61833437	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:61833437T>A	uc001jky.2	-	37	7394	c.7202A>T	c.(7201-7203)GAG>GTG	p.E2401V	ANK3_uc001jkw.2_Intron|ANK3_uc009xpa.2_Intron|ANK3_uc001jkx.2_Intron|ANK3_uc010qih.1_Intron|ANK3_uc001jkz.3_Intron|ANK3_uc001jkv.2_Intron|ANK3_uc009xpb.1_Intron	NM_020987	NP_066267	Q12955	ANK3_HUMAN	ankyrin 3 isoform 1	2401					establishment of protein localization|signal transduction	basolateral plasma membrane|cytoplasm|cytoskeleton	protein binding			skin(9)|ovary(6)|pancreas(2)|central_nervous_system(2)	19						AGGCAATGACTCTTCAGCAGT	0.428													36	110	---	---	---	---	PASS
TMEM26	219623	broad.mit.edu	37	10	63170105	63170105	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:63170105G>A	uc001jlo.2	-	6	1451	c.1082C>T	c.(1081-1083)TCC>TTC	p.S361F	TMEM26_uc010qij.1_RNA|TMEM26_uc001jlp.1_RNA	NM_178505	NP_848600	Q6ZUK4	TMM26_HUMAN	transmembrane protein 26	361						integral to membrane					0	Prostate(12;0.0112)					GGAGTCGTCGGAGGTGACTGG	0.582													4	91	---	---	---	---	PASS
JMJD1C	221037	broad.mit.edu	37	10	64967434	64967434	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64967434C>G	uc001jmn.2	-	10	4295	c.3995G>C	c.(3994-3996)AGA>ACA	p.R1332T	JMJD1C_uc001jml.2_Missense_Mutation_p.R1113T|JMJD1C_uc001jmm.2_Missense_Mutation_p.R1044T|JMJD1C_uc010qiq.1_Missense_Mutation_p.R1150T|JMJD1C_uc009xpi.2_Missense_Mutation_p.R1150T|JMJD1C_uc009xpj.1_RNA|JMJD1C_uc009xpk.1_Missense_Mutation_p.R369T	NM_032776	NP_116165	Q15652	JHD2C_HUMAN	jumonji domain containing 1C isoform a	1332					blood coagulation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm	histone demethylase activity (H3-K9 specific)|metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|thyroid hormone receptor binding			ovary(4)|breast(1)|central_nervous_system(1)	6	Prostate(12;0.0119)|all_hematologic(501;0.191)					AGCTGAAGATCTTTCACTAAC	0.428													88	263	---	---	---	---	PASS
DNAJC12	56521	broad.mit.edu	37	10	69565332	69565332	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69565332G>C	uc001jnb.2	-							NM_021800	NP_068572	Q9UKB3	DJC12_HUMAN	J domain containing protein 1 isoform a						protein folding		heat shock protein binding|unfolded protein binding			breast(1)	1						GTTATATAACGTGACTTACCT	0.408													156	634	---	---	---	---	PASS
MYPN	84665	broad.mit.edu	37	10	69934214	69934214	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69934214C>A	uc001jnm.3	+	12	2550	c.2365C>A	c.(2365-2367)CCA>ACA	p.P789T	MYPN_uc001jnn.3_Missense_Mutation_p.P514T|MYPN_uc001jno.3_Missense_Mutation_p.P789T|MYPN_uc009xpt.2_Missense_Mutation_p.P789T|MYPN_uc010qit.1_Missense_Mutation_p.P495T|MYPN_uc010qiu.1_RNA	NM_032578	NP_115967	Q86TC9	MYPN_HUMAN	myopalladin	789	Pro-rich.					nucleus|sarcomere	actin binding			ovary(3)|skin(2)	5						CCCACCAGGCCCAACAGAACC	0.542													31	76	---	---	---	---	PASS
TET1	80312	broad.mit.edu	37	10	70332691	70332691	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70332691C>A	uc001jok.3	+	2	1101	c.596C>A	c.(595-597)TCC>TAC	p.S199Y		NM_030625	NP_085128	Q8NFU7	TET1_HUMAN	CXXC finger 6	199					DNA demethylation|inner cell mass cell differentiation|negative regulation of methylation-dependent chromatin silencing|stem cell maintenance		iron ion binding|methylcytosine dioxygenase activity|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|structure-specific DNA binding|zinc ion binding			ovary(5)|lung(2)|prostate(1)|breast(1)	9						GTTGAGGATTCCAAGATCAAT	0.468													28	121	---	---	---	---	PASS
CCAR1	55749	broad.mit.edu	37	10	70502187	70502187	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70502187C>T	uc001joo.2	+	6	498	c.379C>T	c.(379-381)CAA>TAA	p.Q127*	CCAR1_uc001jol.1_RNA|CCAR1_uc001jom.1_5'UTR|CCAR1_uc009xpx.1_Nonsense_Mutation_p.Q101*|CCAR1_uc001jon.1_Nonsense_Mutation_p.Q73*|CCAR1_uc010qiz.1_Nonsense_Mutation_p.Q112*|CCAR1_uc010qja.1_Nonsense_Mutation_p.Q112*|CCAR1_uc010qjb.1_RNA	NM_018237	NP_060707	Q8IX12	CCAR1_HUMAN	cell-cycle and apoptosis regulatory protein 1	127					apoptosis|cell cycle|nuclear mRNA splicing, via spliceosome|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm|perinuclear region of cytoplasm	calcium ion binding|nucleic acid binding|protein binding			ovary(6)|large_intestine(1)	7						GCCAACAGCACAAATAACTGT	0.423													59	127	---	---	---	---	PASS
CCAR1	55749	broad.mit.edu	37	10	70509417	70509417	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70509417C>T	uc001joo.2	+	10	1212	c.1093C>T	c.(1093-1095)CAG>TAG	p.Q365*	CCAR1_uc001jol.1_RNA|CCAR1_uc001jom.1_Nonsense_Mutation_p.Q170*|CCAR1_uc009xpx.1_Nonsense_Mutation_p.Q339*|CCAR1_uc001jon.1_Nonsense_Mutation_p.Q311*|CCAR1_uc010qiz.1_Nonsense_Mutation_p.Q350*|CCAR1_uc010qja.1_Nonsense_Mutation_p.Q350*|CCAR1_uc010qjb.1_RNA	NM_018237	NP_060707	Q8IX12	CCAR1_HUMAN	cell-cycle and apoptosis regulatory protein 1	365					apoptosis|cell cycle|nuclear mRNA splicing, via spliceosome|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm|perinuclear region of cytoplasm	calcium ion binding|nucleic acid binding|protein binding			ovary(6)|large_intestine(1)	7						TTACACAGTTCAGTTTTCAAA	0.413													8	301	---	---	---	---	PASS
NEUROG3	50674	broad.mit.edu	37	10	71332178	71332178	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:71332178G>C	uc001jpp.2	-	2	780	c.622C>G	c.(622-624)CTG>GTG	p.L208V		NM_020999	NP_066279	Q9Y4Z2	NGN3_HUMAN	neurogenin 3	208					central nervous system development|endocrine pancreas development|peripheral nervous system development|positive regulation of sequence-specific DNA binding transcription factor activity	nucleus	transcription coactivator activity				0						GAGAAAGCCAGACTGCCTGGG	0.662													2	10	---	---	---	---	PASS
SAR1A	56681	broad.mit.edu	37	10	71920822	71920822	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:71920822G>A	uc010qjh.1	-	5	385	c.182C>T	c.(181-183)TCA>TTA	p.S61L	SAR1A_uc010qji.1_Missense_Mutation_p.S61L|SAR1A_uc010qjj.1_Missense_Mutation_p.S18L	NM_001142648	NP_001136120	Q9NR31	SAR1A_HUMAN	SAR1a gene homolog 1	61					ER to Golgi vesicle-mediated transport|intracellular protein transport	Golgi apparatus	GTP binding|GTPase activity				0						TAGCTCTTCTGATGCTGAAAA	0.363													5	293	---	---	---	---	PASS
NODAL	4838	broad.mit.edu	37	10	72195636	72195636	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72195636G>C	uc001jrc.2	-	2	339	c.297C>G	c.(295-297)AGC>AGG	p.S99R		NM_018055	NP_060525	Q96S42	NODAL_HUMAN	nodal precursor	99					growth	extracellular space	cytokine activity|growth factor activity			large_intestine(1)|kidney(1)	2						GGTCCACAGGGCTGGACAGCT	0.572													21	79	---	---	---	---	PASS
SFTPA1	653509	broad.mit.edu	37	10	81373495	81373495	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:81373495C>G	uc001kap.2	+	6	494	c.373C>G	c.(373-375)CTC>GTC	p.L125V	SFTPA1_uc001kaq.2_Missense_Mutation_p.L125V|SFTPA1_uc009xry.2_Missense_Mutation_p.L140V|SFTPA1_uc001kar.2_Missense_Mutation_p.L125V|SFTPA1_uc010qlt.1_Missense_Mutation_p.L66V|SFTPA1_uc009xrz.2_Missense_Mutation_p.L55V|SFTPA1_uc009xsa.2_Missense_Mutation_p.L125V|SFTPA1_uc009xsf.2_5'Flank	NM_005411	NP_005402	Q8IWL2	SFTA1_HUMAN	surfactant protein A1 isoform 1	125					cell junction assembly|respiratory gaseous exchange	collagen|extracellular space	lipid transporter activity|sugar binding				0	all_cancers(46;0.197)|Breast(12;0.000326)|Prostate(51;0.00985)|all_epithelial(25;0.0149)		Epithelial(14;0.00957)|all cancers(16;0.0179)|Colorectal(32;0.229)			GCTCTCAGCCCTCAGTCTGCA	0.562													50	244	---	---	---	---	PASS
LDB3	11155	broad.mit.edu	37	10	88441531	88441531	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:88441531G>T	uc001kdv.2	+	4	683	c.660G>T	c.(658-660)GGG>GGT	p.G220G	LDB3_uc010qml.1_Silent_p.G220G|LDB3_uc010qmm.1_Silent_p.G220G|LDB3_uc001kdu.2_Intron|LDB3_uc009xsz.2_Intron|LDB3_uc001kdr.2_Intron|LDB3_uc009xsy.2_Silent_p.G220G|LDB3_uc001kds.2_Silent_p.G220G|LDB3_uc001kdt.2_RNA	NM_007078	NP_009009	O75112	LDB3_HUMAN	LIM domain binding 3 isoform 1	220						cytoskeleton|perinuclear region of cytoplasm|pseudopodium	zinc ion binding			ovary(1)	1						GCCTCCGAGGGAAGGCCTCGG	0.627													6	187	---	---	---	---	PASS
LDB3	11155	broad.mit.edu	37	10	88485898	88485898	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:88485898C>A	uc001kdv.2	+	12	2006	c.1983C>A	c.(1981-1983)TAC>TAA	p.Y661*	LDB3_uc010qmm.1_Nonsense_Mutation_p.Y666*|LDB3_uc001kdu.2_Nonsense_Mutation_p.Y551*|LDB3_uc009xsz.2_Nonsense_Mutation_p.Y290*|LDB3_uc009xta.1_Nonsense_Mutation_p.Y40*	NM_007078	NP_009009	O75112	LDB3_HUMAN	LIM domain binding 3 isoform 1	661	LIM zinc-binding 2.					cytoskeleton|perinuclear region of cytoplasm|pseudopodium	zinc ion binding			ovary(1)	1						TTTCAGACTACATCAATCTGT	0.577													10	34	---	---	---	---	PASS
C10orf4	118924	broad.mit.edu	37	10	95447185	95447185	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95447185C>G	uc001kiz.1	-	8	685	c.487G>C	c.(487-489)GAA>CAA	p.E163Q	C10orf4_uc001kiv.1_RNA|C10orf4_uc001kja.1_Missense_Mutation_p.E163Q	NM_145246	NP_660289	Q70Z53	F10C1_HUMAN	FRA10AC1 protein	163	Lys-rich.					nucleus	protein binding				0		Colorectal(252;0.122)				ACTTCTTTTTCTACTCGCCAC	0.254													4	30	---	---	---	---	PASS
LGI1	9211	broad.mit.edu	37	10	95518121	95518121	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95518121G>A	uc001kjc.3	+						LGI1_uc010qnv.1_Intron|LGI1_uc001kjd.3_Intron|LGI1_uc009xui.2_RNA|LGI1_uc001kje.2_RNA	NM_005097	NP_005088	O95970	LGI1_HUMAN	leucine-rich, glioma inactivated 1 precursor						axon guidance|cell proliferation|positive regulation of cell growth|positive regulation of synaptic transmission	cell junction|extracellular space|synapse	receptor binding			ovary(2)|central_nervous_system(1)|skin(1)	4		Colorectal(252;0.124)				CTCATTGTAAGGCCCGTAAGC	0.423													11	223	---	---	---	---	PASS
ALDH18A1	5832	broad.mit.edu	37	10	97376222	97376222	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97376222C>A	uc001kkz.2	-						ALDH18A1_uc001kky.2_Intron|ALDH18A1_uc010qog.1_Intron|ALDH18A1_uc010qoh.1_Intron	NM_002860	NP_002851	P54886	P5CS_HUMAN	pyrroline-5-carboxylate synthetase isoform 1						proline biosynthetic process	mitochondrial inner membrane	ATP binding|glutamate 5-kinase activity|glutamate-5-semialdehyde dehydrogenase activity			pancreas(1)|central_nervous_system(1)|skin(1)	3		Colorectal(252;0.0402)		Epithelial(162;9.1e-07)|all cancers(201;2.55e-05)	L-Glutamic Acid(DB00142)	TGGTGCATTCCCAGGGACCTA	0.547													5	11	---	---	---	---	PASS
TLL2	7093	broad.mit.edu	37	10	98180750	98180750	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:98180750C>G	uc001kml.1	-	7	1112	c.886G>C	c.(886-888)GAC>CAC	p.D296H	TLL2_uc009xvf.1_Missense_Mutation_p.D244H	NM_012465	NP_036597	Q9Y6L7	TLL2_HUMAN	tolloid-like 2 precursor	296	Metalloprotease (By similarity).				cell differentiation|multicellular organismal development|proteolysis	extracellular region	calcium ion binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|pancreas(1)|skin(1)	3		Colorectal(252;0.0846)		Epithelial(162;1.51e-07)|all cancers(201;7.59e-06)		ATGATGCTGTCAAAGTCGTAT	0.483													11	531	---	---	---	---	PASS
SLIT1	6585	broad.mit.edu	37	10	98825822	98825822	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:98825822G>C	uc001kmw.2	-	5	687	c.435C>G	c.(433-435)ATC>ATG	p.I145M	SLIT1_uc009xvh.1_Missense_Mutation_p.I145M	NM_003061	NP_003052	O75093	SLIT1_HUMAN	slit homolog 1 precursor	145	LRR 4.				axon extension involved in axon guidance|forebrain morphogenesis|motor axon guidance|negative chemotaxis|negative regulation of synaptogenesis	cytoplasm|extracellular space	calcium ion binding|Roundabout binding			ovary(4)	4		Colorectal(252;0.162)		Epithelial(162;2.02e-08)|all cancers(201;1.5e-06)		GGATGGCCTGGATGGCGTTCT	0.552													11	12	---	---	---	---	PASS
MMS19	64210	broad.mit.edu	37	10	99229407	99229407	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99229407C>G	uc001kns.3	-	11	1145	c.920G>C	c.(919-921)AGA>ACA	p.R307T	MMS19_uc009xvs.2_5'Flank|MMS19_uc009xvt.2_Missense_Mutation_p.R149T|MMS19_uc001knr.2_Missense_Mutation_p.R149T|MMS19_uc010qox.1_Missense_Mutation_p.R285T|MMS19_uc001knt.2_Missense_Mutation_p.R307T|MMS19_uc001knu.1_RNA	NM_022362	NP_071757	Q96T76	MMS19_HUMAN	MMS19 nucleotide excision repair homolog	307					chromosome segregation|nucleotide-excision repair|positive regulation of transcription, DNA-dependent|response to hormone stimulus|transcription, DNA-dependent|two-component signal transduction system (phosphorelay)	cytoplasm|holo TFIIH complex|MMXD complex	estrogen receptor binding|protein binding, bridging|receptor signaling complex scaffold activity|transcription coactivator activity				0		Colorectal(252;0.0846)		Epithelial(162;3.33e-10)|all cancers(201;2.74e-08)		ACTCACCTCTCTGCGGATAGA	0.368								Direct_reversal_of_damage|NER					7	93	---	---	---	---	PASS
UBTD1	80019	broad.mit.edu	37	10	99330049	99330049	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99330049G>A	uc001knv.1	+	3	646	c.453G>A	c.(451-453)CTG>CTA	p.L151L	ANKRD2_uc001knw.2_5'Flank|ANKRD2_uc009xvu.2_5'Flank	NM_024954	NP_079230	Q9HAC8	UBTD1_HUMAN	ubiquitin domain containing 1	151	Ubiquitin-like.										0		Colorectal(252;0.162)		Epithelial(162;3.04e-10)|all cancers(201;2.86e-08)		AGTTCCCGCTGAAGGTGCGCC	0.697													5	63	---	---	---	---	PASS
SFRP5	6425	broad.mit.edu	37	10	99531265	99531265	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99531265C>A	uc001kor.3	-	1	492	c.326G>T	c.(325-327)TGC>TTC	p.C109F		NM_003015	NP_003006	Q5T4F7	SFRP5_HUMAN	secreted frizzled-related protein 5 precursor	109	FZ.				apoptosis|brain development|cell differentiation|embryo development|establishment or maintenance of cell polarity|gonad development|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of catenin import into nucleus|negative regulation of cell proliferation|negative regulation of protein kinase B signaling cascade|negative regulation of sequence-specific DNA binding transcription factor activity|vasculature development|visual perception	cytoplasm|extracellular space|plasma membrane	PDZ domain binding|Wnt receptor activity|Wnt-protein binding			lung(1)	1		Colorectal(252;0.234)		Epithelial(162;4.98e-10)|all cancers(201;3.58e-08)		AAAGAGCGAGCACAGGAAGAC	0.697													3	49	---	---	---	---	PASS
DNMBP	23268	broad.mit.edu	37	10	101656145	101656145	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101656145T>C	uc001kqj.2	-	10	3022	c.2930A>G	c.(2929-2931)TAC>TGC	p.Y977C	DNMBP_uc010qpl.1_Intron|DNMBP_uc001kqg.2_Missense_Mutation_p.Y265C|DNMBP_uc001kqh.2_Missense_Mutation_p.Y609C	NM_015221	NP_056036	Q6XZF7	DNMBP_HUMAN	dynamin binding protein	977					intracellular signal transduction|regulation of Rho protein signal transduction	cell junction|cytoskeleton|Golgi stack|synapse	protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(5)|skin(1)	6		Colorectal(252;0.234)		Epithelial(162;2.94e-10)|all cancers(201;3.15e-08)		ACCCTTACGGTACTTGAGGAC	0.433													57	97	---	---	---	---	PASS
DNMBP	23268	broad.mit.edu	37	10	101728861	101728861	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101728861G>A	uc001kqj.2	-							NM_015221	NP_056036	Q6XZF7	DNMBP_HUMAN	dynamin binding protein						intracellular signal transduction|regulation of Rho protein signal transduction	cell junction|cytoskeleton|Golgi stack|synapse	protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(5)|skin(1)	6		Colorectal(252;0.234)		Epithelial(162;2.94e-10)|all cancers(201;3.15e-08)		ACTATTTGATGAGCAGCTTAC	0.423													43	95	---	---	---	---	PASS
BTRC	8945	broad.mit.edu	37	10	103281516	103281516	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:103281516C>T	uc001kta.2	+	5	558	c.445C>T	c.(445-447)CAA>TAA	p.Q149*	BTRC_uc001ktb.2_Nonsense_Mutation_p.Q113*|BTRC_uc001ktc.2_Nonsense_Mutation_p.Q123*	NM_033637	NP_378663	Q9Y297	FBW1A_HUMAN	beta-transducin repeat containing protein	149	Homodimerization domain D.				anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|interspecies interaction between organisms|negative regulation of transcription, DNA-dependent|positive regulation of proteolysis|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein destabilization|viral reproduction|Wnt receptor signaling pathway	cytosol|nucleus|SCF ubiquitin ligase complex				ovary(1)	1		Colorectal(252;0.234)		Epithelial(162;1.05e-08)|all cancers(201;6.59e-07)		AGAGTCAGATCAAGTGGAATT	0.398													7	133	---	---	---	---	PASS
PPRC1	23082	broad.mit.edu	37	10	103906839	103906839	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:103906839G>C	uc001kum.2	+	9	4129	c.4090G>C	c.(4090-4092)GAT>CAT	p.D1364H	PPRC1_uc001kun.2_Missense_Mutation_p.D1244H|PPRC1_uc010qqj.1_Intron|PPRC1_uc009xxa.2_Intron	NM_015062	NP_055877	Q5VV67	PPRC1_HUMAN	peroxisome proliferator-activated receptor	1364					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	nucleotide binding|RNA binding			ovary(1)|central_nervous_system(1)|skin(1)	3		Colorectal(252;0.122)		Epithelial(162;4.97e-08)|all cancers(201;8.99e-07)		TGAGCAGGCAGATCCCTCAGC	0.627													3	51	---	---	---	---	PASS
PSD	5662	broad.mit.edu	37	10	104164663	104164663	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:104164663G>A	uc001kvg.1	-	14	3074	c.2547C>T	c.(2545-2547)TTC>TTT	p.F849F	PSD_uc001kve.1_Silent_p.F57F|PSD_uc001kvf.1_Silent_p.F218F|PSD_uc001kvh.1_Silent_p.F470F|PSD_uc009xxd.1_Silent_p.F849F	NM_002779	NP_002770	A5PKW4	PSD1_HUMAN	pleckstrin and Sec7 domain containing	849	PH.				regulation of ARF protein signal transduction	cytoplasm|plasma membrane|ruffle	ARF guanyl-nucleotide exchange factor activity|signal transducer activity			breast(2)|urinary_tract(1)	3				Epithelial(162;1.27e-08)|all cancers(201;2.85e-07)		ACGGGGCCTGGAAGAGGAAGA	0.627													12	13	---	---	---	---	PASS
PCGF6	84108	broad.mit.edu	37	10	105086378	105086378	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105086378C>G	uc001kwt.2	-	8	890	c.822G>C	c.(820-822)AAG>AAC	p.K274N	PCGF6_uc001kwu.2_Missense_Mutation_p.K199N|PCGF6_uc009xxk.2_RNA|PCGF6_uc009xxl.2_RNA|PCGF6_uc009xxm.2_RNA	NM_001011663	NP_001011663	Q9BYE7	PCGF6_HUMAN	polycomb group ring finger 6 isoform a	274					negative regulation of transcription, DNA-dependent	PcG protein complex	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			kidney(1)	1		Colorectal(252;0.0747)|Breast(234;0.128)		Epithelial(162;2.57e-09)|all cancers(201;7.21e-08)|BRCA - Breast invasive adenocarcinoma(275;0.205)		GAACAAACTTCTTTTCCAATG	0.333													7	81	---	---	---	---	PASS
OBFC1	79991	broad.mit.edu	37	10	105657381	105657381	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105657381C>A	uc001kxl.2	-	6	753	c.678G>T	c.(676-678)CAG>CAT	p.Q226H	OBFC1_uc001kxm.2_Missense_Mutation_p.Q226H|OBFC1_uc001kxn.2_RNA	NM_024928	NP_079204	Q9H668	STN1_HUMAN	oligonucleotide/oligosaccharide-binding fold	226					positive regulation of DNA replication|telomere maintenance via telomere lengthening		protein binding|single-stranded telomeric DNA binding			ovary(1)	1		Colorectal(252;0.178)		Epithelial(162;3.39e-10)|all cancers(201;1.32e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0151)		CCAGCTCCTGCTGGTAAAAGC	0.537													4	136	---	---	---	---	PASS
COL17A1	1308	broad.mit.edu	37	10	105796278	105796278	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105796278C>G	uc001kxr.2	-	48	3559	c.3390G>C	c.(3388-3390)CTG>CTC	p.L1130L		NM_000494	NP_000485	Q9UMD9	COHA1_HUMAN	alpha 1 type XVII collagen	1130	Extracellular (Potential).|Triple-helical region.				cell-matrix adhesion|epidermis development|hemidesmosome assembly	basement membrane|cell-cell junction|collagen|hemidesmosome|integral to plasma membrane	protein binding			ovary(4)|pancreas(1)	5		Colorectal(252;0.103)|Breast(234;0.122)		Epithelial(162;2.5e-09)|all cancers(201;7.94e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0165)		TGCGACTACTCAGCTCTGCAT	0.587													34	49	---	---	---	---	PASS
COL17A1	1308	broad.mit.edu	37	10	105824224	105824224	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105824224G>A	uc001kxr.2	-	10	907	c.738C>T	c.(736-738)CTC>CTT	p.L246L	COL17A1_uc010qqv.1_Silent_p.L230L|COL17A1_uc009xxp.1_Silent_p.L246L	NM_000494	NP_000485	Q9UMD9	COHA1_HUMAN	alpha 1 type XVII collagen	246	Cytoplasmic (Potential).|Nonhelical region (NC16).				cell-matrix adhesion|epidermis development|hemidesmosome assembly	basement membrane|cell-cell junction|collagen|hemidesmosome|integral to plasma membrane	protein binding			ovary(4)|pancreas(1)	5		Colorectal(252;0.103)|Breast(234;0.122)		Epithelial(162;2.5e-09)|all cancers(201;7.94e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0165)		CATTGGTGTTGAGGAGGGATG	0.607													4	54	---	---	---	---	PASS
SORCS1	114815	broad.mit.edu	37	10	108589406	108589406	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:108589406C>G	uc001kym.2	-	3	660	c.652G>C	c.(652-654)GAG>CAG	p.E218Q	SORCS1_uc001kyl.2_Missense_Mutation_p.E218Q|SORCS1_uc009xxs.2_Missense_Mutation_p.E218Q|SORCS1_uc001kyn.1_Missense_Mutation_p.E218Q|SORCS1_uc001kyo.2_Missense_Mutation_p.E218Q	NM_052918	NP_443150	Q8WY21	SORC1_HUMAN	SORCS receptor 1 isoform a	218	Lumenal (Potential).|BNR 1.					integral to membrane	neuropeptide receptor activity|protein binding			breast(1)|central_nervous_system(1)	2		Breast(234;0.0256)|Colorectal(252;0.09)|Lung NSC(174;0.168)		Epithelial(162;1.66e-05)|all cancers(201;0.000689)		TTCAGCTTCTCATAGGTTGTT	0.363													7	189	---	---	---	---	PASS
ADD3	120	broad.mit.edu	37	10	111892125	111892125	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:111892125C>T	uc001kyt.3	+	15	2109	c.1795C>T	c.(1795-1797)CAG>TAG	p.Q599*	ADD3_uc001kys.3_Intron|ADD3_uc001kyu.2_Nonsense_Mutation_p.Q599*|ADD3_uc001kyv.2_Nonsense_Mutation_p.Q599*|ADD3_uc001kyw.2_Intron|ADD3_uc001kyx.2_Nonsense_Mutation_p.Q172*	NM_016824	NP_058432	Q9UEY8	ADDG_HUMAN	adducin 3 (gamma) isoform a	599						cytoskeleton	actin binding|calmodulin binding|metal ion binding|structural constituent of cytoskeleton			ovary(2)|skin(2)|large_intestine(1)	5		Breast(234;0.052)|Lung NSC(174;0.223)		Epithelial(162;4.15e-05)|all cancers(201;0.000587)|BRCA - Breast invasive adenocarcinoma(275;0.0742)		GTCTCAAACTCAGTCACCGCA	0.393													4	97	---	---	---	---	PASS
HABP2	3026	broad.mit.edu	37	10	115343952	115343952	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:115343952C>T	uc001lai.3	+	11	1386	c.1283C>T	c.(1282-1284)TCC>TTC	p.S428F	HABP2_uc010qrz.1_RNA	NM_004132	NP_004123	Q14520	HABP2_HUMAN	hyaluronan binding protein 2 preproprotein	428	Peptidase S1.				cell adhesion|proteolysis	extracellular space	glycosaminoglycan binding|serine-type endopeptidase activity			ovary(2)|skin(1)	3		Colorectal(252;0.0233)|Breast(234;0.0672)		Epithelial(162;0.00319)|all cancers(201;0.0112)		GCTCTAGAATCCAAATACGTG	0.507													4	89	---	---	---	---	PASS
ATRNL1	26033	broad.mit.edu	37	10	117075230	117075230	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:117075230C>A	uc001lcg.2	+	18	3407	c.3021C>A	c.(3019-3021)TCC>TCA	p.S1007S	ATRNL1_uc010qsm.1_Silent_p.S182S|ATRNL1_uc010qsn.1_RNA	NM_207303	NP_997186	Q5VV63	ATRN1_HUMAN	attractin-like 1 precursor	1007	PSI 5.|Extracellular (Potential).					integral to membrane	sugar binding			ovary(5)|lung(1)|central_nervous_system(1)	7		all_lung(145;0.0686)|Breast(234;0.0969)|Lung NSC(174;0.17)|Colorectal(252;0.234)		Epithelial(162;0.00031)|all cancers(201;0.000753)|LUSC - Lung squamous cell carcinoma(1;0.0515)|Lung(30;0.0827)		ATGAGTGGTCCTTTATCCAGT	0.373													55	108	---	---	---	---	PASS
PNLIP	5406	broad.mit.edu	37	10	118306940	118306940	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118306940G>C	uc001lcm.2	+	3	224	c.181G>C	c.(181-183)GAG>CAG	p.E61Q		NM_000936	NP_000927	P16233	LIPP_HUMAN	pancreatic lipase precursor	61					lipid catabolic process|retinoid metabolic process|steroid metabolic process	extracellular region	retinyl-palmitate esterase activity|triglyceride lipase activity			ovary(1)|central_nervous_system(1)|skin(1)	3				all cancers(201;0.0131)	Bentiromide(DB00522)|Orlistat(DB01083)	ATATACTAATGAGAACCCAAA	0.318													4	111	---	---	---	---	PASS
HSPA12A	259217	broad.mit.edu	37	10	118460505	118460505	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118460505G>T	uc001lct.2	-	4	495	c.390C>A	c.(388-390)GCC>GCA	p.A130A	HSPA12A_uc001lcu.2_Silent_p.A47A	NM_025015	NP_079291	O43301	HS12A_HUMAN	heat shock 70kDa protein 12A	130							ATP binding			ovary(1)	1				all cancers(201;0.0158)		GCCACTGCTTGGCCTCATTGG	0.577													13	182	---	---	---	---	PASS
VAX1	11023	broad.mit.edu	37	10	118891708	118891708	+	3'UTR	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118891708C>A	uc001ldb.1	-	4						NM_199131	NP_954582	Q5SQQ9	VAX1_HUMAN	ventral anterior homeobox 1 isoform b							nucleus	sequence-specific DNA binding			ovary(2)	2				all cancers(201;0.0108)		GTACCAGTCGCAGGGCCCCGC	0.577													9	78	---	---	---	---	PASS
SLC18A2	6571	broad.mit.edu	37	10	119003708	119003708	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:119003708C>T	uc001ldd.1	+	3	379	c.348C>T	c.(346-348)GAC>GAT	p.D116D	SLC18A2_uc009xyy.1_5'UTR	NM_003054	NP_003045	Q05940	VMAT2_HUMAN	solute carrier family 18 (vesicular monoamine),	116	Lumenal, vesicle (Potential).				neurotransmitter secretion	clathrin sculpted monoamine transport vesicle membrane|integral to plasma membrane|membrane fraction	monoamine transmembrane transporter activity				0		Colorectal(252;0.19)		all cancers(201;0.029)	Alseroxylon(DB00386)|Reserpine(DB00206)|Tetrabenazine(DB04844)	TTCCTTCCGACTGTCCCAGTG	0.522													39	79	---	---	---	---	PASS
DMBT1	1755	broad.mit.edu	37	10	124399867	124399867	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124399867C>T	uc001lgk.1	+	52	6973	c.6867C>T	c.(6865-6867)CTC>CTT	p.L2289L	DMBT1_uc001lgl.1_Silent_p.L2279L|DMBT1_uc001lgm.1_Silent_p.L1661L|DMBT1_uc009xzz.1_Silent_p.L2288L|DMBT1_uc010qtx.1_Silent_p.L1009L|DMBT1_uc009yab.1_Silent_p.L992L|DMBT1_uc009yac.1_Silent_p.L583L	NM_007329	NP_015568	Q9UGM3	DMBT1_HUMAN	deleted in malignant brain tumors 1 isoform b	2289	ZP.				epithelial cell differentiation|induction of bacterial agglutination|innate immune response|interspecies interaction between organisms|protein transport|response to virus	extrinsic to membrane|phagocytic vesicle membrane|zymogen granule membrane	calcium-dependent protein binding|Gram-negative bacterial cell surface binding|Gram-positive bacterial cell surface binding|pattern recognition receptor activity|scavenger receptor activity|zymogen binding			central_nervous_system(7)	7		all_neural(114;0.0765)|Lung NSC(174;0.132)|all_lung(145;0.163)|Breast(234;0.238)				CTGAAATCCTCCATTCTGATG	0.468													39	147	---	---	---	---	PASS
DMBT1	1755	broad.mit.edu	37	10	124399868	124399868	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124399868C>A	uc001lgk.1	+	52	6974	c.6868C>A	c.(6868-6870)CAT>AAT	p.H2290N	DMBT1_uc001lgl.1_Missense_Mutation_p.H2280N|DMBT1_uc001lgm.1_Missense_Mutation_p.H1662N|DMBT1_uc009xzz.1_Missense_Mutation_p.H2289N|DMBT1_uc010qtx.1_Missense_Mutation_p.H1010N|DMBT1_uc009yab.1_Missense_Mutation_p.H993N|DMBT1_uc009yac.1_Missense_Mutation_p.H584N	NM_007329	NP_015568	Q9UGM3	DMBT1_HUMAN	deleted in malignant brain tumors 1 isoform b	2290	ZP.				epithelial cell differentiation|induction of bacterial agglutination|innate immune response|interspecies interaction between organisms|protein transport|response to virus	extrinsic to membrane|phagocytic vesicle membrane|zymogen granule membrane	calcium-dependent protein binding|Gram-negative bacterial cell surface binding|Gram-positive bacterial cell surface binding|pattern recognition receptor activity|scavenger receptor activity|zymogen binding			central_nervous_system(7)	7		all_neural(114;0.0765)|Lung NSC(174;0.132)|all_lung(145;0.163)|Breast(234;0.238)				TGAAATCCTCCATTCTGATGC	0.468													39	147	---	---	---	---	PASS
C10orf88	80007	broad.mit.edu	37	10	124692056	124692056	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124692056C>T	uc001lgw.2	-	6	1450	c.1225G>A	c.(1225-1227)GAT>AAT	p.D409N	C10orf88_uc001lgx.2_Missense_Mutation_p.D311N	NM_024942	NP_079218	Q9H8K7	CJ088_HUMAN	hypothetical protein LOC80007	409											0		all_neural(114;0.0765)|Lung NSC(174;0.163)|all_lung(145;0.205)		Colorectal(40;0.0686)|COAD - Colon adenocarcinoma(40;0.0735)		ATCTTATCATCAATGTGCTCC	0.383													4	187	---	---	---	---	PASS
C10orf137	26098	broad.mit.edu	37	10	127413989	127413989	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:127413989C>G	uc001liq.1	+	5	906	c.613C>G	c.(613-615)CTT>GTT	p.L205V	C10orf137_uc001lin.2_Missense_Mutation_p.L205V|C10orf137_uc001lio.1_Missense_Mutation_p.L205V|C10orf137_uc001lip.1_5'UTR	NM_015608	NP_056423	Q3B7T1	EDRF1_HUMAN	erythroid differentiation-related factor 1	205					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	binding			ovary(5)|large_intestine(3)|lung(2)	10		all_lung(145;0.0096)|Lung NSC(174;0.0145)|Colorectal(57;0.0846)|all_neural(114;0.0936)				AAAGGCAATTCTTTCCAAGTT	0.343													4	136	---	---	---	---	PASS
MMP21	118856	broad.mit.edu	37	10	127464271	127464271	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:127464271T>C	uc001liu.2	-	1	120	c.120A>G	c.(118-120)CCA>CCG	p.P40P		NM_147191	NP_671724	Q8N119	MMP21_HUMAN	matrix metalloproteinase 21 preproprotein	40					proteolysis	extracellular matrix	calcium ion binding|metalloendopeptidase activity|zinc ion binding			ovary(2)	2		all_lung(145;0.0096)|Lung NSC(174;0.0145)|Colorectal(57;0.0846)|all_neural(114;0.0936)				CCTGGCGCAGTGGGGACGGCT	0.672													21	55	---	---	---	---	PASS
MKI67	4288	broad.mit.edu	37	10	129901286	129901286	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:129901286C>T	uc001lke.2	-	13	9013	c.8818G>A	c.(8818-8820)GAT>AAT	p.D2940N	MKI67_uc001lkf.2_Missense_Mutation_p.D2580N|MKI67_uc009yav.1_Missense_Mutation_p.D2515N|MKI67_uc009yaw.1_Missense_Mutation_p.D2090N	NM_002417	NP_002408	P46013	KI67_HUMAN	antigen identified by monoclonal antibody Ki-67	2940					cell proliferation	nucleolus	ATP binding|protein C-terminus binding			ovary(4)|central_nervous_system(2)|skin(1)	7		all_epithelial(44;2.12e-05)|all_lung(145;0.00679)|Lung NSC(174;0.00998)|all_neural(114;0.0936)|Colorectal(57;0.14)|Breast(234;0.166)|Melanoma(40;0.203)				GTAAAGCTATCAGCAGCACCA	0.507													8	471	---	---	---	---	PASS
EBF3	253738	broad.mit.edu	37	10	131671733	131671733	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:131671733G>A	uc001lki.1	-							NM_001005463	NP_001005463	Q9H4W6	COE3_HUMAN	early B-cell factor 3						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|metal ion binding|protein binding			central_nervous_system(1)|pancreas(1)	2		all_cancers(35;1.8e-08)|all_epithelial(44;8.26e-08)|Lung NSC(174;0.0091)|all_lung(145;0.0123)|Breast(234;0.039)|all_neural(114;0.0722)|Colorectal(57;0.0764)		OV - Ovarian serous cystadenocarcinoma(35;0.00513)		CAGATAAGAAGGGGCCGTACC	0.488													4	121	---	---	---	---	PASS
DEAF1	10522	broad.mit.edu	37	11	688371	688371	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:688371C>G	uc001lqq.1	-	3	1170	c.477G>C	c.(475-477)GAG>GAC	p.E159D	DEAF1_uc009ycf.1_5'Flank	NM_021008	NP_066288	O75398	DEAF1_HUMAN	deformed epidermal autoregulatory factor 1	159					embryonic skeletal system development|germ cell development|neural tube closure|regulation of mammary gland epithelial cell proliferation|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	cytoplasm|cytoplasm|extracellular region|nucleus	protein binding|zinc ion binding				0		all_cancers(49;1.24e-08)|all_epithelial(84;1.87e-05)|Breast(177;0.000286)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.106)|all_lung(207;0.136)		all cancers(45;1.76e-27)|Epithelial(43;8.42e-27)|OV - Ovarian serous cystadenocarcinoma(40;6.55e-21)|BRCA - Breast invasive adenocarcinoma(625;4.83e-05)|Lung(200;0.0259)|LUSC - Lung squamous cell carcinoma(625;0.075)		GCCCGGTGGTCTCCACGATGC	0.577													7	44	---	---	---	---	PASS
CARS	833	broad.mit.edu	37	11	3038392	3038392	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:3038392T>C	uc001lxh.2	-	15	1686	c.1612A>G	c.(1612-1614)AGG>GGG	p.R538G	CARS_uc001lxe.2_Missense_Mutation_p.R528G|CARS_uc001lxf.2_Missense_Mutation_p.R621G|CARS_uc001lxg.2_Missense_Mutation_p.R538G|CARS_uc010qxo.1_Missense_Mutation_p.R621G|CARS_uc010qxp.1_Missense_Mutation_p.R551G	NM_001751	NP_001742	P49589	SYCC_HUMAN	cysteinyl-tRNA synthetase isoform b	538					cysteinyl-tRNA aminoacylation	cytoplasm|cytosol	ATP binding|cysteine-tRNA ligase activity|metal ion binding|protein homodimerization activity|protein homodimerization activity|tRNA binding|tRNA binding		CARS/ALK(5)	soft_tissue(5)|ovary(2)	7		all_epithelial(84;0.000236)|Medulloblastoma(188;0.00106)|Breast(177;0.00328)|Ovarian(85;0.00556)|all_neural(188;0.00681)		BRCA - Breast invasive adenocarcinoma(625;0.00317)|LUSC - Lung squamous cell carcinoma(625;0.218)	L-Cysteine(DB00151)	TGGTTGGGCCTCTTCCTCACG	0.592			T	ALK	ALCL								11	85	---	---	---	---	PASS
STIM1	6786	broad.mit.edu	37	11	3988773	3988773	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:3988773C>G	uc001lyv.2	+						STIM1_uc009yef.2_Intron	NM_003156	NP_003147	Q13586	STIM1_HUMAN	stromal interaction molecule 1 precursor						activation of store-operated calcium channel activity|calcium ion transport|detection of calcium ion|platelet activation	integral to endoplasmic reticulum membrane|integral to plasma membrane|microtubule	calcium ion binding|microtubule plus-end binding			pancreas(1)	1		Breast(177;0.00159)|Medulloblastoma(188;0.00258)|all_neural(188;0.0233)		BRCA - Breast invasive adenocarcinoma(625;0.114)|LUSC - Lung squamous cell carcinoma(625;0.141)		TCTTGCTTTTCTTACACAGAG	0.483													9	194	---	---	---	---	PASS
OR51M1	390059	broad.mit.edu	37	11	5410897	5410897	+	Nonsense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5410897T>A	uc010qzc.1	+	1	269	c.269T>A	c.(268-270)TTG>TAG	p.L90*	HBG2_uc001mak.1_Intron|HBE1_uc001mam.1_Intron|OR51B5_uc001maq.1_Intron	NM_001004756	NP_001004756	B2RNI9	B2RNI9_HUMAN	olfactory receptor, family 51, subfamily M,	90						integral to membrane	olfactory receptor activity				0		Medulloblastoma(188;0.0075)|all_neural(188;0.0572)|Breast(177;0.0675)		Epithelial(150;1.98e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)		GTGTCCACGTTGCCCACCACT	0.478													109	170	---	---	---	---	PASS
UBQLN3	50613	broad.mit.edu	37	11	5530093	5530093	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5530093C>A	uc001may.1	-	2	782	c.696G>T	c.(694-696)GAG>GAT	p.E232D	HBG2_uc001mak.1_Intron	NM_017481	NP_059509	Q9H347	UBQL3_HUMAN	ubiquilin 3	232										ovary(3)	3		Medulloblastoma(188;0.00225)|Breast(177;0.0155)|all_neural(188;0.0212)		Epithelial(150;1.74e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)		TACGTATCATCTCCTGCATCA	0.483													52	88	---	---	---	---	PASS
TRIM5	85363	broad.mit.edu	37	11	5686453	5686453	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5686453T>C	uc001mbm.1	-	8	1325	c.1068A>G	c.(1066-1068)TCA>TCG	p.S356S	TRIM78P_uc009yer.2_RNA|TRIM5_uc001mbl.1_RNA|TRIM5_uc001mbn.2_Intron|TRIM5_uc001mbo.2_Intron|TRIM5_uc001mbp.2_3'UTR	NM_033034	NP_149023	Q9C035	TRIM5_HUMAN	tripartite motif protein TRIM5 isoform alpha	356	B30.2/SPRY.				interspecies interaction between organisms|protein trimerization|response to virus	cytoplasm|cytoplasmic mRNA processing body	ligase activity|protein binding|protein homodimerization activity|zinc ion binding			ovary(1)	1		Medulloblastoma(188;0.00225)|Breast(177;0.0204)|all_neural(188;0.0212)|Lung NSC(207;0.138)|all_lung(207;0.221)		Epithelial(150;7.21e-09)|BRCA - Breast invasive adenocarcinoma(625;0.139)		AATGTTTCCCTGATGTGATAC	0.433													135	174	---	---	---	---	PASS
OR52E4	390081	broad.mit.edu	37	11	5905763	5905763	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5905763C>T	uc010qzs.1	+	1	241	c.241C>T	c.(241-243)CCC>TCC	p.P81S	TRIM5_uc001mbq.1_Intron	NM_001005165	NP_001005165	Q8NGH9	O52E4_HUMAN	olfactory receptor, family 52, subfamily E,	81	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2		Medulloblastoma(188;0.00776)|all_neural(188;0.0652)|Breast(177;0.114)		Epithelial(150;1.24e-08)|BRCA - Breast invasive adenocarcinoma(625;0.135)		ATCCACTATCCCCAAAATGCT	0.443													107	169	---	---	---	---	PASS
TPP1	1200	broad.mit.edu	37	11	6638000	6638000	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6638000C>A	uc001mel.1	-	7	839	c.778G>T	c.(778-780)GTG>TTG	p.V260L	TPP1_uc001mek.1_Missense_Mutation_p.V17L	NM_000391	NP_000382	O14773	TPP1_HUMAN	tripeptidyl-peptidase I preproprotein	260					bone resorption|cell death|lipid metabolic process|lysosome organization|nervous system development|neuromuscular process controlling balance|peptide catabolic process|protein catabolic process|proteolysis	lysosome|melanosome|soluble fraction	metal ion binding|peptide binding|protein binding|serine-type endopeptidase activity|tripeptidyl-peptidase activity				0		Medulloblastoma(188;0.00263)|all_neural(188;0.026)		Epithelial(150;3.45e-09)|BRCA - Breast invasive adenocarcinoma(625;0.131)		TGTCCAACCACACGGGCTACT	0.577													84	141	---	---	---	---	PASS
NLRP14	338323	broad.mit.edu	37	11	7092450	7092450	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:7092450G>A	uc001mfb.1	+	12	3516	c.3193G>A	c.(3193-3195)GCT>ACT	p.A1065T		NM_176822	NP_789792	Q86W24	NAL14_HUMAN	NLR family, pyrin domain containing 14	1065					cell differentiation|multicellular organismal development|spermatogenesis		ATP binding			ovary(3)|breast(2)|pancreas(1)|lung(1)|skin(1)	8				Epithelial(150;4.62e-08)|BRCA - Breast invasive adenocarcinoma(625;0.0871)		GCTGCTGGAAGCTGTGGGAGT	0.428													15	97	---	---	---	---	PASS
SCUBE2	57758	broad.mit.edu	37	11	9101052	9101052	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:9101052G>A	uc001mhh.1	-	3	341	c.261C>T	c.(259-261)ATC>ATT	p.I87I	SCUBE2_uc001mhi.1_Silent_p.I87I|SCUBE2_uc001mhj.1_Silent_p.I87I	NM_020974	NP_066025	Q9NQ36	SCUB2_HUMAN	CEGP1 protein precursor	87	EGF-like 2; calcium-binding (Potential).					extracellular region	calcium ion binding			ovary(1)|skin(1)	2				all cancers(16;8.57e-09)|Epithelial(150;4.42e-08)|BRCA - Breast invasive adenocarcinoma(625;0.0116)		CACATTCATCGATGTCTGAGG	0.318													7	195	---	---	---	---	PASS
SBF2	81846	broad.mit.edu	37	11	9838382	9838382	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:9838382C>G	uc001mib.2	-						SBF2_uc001mid.2_Intron	NM_030962	NP_112224	Q86WG5	MTMRD_HUMAN	SET binding factor 2						myelination	cytoplasm|membrane	phosphatase activity|protein binding			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3				all cancers(16;2.88e-11)|Epithelial(150;3.61e-10)|BRCA - Breast invasive adenocarcinoma(625;0.00887)		AAAAAGAAATCTTACCCTTAG	0.403													22	36	---	---	---	---	PASS
GALNTL4	374378	broad.mit.edu	37	11	11400750	11400750	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:11400750G>T	uc001mjo.2	-	4	1078	c.657C>A	c.(655-657)TTC>TTA	p.F219L		NM_198516	NP_940918	Q6P9A2	GLTL4_HUMAN	UDP-N-acetyl-alpha-D-galactosamine:polypeptide	219	Lumenal (Potential).|Catalytic subdomain A.					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding				0				all cancers(16;3.67e-05)|Epithelial(150;0.000184)		CGACTTTGATGAAGCCTGGCT	0.582													48	54	---	---	---	---	PASS
COPB1	1315	broad.mit.edu	37	11	14491055	14491055	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:14491055A>G	uc001mli.2	-	15	2099	c.1792T>C	c.(1792-1794)TCC>CCC	p.S598P	COPB1_uc001mlg.2_Missense_Mutation_p.S598P|COPB1_uc001mlh.2_Missense_Mutation_p.S598P	NM_016451	NP_057535	P53618	COPB_HUMAN	coatomer protein complex, subunit beta 1	598					COPI coating of Golgi vesicle|interspecies interaction between organisms|intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat|cytosol|ER-Golgi intermediate compartment|plasma membrane	protein binding|structural molecule activity			ovary(1)|central_nervous_system(1)	2						GGAAGAGAGGATTTTCCCAAA	0.388													39	53	---	---	---	---	PASS
PLEKHA7	144100	broad.mit.edu	37	11	16863215	16863215	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:16863215G>A	uc001mmo.2	-	9	766	c.751C>T	c.(751-753)CAG>TAG	p.Q251*	PLEKHA7_uc010rcu.1_Nonsense_Mutation_p.Q251*	NM_175058	NP_778228	Q6IQ23	PKHA7_HUMAN	pleckstrin homology domain containing, family A	251	PH.				epithelial cell-cell adhesion|zonula adherens maintenance	centrosome|zonula adherens	delta-catenin binding			skin(2)|central_nervous_system(1)	3						TGCTCGGCCTGAGAGCCCGCT	0.582													4	74	---	---	---	---	PASS
LDHC	3948	broad.mit.edu	37	11	18434253	18434253	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:18434253C>T	uc001mon.3	+						LDHC_uc001mom.3_Intron|LDHC_uc009yhp.2_Intron|LDHC_uc001moo.3_Intron|LDHC_uc009yhq.2_Intron|LDHC_uc009yhr.2_Intron	NM_017448	NP_059144	P07864	LDHC_HUMAN	L-lactate dehydrogenase C						glycolysis	cytoplasm	binding|L-lactate dehydrogenase activity				0					NADH(DB00157)	TTATCCCTATCAGGTTCTCCA	0.423													54	83	---	---	---	---	PASS
LDHC	3948	broad.mit.edu	37	11	18456319	18456319	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:18456319A>G	uc001mon.3	+	5	563	c.451A>G	c.(451-453)AGT>GGT	p.S151G	LDHC_uc001mom.3_Missense_Mutation_p.S151G|LDHC_uc009yhp.2_Missense_Mutation_p.S151G|LDHC_uc001moo.3_Missense_Mutation_p.S35G|LDHC_uc009yhq.2_RNA|LDHC_uc009yhr.2_Missense_Mutation_p.S35G	NM_017448	NP_059144	P07864	LDHC_HUMAN	L-lactate dehydrogenase C	151					glycolysis	cytoplasm	binding|L-lactate dehydrogenase activity				0					NADH(DB00157)	CTGGAAGATAAGTGGCTTACC	0.343													95	134	---	---	---	---	PASS
SLC6A5	9152	broad.mit.edu	37	11	20636265	20636265	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:20636265G>A	uc001mqd.2	+	6	1299	c.1026G>A	c.(1024-1026)AAG>AAA	p.K342K	SLC6A5_uc009yic.2_Silent_p.K107K	NM_004211	NP_004202	Q9Y345	SC6A5_HUMAN	solute carrier family 6 (neurotransmitter	342	Extracellular (Potential).				synaptic transmission	integral to membrane|plasma membrane	glycine:sodium symporter activity|neurotransmitter:sodium symporter activity			ovary(2)|breast(1)|skin(1)	4					Glycine(DB00145)	TACAGATCAAGAACTCGACTT	0.403													91	136	---	---	---	---	PASS
BBOX1	8424	broad.mit.edu	37	11	27077152	27077152	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:27077152G>C	uc001mre.1	+	3	543	c.175G>C	c.(175-177)GAT>CAT	p.D59H	BBOX1_uc009yih.1_Missense_Mutation_p.D59H|BBOX1_uc001mrg.1_Missense_Mutation_p.D59H	NM_003986	NP_003977	O75936	BODG_HUMAN	gamma-butyrobetaine dioxygenase	59					carnitine biosynthetic process	actin cytoskeleton|cytosol|intracellular membrane-bounded organelle	gamma-butyrobetaine dioxygenase activity|iron ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|zinc ion binding			ovary(1)	1					Succinic acid(DB00139)|Vitamin C(DB00126)	GGAAGCTCTTGATGTGAACAT	0.408													7	83	---	---	---	---	PASS
EHF	26298	broad.mit.edu	37	11	34680287	34680287	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:34680287C>T	uc001mvr.1	+						EHF_uc009yke.1_Intron|EHF_uc009ykf.1_Intron	NM_012153	NP_036285	Q9NZC4	EHF_HUMAN	ets homologous factor						cell proliferation|epithelial cell differentiation|multicellular organismal development|positive regulation of transcription, DNA-dependent		protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0		all_hematologic(20;0.117)	Epithelial(1;0.055)|all cancers(1;0.137)|STAD - Stomach adenocarcinoma(6;0.235)			TGAGGAGTTTCATGTCTCTGA	0.423													40	46	---	---	---	---	PASS
C11orf74	119710	broad.mit.edu	37	11	36654838	36654838	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:36654838T>C	uc001mwy.1	+	3	214	c.141T>C	c.(139-141)GAT>GAC	p.D47D	C11orf74_uc010rfd.1_RNA|C11orf74_uc001mww.1_Intron|C11orf74_uc001mwx.1_Intron|C11orf74_uc001mwz.1_Intron|C11orf74_uc010rfe.1_RNA	NM_138787	NP_620142	Q86VG3	CK074_HUMAN	hypothetical protein LOC119710	47											0	all_lung(20;0.226)	all_hematologic(20;0.0118)				TTTCAGAGGATCATGTGTCCA	0.328													55	81	---	---	---	---	PASS
LRRC4C	57689	broad.mit.edu	37	11	40136116	40136116	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:40136116G>T	uc001mxa.1	-	2	3691	c.1727C>A	c.(1726-1728)ACG>AAG	p.T576K	LRRC4C_uc001mxc.1_Missense_Mutation_p.T572K|LRRC4C_uc001mxd.1_Missense_Mutation_p.T572K|LRRC4C_uc001mxb.1_Missense_Mutation_p.T572K	NM_020929	NP_065980	Q9HCJ2	LRC4C_HUMAN	netrin-G1 ligand precursor	576					regulation of axonogenesis	integral to membrane	protein binding			ovary(4)|skin(3)|central_nervous_system(1)	8		all_lung(304;0.0575)|Lung NSC(402;0.138)				TGTGTCTCCCGTAATCTCATC	0.458													10	221	---	---	---	---	PASS
ZNF408	79797	broad.mit.edu	37	11	46726895	46726895	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46726895G>A	uc001nde.1	+	5	1875	c.1645G>A	c.(1645-1647)GAG>AAG	p.E549K	ZNF408_uc010rgw.1_Missense_Mutation_p.E541K	NM_024741	NP_079017	Q9H9D4	ZN408_HUMAN	zinc finger protein 408	549					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|identical protein binding|zinc ion binding				0						ACACACCGGGGAGGCCCACTT	0.682													4	59	---	---	---	---	PASS
LRP4	4038	broad.mit.edu	37	11	46916147	46916147	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46916147C>G	uc001ndn.3	-	12	1679	c.1533G>C	c.(1531-1533)GAG>GAC	p.E511D		NM_002334	NP_002325	O75096	LRP4_HUMAN	low density lipoprotein receptor-related protein	511	Extracellular (Potential).|LDL-receptor class B 1.				endocytosis|negative regulation of canonical Wnt receptor signaling pathway|Wnt receptor signaling pathway	integral to membrane	calcium ion binding|receptor activity			skin(2)|upper_aerodigestive_tract(1)|ovary(1)	4				Lung(87;0.159)		TACCTGGGCTCTCCAGCCCAG	0.552													9	13	---	---	---	---	PASS
OR4C3	256144	broad.mit.edu	37	11	48346796	48346796	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48346796A>T	uc010rhv.1	+	1	304	c.304A>T	c.(304-306)ATG>TTG	p.M102L		NM_001004702	NP_001004702	Q8NH37	OR4C3_HUMAN	olfactory receptor, family 4, subfamily C,	75	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1						TTCTTCTTCTATGGCTCCTAA	0.468													21	275	---	---	---	---	PASS
OR4C46	119749	broad.mit.edu	37	11	51515761	51515761	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:51515761C>T	uc010ric.1	+	1	480	c.480C>T	c.(478-480)TTC>TTT	p.F160F		NM_001004703	NP_001004703	A6NHA9	O4C46_HUMAN	olfactory receptor, family 4, subfamily C,	160	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1						AGATCCTCTTCATCTTCCAAT	0.468													12	286	---	---	---	---	PASS
OR4A15	81328	broad.mit.edu	37	11	55135666	55135666	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55135666A>G	uc010rif.1	+	1	307	c.307A>G	c.(307-309)ACT>GCT	p.T103A		NM_001005275	NP_001005275	Q8NGL6	O4A15_HUMAN	olfactory receptor, family 4, subfamily A,	103	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2						CGTCTATTCTACTGCATTTGC	0.413													75	292	---	---	---	---	PASS
OR5D14	219436	broad.mit.edu	37	11	55563673	55563673	+	Silent	SNP	G	C	C	rs148455368	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55563673G>C	uc010rim.1	+	1	642	c.642G>C	c.(640-642)CTG>CTC	p.L214L		NM_001004735	NP_001004735	Q8NGL3	OR5DE_HUMAN	olfactory receptor, family 5, subfamily D,	214	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|central_nervous_system(1)	3		all_epithelial(135;0.196)				GTACACTACTGATCATCCTCA	0.478													20	385	---	---	---	---	PASS
SPRYD5	84767	broad.mit.edu	37	11	55655595	55655595	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55655595G>C	uc010rip.1	+	4	687	c.595G>C	c.(595-597)GAA>CAA	p.E199Q	SPRYD5_uc010riq.1_Missense_Mutation_p.E56Q	NM_032681	NP_116070	Q9BSJ1	SPRY5_HUMAN	SPRY domain containing 5	199						intracellular	zinc ion binding				0		all_epithelial(135;0.226)				ACATCACTTGGAAAGGCTGCG	0.428													4	116	---	---	---	---	PASS
OR5W2	390148	broad.mit.edu	37	11	55681880	55681880	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55681880T>C	uc010rir.1	-	1	179	c.179A>G	c.(178-180)TAT>TGT	p.Y60C		NM_001001960	NP_001001960	Q8NH69	OR5W2_HUMAN	olfactory receptor, family 5, subfamily W,	60	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2						GAGGAAGAAATACATTGGTGT	0.383													15	118	---	---	---	---	PASS
OR5I1	10798	broad.mit.edu	37	11	55703584	55703584	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55703584C>A	uc010ris.1	-	1	293	c.293G>T	c.(292-294)GGG>GTG	p.G98V		NM_006637	NP_006628	Q13606	OR5I1_HUMAN	olfactory receptor, family 5, subfamily I,	98	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1						CAGGGCACACCCATAATAGGA	0.423													24	70	---	---	---	---	PASS
OR5J2	282775	broad.mit.edu	37	11	55944688	55944688	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55944688C>A	uc010rjb.1	+	1	595	c.595C>A	c.(595-597)CTG>ATG	p.L199M		NM_001005492	NP_001005492	Q8NH18	OR5J2_HUMAN	olfactory receptor, family 5, subfamily J,	199	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|large_intestine(1)|breast(1)|pancreas(1)	4	Esophageal squamous(21;0.00693)					TGAGTTGTTGCTGTTAACCTT	0.453													38	185	---	---	---	---	PASS
OR5T3	390154	broad.mit.edu	37	11	56020334	56020334	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56020334C>G	uc010rjd.1	+	1	659	c.659C>G	c.(658-660)TCT>TGT	p.S220C		NM_001004747	NP_001004747	Q8NGG3	OR5T3_HUMAN	olfactory receptor, family 5, subfamily T,	220	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	Esophageal squamous(21;0.00448)					ATTTCTTGTTCTGACACTCAC	0.398													144	458	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	11	56143465	56143465	+	IGR	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56143465A>C								OR8J1 (14794 upstream) : OR5R1 (41271 downstream)																							CCTATGACCGATATGTGGCCA	0.413													52	231	---	---	---	---	PASS
OR5M3	219482	broad.mit.edu	37	11	56237923	56237923	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56237923G>A	uc010rjk.1	-	1	51	c.51C>T	c.(49-51)AGC>AGT	p.S17S		NM_001004742	NP_001004742	Q8NGP4	OR5M3_HUMAN	olfactory receptor, family 5, subfamily M,	17	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00448)					ATTCTCGACGGCTCGTTAGCC	0.393													10	143	---	---	---	---	PASS
OR5M11	219487	broad.mit.edu	37	11	56310301	56310301	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56310301T>A	uc010rjl.1	-	1	433	c.433A>T	c.(433-435)ACA>TCA	p.T145S		NM_001005245	NP_001005245	Q96RB7	OR5MB_HUMAN	olfactory receptor, family 5, subfamily M,	145	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						TAGGGAAATGTGGCCAAGCAG	0.507													18	49	---	---	---	---	PASS
OR5M11	219487	broad.mit.edu	37	11	56310358	56310358	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56310358A>T	uc010rjl.1	-	1	376	c.376T>A	c.(376-378)TAT>AAT	p.Y126N		NM_001005245	NP_001005245	Q96RB7	OR5MB_HUMAN	olfactory receptor, family 5, subfamily M,	126	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						AGAGGGTCATATATGGCCACA	0.483													25	49	---	---	---	---	PASS
TNKS1BP1	85456	broad.mit.edu	37	11	57077578	57077578	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57077578C>G	uc001njr.2	-	5	2919	c.2607G>C	c.(2605-2607)AAG>AAC	p.K869N	TNKS1BP1_uc001njs.2_Missense_Mutation_p.K869N|TNKS1BP1_uc009ymd.1_Missense_Mutation_p.K320N	NM_033396	NP_203754	Q9C0C2	TB182_HUMAN	tankyrase 1-binding protein 1	869	Acidic.				nuclear-transcribed mRNA poly(A) tail shortening|telomere maintenance via telomerase	cytoskeleton|cytosol|nuclear telomeric heterochromatin	ankyrin binding|enzyme binding			skin(1)	1		all_epithelial(135;0.21)				GTGAATCTCTCTTTCCGAATT	0.532													4	361	---	---	---	---	PASS
GLYATL1	92292	broad.mit.edu	37	11	58722807	58722807	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58722807C>A	uc001nnf.2	+	7	848	c.472C>A	c.(472-474)CCA>ACA	p.P158T	uc001nng.1_Intron|GLYATL1_uc001nnh.1_Missense_Mutation_p.P189T|GLYATL1_uc001nni.1_Missense_Mutation_p.P158T|GLYATL1_uc001nnj.1_Missense_Mutation_p.P158T			Q969I3	GLYL1_HUMAN	SubName: Full=Glycine acyltransferase family-C; SubName: Full=Glycine-N-acyltransferase-like 1, isoform CRA_a;	158						mitochondrion	glycine N-acyltransferase activity			ovary(1)	1					Glycine(DB00145)	GACAGGCCACCCAGATGATGA	0.398													50	100	---	---	---	---	PASS
FAM111A	63901	broad.mit.edu	37	11	58920584	58920584	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58920584G>A	uc010rkp.1	+	5	1670	c.1443G>A	c.(1441-1443)CAG>CAA	p.Q481Q	FAM111A_uc010rkq.1_Silent_p.Q481Q|FAM111A_uc010rkr.1_Silent_p.Q481Q|FAM111A_uc001nno.2_Silent_p.Q481Q|FAM111A_uc001nnp.2_Silent_p.Q481Q|FAM111A_uc001nnq.2_Silent_p.Q481Q	NM_001142521	NP_001135993	Q96PZ2	F111A_HUMAN	hypothetical protein LOC63901	481					proteolysis		serine-type endopeptidase activity			ovary(3)	3		all_epithelial(135;0.139)				AAAAAAAGCAGATTGATGCTT	0.408													32	244	---	---	---	---	PASS
DTX4	23220	broad.mit.edu	37	11	58972187	58972187	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58972187C>G	uc001nns.2	+	9	1922	c.1665C>G	c.(1663-1665)CTC>CTG	p.L555L	DTX4_uc001nnr.2_Silent_p.L449L	NM_015177	NP_055992	Q9Y2E6	DTX4_HUMAN	deltex 4 homolog	555					Notch signaling pathway	cytoplasm	zinc ion binding			lung(2)|central_nervous_system(1)	3		all_epithelial(135;0.125)				ATCGCCGCCTCATTTTTGCCA	0.522													4	32	---	---	---	---	PASS
TMEM132A	54972	broad.mit.edu	37	11	60704150	60704150	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60704150C>G	uc001nqj.2	+	11	3036	c.2843C>G	c.(2842-2844)TCA>TGA	p.S948*	TMEM132A_uc001nqi.2_Nonsense_Mutation_p.S949*|TMEM132A_uc001nqm.2_Nonsense_Mutation_p.S158*	NM_178031	NP_821174	Q24JP5	T132A_HUMAN	transmembrane protein 132A isoform b	948	Cytoplasmic (Potential).|Confers cellular localization similar to full-length form (By similarity).					endoplasmic reticulum membrane|Golgi membrane|integral to membrane				skin(1)	1						ACCAGCTCCTCAAGCACCCTG	0.701													13	21	---	---	---	---	PASS
SLC15A3	51296	broad.mit.edu	37	11	60714262	60714262	+	Missense_Mutation	SNP	C	A	A	rs142952480	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60714262C>A	uc001nqn.2	-	2	824	c.590G>T	c.(589-591)CGC>CTC	p.R197L	SLC15A3_uc001nqo.2_Missense_Mutation_p.R197L	NM_016582	NP_057666	Q8IY34	S15A3_HUMAN	solute carrier family 15, member 3	197					oligopeptide transport|protein transport	integral to membrane|lysosomal membrane	peptide:hydrogen symporter activity				0						GTTGAAGAAGCGGCGGGTGGC	0.597													61	157	---	---	---	---	PASS
VWCE	220001	broad.mit.edu	37	11	61026260	61026260	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61026260G>A	uc001nra.2	-	20	3034	c.2755C>T	c.(2755-2757)CGC>TGC	p.R919C	VWCE_uc001nrb.2_RNA	NM_152718	NP_689931	Q96DN2	VWCE_HUMAN	von Willebrand factor C and EGF domains	919						extracellular region	calcium ion binding			ovary(1)	1						GAAAGCACGCGAGGCCCGAGG	0.667													34	142	---	---	---	---	PASS
BEST1	7439	broad.mit.edu	37	11	61729985	61729985	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61729985C>T	uc001nss.2	+	10	1939	c.1359C>T	c.(1357-1359)TTC>TTT	p.F453F	BEST1_uc010rlq.1_3'UTR|BEST1_uc010rlr.1_3'UTR|BEST1_uc010rls.1_Silent_p.F81F|BEST1_uc001nsr.2_Silent_p.F393F|BEST1_uc009ynt.2_RNA|BEST1_uc010rlt.1_Silent_p.F393F|BEST1_uc001nst.2_Silent_p.F366F|BEST1_uc010rlu.1_3'UTR|BEST1_uc010rlv.1_Silent_p.F347F	NM_004183	NP_004174	O76090	BEST1_HUMAN	bestrophin 1 isoform 1	453	Cytoplasmic (Potential).				response to stimulus|transepithelial chloride transport|visual perception	basolateral plasma membrane|chloride channel complex|cytosol|membrane fraction	chloride channel activity			central_nervous_system(1)	1						TGGACGCCTTCAAGTCTGCCC	0.587													12	131	---	---	---	---	PASS
EML3	256364	broad.mit.edu	37	11	62378413	62378413	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62378413C>T	uc001ntu.1	-	4	812	c.504G>A	c.(502-504)CAG>CAA	p.Q168Q	EML3_uc001ntr.1_Silent_p.Q140Q|EML3_uc001nts.1_Silent_p.Q140Q|EML3_uc001ntt.1_Silent_p.Q52Q|EML3_uc010rly.1_Silent_p.Q168Q|EML3_uc009yny.1_5'UTR|ROM1_uc001ntv.2_5'Flank	NM_153265	NP_694997	Q32P44	EMAL3_HUMAN	echinoderm microtubule associated protein like	168						cytoplasm|microtubule	protein binding			ovary(1)	1						TGGAGAGCTTCTGCCGAGGCC	0.617													9	82	---	---	---	---	PASS
TMEM223	79064	broad.mit.edu	37	11	62558093	62558093	+	3'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62558093C>T	uc001nve.2	-	2						NM_001080501	NP_001073970	A0PJW6	TM223_HUMAN	transmembrane protein 223							integral to membrane					0						GAGGTCATTTCTTCACAAGCT	0.368													6	23	---	---	---	---	PASS
SLC3A2	6520	broad.mit.edu	37	11	62623803	62623803	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62623803G>T	uc001nwd.2	+	1	286	c.62G>T	c.(61-63)GGC>GTC	p.G21V	SLC3A2_uc001nwb.2_Missense_Mutation_p.G21V|SLC3A2_uc001nwc.2_Missense_Mutation_p.G21V|SLC3A2_uc001nwe.2_Missense_Mutation_p.G21V|SLC3A2_uc001nwf.2_Missense_Mutation_p.G21V|SNHG1_uc001nvp.2_5'Flank|SNHG1_uc001nvo.2_5'Flank|SNHG1_uc001nvq.2_5'Flank|SNHG1_uc001nvs.2_5'Flank|SNHG1_uc001nvr.2_5'Flank|SNHG1_uc001nvt.2_5'Flank|SNHG1_uc001nvu.2_5'Flank|SNORD31_uc009yoj.1_5'Flank|SNORD30_uc001nvw.1_5'Flank|SNORD29_uc001nvx.2_5'Flank|SNORD28_uc001nvy.1_5'Flank|SNORD27_uc001nvz.2_5'Flank|SNORD26_uc009yok.1_5'Flank|SNORD25_uc001nwa.3_5'Flank	NM_002394	NP_002385	P08195	4F2_HUMAN	solute carrier family 3, member 2 isoform c	21					blood coagulation|carbohydrate metabolic process|cell growth|cellular nitrogen compound metabolic process|leucine import|leukocyte migration|tryptophan transport	apical plasma membrane|cell surface|integral to membrane|melanosome	calcium:sodium antiporter activity|catalytic activity|cation binding|neutral amino acid transmembrane transporter activity|protein binding				0						CAGTTGCCTGGCTCACATTCG	0.647													9	172	---	---	---	---	PASS
HRASLS2	54979	broad.mit.edu	37	11	63320533	63320533	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63320533G>A	uc001nxg.1	-	4	451	c.392C>T	c.(391-393)ACT>ATT	p.T131I		NM_017878	NP_060348	Q9NWW9	HRSL2_HUMAN	HRAS-like suppressor 2	131					lipid catabolic process	cytoplasm	acyltransferase activity|hydrolase activity				0						GACTGCACCAGTGACCTGCAG	0.577													18	67	---	---	---	---	PASS
MACROD1	28992	broad.mit.edu	37	11	63918818	63918818	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63918818A>T	uc001nyh.2	-	3	529	c.410T>A	c.(409-411)GTG>GAG	p.V137E		NM_014067	NP_054786	Q9BQ69	MACD1_HUMAN	MACRO domain containing 1	137											0						CTCCACCTTCACAGCCACCCC	0.627													8	86	---	---	---	---	PASS
CDC42BPG	55561	broad.mit.edu	37	11	64606236	64606236	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64606236C>A	uc001obs.3	-	8	1015	c.1015G>T	c.(1015-1017)GGC>TGC	p.G339C		NM_017525	NP_059995	Q6DT37	MRCKG_HUMAN	CDC42 binding protein kinase gamma (DMPK-like)	339	AGC-kinase C-terminal.				actin cytoskeleton reorganization|intracellular signal transduction	cell leading edge|centrosome	ATP binding|magnesium ion binding|protein binding|protein serine/threonine kinase activity|small GTPase regulator activity			lung(3)|central_nervous_system(1)	4						CAGTCCACGCCTTCGAAGAAA	0.632													19	56	---	---	---	---	PASS
C11orf85	283129	broad.mit.edu	37	11	64714943	64714943	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64714943G>T	uc001ocb.1	-						C11orf85_uc001occ.1_Intron|C11orf85_uc001ocd.1_Intron	NM_001037225	NP_001032302	Q3KP22	CK085_HUMAN	hypothetical protein LOC283129												0						GGGACCTTCAGGAGGAAGCAG	0.532													17	185	---	---	---	---	PASS
SLC22A20	440044	broad.mit.edu	37	11	65003911	65003911	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65003911G>A	uc010roc.1	+	9	1293	c.1290G>A	c.(1288-1290)GCG>GCA	p.A430A	SLC22A20_uc001odi.3_RNA	NM_001004326	NP_001004326	A6NK97	S22AK_HUMAN	solute carrier family 22, member 20	430	Helical; (Potential).				ion transport	integral to membrane	transmembrane transporter activity			central_nervous_system(1)	1						CCCAGGCAGCGCTGGGCAAAG	0.632													9	9	---	---	---	---	PASS
RAD9A	5883	broad.mit.edu	37	11	67159653	67159653	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67159653C>T	uc001okr.2	+	2	149	c.56C>T	c.(55-57)TCC>TTC	p.S19F		NM_004584	NP_004575	Q99638	RAD9A_HUMAN	RAD9 homolog	19					DNA damage checkpoint|DNA repair|DNA replication|DNA replication checkpoint	nucleoplasm	3'-5' exonuclease activity|exodeoxyribonuclease III activity|histone deacetylase binding|protein kinase binding|SH3 domain binding				0			BRCA - Breast invasive adenocarcinoma(15;8.53e-07)			GCCGTCCACTCCCTGTCCCGC	0.716								Direct_reversal_of_damage|Other_conserved_DNA_damage_response_genes					9	25	---	---	---	---	PASS
RAD9A	5883	broad.mit.edu	37	11	67159668	67159668	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67159668G>T	uc001okr.2	+	2	164	c.71G>T	c.(70-72)GGG>GTG	p.G24V		NM_004584	NP_004575	Q99638	RAD9A_HUMAN	RAD9 homolog	24					DNA damage checkpoint|DNA repair|DNA replication|DNA replication checkpoint	nucleoplasm	3'-5' exonuclease activity|exodeoxyribonuclease III activity|histone deacetylase binding|protein kinase binding|SH3 domain binding				0			BRCA - Breast invasive adenocarcinoma(15;8.53e-07)			TCCCGCATCGGGGACGAGCTC	0.711								Direct_reversal_of_damage|Other_conserved_DNA_damage_response_genes					10	25	---	---	---	---	PASS
IGHMBP2	3508	broad.mit.edu	37	11	68700813	68700813	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68700813G>A	uc001ook.1	+	9	1384	c.1282G>A	c.(1282-1284)GAG>AAG	p.E428K	IGHMBP2_uc001ool.1_Missense_Mutation_p.E52K|IGHMBP2_uc001oom.1_Missense_Mutation_p.E6K	NM_002180	NP_002171	P38935	SMBP2_HUMAN	immunoglobulin mu binding protein 2	428					cell death|DNA recombination|DNA repair|DNA replication|protein homooligomerization|transcription, DNA-dependent|translation	axon|growth cone|nucleus|ribonucleoprotein complex	ATP binding|ATP-dependent 5'-3' DNA helicase activity|ATP-dependent 5'-3' RNA helicase activity|ribosome binding|single-stranded DNA binding|transcription factor binding|tRNA binding|zinc ion binding				0			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)			ACGCCTGGCTGAGGAGTACGG	0.652													50	37	---	---	---	---	PASS
TPCN2	219931	broad.mit.edu	37	11	68851471	68851471	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68851471G>A	uc001oos.2	+	19	1864	c.1748G>A	c.(1747-1749)GGC>GAC	p.G583D	TPCN2_uc010rqg.1_Intron|TPCN2_uc001oot.2_RNA	NM_139075	NP_620714	Q8NHX9	TPC2_HUMAN	two pore segment channel 2	583	Helical; Name=S5 of repeat II; (Potential).				cellular calcium ion homeostasis|smooth muscle contraction	endosome membrane|integral to membrane|lysosomal membrane	NAADP-sensitive calcium-release channel activity|voltage-gated calcium channel activity				0			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)			CGTGCGTTTGGCGGGATCCTG	0.667													11	205	---	---	---	---	PASS
ANO1	55107	broad.mit.edu	37	11	70013343	70013343	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70013343C>G	uc001opj.2	+						ANO1_uc001opl.1_Intron|ANO1_uc010rqk.1_Intron|ANO1_uc010rql.1_5'Flank	NM_018043	NP_060513	Q5XXA6	ANO1_HUMAN	anoctamin 1, calcium activated chloride channel						multicellular organismal development	chloride channel complex|cytoplasm|plasma membrane	intracellular calcium activated chloride channel activity			ovary(1)|pancreas(1)	2						TGTCTCATCTCTCAGGAAGAT	0.473													14	351	---	---	---	---	PASS
SHANK2	22941	broad.mit.edu	37	11	70319315	70319315	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70319315G>C	uc001oqc.2	-	22	5287	c.5209C>G	c.(5209-5211)CTC>GTC	p.L1737V	SHANK2_uc010rqn.1_Missense_Mutation_p.L1149V|SHANK2_uc001opz.2_Missense_Mutation_p.L1142V|uc009ysn.1_Missense_Mutation_p.R72T|SHANK2_uc001opy.2_Missense_Mutation_p.L73V	NM_012309	NP_036441	Q9UPX8	SHAN2_HUMAN	SH3 and multiple ankyrin repeat domains 2	1358					intracellular signal transduction	cell junction|cytoplasm|postsynaptic density|postsynaptic membrane	GKAP/Homer scaffold activity|ionotropic glutamate receptor binding|SH3 domain binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(11;4.72e-09)|STAD - Stomach adenocarcinoma(18;0.071)			ACATCTGAGAGAGCGGGAGAA	0.602													11	608	---	---	---	---	PASS
SHANK2	22941	broad.mit.edu	37	11	70332825	70332825	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70332825C>A	uc001oqc.2	-	21	3651	c.3573G>T	c.(3571-3573)GCG>GCT	p.A1191A	SHANK2_uc010rqn.1_Silent_p.A603A|SHANK2_uc001opz.2_Silent_p.A596A|uc009ysn.1_Intron|SHANK2_uc001opy.2_Intron	NM_012309	NP_036441	Q9UPX8	SHAN2_HUMAN	SH3 and multiple ankyrin repeat domains 2	812					intracellular signal transduction	cell junction|cytoplasm|postsynaptic density|postsynaptic membrane	GKAP/Homer scaffold activity|ionotropic glutamate receptor binding|SH3 domain binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(11;4.72e-09)|STAD - Stomach adenocarcinoma(18;0.071)			TGCCGCTGCTCGCGGAGGGCA	0.706													12	344	---	---	---	---	PASS
SHANK2	22941	broad.mit.edu	37	11	70332944	70332944	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70332944C>T	uc001oqc.2	-	21	3532	c.3454G>A	c.(3454-3456)GAG>AAG	p.E1152K	SHANK2_uc010rqn.1_Missense_Mutation_p.E564K|SHANK2_uc001opz.2_Missense_Mutation_p.E557K|uc009ysn.1_Intron|SHANK2_uc001opy.2_Intron	NM_012309	NP_036441	Q9UPX8	SHAN2_HUMAN	SH3 and multiple ankyrin repeat domains 2	773					intracellular signal transduction	cell junction|cytoplasm|postsynaptic density|postsynaptic membrane	GKAP/Homer scaffold activity|ionotropic glutamate receptor binding|SH3 domain binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(11;4.72e-09)|STAD - Stomach adenocarcinoma(18;0.071)			TTTTCGGGCTCCCTGGGCGTG	0.677													26	581	---	---	---	---	PASS
SHANK2	22941	broad.mit.edu	37	11	70333107	70333107	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70333107C>T	uc001oqc.2	-	21	3369	c.3291G>A	c.(3289-3291)AGG>AGA	p.R1097R	SHANK2_uc010rqn.1_Silent_p.R509R|SHANK2_uc001opz.2_Silent_p.R502R|uc009ysn.1_Intron|SHANK2_uc001opy.2_Intron	NM_012309	NP_036441	Q9UPX8	SHAN2_HUMAN	SH3 and multiple ankyrin repeat domains 2	718					intracellular signal transduction	cell junction|cytoplasm|postsynaptic density|postsynaptic membrane	GKAP/Homer scaffold activity|ionotropic glutamate receptor binding|SH3 domain binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(11;4.72e-09)|STAD - Stomach adenocarcinoma(18;0.071)			CCGGGGAGTTCCTCCTGGCTT	0.716													18	261	---	---	---	---	PASS
SHANK2	22941	broad.mit.edu	37	11	70333132	70333132	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70333132C>T	uc001oqc.2	-	21	3344	c.3266G>A	c.(3265-3267)CGT>CAT	p.R1089H	SHANK2_uc010rqn.1_Missense_Mutation_p.R501H|SHANK2_uc001opz.2_Missense_Mutation_p.R494H|uc009ysn.1_Intron|SHANK2_uc001opy.2_Intron	NM_012309	NP_036441	Q9UPX8	SHAN2_HUMAN	SH3 and multiple ankyrin repeat domains 2	710					intracellular signal transduction	cell junction|cytoplasm|postsynaptic density|postsynaptic membrane	GKAP/Homer scaffold activity|ionotropic glutamate receptor binding|SH3 domain binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(11;4.72e-09)|STAD - Stomach adenocarcinoma(18;0.071)			CCGCTTCTCACGGTCGCGGAC	0.726													7	224	---	---	---	---	PASS
SHANK2	22941	broad.mit.edu	37	11	70333551	70333551	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70333551C>G	uc001oqc.2	-	21	2925	c.2847G>C	c.(2845-2847)GGG>GGC	p.G949G	SHANK2_uc010rqn.1_Silent_p.G361G|SHANK2_uc001opz.2_Silent_p.G354G|uc009ysn.1_Intron|SHANK2_uc001opy.2_Intron	NM_012309	NP_036441	Q9UPX8	SHAN2_HUMAN	SH3 and multiple ankyrin repeat domains 2	570					intracellular signal transduction	cell junction|cytoplasm|postsynaptic density|postsynaptic membrane	GKAP/Homer scaffold activity|ionotropic glutamate receptor binding|SH3 domain binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(11;4.72e-09)|STAD - Stomach adenocarcinoma(18;0.071)			TGAAGTACATCCCCTTCTCCC	0.587													26	498	---	---	---	---	PASS
CLPB	81570	broad.mit.edu	37	11	72040820	72040820	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72040820C>G	uc001osj.2	-	7	944	c.894G>C	c.(892-894)ATG>ATC	p.M298I	CLPB_uc010rqx.1_Missense_Mutation_p.M253I|CLPB_uc010rqy.1_Missense_Mutation_p.M239I|CLPB_uc001osk.2_Missense_Mutation_p.M268I|CLPB_uc009ytg.2_RNA|CLPB_uc010rqz.1_Missense_Mutation_p.M97I	NM_030813	NP_110440	Q9H078	CLPB_HUMAN	caseinolytic peptidase B	298	ANK 4.				cellular response to heat		ATP binding|nucleoside-triphosphatase activity|protein binding			pancreas(1)	1						GTGTGTGTCCCATTTCATTCC	0.542													16	168	---	---	---	---	PASS
PDE2A	5138	broad.mit.edu	37	11	72290356	72290356	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72290356G>C	uc010rrc.1	-	27	2571	c.2328C>G	c.(2326-2328)ATC>ATG	p.I776M	PDE2A_uc001oso.2_Missense_Mutation_p.I755M|PDE2A_uc010rra.1_Missense_Mutation_p.I769M|PDE2A_uc001osn.2_Missense_Mutation_p.I520M|PDE2A_uc010rrb.1_Missense_Mutation_p.I767M|PDE2A_uc010rrd.1_Missense_Mutation_p.I661M	NM_002599	NP_002590	O00408	PDE2A_HUMAN	phosphodiesterase 2A isoform 1	776	Catalytic (By similarity).				platelet activation|signal transduction	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|3',5'-cyclic-GMP phosphodiesterase activity|cGMP binding|cGMP-stimulated cyclic-nucleotide phosphodiesterase activity|metal ion binding			ovary(2)|breast(1)|skin(1)	4			BRCA - Breast invasive adenocarcinoma(5;3.55e-05)		Sildenafil(DB00203)|Sulindac(DB00605)	GGTCCTTGAAGATGCGGAGAT	0.597													23	224	---	---	---	---	PASS
ATG16L2	89849	broad.mit.edu	37	11	72537294	72537294	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72537294G>A	uc001otd.2	+						ATG16L2_uc001ote.2_Intron|ATG16L2_uc009ytj.1_Intron|ATG16L2_uc001otf.2_Intron|ATG16L2_uc001otg.2_Intron|ATG16L2_uc009ytk.2_Intron	NM_033388	NP_203746	Q8NAA4	A16L2_HUMAN	ATG16 autophagy related 16-like 2						autophagy|protein transport	cytoplasm	protein binding				0			BRCA - Breast invasive adenocarcinoma(5;2.73e-06)			CCTCGGTGAGGAACTCTGCCC	0.632													10	66	---	---	---	---	PASS
C2CD3	26005	broad.mit.edu	37	11	73748584	73748584	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:73748584C>A	uc001ouu.2	-	30	6047	c.5820G>T	c.(5818-5820)GGG>GGT	p.G1940G	C2CD3_uc001out.2_RNA	NM_015531	NP_056346	Q4AC94	C2CD3_HUMAN	C2 calcium-dependent domain containing 3	1940						centrosome				ovary(4)|pancreas(2)|skin(1)	7	Breast(11;4.16e-06)					TACACTGGCTCCCAGGGTCTA	0.527													65	392	---	---	---	---	PASS
XRRA1	143570	broad.mit.edu	37	11	74555245	74555245	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:74555245G>C	uc009yub.2	-	17	2319	c.1987C>G	c.(1987-1989)CTT>GTT	p.L663V	XRRA1_uc001ovm.2_RNA|XRRA1_uc001ovn.2_Missense_Mutation_p.L286V|XRRA1_uc001ovo.2_Missense_Mutation_p.L271V|XRRA1_uc001ovq.3_Missense_Mutation_p.L576V|XRRA1_uc001ovp.3_Missense_Mutation_p.L388V|XRRA1_uc001ovr.2_Missense_Mutation_p.L286V|XRRA1_uc001ovs.1_Missense_Mutation_p.L265V	NM_182969	NP_892014	Q6P2D8	XRRA1_HUMAN	X-ray radiation resistance associated 1	663					response to X-ray	cytoplasm|nucleus				central_nervous_system(1)	1						GGTTTCTGAAGAGTGTCCAGC	0.502													89	640	---	---	---	---	PASS
KLHL35	283212	broad.mit.edu	37	11	75139655	75139655	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:75139655C>T	uc001owm.1	-	2	457	c.238G>A	c.(238-240)GAA>AAA	p.E80K		NM_001039548	NP_001034637	Q6PF15	KLH35_HUMAN	kelch-like 35	80											0						ACGATCACTTCAGCTAGGTCC	0.627													4	88	---	---	---	---	PASS
LRRC32	2615	broad.mit.edu	37	11	76371468	76371468	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:76371468G>A	uc001oxq.3	-	3	1412	c.1169C>T	c.(1168-1170)ACG>ATG	p.T390M	LRRC32_uc001oxr.3_Missense_Mutation_p.T390M|LRRC32_uc010rsf.1_Missense_Mutation_p.T390M	NM_005512	NP_005503	Q14392	LRC32_HUMAN	leucine rich repeat containing 32 precursor	390	LRR 14.|Extracellular (Potential).					integral to plasma membrane					0						TAGGAGCAGCGTCCGCAGAGA	0.647													8	42	---	---	---	---	PASS
MYO7A	4647	broad.mit.edu	37	11	76885810	76885810	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:76885810C>A	uc001oyb.2	+	17	2216	c.1944C>A	c.(1942-1944)GAC>GAA	p.D648E	MYO7A_uc010rsl.1_Missense_Mutation_p.D648E|MYO7A_uc010rsm.1_Missense_Mutation_p.D637E|MYO7A_uc001oyc.2_Missense_Mutation_p.D648E|MYO7A_uc001oyd.2_5'UTR	NM_000260	NP_000251	Q13402	MYO7A_HUMAN	myosin VIIA isoform 1	648	Myosin head-like.				actin filament-based movement|equilibrioception|lysosome organization|sensory perception of sound|visual perception	cytosol|lysosomal membrane|myosin complex|photoreceptor inner segment|photoreceptor outer segment|synapse	actin binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(3)|breast(1)	4						AGCTGTTCGACCGGCACCTGT	0.617													7	23	---	---	---	---	PASS
ALG8	79053	broad.mit.edu	37	11	77835150	77835150	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:77835150C>G	uc001oza.1	-	3	350	c.285G>C	c.(283-285)TTG>TTC	p.L95F	ALG8_uc001oyz.1_Missense_Mutation_p.L95F|ALG8_uc009yux.1_5'UTR|ALG8_uc009yuy.1_RNA	NM_024079	NP_076984	Q9BVK2	ALG8_HUMAN	dolichyl pyrophosphate Glc1Man9GlcNAc2	95					dolichol-linked oligosaccharide biosynthetic process|post-translational protein modification|protein N-linked glycosylation via asparagine	endoplasmic reticulum membrane|integral to membrane	alpha-1,3-mannosyltransferase activity|dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase activity			ovary(2)|pancreas(1)	3	all_cancers(14;3.62e-19)|all_epithelial(13;1.27e-21)|Breast(9;8.51e-17)|Ovarian(111;0.152)		OV - Ovarian serous cystadenocarcinoma(8;9.66e-25)			TGGAGTAATTCAAATTATGGA	0.403													15	345	---	---	---	---	PASS
USP35	57558	broad.mit.edu	37	11	77907956	77907956	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:77907956C>T	uc009yva.1	+	2	911	c.665C>T	c.(664-666)TCC>TTC	p.S222F	USP35_uc001oze.2_Intron|USP35_uc001ozc.2_Intron|USP35_uc010rsp.1_Intron|USP35_uc001ozd.2_5'UTR|USP35_uc001ozf.2_5'Flank	NM_020798	NP_065849	Q9P2H5	UBP35_HUMAN	ubiquitin specific protease 35	222					ubiquitin-dependent protein catabolic process		binding|cysteine-type peptidase activity|ubiquitin thiolesterase activity			lung(2)|ovary(1)	3	all_cancers(14;3.77e-18)|all_epithelial(13;6.16e-21)|Breast(9;5.6e-16)|Ovarian(111;0.152)		OV - Ovarian serous cystadenocarcinoma(8;1.04e-25)			GCAGTCATCTCCTGCGCAGGT	0.692													4	20	---	---	---	---	PASS
NARS2	79731	broad.mit.edu	37	11	78176982	78176982	+	Missense_Mutation	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:78176982A>C	uc001ozi.2	-	11	1480	c.1104T>G	c.(1102-1104)AAT>AAG	p.N368K	NARS2_uc010rsq.1_Missense_Mutation_p.N141K	NM_024678	NP_078954	Q96I59	SYNM_HUMAN	asparaginyl-tRNA synthetase 2, mitochondrial	368					asparaginyl-tRNA aminoacylation	mitochondrial matrix	asparagine-tRNA ligase activity|ATP binding|nucleic acid binding			ovary(2)	2	all_cancers(14;2.63e-17)|all_epithelial(13;1.85e-19)				L-Asparagine(DB00174)	TTAATGGATAATTAATAACGA	0.413													12	226	---	---	---	---	PASS
ODZ4	26011	broad.mit.edu	37	11	78369130	78369130	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:78369130C>G	uc001ozl.3	-	34	8746	c.8283G>C	c.(8281-8283)ATG>ATC	p.M2761I	ODZ4_uc001ozk.3_Missense_Mutation_p.M986I|ODZ4_uc009yvb.1_Intron	NM_001098816	NP_001092286	Q6N022	TEN4_HUMAN	odz, odd Oz/ten-m homolog 4	2761	Extracellular (Potential).				signal transduction	integral to membrane				ovary(2)|pancreas(2)	4						CGCTCTGTCTCATGAAGTGGA	0.537													81	732	---	---	---	---	PASS
ODZ4	26011	broad.mit.edu	37	11	78449625	78449625	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:78449625G>C	uc001ozl.3	-							NM_001098816	NP_001092286	Q6N022	TEN4_HUMAN	odz, odd Oz/ten-m homolog 4						signal transduction	integral to membrane				ovary(2)|pancreas(2)	4						CCTGTGGGAAGAGAAGAGAGA	0.488													7	54	---	---	---	---	PASS
CCDC89	220388	broad.mit.edu	37	11	85397140	85397140	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:85397140G>C	uc001pau.1	-	1	181	c.34C>G	c.(34-36)CCC>GCC	p.P12A		NM_152723	NP_689936	Q8N998	CCD89_HUMAN	coiled-coil domain containing 89	12						cytoplasm|nucleus					0		Acute lymphoblastic leukemia(157;4.88e-06)|all_hematologic(158;0.00572)				TCCATCCTGGGAGCCTGCTGT	0.522													5	399	---	---	---	---	PASS
ME3	10873	broad.mit.edu	37	11	86158109	86158109	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:86158109C>T	uc001pbz.2	-	11	1632	c.1378G>A	c.(1378-1380)GAG>AAG	p.E460K	ME3_uc001pca.2_Missense_Mutation_p.E460K|ME3_uc009yvk.2_Missense_Mutation_p.E460K	NM_001014811	NP_001014811	Q16798	MAON_HUMAN	mitochondrial malic enzyme 3 precursor	460					aerobic respiration|malate metabolic process|oxygen metabolic process|pyruvate metabolic process	mitochondrial matrix	malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activity|metal ion binding|NAD binding			ovary(1)	1		Acute lymphoblastic leukemia(157;4.34e-06)|all_hematologic(158;0.00252)			NADH(DB00157)	CCGCTGACCTCGGTGACCCGG	0.478													7	158	---	---	---	---	PASS
TMEM135	65084	broad.mit.edu	37	11	87024486	87024486	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:87024486G>T	uc001pch.2	+	11	979	c.956G>T	c.(955-957)CGC>CTC	p.R319L	TMEM135_uc010rtt.1_Missense_Mutation_p.R180L|TMEM135_uc001pci.2_Missense_Mutation_p.R297L	NM_022918	NP_075069	Q86UB9	TM135_HUMAN	transmembrane protein 135	319						integral to membrane					0		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.0123)				TGCTTCCTGCGCTGGATCAGA	0.294													69	325	---	---	---	---	PASS
GRM5	2915	broad.mit.edu	37	11	88780474	88780474	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:88780474C>T	uc001pcq.2	-	1	767	c.567G>A	c.(565-567)ATG>ATA	p.M189I	GRM5_uc009yvm.2_Missense_Mutation_p.M189I|GRM5_uc009yvn.1_Missense_Mutation_p.M189I	NM_001143831	NP_001137303	P41594	GRM5_HUMAN	glutamate receptor, metabotropic 5 isoform a	189	Extracellular (Potential).				activation of phospholipase C activity by metabotropic glutamate receptor signaling pathway|synaptic transmission	integral to plasma membrane	G-protein coupled receptor activity|glutamate receptor activity			central_nervous_system(4)|ovary(2)|lung(2)|breast(1)	9		Acute lymphoblastic leukemia(157;2.54e-05)|all_hematologic(158;0.00834)			Acamprosate(DB00659)	GCACAACCCTCATGAAATATT	0.468													14	326	---	---	---	---	PASS
MTNR1B	4544	broad.mit.edu	37	11	92714695	92714695	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92714695C>A	uc001pdk.1	+	2	409	c.306C>A	c.(304-306)TTC>TTA	p.F102L		NM_005959	NP_005950	P49286	MTR1B_HUMAN	melatonin receptor 1B	102	Extracellular (Potential).				G-protein signaling, coupled to cyclic nucleotide second messenger|glucose homeostasis|regulation of insulin secretion|synaptic transmission	integral to plasma membrane	melatonin receptor activity			ovary(1)|central_nervous_system(1)	2		Acute lymphoblastic leukemia(157;2.31e-05)|all_hematologic(158;0.00824)			Ramelteon(DB00980)	TGGCCATCTTCTATGACGGCT	0.572													106	311	---	---	---	---	PASS
PIWIL4	143689	broad.mit.edu	37	11	94354034	94354034	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:94354034C>G	uc001pfa.2	+						PIWIL4_uc009ywk.1_Intron	NM_152431	NP_689644	Q7Z3Z4	PIWL4_HUMAN	piwi-like 4						cell differentiation|DNA methylation involved in gamete generation|gene silencing by RNA|meiosis|multicellular organismal development|piRNA metabolic process|regulation of translation|spermatogenesis	nucleus|piP-body	piRNA binding			skin(1)	1		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.0123)				ATACTTTTTTCTCCTCAGGGC	0.378													34	58	---	---	---	---	PASS
ENDOD1	23052	broad.mit.edu	37	11	94862660	94862660	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:94862660C>G	uc001pfh.2	+	2	1495	c.1420C>G	c.(1420-1422)CTG>GTG	p.L474V		NM_015036	NP_055851	O94919	ENDD1_HUMAN	endonuclease domain containing 1 precursor	474						extracellular region	endonuclease activity|metal ion binding|nucleic acid binding				0		Acute lymphoblastic leukemia(157;2.33e-05)|all_hematologic(158;0.00824)				TTTTGGTACCCTGGGTGGCCT	0.463													31	204	---	---	---	---	PASS
PPP2R1B	5519	broad.mit.edu	37	11	111597721	111597721	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:111597721C>T	uc001plw.1	-	16	2056	c.1972G>A	c.(1972-1974)GAG>AAG	p.E658K	uc001plu.1_5'Flank|PPP2R1B_uc009yye.1_RNA|PPP2R1B_uc010rwi.1_Missense_Mutation_p.E594K	NM_181699	NP_859050	P30154	2AAB_HUMAN	beta isoform of regulatory subunit A, protein	Error:Variant_position_missing_in_P30154_after_alignment							protein binding				0		all_cancers(61;2.34e-15)|all_epithelial(67;1.72e-09)|Melanoma(852;1.91e-06)|all_hematologic(158;0.000405)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0112)|all_neural(223;0.0281)|Medulloblastoma(222;0.0425)		BRCA - Breast invasive adenocarcinoma(274;1.13e-06)|Epithelial(105;2.36e-06)|all cancers(92;3.78e-05)|OV - Ovarian serous cystadenocarcinoma(223;0.0761)		TGCACTAGCTCTGCAATTCCC	0.443													45	55	---	---	---	---	PASS
FDXACB1	91893	broad.mit.edu	37	11	111746170	111746170	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:111746170G>T	uc001pmc.3	-	5	1648	c.1351C>A	c.(1351-1353)CGT>AGT	p.R451S	ALG9_uc010rwo.1_Intron|FDXACB1_uc009yyi.2_Missense_Mutation_p.R302S	NM_138378	NP_612387	Q9BRP7	FDXA1_HUMAN	ferredoxin-fold anticodon binding domain	451					phenylalanyl-tRNA aminoacylation|tRNA processing		ATP binding|magnesium ion binding|phenylalanine-tRNA ligase activity|tRNA binding				0						GTCTTCACACGAATCATATAA	0.398													61	108	---	---	---	---	PASS
PIH1D2	120379	broad.mit.edu	37	11	111942410	111942410	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:111942410G>C	uc001pmq.3	-	3	332	c.250C>G	c.(250-252)CAT>GAT	p.H84D	PIH1D2_uc009yyl.2_Missense_Mutation_p.H84D|PIH1D2_uc001pmp.3_Missense_Mutation_p.H84D|PIH1D2_uc010rws.1_Missense_Mutation_p.H84D|C11orf57_uc001pmu.2_5'Flank|C11orf57_uc001pmw.3_5'Flank|C11orf57_uc001pmt.3_5'Flank|C11orf57_uc001pmr.3_5'Flank|C11orf57_uc001pmv.3_5'Flank|C11orf57_uc001pms.3_5'Flank	NM_138789	NP_620144	Q8WWB5	PIHD2_HUMAN	PIH1 domain containing 2 isoform 1	84										ovary(1)	1		all_cancers(61;1.09e-14)|all_epithelial(67;7.64e-09)|Melanoma(852;1.91e-06)|all_hematologic(158;0.000405)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0112)|all_neural(223;0.0281)|Medulloblastoma(222;0.0425)		Epithelial(105;3.19e-07)|BRCA - Breast invasive adenocarcinoma(274;6.17e-07)|all cancers(92;6.18e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.0508)		GGTACTGGATGAGTGGTTGAT	0.368													8	186	---	---	---	---	PASS
NCAM1	4684	broad.mit.edu	37	11	112832291	112832291	+	5'UTR	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:112832291G>C	uc009yyq.1	+	1					NCAM1_uc001pno.2_5'UTR|uc001pnn.2_Intron	NM_001076682	NP_001070150	P13591	NCAM1_HUMAN	neural cell adhesion molecule 1 isoform 3						axon guidance|interferon-gamma-mediated signaling pathway	anchored to membrane|extracellular region|Golgi membrane|integral to membrane				ovary(1)	1		all_cancers(61;5.82e-19)|all_epithelial(67;6.87e-12)|Melanoma(852;1.99e-05)|all_hematologic(158;3.66e-05)|Acute lymphoblastic leukemia(157;0.00119)|Breast(348;0.0109)|all_neural(223;0.0299)|Medulloblastoma(222;0.0458)|Renal(330;0.198)|Prostate(24;0.207)		BRCA - Breast invasive adenocarcinoma(274;1.78e-05)|Epithelial(105;0.000114)|all cancers(92;0.000467)|OV - Ovarian serous cystadenocarcinoma(223;0.212)		GGGGGGCACAGAATTTACCGC	0.512													3	7	---	---	---	---	PASS
UBE4A	9354	broad.mit.edu	37	11	118267127	118267127	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118267127G>A	uc001psw.2	+	20	3302	c.3173G>A	c.(3172-3174)AGG>AAG	p.R1058K	UBE4A_uc001psv.2_Missense_Mutation_p.R1065K	NM_004788	NP_004779	Q14139	UBE4A_HUMAN	ubiquitination factor E4A	1058					ubiquitin-dependent protein catabolic process	ubiquitin ligase complex	protein binding			ovary(2)|upper_aerodigestive_tract(1)|breast(1)|kidney(1)	5	all_hematologic(175;0.046)	Medulloblastoma(222;0.0425)|Breast(348;0.181)|all_hematologic(192;0.196)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;3.28e-05)		CTTGCAGAGAGGAAACAACAA	0.433													17	123	---	---	---	---	PASS
H2AFX	3014	broad.mit.edu	37	11	118965713	118965713	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118965713G>A	uc001pvg.2	-	1	465	c.392C>T	c.(391-393)TCG>TTG	p.S131L	H2AFX_uc001pvh.1_RNA	NM_002105	NP_002096	P16104	H2AX_HUMAN	H2A histone family, member X	131					DNA damage checkpoint|double-strand break repair via homologous recombination|meiosis|nucleosome assembly|positive regulation of DNA repair|response to ionizing radiation	nucleoplasm|nucleosome	DNA binding|enzyme binding|histone binding				0	all_hematologic(175;0.0977)	Medulloblastoma(222;0.0425)|Breast(348;0.052)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;7.47e-05)		CTTGCCGCCCGAGGGCGCCTT	0.592								Chromatin_Structure|Direct_reversal_of_damage			OREG0021395	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	12	54	---	---	---	---	PASS
OR8D2	283160	broad.mit.edu	37	11	124189674	124189674	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124189674G>T	uc010sah.1	-	1	420	c.420C>A	c.(418-420)GTC>GTA	p.V140V		NM_001002918	NP_001002918	Q9GZM6	OR8D2_HUMAN	olfactory receptor, family 8, subfamily D,	140	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			breast(1)|central_nervous_system(1)|pancreas(1)	3		Breast(109;0.0115)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;1.49e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0525)		TTATGGAACAGACCCTGTGGG	0.468													30	70	---	---	---	---	PASS
OR8B12	219858	broad.mit.edu	37	11	124412888	124412888	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124412888G>T	uc010sam.1	-	1	663	c.663C>A	c.(661-663)CTC>CTA	p.L221L		NM_001005195	NP_001005195	Q8NGG6	OR8BC_HUMAN	olfactory receptor, family 8, subfamily B,	221	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|breast(1)|skin(1)	3		Breast(109;0.0115)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;1.49e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0213)		GAATGCTGGAGAGGATGAGGG	0.438													18	39	---	---	---	---	PASS
ESAM	90952	broad.mit.edu	37	11	124623562	124623562	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124623562G>C	uc001qav.3	-	7	1326	c.1153C>G	c.(1153-1155)CAA>GAA	p.Q385E	VSIG2_uc001qas.2_5'Flank|VSIG2_uc001qat.2_5'Flank|ESAM_uc010sao.1_Intron|ESAM_uc001qau.3_Missense_Mutation_p.Q312E|ESAM_uc001qaw.3_RNA|ESAM_uc001qax.3_RNA|ESAM_uc009zbi.2_3'UTR	NM_138961	NP_620411	Q96AP7	ESAM_HUMAN	endothelial cell adhesion molecule precursor	385	Cytoplasmic (Potential).				blood coagulation|leukocyte migration	adherens junction|integral to membrane|tight junction					0	all_hematologic(175;0.215)	Breast(109;0.00109)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.49e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.022)		GAGCCAGCTTGACTCTGGGCA	0.572													28	52	---	---	---	---	PASS
CDON	50937	broad.mit.edu	37	11	125867216	125867216	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:125867216G>C	uc009zbw.2	-	12	2376	c.2248C>G	c.(2248-2250)CCA>GCA	p.P750A	CDON_uc001qdb.3_Missense_Mutation_p.P127A|CDON_uc001qdc.3_Missense_Mutation_p.P750A	NM_016952	NP_058648	Q4KMG0	CDON_HUMAN	surface glycoprotein, Ig superfamily member	750	Fibronectin type-III 2.|Extracellular (Potential).				cell adhesion|muscle cell differentiation|positive regulation of muscle cell differentiation	integral to membrane|plasma membrane	protein binding			ovary(3)|skin(2)|breast(1)	6	all_hematologic(175;0.177)	Breast(109;0.00157)|Lung NSC(97;0.0127)|all_lung(97;0.0133)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.51e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0604)		GCAGTGATTGGAGAACCCCCG	0.507													51	49	---	---	---	---	PASS
PRDM10	56980	broad.mit.edu	37	11	129787090	129787090	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:129787090C>T	uc001qfm.2	-	16	2501	c.2269G>A	c.(2269-2271)GAG>AAG	p.E757K	PRDM10_uc001qfj.2_Missense_Mutation_p.E671K|PRDM10_uc001qfk.2_Missense_Mutation_p.E667K|PRDM10_uc001qfl.2_Missense_Mutation_p.E671K|PRDM10_uc010sbx.1_Missense_Mutation_p.E667K|PRDM10_uc001qfn.2_Missense_Mutation_p.E753K|PRDM10_uc009zcs.1_5'Flank	NM_020228	NP_064613	Q9NQV6	PRD10_HUMAN	PR domain containing 10 isoform 1	757					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			pancreas(1)	1	all_hematologic(175;0.0537)	Breast(109;0.000496)|Lung NSC(97;0.000693)|all_lung(97;0.00151)|Medulloblastoma(222;0.0425)|all_neural(223;0.0837)		OV - Ovarian serous cystadenocarcinoma(99;0.0174)|Lung(977;0.176)|LUSC - Lung squamous cell carcinoma(976;0.185)		TCTGGCACCTCTTCTATCTTC	0.383													79	100	---	---	---	---	PASS
WNK1	65125	broad.mit.edu	37	12	968625	968625	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:968625G>A	uc001qio.3	+	6	2122	c.1615G>A	c.(1615-1617)GAA>AAA	p.E539K	WNK1_uc001qip.3_Missense_Mutation_p.E539K|WNK1_uc001qir.3_5'Flank	NM_018979	NP_061852	Q9H4A3	WNK1_HUMAN	WNK lysine deficient protein kinase 1	539					intracellular protein kinase cascade|ion transport|neuron development	cytoplasm	ATP binding|protein binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			stomach(6)|breast(6)|ovary(5)|lung(4)|large_intestine(1)|central_nervous_system(1)	23	all_cancers(10;0.00611)|all_epithelial(11;0.00825)|all_lung(10;0.0331)|Ovarian(42;0.0512)|Lung NSC(10;0.0632)		Epithelial(1;1.74e-08)|all cancers(1;7.04e-08)|OV - Ovarian serous cystadenocarcinoma(31;0.000423)|BRCA - Breast invasive adenocarcinoma(9;0.0149)|Colorectal(1;0.0197)			TGTTGCACAAGAAATGGTAAA	0.294													95	218	---	---	---	---	PASS
WNK1	65125	broad.mit.edu	37	12	993358	993358	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:993358G>A	uc001qio.3	+	18	4300	c.3793G>A	c.(3793-3795)GAA>AAA	p.E1265K	WNK1_uc001qip.3_Missense_Mutation_p.E1018K|WNK1_uc001qir.3_Missense_Mutation_p.E438K	NM_018979	NP_061852	Q9H4A3	WNK1_HUMAN	WNK lysine deficient protein kinase 1	1265					intracellular protein kinase cascade|ion transport|neuron development	cytoplasm	ATP binding|protein binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			stomach(6)|breast(6)|ovary(5)|lung(4)|large_intestine(1)|central_nervous_system(1)	23	all_cancers(10;0.00611)|all_epithelial(11;0.00825)|all_lung(10;0.0331)|Ovarian(42;0.0512)|Lung NSC(10;0.0632)		Epithelial(1;1.74e-08)|all cancers(1;7.04e-08)|OV - Ovarian serous cystadenocarcinoma(31;0.000423)|BRCA - Breast invasive adenocarcinoma(9;0.0149)|Colorectal(1;0.0197)			TCCTGTGCCAGAAAGCCGATT	0.408													31	396	---	---	---	---	PASS
WNK1	65125	broad.mit.edu	37	12	994443	994443	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:994443A>G	uc001qio.3	+	19	4980	c.4473A>G	c.(4471-4473)TCA>TCG	p.S1491S	WNK1_uc001qip.3_Silent_p.S1244S|WNK1_uc001qir.3_Silent_p.S664S	NM_018979	NP_061852	Q9H4A3	WNK1_HUMAN	WNK lysine deficient protein kinase 1	1491					intracellular protein kinase cascade|ion transport|neuron development	cytoplasm	ATP binding|protein binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			stomach(6)|breast(6)|ovary(5)|lung(4)|large_intestine(1)|central_nervous_system(1)	23	all_cancers(10;0.00611)|all_epithelial(11;0.00825)|all_lung(10;0.0331)|Ovarian(42;0.0512)|Lung NSC(10;0.0632)		Epithelial(1;1.74e-08)|all cancers(1;7.04e-08)|OV - Ovarian serous cystadenocarcinoma(31;0.000423)|BRCA - Breast invasive adenocarcinoma(9;0.0149)|Colorectal(1;0.0197)			CATTAACATCAGTTTCTACCA	0.517													16	438	---	---	---	---	PASS
CACNA2D4	93589	broad.mit.edu	37	12	1987508	1987508	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:1987508G>T	uc001qjp.2	-	16	1923	c.1692C>A	c.(1690-1692)ATC>ATA	p.I564I	CACNA2D4_uc009zds.1_RNA|CACNA2D4_uc009zdt.1_Silent_p.I452I	NM_172364	NP_758952	Q7Z3S7	CA2D4_HUMAN	voltage-gated calcium channel alpha(2)delta-4	564	Cache.|Extracellular (Potential).					integral to membrane	calcium channel activity|metal ion binding|voltage-gated ion channel activity			ovary(1)	1	Ovarian(42;0.107)	Myeloproliferative disorder(1001;0.206)	OV - Ovarian serous cystadenocarcinoma(31;0.00113)	Kidney(2;0.0205)|KIRC - Kidney renal clear cell carcinoma(2;0.0451)		GATGGGAGAGGATGTAGCCAT	0.527													14	9	---	---	---	---	PASS
CACNA1C	775	broad.mit.edu	37	12	2786995	2786995	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:2786995G>C	uc009zdu.1	+	43	5510	c.5197G>C	c.(5197-5199)GAG>CAG	p.E1733Q	CACNA1C_uc009zdv.1_Missense_Mutation_p.E1682Q|CACNA1C_uc001qkb.2_Missense_Mutation_p.E1685Q|CACNA1C_uc001qkc.2_Missense_Mutation_p.E1704Q|CACNA1C_uc001qke.2_Missense_Mutation_p.E1674Q|CACNA1C_uc001qkf.2_Missense_Mutation_p.E1693Q|CACNA1C_uc001qjz.2_Missense_Mutation_p.E1685Q|CACNA1C_uc001qkd.2_Missense_Mutation_p.E1704Q|CACNA1C_uc001qkg.2_Missense_Mutation_p.E1691Q|CACNA1C_uc009zdw.1_Missense_Mutation_p.E1726Q|CACNA1C_uc001qkh.2_Missense_Mutation_p.E1693Q|CACNA1C_uc001qkl.2_Missense_Mutation_p.E1733Q|CACNA1C_uc001qkn.2_Missense_Mutation_p.E1685Q|CACNA1C_uc001qko.2_Missense_Mutation_p.E1705Q|CACNA1C_uc001qkp.2_Missense_Mutation_p.E1685Q|CACNA1C_uc001qkr.2_Missense_Mutation_p.E1702Q|CACNA1C_uc001qku.2_Missense_Mutation_p.E1685Q|CACNA1C_uc001qkq.2_Missense_Mutation_p.E1713Q|CACNA1C_uc001qks.2_Missense_Mutation_p.E1685Q|CACNA1C_uc001qkt.2_Missense_Mutation_p.E1704Q|CACNA1C_uc001qki.1_Missense_Mutation_p.E1421Q|CACNA1C_uc001qkj.1_Missense_Mutation_p.E1421Q|CACNA1C_uc001qkk.1_Missense_Mutation_p.E1421Q|CACNA1C_uc001qkm.1_Missense_Mutation_p.E1410Q|CACNA1C_uc010sea.1_Missense_Mutation_p.E376Q|uc001qkx.1_RNA|CACNA1C_uc001qky.1_Missense_Mutation_p.E3Q	NM_199460	NP_955630	Q13936	CAC1C_HUMAN	calcium channel, voltage-dependent, L type,	1733	Cytoplasmic (Potential).				axon guidance|calcium ion transport into cytosol|energy reserve metabolic process|regulation of insulin secretion	cytoplasm|postsynaptic density|voltage-gated calcium channel complex	calmodulin binding|voltage-gated calcium channel activity			ovary(10)|central_nervous_system(1)	11			OV - Ovarian serous cystadenocarcinoma(31;0.00256)	LUAD - Lung adenocarcinoma(1;0.134)	Ibutilide(DB00308)|Isradipine(DB00270)|Magnesium Sulfate(DB00653)|Mibefradil(DB01388)|Nicardipine(DB00622)|Verapamil(DB00661)	GGCCATGAAGGAGGCTGTGTC	0.587													9	133	---	---	---	---	PASS
TULP3	7289	broad.mit.edu	37	12	3040350	3040350	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:3040350G>C	uc010seh.1	+	6	721	c.640G>C	c.(640-642)GAT>CAT	p.D214H	TULP3_uc010sef.1_RNA|TULP3_uc009zec.1_5'UTR|TULP3_uc010seg.1_RNA|TULP3_uc001qlj.2_Missense_Mutation_p.D214H|TULP3_uc010sei.1_Missense_Mutation_p.D71H	NM_003324	NP_003315	O75386	TULP3_HUMAN	tubby like protein 3 isoform 1	214					G-protein coupled receptor protein signaling pathway|regulation of transcription, DNA-dependent	cytoplasm|extracellular region|nucleus|plasma membrane	phosphatidylinositol-4,5-bisphosphate binding				0			OV - Ovarian serous cystadenocarcinoma(31;0.000818)			AAGGGGAATGGATCGGGGTCT	0.443													73	177	---	---	---	---	PASS
AKAP3	10566	broad.mit.edu	37	12	4725047	4725047	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:4725047G>A	uc001qnb.3	-	5	2649	c.2420C>T	c.(2419-2421)TCA>TTA	p.S807L		NM_006422	NP_006413	O75969	AKAP3_HUMAN	A-kinase anchor protein 3	807					acrosome reaction|cellular component movement	acrosomal vesicle	protein kinase A binding			skin(3)|large_intestine(1)|ovary(1)|kidney(1)	6						AGCAGCAGCTGAGAGCTGAAG	0.582													66	143	---	---	---	---	PASS
GALNT8	26290	broad.mit.edu	37	12	4848503	4848503	+	Intron	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:4848503A>C	uc001qne.1	+							NM_017417	NP_059113	Q9NY28	GALT8_HUMAN	polypeptide N-acetylgalactosaminyltransferase 8							Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			ovary(2)|pancreas(1)|skin(1)	4						ATGGTGAGCAACGTGATCAAA	0.428													4	126	---	---	---	---	PASS
ACSM4	341392	broad.mit.edu	37	12	7469741	7469741	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7469741C>G	uc001qsx.1	+	4	629	c.629C>G	c.(628-630)TCT>TGT	p.S210C		NM_001080454	NP_001073923	P0C7M7	ACSM4_HUMAN	acyl-CoA synthetase medium-chain family member 4	210					fatty acid metabolic process	mitochondrial matrix	ATP binding|butyrate-CoA ligase activity|metal ion binding				0						AGATTCGCCTCTGAAGAGCAC	0.483													3	76	---	---	---	---	PASS
CD163L1	283316	broad.mit.edu	37	12	7525937	7525937	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7525937C>G	uc001qsy.2	-	14	3735	c.3709G>C	c.(3709-3711)GAG>CAG	p.E1237Q	CD163L1_uc010sge.1_Missense_Mutation_p.E1247Q	NM_174941	NP_777601	Q9NR16	C163B_HUMAN	scavenger receptor cysteine-rich type 1	1237	SRCR 11.|Extracellular (Potential).					extracellular region|integral to membrane|plasma membrane	scavenger receptor activity			ovary(8)|skin(2)|central_nervous_system(1)	11						ATCCAGGTCTCTTCTGCTGGG	0.458													29	131	---	---	---	---	PASS
CD163L1	283316	broad.mit.edu	37	12	7586033	7586033	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7586033G>C	uc001qsy.2	-	3	408	c.382C>G	c.(382-384)CAA>GAA	p.Q128E	CD163L1_uc010sge.1_Missense_Mutation_p.Q128E	NM_174941	NP_777601	Q9NR16	C163B_HUMAN	scavenger receptor cysteine-rich type 1	128	SRCR 1.|Extracellular (Potential).					extracellular region|integral to membrane|plasma membrane	scavenger receptor activity			ovary(8)|skin(2)|central_nervous_system(1)	11						TCCCGGTGTTGACATTCCCAG	0.433													8	209	---	---	---	---	PASS
CD163	9332	broad.mit.edu	37	12	7635290	7635290	+	Missense_Mutation	SNP	C	T	T	rs139478533	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7635290C>T	uc001qsz.3	-	14	3324	c.3196G>A	c.(3196-3198)GTC>ATC	p.V1066I	CD163_uc001qta.3_Missense_Mutation_p.V1066I|CD163_uc009zfw.2_Missense_Mutation_p.V1099I	NM_004244	NP_004235	Q86VB7	C163A_HUMAN	CD163 antigen isoform a	1066	Helical; (Potential).				acute-phase response	extracellular region|integral to plasma membrane	protein binding|scavenger receptor activity			ovary(6)|pancreas(1)|skin(1)	8						AATAATGCGACGAAAATGGCC	0.423													63	286	---	---	---	---	PASS
ARHGDIB	397	broad.mit.edu	37	12	15095465	15095465	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:15095465C>T	uc001rcq.1	-	6	701	c.597G>A	c.(595-597)TGG>TGA	p.W199*	ARHGDIB_uc001rcp.1_RNA	NM_001175	NP_001166	P52566	GDIR2_HUMAN	Rho GDP dissociation inhibitor (GDI) beta	199					actin cytoskeleton organization|cellular component movement|immune response|multicellular organismal development|negative regulation of cell adhesion|regulation of small GTPase mediated signal transduction|Rho protein signal transduction	cytoplasmic membrane-bounded vesicle|cytoskeleton|cytosol	GTPase activator activity|Rho GDP-dissociation inhibitor activity				0						TTCATTCTGTCCACTCCTTCT	0.567													13	255	---	---	---	---	PASS
PTPRO	5800	broad.mit.edu	37	12	15732973	15732973	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:15732973A>G	uc001rcv.1	+	21	3095	c.2921A>G	c.(2920-2922)TAT>TGT	p.Y974C	PTPRO_uc001rcw.1_Missense_Mutation_p.Y946C|PTPRO_uc001rcx.1_Missense_Mutation_p.Y163C|PTPRO_uc001rcy.1_Missense_Mutation_p.Y163C|PTPRO_uc001rcz.1_Missense_Mutation_p.Y135C|PTPRO_uc001rda.1_Missense_Mutation_p.Y135C	NM_030667	NP_109592	Q16827	PTPRO_HUMAN	receptor-type protein tyrosine phosphatase O	974	Cytoplasmic (Potential).|Tyrosine-protein phosphatase.					integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			skin(5)|ovary(2)|upper_aerodigestive_tract(1)|lung(1)	9		Hepatocellular(102;0.244)				TTCTCTACAGATGACTTCAGC	0.343													53	110	---	---	---	---	PASS
EPS8	2059	broad.mit.edu	37	12	15784501	15784501	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:15784501G>C	uc009zif.2	-	18	2013	c.1919C>G	c.(1918-1920)TCC>TGC	p.S640C	EPS8_uc001rdb.2_Missense_Mutation_p.S640C|EPS8_uc009zig.2_Missense_Mutation_p.S380C|EPS8_uc010shv.1_Missense_Mutation_p.S380C	NM_004447	NP_004438	Q12929	EPS8_HUMAN	epidermal growth factor receptor pathway	640	Pro-rich.				cell proliferation|epidermal growth factor receptor signaling pathway		SH3/SH2 adaptor activity			ovary(2)|upper_aerodigestive_tract(1)|skin(1)	4		all_epithelial(100;1.87e-05)|Breast(259;0.000286)|Hepatocellular(102;0.244)		BRCA - Breast invasive adenocarcinoma(232;4.29e-05)|GBM - Glioblastoma multiforme(207;0.0264)		TGCTGGAGTGGAAGGGGGAAG	0.542													125	180	---	---	---	---	PASS
PLCZ1	89869	broad.mit.edu	37	12	18854647	18854647	+	Nonsense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:18854647T>A	uc010sid.1	-	8	1119	c.928A>T	c.(928-930)AGA>TGA	p.R310*	PLCZ1_uc001rdv.3_Nonsense_Mutation_p.R206*|PLCZ1_uc001rdw.3_Nonsense_Mutation_p.R51*|PLCZ1_uc001rdu.1_Nonsense_Mutation_p.R51*|PLCZ1_uc009zil.1_RNA	NM_033123	NP_149114	Q86YW0	PLCZ1_HUMAN	phospholipase C, zeta 1	310					intracellular signal transduction|lipid catabolic process|multicellular organismal development	nucleus|perinuclear region of cytoplasm	calcium ion binding|phosphatidylinositol phospholipase C activity|signal transducer activity			ovary(1)|lung(1)|skin(1)	3	Acute lymphoblastic leukemia(4;0.000455)|all_hematologic(4;0.0241)					GAACCTTTTCTTTCATGGGTT	0.269													48	33	---	---	---	---	PASS
SLCO1B3	28234	broad.mit.edu	37	12	21008097	21008097	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21008097G>A	uc001rek.2	+	3	346	c.220G>A	c.(220-222)GAA>AAA	p.E74K	SLCO1B3_uc001rel.2_Missense_Mutation_p.E74K|SLCO1B3_uc010sil.1_Missense_Mutation_p.E74K|LST-3TM12_uc010sim.1_Missense_Mutation_p.E74K	NM_019844	NP_062818	Q9NPD5	SO1B3_HUMAN	solute carrier organic anion transporter family,	74	Helical; Name=2; (Potential).				bile acid metabolic process|sodium-independent organic anion transport	basolateral plasma membrane|cytoplasm|integral to plasma membrane	bile acid transmembrane transporter activity|organic anion transmembrane transporter activity			large_intestine(2)|ovary(1)|skin(1)	4	Esophageal squamous(101;0.149)					TGGAAGCTTTGAAATTGGTAA	0.274													11	103	---	---	---	---	PASS
KCNJ8	3764	broad.mit.edu	37	12	21919017	21919017	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21919017G>A	uc001rff.2	-	3	1253	c.915C>T	c.(913-915)ATC>ATT	p.I305I		NM_004982	NP_004973	Q15842	IRK8_HUMAN	potassium inwardly-rectifying channel J8	305	Cytoplasmic (By similarity).					voltage-gated potassium channel complex					0					Levosimendan(DB00922)	CTTGTGTGGTGATGCCAGTAG	0.498													12	233	---	---	---	---	PASS
KCNJ8	3764	broad.mit.edu	37	12	21919230	21919230	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21919230A>G	uc001rff.2	-	3	1040	c.702T>C	c.(700-702)ACT>ACC	p.T234T		NM_004982	NP_004973	Q15842	IRK8_HUMAN	potassium inwardly-rectifying channel J8	234	Cytoplasmic (By similarity).					voltage-gated potassium channel complex					0					Levosimendan(DB00922)	CTTCAGGTGTAGTTGTTTTCT	0.478													5	323	---	---	---	---	PASS
MED21	9412	broad.mit.edu	37	12	27175566	27175566	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:27175566C>T	uc001rhp.1	+						MED21_uc009zjh.1_Intron	NM_004264	NP_004255	Q13503	MED21_HUMAN	mediator complex subunit 21						positive regulation of transcription from RNA polymerase II promoter	mediator complex	DNA-directed RNA polymerase activity|transcription coactivator activity				0	Colorectal(261;0.0847)					TGAGGAATTTCATTCGATTAG	0.532													16	178	---	---	---	---	PASS
YARS2	51067	broad.mit.edu	37	12	32900274	32900274	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32900274C>G	uc001rli.2	-	5	1364	c.1298G>C	c.(1297-1299)GGA>GCA	p.G433A		NM_001040436	NP_001035526	Q9Y2Z4	SYYM_HUMAN	tyrosyl-tRNA synthetase 2, mitochondrial	433					tyrosyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|protein binding|RNA binding|tyrosine-tRNA ligase activity				0	Lung NSC(5;2.43e-07)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.239)				L-Tyrosine(DB00135)	TATGCTGACTCCGCCTTCTGT	0.348													5	397	---	---	---	---	PASS
PKP2	5318	broad.mit.edu	37	12	32975454	32975454	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32975454C>T	uc001rlj.3	-	9	2033	c.1918G>A	c.(1918-1920)GAC>AAC	p.D640N	PKP2_uc001rlk.3_Missense_Mutation_p.D596N|PKP2_uc010skj.1_Missense_Mutation_p.D596N	NM_004572	NP_004563	Q99959	PKP2_HUMAN	plakophilin 2 isoform 2b	640					cell-cell adhesion	desmosome|integral to membrane|nucleus	binding			ovary(1)|pancreas(1)	2	Lung NSC(5;9.35e-07)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.239)					TTGTTGTTGTCAGTCTGGATA	0.403													12	306	---	---	---	---	PASS
KIF21A	55605	broad.mit.edu	37	12	39726900	39726900	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:39726900G>C	uc001rly.2	-	19	2643	c.2497C>G	c.(2497-2499)CTT>GTT	p.L833V	KIF21A_uc001rlv.2_5'Flank|KIF21A_uc001rlw.2_Missense_Mutation_p.L150V|KIF21A_uc001rlx.2_Missense_Mutation_p.L820V|KIF21A_uc001rlz.2_Missense_Mutation_p.L797V|KIF21A_uc010skl.1_Missense_Mutation_p.L820V	NM_017641	NP_060111	Q7Z4S6	KI21A_HUMAN	kinesin family member 21A	833					microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(4)|pancreas(1)|lung(1)|skin(1)	7		Lung NSC(34;0.179)|all_lung(34;0.213)				TGCCGACGAAGAGCCGTAACC	0.448													38	240	---	---	---	---	PASS
ABCD2	225	broad.mit.edu	37	12	39980068	39980068	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:39980068G>C	uc001rmb.2	-	7	2104	c.1678C>G	c.(1678-1680)CAA>GAA	p.Q560E		NM_005164	NP_005155	Q9UBJ2	ABCD2_HUMAN	ATP-binding cassette, sub-family D, member 2	560	ABC transporter.				fatty acid metabolic process|transport	ATP-binding cassette (ABC) transporter complex|integral to plasma membrane|peroxisomal membrane	ATP binding|ATPase activity|protein binding			ovary(2)|upper_aerodigestive_tract(1)|pancreas(1)|central_nervous_system(1)|skin(1)	6						TAAATGACTTGATCCCGAAGA	0.398													89	146	---	---	---	---	PASS
LRRK2	120892	broad.mit.edu	37	12	40619421	40619421	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:40619421G>A	uc001rmg.3	+	2	337	c.216G>A	c.(214-216)ATG>ATA	p.M72I		NM_198578	NP_940980	Q5S007	LRRK2_HUMAN	leucine-rich repeat kinase 2	72					activation of MAPKK activity|determination of adult lifespan|exploration behavior|intracellular distribution of mitochondria|negative regulation of branching morphogenesis of a nerve|negative regulation of dendritic spine morphogenesis|negative regulation of neuroblast proliferation|negative regulation of neuron maturation|neuromuscular junction development|neuron death|peptidyl-serine phosphorylation|positive regulation of autophagy|positive regulation of dopamine receptor signaling pathway|positive regulation of programmed cell death|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein phosphorylation|positive regulation of protein ubiquitination|protein autophosphorylation|regulation of kidney size|regulation of locomotion|regulation of membrane potential|response to oxidative stress|small GTPase mediated signal transduction|tangential migration from the subventricular zone to the olfactory bulb	external side of mitochondrial outer membrane	ATP binding|GTP binding|GTP-dependent protein kinase activity|GTPase activator activity|MAP kinase kinase activity|protein homodimerization activity|tubulin binding			ovary(12)|stomach(5)|upper_aerodigestive_tract(2)|lung(2)|large_intestine(1)|urinary_tract(1)|pancreas(1)	24	all_cancers(12;0.00108)|Breast(8;0.218)	Lung NSC(34;0.0942)|all_lung(34;0.11)				ACTCCTATATGAGAGTCGCGA	0.438													5	105	---	---	---	---	PASS
LRRK2	120892	broad.mit.edu	37	12	40689242	40689242	+	Silent	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:40689242T>G	uc001rmg.3	+	23	3013	c.2892T>G	c.(2890-2892)CTT>CTG	p.L964L	LRRK2_uc001rmh.1_Silent_p.L586L|LRRK2_uc009zjw.2_5'UTR	NM_198578	NP_940980	Q5S007	LRRK2_HUMAN	leucine-rich repeat kinase 2	964					activation of MAPKK activity|determination of adult lifespan|exploration behavior|intracellular distribution of mitochondria|negative regulation of branching morphogenesis of a nerve|negative regulation of dendritic spine morphogenesis|negative regulation of neuroblast proliferation|negative regulation of neuron maturation|neuromuscular junction development|neuron death|peptidyl-serine phosphorylation|positive regulation of autophagy|positive regulation of dopamine receptor signaling pathway|positive regulation of programmed cell death|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein phosphorylation|positive regulation of protein ubiquitination|protein autophosphorylation|regulation of kidney size|regulation of locomotion|regulation of membrane potential|response to oxidative stress|small GTPase mediated signal transduction|tangential migration from the subventricular zone to the olfactory bulb	external side of mitochondrial outer membrane	ATP binding|GTP binding|GTP-dependent protein kinase activity|GTPase activator activity|MAP kinase kinase activity|protein homodimerization activity|tubulin binding			ovary(12)|stomach(5)|upper_aerodigestive_tract(2)|lung(2)|large_intestine(1)|urinary_tract(1)|pancreas(1)	24	all_cancers(12;0.00108)|Breast(8;0.218)	Lung NSC(34;0.0942)|all_lung(34;0.11)				CATCAAAACTTCAATCCCATA	0.264													8	149	---	---	---	---	PASS
CNTN1	1272	broad.mit.edu	37	12	41410677	41410677	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:41410677G>C	uc001rmm.1	+	19	2491	c.2378G>C	c.(2377-2379)GGA>GCA	p.G793A	CNTN1_uc001rmn.1_Missense_Mutation_p.G782A	NM_001843	NP_001834	Q12860	CNTN1_HUMAN	contactin 1 isoform 1 precursor	793	Fibronectin type-III 2.				axon guidance|cell adhesion|Notch signaling pathway	anchored to membrane|membrane fraction|plasma membrane				lung(4)|ovary(3)|large_intestine(1)|skin(1)	9	all_cancers(12;2.07e-06)|all_epithelial(1;4.26e-06)|Breast(8;0.0716)	Lung NSC(34;0.0211)|all_lung(34;0.0294)				AAAGGAGATGGACCTTACAGC	0.433													17	127	---	---	---	---	PASS
PRICKLE1	144165	broad.mit.edu	37	12	42862463	42862463	+	Missense_Mutation	SNP	C	G	G	rs61924369		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:42862463C>G	uc010skv.1	-	5	840	c.553G>C	c.(553-555)GAA>CAA	p.E185Q	PRICKLE1_uc001rnl.2_Missense_Mutation_p.E185Q|PRICKLE1_uc010skw.1_Missense_Mutation_p.E185Q|PRICKLE1_uc001rnm.2_Missense_Mutation_p.E185Q	NM_001144881	NP_001138353	Q96MT3	PRIC1_HUMAN	prickle homolog 1	185	LIM zinc-binding 1.				negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cardiac muscle cell myoblast differentiation|negative regulation of transcription, DNA-dependent|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein ubiquitination|protein import into nucleus	cytosol|nuclear membrane	zinc ion binding			ovary(3)|skin(1)	4	all_cancers(12;4.25e-05)|Breast(8;0.176)			GBM - Glioblastoma multiforme(48;0.2)		TTGAGCAGTTCTGCATGGTGC	0.433													6	142	---	---	---	---	PASS
PLEKHA9	51054	broad.mit.edu	37	12	45568035	45568035	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:45568035C>A	uc001rom.1	-	3	651	c.114G>T	c.(112-114)TTG>TTT	p.L38F	PLEKHA9_uc009zke.2_Missense_Mutation_p.L38F	NM_015899	NP_056983			pleckstrin homology domain containing, family A												0	Lung SC(27;0.192)|Renal(347;0.236)			GBM - Glioblastoma multiforme(48;0.173)		TTGATTTCAGCAAAGTTCCCA	0.453													228	319	---	---	---	---	PASS
ARID2	196528	broad.mit.edu	37	12	46123889	46123889	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46123889C>T	uc001ros.1	+	2	155	c.155C>T	c.(154-156)ACC>ATC	p.T52I	ARID2_uc001ror.2_Missense_Mutation_p.T52I|LOC400027_uc001roq.2_5'Flank	NM_152641	NP_689854	Q68CP9	ARID2_HUMAN	AT rich interactive domain 2 (ARID, RFX-like)	52	ARID.				chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(6)|skin(3)|upper_aerodigestive_tract(1)	10	Lung SC(27;0.192)|Renal(347;0.236)	Lung NSC(34;0.106)|all_lung(34;0.22)	OV - Ovarian serous cystadenocarcinoma(5;0.00691)	GBM - Glioblastoma multiforme(48;0.0153)		GGTCTCTACACCAGAGTCACT	0.527													55	78	---	---	---	---	PASS
ARID2	196528	broad.mit.edu	37	12	46245204	46245204	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46245204C>G	uc001ros.1	+	15	3298	c.3298C>G	c.(3298-3300)CAG>GAG	p.Q1100E	ARID2_uc001ror.2_Missense_Mutation_p.Q1100E|ARID2_uc009zkg.1_Missense_Mutation_p.Q556E|ARID2_uc009zkh.1_Missense_Mutation_p.Q727E|ARID2_uc001rou.1_Missense_Mutation_p.Q434E	NM_152641	NP_689854	Q68CP9	ARID2_HUMAN	AT rich interactive domain 2 (ARID, RFX-like)	1100	Gln-rich.				chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(6)|skin(3)|upper_aerodigestive_tract(1)	10	Lung SC(27;0.192)|Renal(347;0.236)	Lung NSC(34;0.106)|all_lung(34;0.22)	OV - Ovarian serous cystadenocarcinoma(5;0.00691)	GBM - Glioblastoma multiforme(48;0.0153)		GGTGGTCTATCAGGTGGCCAG	0.532													12	147	---	---	---	---	PASS
RPAP3	79657	broad.mit.edu	37	12	48084348	48084348	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48084348C>T	uc001rpr.2	-	6	736	c.620G>A	c.(619-621)CGA>CAA	p.R207Q	RPAP3_uc010slk.1_Missense_Mutation_p.R48Q|RPAP3_uc001rps.2_Missense_Mutation_p.R207Q	NM_024604	NP_078880	Q9H6T3	RPAP3_HUMAN	RNA polymerase II associated protein 3 isoform	207	TPR 4.						binding			ovary(1)	1	Lung SC(27;0.192)					AGCAGCACCTCGTCTGGAATA	0.333													108	442	---	---	---	---	PASS
RAPGEF3	10411	broad.mit.edu	37	12	48131351	48131351	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48131351C>T	uc009zkp.2	-	27	3085	c.2645G>A	c.(2644-2646)TGA>TAA	p.*882*	uc001rpv.2_Intron|RAPGEF3_uc001rpw.2_Silent_p.*217*|RAPGEF3_uc001rpx.2_Silent_p.*339*|RAPGEF3_uc010sln.1_Silent_p.*379*|RAPGEF3_uc001rpy.2_RNA|RAPGEF3_uc009zkq.2_Silent_p.*882*|RAPGEF3_uc001rpz.3_Silent_p.*924*	NM_001098532	NP_001092002	A8K2G5	A8K2G5_HUMAN	Rap guanine nucleotide exchange factor 3 isoform	882					regulation of protein phosphorylation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cAMP-dependent protein kinase complex	cAMP-dependent protein kinase regulator activity|guanyl-nucleotide exchange factor activity			lung(2)|skin(1)|pancreas(1)	4	Lung SC(27;0.192)			GBM - Glioblastoma multiforme(48;0.0375)		AGCCCCTCCTCATGGCTCCAG	0.647													9	15	---	---	---	---	PASS
SENP1	29843	broad.mit.edu	37	12	48457586	48457586	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48457586C>T	uc001rqx.2	-	13	1760	c.1314G>A	c.(1312-1314)GGG>GGA	p.G438G	SENP1_uc001rqw.2_Silent_p.G438G|SENP1_uc001rqy.2_Silent_p.G239G|SENP1_uc001rqz.2_Silent_p.G239G|SENP1_uc009zkx.2_Silent_p.G438G	NM_014554	NP_055369	Q9P0U3	SENP1_HUMAN	sentrin/SUMO-specific protease 1	438					activation of caspase activity|induction of apoptosis by extracellular signals|protein desumoylation|proteolysis	cytoplasm|nucleus	endopeptidase activity|SUMO-specific protease activity			pancreas(2)|lung(1)	3		Acute lymphoblastic leukemia(13;0.108)|all_hematologic(14;0.214)				CATCCTGATTCCCATTACGAA	0.378													17	76	---	---	---	---	PASS
PFKM	5213	broad.mit.edu	37	12	48537533	48537533	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48537533C>G	uc001rrc.2	+						PFKM_uc001rra.1_Intron|PFKM_uc001rrb.1_Intron|PFKM_uc001rrd.2_Intron|PFKM_uc001rre.1_Intron|PFKM_uc001rrg.1_Intron	NM_000289	NP_000280	P08237	K6PF_HUMAN	phosphofructokinase, muscle						fructose 6-phosphate metabolic process|glycolysis|muscle cell homeostasis	6-phosphofructokinase complex|apical plasma membrane	6-phosphofructokinase activity|ATP binding|identical protein binding|kinase binding|metal ion binding|protein C-terminus binding			ovary(2)|upper_aerodigestive_tract(1)|kidney(1)	4						CTTTCATTTTCAGGCAAATGT	0.413													6	182	---	---	---	---	PASS
MLL2	8085	broad.mit.edu	37	12	49442443	49442443	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49442443T>C	uc001rta.3	-	13	4130	c.4130A>G	c.(4129-4131)CAG>CGG	p.Q1377R		NM_003482	NP_003473	O14686	MLL2_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 2	1377	PHD-type 3.				chromatin silencing|histone H3-K4 methylation|oocyte growth|positive regulation of cell proliferation|positive regulation of estrogen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|response to estrogen stimulus|transcription, DNA-dependent	histone methyltransferase complex	histone-lysine N-methyltransferase activity|protein binding|transcription regulatory region DNA binding|zinc ion binding			kidney(16)|central_nervous_system(12)|lung(4)|skin(4)|ovary(3)|pancreas(2)	41						GTATGGTACCTGCATTAGGAC	0.463			N|F|Mis		medulloblastoma|renal					HNSCC(34;0.089)			182	300	---	---	---	---	PASS
DHH	50846	broad.mit.edu	37	12	49488131	49488131	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49488131C>A	uc001rtf.2	-	1	472	c.165G>T	c.(163-165)CGG>CGT	p.R55R		NM_021044	NP_066382	O43323	DHH_HUMAN	desert hedgehog preproprotein	55					cell-cell signaling|proteolysis	extracellular space|plasma membrane	calcium ion binding|peptidase activity|zinc ion binding			lung(1)|breast(1)	2						CGCCCAGGGTCCGCTCTGGCA	0.602													18	88	---	---	---	---	PASS
DHH	50846	broad.mit.edu	37	12	49488136	49488136	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49488136C>G	uc001rtf.2	-	1	467	c.160G>C	c.(160-162)GAG>CAG	p.E54Q		NM_021044	NP_066382	O43323	DHH_HUMAN	desert hedgehog preproprotein	54					cell-cell signaling|proteolysis	extracellular space|plasma membrane	calcium ion binding|peptidase activity|zinc ion binding			lung(1)|breast(1)	2						AGGGTCCGCTCTGGCACGCCG	0.602													17	90	---	---	---	---	PASS
AQP5	362	broad.mit.edu	37	12	50356011	50356011	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50356011G>T	uc001rvo.2	+	1	733	c.211G>T	c.(211-213)GCC>TCC	p.A71S		NM_001651	NP_001642	P55064	AQP5_HUMAN	aquaporin 5	71	Cytoplasmic (Potential).|NPA 1.				carbon dioxide transport|excretion|odontogenesis|pancreatic juice secretion	apical plasma membrane|integral to plasma membrane	protein binding|water channel activity				0						CATCAACCCCGCCATCACCCT	0.692													16	31	---	---	---	---	PASS
SMARCD1	6602	broad.mit.edu	37	12	50482376	50482376	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50482376G>A	uc001rvx.3	+	6	897	c.727G>A	c.(727-729)GAA>AAA	p.E243K	SMARCD1_uc010smo.1_Missense_Mutation_p.E243K|SMARCD1_uc001rvy.3_Missense_Mutation_p.E243K|SMARCD1_uc009zlp.2_Missense_Mutation_p.E202K	NM_003076	NP_003067	Q96GM5	SMRD1_HUMAN	SWI/SNF-related matrix-associated	243	Necessary for GR/NR3C1-mediated remodeling and transcription from chromatin; required for GR/NR3C1 interaction with the BRG1/SMARCA4 complex in vivo.|Interaction with SMARCC1 and SMARCC2.				chromatin-mediated maintenance of transcription|nervous system development|regulation of transcription from RNA polymerase II promoter	nBAF complex|npBAF complex|nucleoplasm|SWI/SNF complex	protein complex scaffold|transcription coactivator activity			ovary(1)	1						CTTGGTGATTGAACTGGACAA	0.423													17	151	---	---	---	---	PASS
SCN8A	6334	broad.mit.edu	37	12	52099357	52099357	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52099357G>A	uc001ryw.2	+	10	1469	c.1291G>A	c.(1291-1293)GAA>AAA	p.E431K	SCN8A_uc010snl.1_Missense_Mutation_p.E296K|SCN8A_uc001ryx.1_Missense_Mutation_p.E296K|SCN8A_uc001ryz.1_Missense_Mutation_p.E296K|SCN8A_uc001ryy.2_Missense_Mutation_p.E296K	NM_014191	NP_055006	Q9UQD0	SCN8A_HUMAN	sodium channel, voltage gated, type VIII, alpha	431	I.				axon guidance|myelination|peripheral nervous system development	cytoplasmic membrane-bounded vesicle|node of Ranvier	ATP binding|voltage-gated sodium channel activity			ovary(7)	7				BRCA - Breast invasive adenocarcinoma(357;0.181)	Lamotrigine(DB00555)	AAAAGAGGCTGAATTTAAAGC	0.453													5	58	---	---	---	---	PASS
KRT85	3891	broad.mit.edu	37	12	52760965	52760965	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52760965G>T	uc001sag.2	-	1	345	c.225C>A	c.(223-225)TCC>TCA	p.S75S		NM_002283	NP_002274	P78386	KRT85_HUMAN	keratin 85	75	Head.				epidermis development	keratin filament	protein binding|structural molecule activity			ovary(1)	1	Myeloproliferative disorder(4;0.0484)|all_hematologic(5;0.088)			BRCA - Breast invasive adenocarcinoma(357;0.189)		TGCGTCCGCAGGAGCCGGCTC	0.697													15	26	---	---	---	---	PASS
ITGB7	3695	broad.mit.edu	37	12	53590369	53590369	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53590369G>T	uc009zmv.2	-	5	881	c.810C>A	c.(808-810)CTC>CTA	p.L270L	ITGB7_uc001scc.2_Silent_p.L270L|ITGB7_uc010snz.1_RNA|ITGB7_uc010soa.1_3'UTR	NM_000889	NP_000880	P26010	ITB7_HUMAN	integrin, beta 7 precursor	270	VWFA.|Extracellular (Potential).				cell-matrix adhesion|integrin-mediated signaling pathway|multicellular organismal development|regulation of immune response	integrin complex	identical protein binding|metal ion binding|receptor activity			ovary(3)|skin(2)|upper_aerodigestive_tract(1)|urinary_tract(1)|breast(1)	8						TCACCTGGCAGAGTGCAGCCT	0.532													18	39	---	---	---	---	PASS
PFDN5	5204	broad.mit.edu	37	12	53689355	53689355	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53689355G>T	uc001scl.2	+	1	121	c.4G>T	c.(4-6)GCG>TCG	p.A2S	PFDN5_uc001scm.2_Missense_Mutation_p.A2S|PFDN5_uc001scn.2_RNA|PFDN5_uc001sco.2_RNA	NM_002624	NP_002615	Q99471	PFD5_HUMAN	prefoldin subunit 5 isoform alpha	2					'de novo' posttranslational protein folding|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of transcription, DNA-dependent	nucleus|prefoldin complex	transcription corepressor activity|unfolded protein binding			ovary(1)	1						TCCCAACATGGCGCAGTCTAT	0.617													56	149	---	---	---	---	PASS
AMHR2	269	broad.mit.edu	37	12	53818148	53818148	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53818148G>A	uc001scx.1	+	2	204	c.126G>A	c.(124-126)CTG>CTA	p.L42L	AMHR2_uc009zmy.1_Silent_p.L42L	NM_020547	NP_065434	Q16671	AMHR2_HUMAN	anti-Mullerian hormone receptor, type II isoform	42	Extracellular (Potential).				Mullerian duct regression		ATP binding|hormone binding|metal ion binding			ovary(1)|skin(1)	2					Adenosine triphosphate(DB00171)	TGGGAGAGCTGCTAGATACAG	0.602									Persistant_Mullerian_Duct_Syndrome_(type_I_and_II)				34	52	---	---	---	---	PASS
HOXC9	3225	broad.mit.edu	37	12	54396299	54396299	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54396299G>A	uc001sep.2	+	3	722	c.624G>A	c.(622-624)GAG>GAA	p.E208E	HOXC9_uc001seq.2_Silent_p.E208E	NM_006897	NP_008828	P31274	HXC9_HUMAN	homeobox C9	208	Homeobox.				multicellular organismal development	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			large_intestine(1)|pancreas(1)|skin(1)	3						TGGAACTGGAGAAGGAGTTTC	0.557													6	202	---	---	---	---	PASS
HOXC6	3223	broad.mit.edu	37	12	54423608	54423608	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54423608G>T	uc001sev.2	+	2	682	c.570G>T	c.(568-570)CAG>CAT	p.Q190H	HOXC6_uc001ses.2_Missense_Mutation_p.Q108H|HOXC5_uc001set.2_Intron|HOXC4_uc001seu.2_Intron	NM_004503	NP_004494	P09630	HXC6_HUMAN	homeobox C6 isoform 1	190	Homeobox.				regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(2)|upper_aerodigestive_tract(1)	3						TCTGGTTCCAGAACCGCCGGA	0.572													38	134	---	---	---	---	PASS
NCKAP1L	3071	broad.mit.edu	37	12	54902176	54902176	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54902176C>G	uc001sgc.3	+	5	446	c.367C>G	c.(367-369)CTC>GTC	p.L123V	NCKAP1L_uc010sox.1_Translation_Start_Site|NCKAP1L_uc010soy.1_Missense_Mutation_p.L73V	NM_005337	NP_005328	P55160	NCKPL_HUMAN	NCK-associated protein 1-like	123					actin polymerization-dependent cell motility|B cell homeostasis|B cell receptor signaling pathway|cortical actin cytoskeleton organization|erythrocyte development|maintenance of cell polarity|myeloid cell homeostasis|negative regulation of apoptosis|negative regulation of interleukin-17 production|negative regulation of interleukin-6 production|negative regulation of myosin-light-chain-phosphatase activity|neutrophil chemotaxis|positive regulation of actin filament polymerization|positive regulation of B cell differentiation|positive regulation of B cell proliferation|positive regulation of CD4-positive, alpha-beta T cell differentiation|positive regulation of CD8-positive, alpha-beta T cell differentiation|positive regulation of cell adhesion mediated by integrin|positive regulation of erythrocyte differentiation|positive regulation of gamma-delta T cell differentiation|positive regulation of neutrophil chemotaxis|positive regulation of phagocytosis, engulfment|positive regulation of T cell proliferation|protein complex assembly|response to drug|T cell homeostasis	cytosol|integral to plasma membrane|membrane fraction|SCAR complex	protein complex binding|protein kinase activator activity|Rac GTPase activator activity			ovary(3)|central_nervous_system(1)	4						CTTGTAGAATCTCAACTTTGA	0.433													54	578	---	---	---	---	PASS
MMP19	4327	broad.mit.edu	37	12	56233310	56233310	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56233310C>G	uc001sib.2	-	5	857	c.736G>C	c.(736-738)GAT>CAT	p.D246H	MMP19_uc001sia.2_5'UTR|MMP19_uc001sid.2_RNA|MMP19_uc010spw.1_Intron	NM_002429	NP_002420	Q99542	MMP19_HUMAN	matrix metalloproteinase 19 isoform rasi-1	246					angiogenesis|cell differentiation|collagen catabolic process|proteolysis	proteinaceous extracellular matrix	calcium ion binding|metalloendopeptidase activity|zinc ion binding			ovary(1)	1						GCCACATCATCTGGGTGCAGC	0.607													12	87	---	---	---	---	PASS
RAB5B	5869	broad.mit.edu	37	12	56384536	56384536	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56384536C>T	uc001siv.2	+	4	503	c.386C>T	c.(385-387)GCC>GTC	p.A129V	RAB5B_uc001siw.2_Missense_Mutation_p.A129V|RAB5B_uc009zog.2_Missense_Mutation_p.A69V|RAB5B_uc010spz.1_Intron	NM_002868	NP_002859	P61020	RAB5B_HUMAN	RAB5B, member RAS oncogene family	129					protein transport|small GTPase mediated signal transduction	early endosome membrane|melanosome|membrane fraction|plasma membrane	GTP binding|GTP-dependent protein binding|GTPase activity				0			UCEC - Uterine corpus endometrioid carcinoma (6;0.0471)|OV - Ovarian serous cystadenocarcinoma(18;0.235)			ATCGTTATTGCCCTGGCAGGG	0.512													5	295	---	---	---	---	PASS
ESYT1	23344	broad.mit.edu	37	12	56527954	56527954	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56527954C>G	uc001sjq.2	+	14	1584	c.1534C>G	c.(1534-1536)CAG>GAG	p.Q512E	ESYT1_uc001sjr.2_Missense_Mutation_p.Q522E	NM_015292	NP_056107	Q9BSJ8	ESYT1_HUMAN	extended synaptotagmin-like protein 1	512	C2 2.					integral to membrane				ovary(4)|skin(1)	5						GGATGTGACTCAGGAGAGCAA	0.517													19	91	---	---	---	---	PASS
RNF41	10193	broad.mit.edu	37	12	56600432	56600432	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56600432G>T	uc001skf.1	-	7	1122	c.753C>A	c.(751-753)CAC>CAA	p.H251Q	RNF41_uc001ske.1_Missense_Mutation_p.H180Q|RNF41_uc001skg.1_Missense_Mutation_p.H251Q|RNF41_uc010sqg.1_Missense_Mutation_p.H186Q|RNF41_uc010sqh.1_Missense_Mutation_p.H180Q	NM_005785	NP_005776	Q9H4P4	RNF41_HUMAN	ring finger protein 41 isoform 1	251					apoptosis|induction of apoptosis|protein polyubiquitination|regulation of reactive oxygen species metabolic process		protein binding|protein tag|ubiquitin-protein ligase activity|zinc ion binding			skin(1)	1						AGCTACGCTCGTGGGCATTTT	0.562											OREG0021921	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	25	105	---	---	---	---	PASS
GLS2	27165	broad.mit.edu	37	12	56869734	56869734	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56869734C>G	uc001slj.2	-	8	1144	c.865G>C	c.(865-867)GAT>CAT	p.D289H	GLS2_uc009zos.2_RNA|GLS2_uc001slk.2_Missense_Mutation_p.D24H|GLS2_uc009zot.2_Intron	NM_013267	NP_037399	Q9UI32	GLSL_HUMAN	glutaminase 2 precursor	289					cellular amino acid biosynthetic process|glutamate secretion|glutamine metabolic process|neurotransmitter secretion	mitochondrial matrix	glutaminase activity|protein binding			ovary(1)|central_nervous_system(1)	2					L-Glutamic Acid(DB00142)|L-Glutamine(DB00130)	CTTACAAAATCAAACTTCTCT	0.502													4	91	---	---	---	---	PASS
TMEM194A	23306	broad.mit.edu	37	12	57458420	57458420	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57458420G>C	uc001smy.2	-						TMEM194A_uc001smx.2_Intron|TMEM194A_uc010sra.1_Intron	NM_001130963	NP_001124435	O14524	T194A_HUMAN	transmembrane protein 194A isoform a							integral to membrane					0						TGAAGATTCTGATACTTACCT	0.373													10	201	---	---	---	---	PASS
MARS	4141	broad.mit.edu	37	12	57884123	57884123	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57884123C>G	uc001sog.2	+	6	647	c.624C>G	c.(622-624)CCC>CCG	p.P208P	ARHGAP9_uc001sod.2_5'Flank|ARHGAP9_uc001soe.1_5'Flank|MARS_uc001sof.1_RNA|MARS_uc010srp.1_Silent_p.P81P|MARS_uc010srq.1_5'UTR	NM_004990	NP_004981	P56192	SYMC_HUMAN	methionyl-tRNA synthetase	208					methionyl-tRNA aminoacylation	cytosol	ATP binding|methionine-tRNA ligase activity|protein binding|tRNA binding			ovary(3)|central_nervous_system(1)|pancreas(1)	5			GBM - Glioblastoma multiforme(3;4.27e-41)		L-Methionine(DB00134)	AGCCCCAGCCCAGCCCCGCTG	0.592													21	376	---	---	---	---	PASS
MON2	23041	broad.mit.edu	37	12	62954271	62954271	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:62954271G>A	uc001sre.2	+	26	3801	c.3410G>A	c.(3409-3411)GGA>GAA	p.G1137E	MON2_uc009zqj.2_Missense_Mutation_p.G1137E|MON2_uc010ssl.1_Missense_Mutation_p.G1065E|MON2_uc010ssm.1_Missense_Mutation_p.G1114E|MON2_uc010ssn.1_Missense_Mutation_p.G1137E|MON2_uc001srf.2_Missense_Mutation_p.G900E|MON2_uc001srg.2_Missense_Mutation_p.G12E	NM_015026	NP_055841	Q7Z3U7	MON2_HUMAN	MON2 homolog	1138					Golgi to endosome transport|protein transport	cytoplasm	ARF guanyl-nucleotide exchange factor activity|binding			central_nervous_system(2)	2			BRCA - Breast invasive adenocarcinoma(9;0.218)	GBM - Glioblastoma multiforme(28;0.128)		CCTAATATAGGAGATTTTTCA	0.338													28	193	---	---	---	---	PASS
MON2	23041	broad.mit.edu	37	12	62972245	62972245	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:62972245C>T	uc001sre.2	+	31	4926	c.4535C>T	c.(4534-4536)TCT>TTT	p.S1512F	MON2_uc009zqj.2_Missense_Mutation_p.S1512F|MON2_uc010ssl.1_Missense_Mutation_p.S1440F|MON2_uc010ssm.1_Missense_Mutation_p.S1483F|MON2_uc010ssn.1_Missense_Mutation_p.S1506F|MON2_uc001srf.2_Missense_Mutation_p.S1275F|MON2_uc001srg.2_Missense_Mutation_p.S381F	NM_015026	NP_055841	Q7Z3U7	MON2_HUMAN	MON2 homolog	1513					Golgi to endosome transport|protein transport	cytoplasm	ARF guanyl-nucleotide exchange factor activity|binding			central_nervous_system(2)	2			BRCA - Breast invasive adenocarcinoma(9;0.218)	GBM - Glioblastoma multiforme(28;0.128)		GATAATCTCTCTATTCAAGAG	0.269													5	53	---	---	---	---	PASS
SRGAP1	57522	broad.mit.edu	37	12	64502828	64502828	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:64502828G>T	uc010ssp.1	+						SRGAP1_uc001srv.2_Intron	NM_020762	NP_065813	Q7Z6B7	SRGP1_HUMAN	SLIT-ROBO Rho GTPase activating protein 1						axon guidance	cytosol				ovary(2)|central_nervous_system(2)	4			GBM - Glioblastoma multiforme(3;0.000139)|BRCA - Breast invasive adenocarcinoma(9;0.225)	GBM - Glioblastoma multiforme(28;0.0608)		GTAAGTACCTGAATGCTCTGA	0.453													78	101	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	12	80663890	80663890	+	IGR	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:80663890C>G								PPP1R12A (334655 upstream) : PTPRQ (174236 downstream)																							AGCCAGTGTTCAAATGGGACT	0.358													5	39	---	---	---	---	PASS
MYF5	4617	broad.mit.edu	37	12	81111108	81111108	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:81111108C>G	uc001szg.2	+	1	401	c.266C>G	c.(265-267)ACT>AGT	p.T89S		NM_005593	NP_005584	P13349	MYF5_HUMAN	myogenic factor 5	89	Basic motif.				muscle cell fate commitment|positive regulation of muscle cell differentiation|skeletal muscle tissue development	nucleoplasm	DNA binding|protein heterodimerization activity|sequence-specific enhancer binding RNA polymerase II transcription factor activity			ovary(1)	1						AAGGCAGCCACTATGCGCGAG	0.627													3	36	---	---	---	---	PASS
SLC6A15	55117	broad.mit.edu	37	12	85255544	85255544	+	Missense_Mutation	SNP	G	C	C	rs141349631		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:85255544G>C	uc001szv.2	-	12	2553	c.2060C>G	c.(2059-2061)TCT>TGT	p.S687C	SLC6A15_uc010sul.1_Missense_Mutation_p.S580C|SLC6A15_uc001szw.1_3'UTR	NM_182767	NP_877499	Q9H2J7	S6A15_HUMAN	solute carrier family 6, member 15 isoform 1	687	Cytoplasmic (Potential).				cellular nitrogen compound metabolic process|leucine transport|proline transport	integral to plasma membrane	amino acid transmembrane transporter activity|neurotransmitter:sodium symporter activity			pancreas(2)|ovary(1)	3						AAAATTTGGAGATGGCATCTC	0.448													47	244	---	---	---	---	PASS
C12orf50	160419	broad.mit.edu	37	12	88390363	88390363	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:88390363T>C	uc001tam.1	-	5	518	c.350A>G	c.(349-351)GAG>GGG	p.E117G	C12orf50_uc001tan.2_Missense_Mutation_p.E171G	NM_152589	NP_689802	Q8NA57	CL050_HUMAN	hypothetical protein LOC160419	117										skin(2)|ovary(1)	3						ATAACACATCTCCTTTATTGC	0.284													29	98	---	---	---	---	PASS
C12orf50	160419	broad.mit.edu	37	12	88420369	88420369	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:88420369G>A	uc001tam.1	-	3	197	c.29C>T	c.(28-30)TCA>TTA	p.S10L	C12orf50_uc001tan.2_Missense_Mutation_p.S64L	NM_152589	NP_689802	Q8NA57	CL050_HUMAN	hypothetical protein LOC160419	10										skin(2)|ovary(1)	3						CCAGAAGCATGAAATGCTGCA	0.378													29	72	---	---	---	---	PASS
PLXNC1	10154	broad.mit.edu	37	12	94543548	94543548	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:94543548C>G	uc001tdc.2	+	1	1050	c.801C>G	c.(799-801)ATC>ATG	p.I267M		NM_005761	NP_005752	O60486	PLXC1_HUMAN	plexin C1 precursor	267	Extracellular (Potential).|Sema.				axon guidance|cell adhesion	integral to membrane|intracellular|plasma membrane	receptor activity|receptor binding			ovary(2)|central_nervous_system(1)	3						TGGCGCGCATCGCGCAGAGCA	0.682													5	36	---	---	---	---	PASS
PLXNC1	10154	broad.mit.edu	37	12	94575247	94575247	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:94575247C>G	uc001tdc.2	+	3	1478	c.1229C>G	c.(1228-1230)TCA>TGA	p.S410*		NM_005761	NP_005752	O60486	PLXC1_HUMAN	plexin C1 precursor	410	Extracellular (Potential).|Sema.				axon guidance|cell adhesion	integral to membrane|intracellular|plasma membrane	receptor activity|receptor binding			ovary(2)|central_nervous_system(1)	3						AATTTGACTTCAAATTGTCCA	0.254													23	188	---	---	---	---	PASS
NR1H4	9971	broad.mit.edu	37	12	100904848	100904848	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100904848T>A	uc001tht.1	+	2	430	c.402T>A	c.(400-402)GAT>GAA	p.D134E	NR1H4_uc001thp.1_Missense_Mutation_p.D124E|NR1H4_uc001thq.1_Missense_Mutation_p.D124E|NR1H4_uc010svj.1_RNA|NR1H4_uc001thr.1_Missense_Mutation_p.D124E|NR1H4_uc010svk.1_Missense_Mutation_p.D124E|NR1H4_uc001ths.1_Missense_Mutation_p.D134E	NM_005123	NP_005114	Q96RI1	NR1H4_HUMAN	nuclear receptor subfamily 1, group H, member 4	134	Nuclear receptor.				bile acid metabolic process|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|thyroid hormone receptor activity|transcription coactivator activity|transcription corepressor activity|zinc ion binding			ovary(1)|lung(1)|skin(1)	3						TCAAAGGGGATGAGCTGTGTG	0.512													76	179	---	---	---	---	PASS
UTP20	27340	broad.mit.edu	37	12	101763603	101763603	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101763603G>A	uc001tia.1	+	49	6645	c.6489G>A	c.(6487-6489)CTG>CTA	p.L2163L		NM_014503	NP_055318	O75691	UTP20_HUMAN	down-regulated in metastasis	2163					endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|negative regulation of cell proliferation	90S preribosome|cytoplasm|nucleolus|nucleoplasm|preribosome, small subunit precursor|small-subunit processome	protein binding			ovary(2)|breast(2)	4						TCCTTCTGCTGAAGGACTATG	0.507													50	275	---	---	---	---	PASS
CHPT1	56994	broad.mit.edu	37	12	102116979	102116979	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:102116979G>A	uc001tin.2	+	6	1037	c.814G>A	c.(814-816)GGA>AGA	p.G272R	CHPT1_uc001tio.2_RNA|CHPT1_uc001tip.1_Missense_Mutation_p.G272R	NM_020244	NP_064629	Q8WUD6	CHPT1_HUMAN	choline phosphotransferase 1	272	Helical; (Potential).				platelet activating factor biosynthetic process|regulation of cell growth	Golgi membrane|integral to membrane|microsome	diacylglycerol binding|diacylglycerol cholinephosphotransferase activity|metal ion binding				0						ACTCCACATAGGACTAATTAT	0.318													11	178	---	---	---	---	PASS
GNPTAB	79158	broad.mit.edu	37	12	102158651	102158651	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:102158651C>A	uc001tit.2	-	13	2223	c.2044G>T	c.(2044-2046)GAT>TAT	p.D682Y		NM_024312	NP_077288	Q3T906	GNPTA_HUMAN	N-acetylglucosamine-1-phosphate transferase	682					cell differentiation	Golgi membrane|integral to membrane|nucleus	metal ion binding|transcription factor binding|UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase activity			ovary(1)|skin(1)	2						GAGTTAACATCATGTCTCTTA	0.413													24	122	---	---	---	---	PASS
MAPKAPK5	8550	broad.mit.edu	37	12	112318306	112318306	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112318306C>A	uc001tta.2	+	8	894	c.635C>A	c.(634-636)TCA>TAA	p.S212*	MAPKAPK5_uc001tsz.2_Nonsense_Mutation_p.S212*|MAPKAPK5_uc001ttb.2_Nonsense_Mutation_p.S145*	NM_139078	NP_620777	Q8IW41	MAPK5_HUMAN	MAP kinase-activated protein kinase 5 isoform 2	212	Protein kinase.				signal transduction	cytoplasm|nucleus	ATP binding|MAP kinase kinase activity|protein binding|protein serine/threonine kinase activity			lung(2)|ovary(1)	3						ATACCTACCTCACCGACGCCC	0.478													34	71	---	---	---	---	PASS
RPH3A	22895	broad.mit.edu	37	12	113307575	113307575	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:113307575G>C	uc010syl.1	+	9	984	c.622G>C	c.(622-624)GAT>CAT	p.D208H	RPH3A_uc001ttz.2_Missense_Mutation_p.D208H|RPH3A_uc001tty.2_Missense_Mutation_p.D204H|RPH3A_uc009zwe.1_Missense_Mutation_p.D204H|RPH3A_uc010sym.1_Missense_Mutation_p.D159H|RPH3A_uc001tua.2_5'UTR	NM_001143854	NP_001137326	Q9Y2J0	RP3A_HUMAN	rabphilin 3A homolog isoform 1	208	Pro-rich.				intracellular protein transport	cell junction|synaptic vesicle	Rab GTPase binding|transporter activity|zinc ion binding			ovary(3)|central_nervous_system(2)|skin(2)	7				BRCA - Breast invasive adenocarcinoma(302;0.00453)		TGACAGTGAAGATAGGAGGGG	0.463													50	135	---	---	---	---	PASS
RASAL1	8437	broad.mit.edu	37	12	113553030	113553030	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:113553030G>C	uc001tum.1	-	12	1336	c.1043C>G	c.(1042-1044)TCC>TGC	p.S348C	RASAL1_uc010syp.1_Missense_Mutation_p.S348C|RASAL1_uc001tul.2_Missense_Mutation_p.S348C|RASAL1_uc001tun.1_Missense_Mutation_p.S348C|RASAL1_uc010syq.1_Missense_Mutation_p.S348C|RASAL1_uc001tuo.3_Missense_Mutation_p.S348C|RASAL1_uc010syr.1_Missense_Mutation_p.S348C	NM_004658	NP_004649	O95294	RASL1_HUMAN	RAS protein activator like 1	348	Ras-GAP.				intracellular signal transduction|negative regulation of Ras protein signal transduction	cytoplasm|intrinsic to internal side of plasma membrane	metal ion binding|phospholipid binding|Ras GTPase activator activity			ovary(2)|skin(2)	4						CATCGACTTGGATGCCAGGGA	0.582													25	251	---	---	---	---	PASS
MED13L	23389	broad.mit.edu	37	12	116408434	116408434	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:116408434T>A	uc001tvw.2	-	27	6087	c.6032A>T	c.(6031-6033)AAC>ATC	p.N2011I		NM_015335	NP_056150	Q71F56	MD13L_HUMAN	mediator complex subunit 13-like	2011					regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent					skin(4)|ovary(2)|upper_aerodigestive_tract(1)|lung(1)	8	all_neural(191;0.117)|Medulloblastoma(191;0.163)			BRCA - Breast invasive adenocarcinoma(302;0.0407)		ATTGGGGTAGTTGGCTGGAGC	0.498													23	202	---	---	---	---	PASS
FBXO21	23014	broad.mit.edu	37	12	117610273	117610273	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:117610273C>T	uc001twk.2	-						FBXO21_uc001twj.2_Intron|FBXO21_uc009zwq.2_Intron	NM_033624	NP_296373	O94952	FBX21_HUMAN	F-box only protein 21 isoform 1						ubiquitin-dependent protein catabolic process	ubiquitin ligase complex	ubiquitin-protein ligase activity			kidney(1)	1	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)			BRCA - Breast invasive adenocarcinoma(302;0.0291)		CACGGATGCTCACCCTTCTGC	0.498													26	144	---	---	---	---	PASS
NOS1	4842	broad.mit.edu	37	12	117680494	117680494	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:117680494G>T	uc001twm.1	-	20	3665	c.2979C>A	c.(2977-2979)CAC>CAA	p.H993Q		NM_000620	NP_000611	P29475	NOS1_HUMAN	nitric oxide synthase 1, neuronal	993					multicellular organismal response to stress|myoblast fusion|negative regulation of calcium ion transport into cytosol|neurotransmitter biosynthetic process|nitric oxide biosynthetic process|platelet activation|positive regulation of vasodilation|regulation of cardiac muscle contraction|response to heat|response to hypoxia	cytoskeleton|cytosol|dendritic spine|perinuclear region of cytoplasm|photoreceptor inner segment|sarcolemma|sarcoplasmic reticulum	arginine binding|cadmium ion binding|calmodulin binding|flavin adenine dinucleotide binding|FMN binding|heme binding|NADP binding|nitric-oxide synthase activity|tetrahydrobiopterin binding			ovary(3)|skin(3)|pancreas(1)	7	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)			BRCA - Breast invasive adenocarcinoma(302;0.0561)	L-Citrulline(DB00155)	CTCGCTTTTTGTGGACATTGG	0.453													15	74	---	---	---	---	PASS
GCN1L1	10985	broad.mit.edu	37	12	120576213	120576213	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:120576213C>T	uc001txo.2	-	47	6176	c.6163G>A	c.(6163-6165)GAG>AAG	p.E2055K		NM_006836	NP_006827	Q92616	GCN1L_HUMAN	GCN1 general control of amino-acid synthesis	2055	HEAT 18.				regulation of translation	ribosome	protein binding|translation factor activity, nucleic acid binding			ovary(4)	4	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)					GACACCTCCTCGTCATCCTGC	0.532													29	76	---	---	---	---	PASS
GATC	283459	broad.mit.edu	37	12	120884281	120884281	+	5'Flank	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:120884281G>T	uc010szi.1	+						TRIAP1_uc001tyg.2_5'Flank	NM_176818	NP_789788	O43716	GATCL_HUMAN	glutamyl-tRNA(Gln) amidotransferase, subunit C						regulation of translational fidelity						0	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)					AAGGAAGGAAGAAATGTGGTC	0.687													30	78	---	---	---	---	PASS
MORN3	283385	broad.mit.edu	37	12	122107252	122107252	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:122107252C>T	uc001uax.2	-	1	309	c.138G>A	c.(136-138)GTG>GTA	p.V46V	MORN3_uc001uay.2_RNA	NM_173855	NP_776254	Q6PF18	MORN3_HUMAN	MORN repeat containing 3	46	MORN 1.										0	all_neural(191;0.0684)|Medulloblastoma(191;0.0922)			OV - Ovarian serous cystadenocarcinoma(86;0.000409)|Epithelial(86;0.00145)		CACCGTGTTTCACGTTGTCCT	0.642											OREG0022205	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	19	121	---	---	---	---	PASS
KNTC1	9735	broad.mit.edu	37	12	123042002	123042002	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123042002G>C	uc001ucv.2	+	17	1507	c.1344G>C	c.(1342-1344)CAG>CAC	p.Q448H	KNTC1_uc010taf.1_Missense_Mutation_p.Q411H	NM_014708	NP_055523	P50748	KNTC1_HUMAN	Rough Deal homolog, centromere/kinetochore	448					cell division|mitotic cell cycle checkpoint|mitotic prometaphase|protein complex assembly|regulation of exit from mitosis	condensed chromosome kinetochore|cytosol|kinetochore microtubule|nucleus|spindle pole	protein binding	p.Q448H(1)		ovary(5)|kidney(3)|lung(1)|central_nervous_system(1)	10	all_neural(191;0.0837)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;7.21e-05)|Epithelial(86;0.000178)|BRCA - Breast invasive adenocarcinoma(302;0.217)		CCAGTGAACAGACCGAATGGC	0.388													20	57	---	---	---	---	PASS
GPR109B	8843	broad.mit.edu	37	12	123201053	123201053	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123201053T>A	uc001ucy.3	-	1	387	c.232A>T	c.(232-234)ATC>TTC	p.I78F	GPR81_uc001ucw.1_Intron	NM_006018	NP_006009	P49019	HCAR3_HUMAN	G protein-coupled receptor 109B	78	Helical; Name=2; (Potential).					integral to plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			ovary(1)|skin(1)	2	all_neural(191;0.0837)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;2.12e-05)|Epithelial(86;3.19e-05)|BRCA - Breast invasive adenocarcinoma(302;0.196)	Mepenzolate(DB04843)|Niacin(DB00627)	GGCAGGCAGATGATCAGTAGA	0.522													3	41	---	---	---	---	PASS
MPHOSPH9	10198	broad.mit.edu	37	12	123645802	123645802	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123645802C>T	uc001uel.2	-	18	2913	c.2806G>A	c.(2806-2808)GAA>AAA	p.E936K	MPHOSPH9_uc010tal.1_Missense_Mutation_p.E390K|MPHOSPH9_uc010tam.1_RNA|MPHOSPH9_uc001uem.2_Missense_Mutation_p.E390K	NM_022782	NP_073619	Q99550	MPP9_HUMAN	M-phase phosphoprotein 9	936					M phase of mitotic cell cycle	centriole|Golgi membrane					0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000182)|Epithelial(86;0.00046)|BRCA - Breast invasive adenocarcinoma(302;0.169)		TTACACTGTTCGTAGCTAACT	0.418													7	245	---	---	---	---	PASS
MPHOSPH9	10198	broad.mit.edu	37	12	123645826	123645826	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123645826C>G	uc001uel.2	-	18	2889	c.2782G>C	c.(2782-2784)GAG>CAG	p.E928Q	MPHOSPH9_uc010tal.1_Missense_Mutation_p.E382Q|MPHOSPH9_uc010tam.1_RNA|MPHOSPH9_uc001uem.2_Missense_Mutation_p.E382Q	NM_022782	NP_073619	Q99550	MPP9_HUMAN	M-phase phosphoprotein 9	928					M phase of mitotic cell cycle	centriole|Golgi membrane					0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000182)|Epithelial(86;0.00046)|BRCA - Breast invasive adenocarcinoma(302;0.169)		TTATTCTTCTCCCAGGCTGTT	0.433													5	261	---	---	---	---	PASS
DHX37	57647	broad.mit.edu	37	12	125465293	125465293	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:125465293C>G	uc001ugy.2	-	4	580	c.481G>C	c.(481-483)GAG>CAG	p.E161Q		NM_032656	NP_116045	Q8IY37	DHX37_HUMAN	DEAH (Asp-Glu-Ala-His) box polypeptide 37	161							ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding			skin(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;8.05e-05)|Epithelial(86;0.000486)|all cancers(50;0.00653)		tcctcctcctcctcAGCTGAG	0.577													4	7	---	---	---	---	PASS
SLC15A4	121260	broad.mit.edu	37	12	129278733	129278733	+	3'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:129278733C>T	uc001uhu.2	-	8					SLC15A4_uc001uhv.2_RNA	NM_145648	NP_663623	Q8N697	S15A4_HUMAN	solute carrier family 15, member 4						oligopeptide transport|protein transport	integral to membrane|lysosomal membrane	peptide:hydrogen symporter activity				0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;1.69e-06)|Epithelial(86;1.17e-05)|all cancers(50;5.07e-05)		CACATGGCCTCAGGAAGGTCA	0.493													16	146	---	---	---	---	PASS
GLT1D1	144423	broad.mit.edu	37	12	129467578	129467578	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:129467578G>T	uc010tbh.1	+	13	1008	c.999G>T	c.(997-999)GTG>GTT	p.V333V	GLT1D1_uc001uhx.1_Silent_p.V248V|GLT1D1_uc001uhy.1_RNA	NM_144669	NP_653270	Q96MS3	GL1D1_HUMAN	glycosyltransferase 1 domain containing 1	328					biosynthetic process	extracellular region	transferase activity, transferring glycosyl groups				0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;3.97e-06)|Epithelial(86;3.97e-05)|all cancers(50;0.00019)		CATGGCAGGTGGAAAGAGACA	0.483													37	127	---	---	---	---	PASS
GLT1D1	144423	broad.mit.edu	37	12	129467579	129467579	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:129467579G>T	uc010tbh.1	+	13	1009	c.1000G>T	c.(1000-1002)GAA>TAA	p.E334*	GLT1D1_uc001uhx.1_Nonsense_Mutation_p.E249*|GLT1D1_uc001uhy.1_RNA	NM_144669	NP_653270	Q96MS3	GL1D1_HUMAN	glycosyltransferase 1 domain containing 1	329					biosynthetic process	extracellular region	transferase activity, transferring glycosyl groups				0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;3.97e-06)|Epithelial(86;3.97e-05)|all cancers(50;0.00019)		ATGGCAGGTGGAAAGAGACAC	0.488													37	121	---	---	---	---	PASS
TMEM132D	121256	broad.mit.edu	37	12	129558466	129558466	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:129558466C>T	uc009zyl.1	-	9	3582	c.3254G>A	c.(3253-3255)TGC>TAC	p.C1085Y	TMEM132D_uc001uia.2_Missense_Mutation_p.C623Y	NM_133448	NP_597705	Q14C87	T132D_HUMAN	transmembrane protein 132D precursor	1085	Cytoplasmic (Potential).					integral to membrane				ovary(10)|pancreas(2)|upper_aerodigestive_tract(1)|skin(1)	14	all_neural(191;0.101)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0934)|Breast(359;0.133)		OV - Ovarian serous cystadenocarcinoma(86;0.000288)|Epithelial(86;0.0116)|all cancers(50;0.0246)		CAGCTCTTTGCAGTCCCCAGG	0.512													37	217	---	---	---	---	PASS
GPR133	283383	broad.mit.edu	37	12	131602941	131602941	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:131602941C>G	uc001uit.3	+	19	2612	c.2053C>G	c.(2053-2055)CTG>GTG	p.L685V	GPR133_uc010tbm.1_Missense_Mutation_p.L717V|GPR133_uc009zyo.2_Intron|GPR133_uc001uiv.1_Missense_Mutation_p.L204V|GPR133_uc009zyp.2_RNA	NM_198827	NP_942122	Q6QNK2	GP133_HUMAN	G protein-coupled receptor 133 precursor	685	Helical; Name=4; (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			pancreas(5)|ovary(3)|skin(2)	10	all_neural(191;0.0982)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;1.68e-06)|all cancers(50;2.71e-06)|Epithelial(86;6.75e-06)		TTTTCCTCTTCTGATCTGCAT	0.343													38	200	---	---	---	---	PASS
NOC4L	79050	broad.mit.edu	37	12	132636740	132636740	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132636740G>A	uc001ujz.1	+	14	1470	c.1429G>A	c.(1429-1431)GAG>AAG	p.E477K		NM_024078	NP_076983	Q9BVI4	NOC4L_HUMAN	nucleolar complex associated 4 homolog	477					rRNA processing	integral to membrane|nuclear membrane|nucleolus	protein binding				0	all_neural(191;0.0982)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;7.2e-08)|Epithelial(86;3.34e-07)|all cancers(50;1.97e-05)		CACGGCCTACGAGGTGCGGAA	0.652													11	26	---	---	---	---	PASS
ZNF268	10795	broad.mit.edu	37	12	133768599	133768599	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:133768599G>T	uc010tcf.1	+						ZNF268_uc010tbv.1_Intron|ZNF268_uc010tbw.1_Intron|ZNF268_uc010tbx.1_Intron|ZNF268_uc010tby.1_Intron|ZNF268_uc010tbz.1_Intron|ZNF268_uc010tca.1_Intron|ZNF268_uc010tcb.1_Intron|ZNF268_uc010tcc.1_Intron|ZNF268_uc010tcd.1_Intron|ZNF268_uc010tce.1_Intron|ZNF268_uc010tcg.1_Intron|ZNF268_uc010tch.1_Intron	NM_003415	NP_003406	Q14587	ZN268_HUMAN	zinc finger protein 268 isoform a							nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_cancers(7;0.000215)|all_epithelial(31;0.096)		OV - Ovarian serous cystadenocarcinoma(86;3.58e-08)|Epithelial(86;6.6e-07)|all cancers(50;2.28e-05)		AGTGAGTGATGGAGACAAATC	0.403													32	109	---	---	---	---	PASS
PARP4	143	broad.mit.edu	37	13	25067872	25067872	+	Splice_Site	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25067872C>T	uc001upl.2	-	8	848	c.742_splice	c.e8-1	p.L248_splice	PARP4_uc010tdc.1_Splice_Site_p.L248_splice	NM_006437	NP_006428	Q9UKK3	PARP4_HUMAN	poly (ADP-ribose) polymerase family, member 4						cell death|DNA repair|inflammatory response|protein ADP-ribosylation|response to drug|transport	cytoplasm|nucleus|ribonucleoprotein complex|spindle microtubule	DNA binding|enzyme binding|NAD+ ADP-ribosyltransferase activity			ovary(3)|skin(1)	4		all_epithelial(30;7.67e-16)|Lung SC(185;0.0225)|Breast(139;0.052)		all cancers(112;0.000127)|Epithelial(112;0.000778)|Kidney(163;0.039)|OV - Ovarian serous cystadenocarcinoma(117;0.0578)|KIRC - Kidney renal clear cell carcinoma(186;0.135)|Lung(94;0.195)		CCAAAAGCAACTACAATAATA	0.428													7	165	---	---	---	---	PASS
MTMR6	9107	broad.mit.edu	37	13	25831403	25831403	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25831403C>T	uc001uqf.3	-	9	1345	c.1026G>A	c.(1024-1026)AGG>AGA	p.R342R	MTMR6_uc001uqe.1_Silent_p.R342R	NM_004685	NP_004676	Q9Y217	MTMR6_HUMAN	myotubularin related protein 6	342	Myotubularin phosphatase.|Substrate binding (By similarity).					cytoplasm|nuclear envelope	calcium-activated potassium channel activity|protein serine/threonine phosphatase activity|protein tyrosine phosphatase activity			ovary(2)|skin(2)	4		Lung SC(185;0.0225)|Breast(139;0.0351)		all cancers(112;0.00927)|Epithelial(112;0.0474)|OV - Ovarian serous cystadenocarcinoma(117;0.164)		CCTGGGAAGTCCTATCCCAAC	0.373													50	42	---	---	---	---	PASS
RNF6	6049	broad.mit.edu	37	13	26788682	26788682	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:26788682G>C	uc001uqo.2	-	5	1628	c.1337C>G	c.(1336-1338)TCT>TGT	p.S446C	RNF6_uc001uqn.1_Intron|RNF6_uc010aak.2_Missense_Mutation_p.S446C|RNF6_uc001uqp.2_Missense_Mutation_p.S446C|RNF6_uc001uqq.2_Missense_Mutation_p.S446C|RNF6_uc010tdk.1_Missense_Mutation_p.S90C	NM_183044	NP_898865	Q9Y252	RNF6_HUMAN	ring finger protein 6	446					negative regulation of axon extension|positive regulation of transcription, DNA-dependent|protein K27-linked ubiquitination|protein K48-linked ubiquitination|protein K6-linked ubiquitination|regulation of androgen receptor signaling pathway|ubiquitin-dependent protein catabolic process	axon|cytoplasm|PML body	androgen receptor binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|skin(1)	2	Colorectal(5;0.000442)	Lung SC(185;0.0156)|Breast(139;0.147)		all cancers(112;0.00893)|Epithelial(112;0.0481)|OV - Ovarian serous cystadenocarcinoma(117;0.148)|GBM - Glioblastoma multiforme(144;0.23)|Lung(94;0.245)		CTCTAAACGAGAAATGGTTCG	0.443													18	297	---	---	---	---	PASS
CDK8	1024	broad.mit.edu	37	13	26971323	26971323	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:26971323A>G	uc001uqr.1	+	9	920	c.894A>G	c.(892-894)GAA>GAG	p.E298E	CDK8_uc001uqs.1_Silent_p.E298E|CDK8_uc001uqt.1_Silent_p.E125E	NM_001260	NP_001251	P49336	CDK8_HUMAN	cyclin-dependent kinase 8	298	Protein kinase.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	mediator complex	ATP binding|cyclin-dependent protein kinase activity|protein binding|RNA polymerase II carboxy-terminal domain kinase activity			lung(2)|large_intestine(1)|ovary(1)|skin(1)	5	Colorectal(5;0.000442)	Lung SC(185;0.0156)|Breast(139;0.147)		all cancers(112;0.0384)|Epithelial(112;0.142)|OV - Ovarian serous cystadenocarcinoma(117;0.188)		AGTATATGGAAAAACATAAAG	0.328													8	144	---	---	---	---	PASS
PAN3	255967	broad.mit.edu	37	13	28841288	28841288	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:28841288C>G	uc001urz.2	+	10	1200	c.1192C>G	c.(1192-1194)CAA>GAA	p.Q398E	PAN3_uc010tdo.1_Missense_Mutation_p.Q544E|PAN3_uc001ury.2_Missense_Mutation_p.Q232E|PAN3_uc001urx.2_Missense_Mutation_p.Q344E	NM_175854	NP_787050	Q58A45	PAN3_HUMAN	PABP1-dependent poly A-specific ribonuclease	544	Protein kinase.|Interaction with PAN2.				nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|nuclear-transcribed mRNA poly(A) tail shortening	centrosome|cytosol	ATP binding|protein kinase activity			ovary(1)	1	Acute lymphoblastic leukemia(6;0.04)	Lung SC(185;0.0262)	Colorectal(13;0.000334)	all cancers(112;0.0102)|Epithelial(112;0.0803)|GBM - Glioblastoma multiforme(144;0.121)|OV - Ovarian serous cystadenocarcinoma(117;0.13)|Lung(94;0.174)		GAAGAAAATTCAACACTCAAA	0.388													12	280	---	---	---	---	PASS
FLT1	2321	broad.mit.edu	37	13	29001395	29001395	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:29001395A>T	uc001usb.3	-	10	1622	c.1337T>A	c.(1336-1338)CTG>CAG	p.L446Q	FLT1_uc010aar.1_Missense_Mutation_p.L446Q|FLT1_uc001usc.3_Missense_Mutation_p.L446Q|FLT1_uc010tdp.1_Missense_Mutation_p.L446Q	NM_002019	NP_002010	P17948	VGFR1_HUMAN	fms-related tyrosine kinase 1 isoform 1	446	Ig-like C2-type 5.|Extracellular (Potential).				cell differentiation|female pregnancy|positive regulation of vascular endothelial growth factor receptor signaling pathway	extracellular space|Golgi apparatus|integral to plasma membrane|nucleus	ATP binding|growth factor binding|vascular endothelial growth factor receptor activity			lung(10)|central_nervous_system(5)|ovary(3)|stomach(2)|skin(2)|urinary_tract(1)|breast(1)	24	Acute lymphoblastic leukemia(6;0.04)	Lung SC(185;0.0262)|Breast(139;0.188)	Colorectal(13;0.000674)	all cancers(112;0.0301)|Epithelial(112;0.155)|GBM - Glioblastoma multiforme(144;0.184)|OV - Ovarian serous cystadenocarcinoma(117;0.205)|Lung(94;0.207)	Sunitinib(DB01268)	TCTGCTGCCCAGTGGGTAGAG	0.502													93	86	---	---	---	---	PASS
FRY	10129	broad.mit.edu	37	13	32786485	32786485	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:32786485G>A	uc001utx.2	+	35	5144	c.4648G>A	c.(4648-4650)GAG>AAG	p.E1550K	FRY_uc010tdw.1_RNA	NM_023037	NP_075463	Q5TBA9	FRY_HUMAN	furry homolog	1550					regulation of transcription, DNA-dependent|transcription, DNA-dependent	integral to membrane				ovary(5)|large_intestine(1)|skin(1)	7		Lung SC(185;0.0271)		all cancers(112;4.81e-05)|Epithelial(112;0.000656)|OV - Ovarian serous cystadenocarcinoma(117;0.0123)|BRCA - Breast invasive adenocarcinoma(63;0.0295)|GBM - Glioblastoma multiforme(144;0.104)		CCCAGATGCTGAGGAGAACAA	0.373													20	21	---	---	---	---	PASS
LHFP	10186	broad.mit.edu	37	13	40175055	40175055	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:40175055G>A	uc001uxf.2	-	2	810	c.299C>T	c.(298-300)GCG>GTG	p.A100V		NM_005780	NP_005771	Q9Y693	LHFP_HUMAN	lipoma HMGIC fusion partner precursor	100	Helical; (Potential).					integral to membrane	DNA binding		HMGA2/LHFP(2)	soft_tissue(2)|lung(1)|breast(1)	4		Lung NSC(96;3.55e-06)|Breast(139;0.00408)|Ovarian(182;0.0107)|Prostate(109;0.0118)|Lung SC(185;0.0719)|Hepatocellular(188;0.114)		OV - Ovarian serous cystadenocarcinoma(117;6.48e-46)|Epithelial(112;8.43e-42)|all cancers(112;1.42e-36)|GBM - Glioblastoma multiforme(144;0.00187)|BRCA - Breast invasive adenocarcinoma(63;0.00886)|KIRC - Kidney renal clear cell carcinoma(186;0.048)|Kidney(163;0.0601)|LUSC - Lung squamous cell carcinoma(192;0.105)		GGCAGTGAGCGCCACCAGGAG	0.587			T	HMGA2	lipoma								10	253	---	---	---	---	PASS
KBTBD6	89890	broad.mit.edu	37	13	41706348	41706348	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:41706348G>C	uc001uxu.1	-	1	589	c.300C>G	c.(298-300)TTC>TTG	p.F100L	KBTBD6_uc010ace.1_Intron|KBTBD6_uc010tfe.1_Intron|uc001uxv.1_5'Flank	NM_152903	NP_690867	Q86V97	KBTB6_HUMAN	kelch repeat and BTB (POZ) domain-containing 6	100	BTB.						protein binding			ovary(1)|skin(1)	2		Lung NSC(96;4.52e-06)|Breast(139;0.00123)|Prostate(109;0.0181)|Lung SC(185;0.0262)|Hepatocellular(98;0.114)		all cancers(112;4.08e-09)|Epithelial(112;4.74e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.000131)|GBM - Glioblastoma multiforme(144;0.000876)|BRCA - Breast invasive adenocarcinoma(63;0.0673)		TGCCACCTGTGAACATGCTCT	0.632													7	84	---	---	---	---	PASS
MTRF1	9617	broad.mit.edu	37	13	41826881	41826881	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:41826881G>A	uc001uxx.2	-	7	1067	c.597C>T	c.(595-597)ATC>ATT	p.I199I	MTRF1_uc001uxy.2_Silent_p.I199I|MTRF1_uc001uxz.2_Silent_p.I35I|MTRF1_uc010tff.1_Silent_p.I212I|MTRF1_uc001uyc.1_Silent_p.I199I	NM_004294	NP_004285	O75570	RF1M_HUMAN	mitochondrial translational release factor 1	199					regulation of translational termination	mitochondrion	translation release factor activity, codon specific				0		Lung NSC(96;4.52e-06)|Breast(139;0.00123)|Prostate(109;0.0181)|Lung SC(185;0.0262)|Hepatocellular(98;0.114)|Ovarian(182;0.125)		OV - Ovarian serous cystadenocarcinoma(117;4.24e-10)|all cancers(112;2.05e-09)|Epithelial(112;2.48e-09)|GBM - Glioblastoma multiforme(144;0.00115)|BRCA - Breast invasive adenocarcinoma(63;0.0721)|KIRC - Kidney renal clear cell carcinoma(186;0.248)		ATTGTTGGCAGATGTCACCTA	0.333													9	105	---	---	---	---	PASS
C13orf30	144809	broad.mit.edu	37	13	43362793	43362793	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:43362793C>T	uc010tfk.1	+	4	410	c.287C>T	c.(286-288)TCA>TTA	p.S96L	C13orf30_uc010tfl.1_Missense_Mutation_p.S96L	NM_182508	NP_872314	Q8N7L0	CM030_HUMAN	hypothetical protein LOC144809	96											0		Lung NSC(96;0.000369)|Prostate(109;0.0305)|Lung SC(185;0.0367)|Breast(139;0.0406)		GBM - Glioblastoma multiforme(144;0.000512)|OV - Ovarian serous cystadenocarcinoma(117;0.000563)|BRCA - Breast invasive adenocarcinoma(63;0.0677)		AAGAGAGCCTCAGCCAAGGTA	0.448													33	211	---	---	---	---	PASS
SERP2	387923	broad.mit.edu	37	13	44971456	44971456	+	3'UTR	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:44971456A>C	uc001uzj.2	+	3					SERP2_uc001uzk.2_RNA	NM_001010897	NP_001010897	Q8N6R1	SERP2_HUMAN	stress-associated endoplasmic reticulum protein						protein transport|transmembrane transport	endoplasmic reticulum membrane|integral to membrane					0		all_hematologic(4;1.49e-06)|Acute lymphoblastic leukemia(4;1.5e-06)|Lung NSC(96;0.00043)|Breast(139;0.0044)|Prostate(109;0.0137)|Lung SC(185;0.0367)|Hepatocellular(98;0.0556)		GBM - Glioblastoma multiforme(144;0.00026)|BRCA - Breast invasive adenocarcinoma(63;0.123)		TGAGAAAGCCAGGGATTTGAC	0.517													34	28	---	---	---	---	PASS
PIBF1	10464	broad.mit.edu	37	13	73396017	73396017	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:73396017G>A	uc001vjc.2	+	6	1008	c.703G>A	c.(703-705)GAA>AAA	p.E235K	PIBF1_uc001vja.1_Missense_Mutation_p.E235K|PIBF1_uc010aeo.1_RNA|PIBF1_uc001vjb.2_Missense_Mutation_p.E235K|PIBF1_uc010aep.2_Intron	NM_006346	NP_006337	Q8WXW3	PIBF1_HUMAN	progesterone-induced blocking factor 1	235						centrosome				ovary(1)|breast(1)	2		Prostate(6;0.00191)|Breast(118;0.0736)|Acute lymphoblastic leukemia(28;0.0865)		GBM - Glioblastoma multiforme(99;0.000664)		AAACTACTCTGAAGTTCAAAT	0.338													34	92	---	---	---	---	PASS
MYCBP2	23077	broad.mit.edu	37	13	77759384	77759384	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:77759384G>A	uc001vkf.2	-	33	4550	c.4459C>T	c.(4459-4461)CAA>TAA	p.Q1487*	MYCBP2_uc010aev.2_Nonsense_Mutation_p.Q891*	NM_015057	NP_055872	O75592	MYCB2_HUMAN	MYC binding protein 2	1487					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ligase activity|protein binding|zinc ion binding			ovary(4)|breast(4)|skin(3)|lung(2)|pancreas(1)	14		Breast(118;0.212)|Acute lymphoblastic leukemia(28;0.22)		GBM - Glioblastoma multiforme(99;0.109)		AGATATCCTTGAGGATCATTA	0.383													20	312	---	---	---	---	PASS
RNF219	79596	broad.mit.edu	37	13	79216305	79216305	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:79216305C>T	uc001vkw.1	-	3	311	c.252G>A	c.(250-252)AGG>AGA	p.R84R	RNF219_uc010afb.1_5'UTR|RNF219_uc010afc.2_Silent_p.R84R	NM_024546	NP_078822	Q5W0B1	RN219_HUMAN	ring finger protein 219	84							zinc ion binding			large_intestine(2)	2		Acute lymphoblastic leukemia(28;0.0279)|Breast(118;0.0848)		GBM - Glioblastoma multiforme(99;0.0414)		GAAGATGCTTCCTGACCGTAT	0.328													12	278	---	---	---	---	PASS
SLITRK5	26050	broad.mit.edu	37	13	88329558	88329558	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:88329558C>A	uc001vln.2	+	2	2134	c.1915C>A	c.(1915-1917)CCT>ACT	p.P639T	SLITRK5_uc010tic.1_Missense_Mutation_p.P398T	NM_015567	NP_056382	O94991	SLIK5_HUMAN	SLIT and NTRK-like family, member 5 precursor	639	Extracellular (Potential).					integral to membrane				ovary(2)|pancreas(2)|central_nervous_system(1)	5	all_neural(89;0.101)|Medulloblastoma(90;0.163)					CGCCGTGACTCCTGCGGTCCG	0.622													7	139	---	---	---	---	PASS
GPC5	2262	broad.mit.edu	37	13	92345877	92345877	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:92345877G>T	uc010tif.1	+	3	1128	c.762G>T	c.(760-762)AAG>AAT	p.K254N		NM_004466	NP_004457	P78333	GPC5_HUMAN	glypican 5 precursor	254						anchored to membrane|extracellular space|integral to plasma membrane|proteinaceous extracellular matrix	heparan sulfate proteoglycan binding			ovary(2)|skin(2)|upper_aerodigestive_tract(1)	5	all_cancers(3;1.43e-07)|all_neural(89;0.0804)|Medulloblastoma(90;0.163)	Lung NSC(4;0.00454)				CCCTCCTGAAGATGCAATACT	0.562													53	57	---	---	---	---	PASS
HS6ST3	266722	broad.mit.edu	37	13	97485146	97485146	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:97485146C>T	uc001vmw.2	+	2	1134	c.1110C>T	c.(1108-1110)CTC>CTT	p.L370L		NM_153456	NP_703157	Q8IZP7	H6ST3_HUMAN	heparan sulfate 6-O-sulfotransferase 3	370	Lumenal (Potential).					integral to membrane	sulfotransferase activity			ovary(1)|skin(1)	2	all_neural(89;0.0878)|Medulloblastoma(90;0.163)					CATTCAACCTCAAGTTCATCT	0.493													30	174	---	---	---	---	PASS
FARP1	10160	broad.mit.edu	37	13	99042240	99042240	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:99042240G>C	uc001vnj.2	+	10	1221	c.885G>C	c.(883-885)CTG>CTC	p.L295L	FARP1_uc001vnh.2_Silent_p.L295L	NM_005766	NP_005757	Q9Y4F1	FARP1_HUMAN	FERM, RhoGEF, and pleckstrin domain protein 1	295	FERM.				regulation of Rho protein signal transduction	cytoplasm|cytoskeleton|extrinsic to membrane	cytoskeletal protein binding|Rho guanyl-nucleotide exchange factor activity			breast(2)	2	all_neural(89;0.0982)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)		BRCA - Breast invasive adenocarcinoma(86;0.233)			TGGAATTCCTGATGGCCAGTC	0.443													7	315	---	---	---	---	PASS
GPR18	2841	broad.mit.edu	37	13	99907182	99907182	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:99907182G>C	uc001voe.3	-	3	1446	c.945C>G	c.(943-945)TTC>TTG	p.F315L	UBAC2_uc001voa.3_Intron|UBAC2_uc010tiu.1_Intron|UBAC2_uc001vob.3_Intron|UBAC2_uc010tiv.1_Intron|UBAC2_uc001vod.2_Intron|UBAC2_uc001voc.2_Intron|UBAC2_uc010tiw.1_Intron|GPR18_uc010afv.2_Missense_Mutation_p.F315L	NM_005292	NP_005283	Q14330	GPR18_HUMAN	G protein-coupled receptor 18	315	Cytoplasmic (Potential).					integral to membrane|plasma membrane	purinergic nucleotide receptor activity, G-protein coupled				0	all_neural(89;0.101)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)				Glycine(DB00145)	TACCAGATCGGAAACTTTTTC	0.358													70	153	---	---	---	---	PASS
NALCN	259232	broad.mit.edu	37	13	101710283	101710283	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101710283G>T	uc001vox.1	-							NM_052867	NP_443099	Q8IZF0	NALCN_HUMAN	voltage gated channel like 1							integral to membrane	sodium channel activity|voltage-gated ion channel activity			ovary(8)|breast(4)|skin(2)|pancreas(1)|central_nervous_system(1)	16	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)					ATGCCTGGATGGACCTACCTG	0.522													90	109	---	---	---	---	PASS
ERCC5	2073	broad.mit.edu	37	13	103514069	103514069	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:103514069C>G	uc001vpw.2	+						ERCC5_uc001vpu.1_Intron|ERCC5_uc010tjb.1_Intron|ERCC5_uc010tjc.1_Intron|ERCC5_uc010tjd.1_Intron	NM_000123	NP_000114	P28715	ERCC5_HUMAN	XPG-complementing protein						negative regulation of apoptosis|nucleotide-excision repair, DNA damage removal|nucleotide-excision repair, DNA incision, 3'-to lesion|response to UV-C|transcription-coupled nucleotide-excision repair|UV protection	nucleoplasm	bubble DNA binding|double-stranded DNA binding|endodeoxyribonuclease activity|metal ion binding|protein homodimerization activity|protein N-terminus binding|single-stranded DNA binding			ovary(4)|lung(1)|central_nervous_system(1)|skin(1)	7	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.211)					TAAAAGGTATCAGGCACCATC	0.353			Mis|N|F			skin basal cell|skin squamous cell|melanoma		Direct_reversal_of_damage|NER	Xeroderma_Pigmentosum				7	116	---	---	---	---	PASS
IRS2	8660	broad.mit.edu	37	13	110434648	110434648	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:110434648G>C	uc001vqv.2	-	1	4267	c.3753C>G	c.(3751-3753)CTC>CTG	p.L1251L		NM_003749	NP_003740	Q9Y4H2	IRS2_HUMAN	insulin receptor substrate 2	1251					fibroblast growth factor receptor signaling pathway|glucose metabolic process|insulin receptor signaling pathway|lipid homeostasis|negative regulation of B cell apoptosis|negative regulation of kinase activity|negative regulation of plasma membrane long-chain fatty acid transport|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of B cell proliferation|positive regulation of fatty acid beta-oxidation|positive regulation of glucose import|positive regulation of glycogen biosynthetic process|positive regulation of insulin secretion|response to glucose stimulus	cytosol|plasma membrane	insulin receptor binding|signal transducer activity			large_intestine(2)|lung(2)|upper_aerodigestive_tract(1)|skin(1)|ovary(1)|kidney(1)	8	all_cancers(4;7.57e-15)|all_epithelial(4;5.91e-09)|all_lung(23;7.64e-07)|Lung NSC(43;0.000183)|Colorectal(4;0.00159)|all_neural(89;0.00294)|Medulloblastoma(90;0.00596)|Lung SC(71;0.0155)	Breast(118;0.159)	all cancers(43;0.00815)|BRCA - Breast invasive adenocarcinoma(86;0.11)|Epithelial(84;0.127)|GBM - Glioblastoma multiforme(44;0.147)			CGATGTAGTTGAGACCATTCT	0.517													22	20	---	---	---	---	PASS
COL4A1	1282	broad.mit.edu	37	13	110829259	110829259	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:110829259C>A	uc001vqw.3	-	34	2964	c.2842G>T	c.(2842-2844)GGC>TGC	p.G948C	COL4A1_uc010agl.2_Intron	NM_001845	NP_001836	P02462	CO4A1_HUMAN	alpha 1 type IV collagen preproprotein	948	Triple-helical region.				angiogenesis|axon guidance		extracellular matrix structural constituent|platelet-derived growth factor binding			ovary(3)|lung(1)|central_nervous_system(1)|pancreas(1)	6	all_cancers(4;9.8e-13)|all_epithelial(4;9.66e-08)|all_lung(23;3.75e-06)|Lung NSC(43;0.000274)|Colorectal(4;0.00178)|all_neural(89;0.00459)|Medulloblastoma(90;0.00596)|Lung SC(71;0.0604)	Breast(118;0.2)	BRCA - Breast invasive adenocarcinoma(86;0.11)|all cancers(43;0.145)			CCTTTCTGGCCCTTCATGCTG	0.572													60	80	---	---	---	---	PASS
COL4A1	1282	broad.mit.edu	37	13	110829260	110829260	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:110829260C>A	uc001vqw.3	-	34	2963	c.2841G>T	c.(2839-2841)AAG>AAT	p.K947N	COL4A1_uc010agl.2_Intron	NM_001845	NP_001836	P02462	CO4A1_HUMAN	alpha 1 type IV collagen preproprotein	947	Triple-helical region.				angiogenesis|axon guidance		extracellular matrix structural constituent|platelet-derived growth factor binding			ovary(3)|lung(1)|central_nervous_system(1)|pancreas(1)	6	all_cancers(4;9.8e-13)|all_epithelial(4;9.66e-08)|all_lung(23;3.75e-06)|Lung NSC(43;0.000274)|Colorectal(4;0.00178)|all_neural(89;0.00459)|Medulloblastoma(90;0.00596)|Lung SC(71;0.0604)	Breast(118;0.2)	BRCA - Breast invasive adenocarcinoma(86;0.11)|all cancers(43;0.145)			CTTTCTGGCCCTTCATGCTGC	0.577													63	80	---	---	---	---	PASS
ANKRD10	55608	broad.mit.edu	37	13	111532094	111532094	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:111532094C>T	uc001vrn.2	-	6	1288	c.1153G>A	c.(1153-1155)GAA>AAA	p.E385K	ANKRD10_uc001vrm.2_Missense_Mutation_p.E122K|ANKRD10_uc001vrl.2_RNA	NM_017664	NP_060134	Q9NXR5	ANR10_HUMAN	ankyrin repeat domain 10	385										central_nervous_system(1)	1	all_lung(23;3.61e-05)|Lung NSC(43;0.00144)|Lung SC(71;0.0753)|all_neural(89;0.077)|Medulloblastoma(90;0.148)		all cancers(43;0.0882)|BRCA - Breast invasive adenocarcinoma(86;0.188)|Lung(89;0.208)			GGGATGCTTTCAGCAGTGTCC	0.567													9	117	---	---	---	---	PASS
ATP11A	23250	broad.mit.edu	37	13	113479828	113479828	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:113479828G>A	uc001vsi.3	+	11	1045	c.957G>A	c.(955-957)CAG>CAA	p.Q319Q	ATP11A_uc001vsj.3_Silent_p.Q319Q|ATP11A_uc001vsm.1_Silent_p.Q195Q	NM_015205	NP_056020	P98196	AT11A_HUMAN	ATPase, class VI, type 11A isoform a	319	Extracellular (Potential).				ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			large_intestine(2)|ovary(2)	4	all_lung(23;0.000374)|Lung NSC(43;0.0107)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)	all_lung(25;0.134)|all_epithelial(44;0.141)				ACATGTGGCAGAGTGAGCCCT	0.463													8	125	---	---	---	---	PASS
ATP11A	23250	broad.mit.edu	37	13	113527915	113527915	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:113527915G>C	uc001vsi.3	+	27	3174	c.3086G>C	c.(3085-3087)TGG>TCG	p.W1029S	ATP11A_uc001vsj.3_Missense_Mutation_p.W1029S|ATP11A_uc010ago.2_RNA	NM_015205	NP_056020	P98196	AT11A_HUMAN	ATPase, class VI, type 11A isoform a	1029	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			large_intestine(2)|ovary(2)	4	all_lung(23;0.000374)|Lung NSC(43;0.0107)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)	all_lung(25;0.134)|all_epithelial(44;0.141)				TACTGGACTTGGATCAACCAT	0.453											OREG0003854	type=REGULATORY REGION|Gene=ATP11A|Dataset=Stanford ENCODE Dataset|EvidenceSubtype=Transient transfection luciferase assay	20	120	---	---	---	---	PASS
ZNF828	283489	broad.mit.edu	37	13	115090626	115090626	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:115090626C>G	uc010ahb.2	+	3	1638	c.1309C>G	c.(1309-1311)CCA>GCA	p.P437A	ZNF828_uc001vuv.2_Missense_Mutation_p.P437A|ZNF828_uc010tko.1_Missense_Mutation_p.P437A	NM_001164144	NP_001157616	Q96JM3	ZN828_HUMAN	zinc finger protein 828	437	Mediates interaction with MAD2L2.|Pro-rich.				attachment of spindle microtubules to kinetochore involved in mitotic sister chromatid segregation|protein localization to kinetochore|protein localization to microtubule|sister chromatid biorientation	condensed chromosome kinetochore|cytoplasm|nucleus|spindle	nucleic acid binding|protein binding|zinc ion binding			ovary(2)	2	Lung NSC(43;0.00299)|all_neural(89;0.0337)|Medulloblastoma(90;0.163)|Lung SC(71;0.218)	all_epithelial(44;0.122)|all_lung(25;0.123)	BRCA - Breast invasive adenocarcinoma(86;0.104)	OV - Ovarian serous cystadenocarcinoma(48;0.193)|Epithelial(10;0.197)		AGCAGGATCTCCAGAGCTCAG	0.532													183	144	---	---	---	---	PASS
TEP1	7011	broad.mit.edu	37	14	20852761	20852761	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20852761G>T	uc001vxe.2	-	22	3259	c.3219C>A	c.(3217-3219)CGC>CGA	p.R1073R	TEP1_uc010ahk.2_Silent_p.R423R|TEP1_uc010tlf.1_RNA|TEP1_uc010tlg.1_Silent_p.R965R|TEP1_uc010tlh.1_5'Flank	NM_007110	NP_009041	Q99973	TEP1_HUMAN	telomerase-associated protein 1	1073					telomere maintenance via recombination	chromosome, telomeric region|cytoplasm|nuclear matrix|soluble fraction|telomerase holoenzyme complex	ATP binding|RNA binding			ovary(5)	5	all_cancers(95;0.00123)	all_lung(585;0.235)	Epithelial(56;7.42e-08)|all cancers(55;6.46e-07)	GBM - Glioblastoma multiforme(265;0.028)|READ - Rectum adenocarcinoma(17;0.233)		CAGCTCACCTGCGGCAGGTGA	0.552													83	317	---	---	---	---	PASS
RNASE4	6038	broad.mit.edu	37	14	21167599	21167599	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:21167599C>G	uc001vxy.3	+	2	632	c.69C>G	c.(67-69)GTC>GTG	p.V23V	RNASE4_uc001vxx.3_RNA|RNASE4_uc001vya.2_Silent_p.V23V	NM_002937	NP_002928	P34096	RNAS4_HUMAN	ribonuclease, RNase A family, 4 precursor	23					mRNA cleavage	extracellular region	nucleic acid binding|pancreatic ribonuclease activity			central_nervous_system(1)	1	all_cancers(95;0.00304)		Epithelial(56;5.13e-07)|all cancers(55;4.73e-06)	GBM - Glioblastoma multiforme(265;0.0133)		TGGGGCTGGTCCAGCCCTCCT	0.557													35	201	---	---	---	---	PASS
SALL2	6297	broad.mit.edu	37	14	21993371	21993371	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:21993371G>C	uc001wbe.2	-	2	773	c.491C>G	c.(490-492)CCA>CGA	p.P164R	SALL2_uc010tly.1_Missense_Mutation_p.P162R|SALL2_uc010tlz.1_Intron|SALL2_uc001wbf.3_Intron|SALL2_uc010tma.1_Intron|SALL2_uc001wbg.1_Intron	NM_005407	NP_005398	Q9Y467	SALL2_HUMAN	sal-like 2	164	Poly-Pro.						DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)|large_intestine(1)	3	all_cancers(95;0.000662)			GBM - Glioblastoma multiforme(265;0.0151)		AGGGGGTGGTGGAGGAGGAGG	0.647													6	89	---	---	---	---	PASS
MYH7	4625	broad.mit.edu	37	14	23894185	23894185	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23894185G>C	uc001wjx.2	-	22	2578	c.2472C>G	c.(2470-2472)GTC>GTG	p.V824V		NM_000257	NP_000248	P12883	MYH7_HUMAN	myosin, heavy chain 7, cardiac muscle, beta	824			V -> I (in CMH1).		adult heart development|muscle filament sliding|regulation of heart rate|ventricular cardiac muscle tissue morphogenesis	focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(3)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00725)		GCCAATTCTTGACCCCCATGA	0.547													7	204	---	---	---	---	PASS
LRRC16B	90668	broad.mit.edu	37	14	24522926	24522926	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24522926C>A	uc001wlj.2	+	2	206	c.49C>A	c.(49-51)CGG>AGG	p.R17R		NM_138360	NP_612369	Q8ND23	LR16B_HUMAN	leucine rich repeat containing 16B	17										ovary(2)|breast(2)|pancreas(1)	5				GBM - Glioblastoma multiforme(265;0.019)		AGACAGCATCCGGAGGTGCCT	0.612													4	79	---	---	---	---	PASS
FITM1	161247	broad.mit.edu	37	14	24601642	24601642	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24601642C>G	uc001wmf.2	+	2	587	c.489C>G	c.(487-489)CAC>CAG	p.H163Q		NM_203402	NP_981947	A5D6W6	FITM1_HUMAN	fat-inducing transcript 1	163	Extracellular (Potential).				lipid particle organization|positive regulation of sequestering of triglyceride	endoplasmic reticulum membrane|integral to membrane					0						TGCTGCTCCACGAGCTGCCTG	0.687													8	69	---	---	---	---	PASS
MDP1	145553	broad.mit.edu	37	14	24684816	24684816	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24684816C>A	uc001wnl.1	-	3	231	c.151G>T	c.(151-153)GTG>TTG	p.V51L	TM9SF1_uc010tob.1_5'Flank|CHMP4A_uc001wni.2_5'Flank|CHMP4A_uc010toc.1_5'Flank|CHMP4A_uc001wnj.2_5'UTR|MDP1_uc001wnk.1_Missense_Mutation_p.V51L|CHMP4A_uc001wnm.1_Missense_Mutation_p.V51L	NM_138476	NP_612485	Q86V88	MGDP1_HUMAN	magnesium-dependent phosphatase 1	51							metal ion binding|protein tyrosine phosphatase activity				0						ACCTCAGGCACCTCTGGGTAC	0.587											OREG0022620	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	30	711	---	---	---	---	PASS
G2E3	55632	broad.mit.edu	37	14	31071217	31071217	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31071217A>T	uc001wqk.2	+	10	1044	c.890A>T	c.(889-891)AAA>ATA	p.K297I	G2E3_uc010tpe.1_Missense_Mutation_p.K212I|G2E3_uc010tpf.1_Missense_Mutation_p.K251I	NM_017769	NP_060239	Q7L622	G2E3_HUMAN	G2/M-phase specific E3 ubiquitin ligase	297					apoptosis|multicellular organismal development|protein modification process	Golgi apparatus|nucleolus	acid-amino acid ligase activity|protein binding|zinc ion binding			ovary(2)|skin(1)	3						GAGTTCCAAAAAGCCAAAAAA	0.308													16	115	---	---	---	---	PASS
EAPP	55837	broad.mit.edu	37	14	35002695	35002695	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:35002695C>T	uc001wsd.1	-	3	416	c.307G>A	c.(307-309)GAT>AAT	p.D103N		NM_018453	NP_060923	Q56P03	EAPP_HUMAN	E2F-associated phosphoprotein	103					negative regulation of transcription elongation from RNA polymerase II promoter|positive regulation of cell proliferation|positive regulation of transcription elongation from RNA polymerase II promoter	Golgi apparatus|nucleus|plasma membrane				ovary(1)	1	Breast(36;0.0473)|Hepatocellular(127;0.158)		LUAD - Lung adenocarcinoma(48;0.00169)|Lung(238;0.00342)|Epithelial(34;0.18)	GBM - Glioblastoma multiforme(112;0.0196)		TATATATCATCGTAGTACCTT	0.343													80	139	---	---	---	---	PASS
LRFN5	145581	broad.mit.edu	37	14	42356460	42356460	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:42356460C>G	uc001wvm.2	+	3	1830	c.632C>G	c.(631-633)CCA>CGA	p.P211R	LRFN5_uc010ana.2_Missense_Mutation_p.P211R	NM_152447	NP_689660	Q96NI6	LRFN5_HUMAN	leucine rich repeat and fibronectin type III	211	Extracellular (Potential).|LRR 7.					integral to membrane				ovary(5)|pancreas(2)|central_nervous_system(1)	8			LUAD - Lung adenocarcinoma(50;0.0223)|Lung(238;0.0728)	GBM - Glioblastoma multiforme(112;0.00847)		CAGAAGCTACCACCTGACCCT	0.433										HNSCC(30;0.082)			22	152	---	---	---	---	PASS
FSCB	84075	broad.mit.edu	37	14	44975323	44975323	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:44975323G>A	uc001wvn.2	-	1	1177	c.868C>T	c.(868-870)CAT>TAT	p.H290Y		NM_032135	NP_115511	Q5H9T9	FSCB_HUMAN	fibrous sheath CABYR binding protein	290						cilium				lung(3)|breast(3)|ovary(2)|central_nervous_system(1)	9				GBM - Glioblastoma multiforme(112;0.128)		ACTTGGACATGGGTCTCTTCA	0.493													7	141	---	---	---	---	PASS
SOS2	6655	broad.mit.edu	37	14	50585451	50585451	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50585451G>A	uc001wxs.3	-	23	3708	c.3610C>T	c.(3610-3612)CCT>TCT	p.P1204S	SOS2_uc010ans.2_Missense_Mutation_p.P39S|SOS2_uc010tql.1_Missense_Mutation_p.P1171S|C14orf138_uc001wxn.1_5'Flank|C14orf138_uc001wxo.1_5'Flank|C14orf138_uc001wxp.1_5'Flank|C14orf138_uc001wxq.1_5'Flank	NM_006939	NP_008870	Q07890	SOS2_HUMAN	son of sevenless homolog 2	1204	Poly-Pro.				apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	DNA binding|protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(2)	2	all_epithelial(31;0.000822)|Breast(41;0.0065)					GGTGGCGGAGGTGGACTATGC	0.522													11	346	---	---	---	---	PASS
FRMD6	122786	broad.mit.edu	37	14	52164869	52164869	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52164869C>T	uc001wzd.2	+	3	394	c.109C>T	c.(109-111)CTG>TTG	p.L37L	FRMD6_uc001wzb.2_Silent_p.L37L|FRMD6_uc001wzc.2_Silent_p.L37L|FRMD6_uc001wze.2_5'UTR	NM_152330	NP_689543	Q96NE9	FRMD6_HUMAN	FERM domain containing 6	37	FERM.					cytoskeleton|mitochondrion|plasma membrane	binding			ovary(1)|breast(1)|central_nervous_system(1)	3	all_epithelial(31;0.0163)|Breast(41;0.089)					GGTTAAGATTCTGTGTCACCA	0.443													29	109	---	---	---	---	PASS
PTGDR	5729	broad.mit.edu	37	14	52741475	52741475	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52741475G>T	uc001wzq.2	+	2	975	c.873G>T	c.(871-873)AAG>AAT	p.K291N		NM_000953	NP_000944	Q13258	PD2R_HUMAN	prostaglandin D2 receptor	291	Extracellular (Potential).					integral to membrane|plasma membrane	prostaglandin D receptor activity|protein binding			ovary(1)|lung(1)|central_nervous_system(1)|skin(1)	4	Breast(41;0.0639)|all_epithelial(31;0.0887)				Nedocromil(DB00716)	GAGCATTTAAGGATGTCAAGG	0.398													4	110	---	---	---	---	PASS
WDHD1	11169	broad.mit.edu	37	14	55475407	55475407	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:55475407C>G	uc001xbm.1	-	5	450	c.372G>C	c.(370-372)ATG>ATC	p.M124I	WDHD1_uc001xbn.1_Missense_Mutation_p.M1I	NM_007086	NP_009017	O75717	WDHD1_HUMAN	WD repeat and HMG-box DNA binding protein 1	124	WD 3.					cytoplasm|nucleoplasm	DNA binding			skin(1)	1						GGCTGCTATCCATCACATCCA	0.363													60	124	---	---	---	---	PASS
KTN1	3895	broad.mit.edu	37	14	56079043	56079043	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:56079043G>C	uc001xcb.2	+	3	579	c.277G>C	c.(277-279)GAA>CAA	p.E93Q	KTN1_uc001xce.2_Missense_Mutation_p.E93Q|KTN1_uc001xcc.2_Missense_Mutation_p.E93Q|KTN1_uc001xcd.2_Missense_Mutation_p.E93Q|KTN1_uc010trb.1_Missense_Mutation_p.E93Q|KTN1_uc001xcf.1_Missense_Mutation_p.E93Q	NM_182926	NP_891556	Q86UP2	KTN1_HUMAN	kinectin 1 isoform a	93	Lumenal (Potential).				microtubule-based movement	endoplasmic reticulum membrane|integral to plasma membrane|membrane fraction				breast(3)|ovary(2)|lung(1)|central_nervous_system(1)	7						TTTGGCAGTAGAAGATGATCA	0.353			T	RET	papillary thryoid								8	212	---	---	---	---	PASS
C14orf37	145407	broad.mit.edu	37	14	58604887	58604887	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:58604887G>A	uc001xdc.2	-	2	1301	c.1190C>T	c.(1189-1191)TCC>TTC	p.S397F	C14orf37_uc010tro.1_Missense_Mutation_p.S435F|C14orf37_uc001xdd.2_Missense_Mutation_p.S397F|C14orf37_uc001xde.2_Missense_Mutation_p.S397F	NM_001001872	NP_001001872	Q86TY3	CN037_HUMAN	hypothetical protein LOC145407 precursor	397	Extracellular (Potential).					integral to membrane	binding				0						GGGGGTAAAGGAACTTTGATC	0.512													99	176	---	---	---	---	PASS
KIAA0586	9786	broad.mit.edu	37	14	58895097	58895097	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:58895097G>A	uc001xdv.3	+	1	388	c.115G>A	c.(115-117)GAG>AAG	p.E39K	KIAA0586_uc010trr.1_Missense_Mutation_p.E39K|KIAA0586_uc001xdt.3_Intron|KIAA0586_uc001xdu.3_Missense_Mutation_p.E24K|KIAA0586_uc010trs.1_Intron|TIMM9_uc010aph.2_5'Flank|TIMM9_uc001xds.2_5'Flank|TIMM9_uc010api.2_5'Flank	NM_014749	NP_055564	E9PGW8	E9PGW8_HUMAN	talpid3 protein	39										ovary(1)	1						GCTGAAAGATGAGTTGCCCTG	0.428													8	122	---	---	---	---	PASS
RTN1	6252	broad.mit.edu	37	14	60193809	60193809	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:60193809C>A	uc001xen.1	-	3	1802	c.1593G>T	c.(1591-1593)CAG>CAT	p.Q531H	RTN1_uc001xem.1_Missense_Mutation_p.Q111H	NM_021136	NP_066959	Q16799	RTN1_HUMAN	reticulon 1 isoform A	531					neuron differentiation	integral to endoplasmic reticulum membrane	signal transducer activity			ovary(2)|central_nervous_system(2)	4				OV - Ovarian serous cystadenocarcinoma(108;0.0968)		CGGGGCCAGGCTGGGGCTCAG	0.687													8	16	---	---	---	---	PASS
SYNE2	23224	broad.mit.edu	37	14	64519092	64519092	+	Nonsense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64519092A>T	uc001xgm.2	+	48	8691	c.8461A>T	c.(8461-8463)AAA>TAA	p.K2821*	SYNE2_uc001xgl.2_Nonsense_Mutation_p.K2821*	NM_015180	NP_055995	Q8WXH0	SYNE2_HUMAN	spectrin repeat containing, nuclear envelope 2	2821	Potential.|Cytoplasmic (Potential).				centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)		GCTGGTTTTAAAATCAACTCA	0.338													11	109	---	---	---	---	PASS
SYNE2	23224	broad.mit.edu	37	14	64595260	64595260	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64595260G>A	uc001xgm.2	+	74	14238	c.14008G>A	c.(14008-14010)GAA>AAA	p.E4670K	SYNE2_uc001xgl.2_Missense_Mutation_p.E4670K|SYNE2_uc010apy.2_Missense_Mutation_p.E1055K|SYNE2_uc010apz.1_Missense_Mutation_p.E562K	NM_015180	NP_055995	Q8WXH0	SYNE2_HUMAN	spectrin repeat containing, nuclear envelope 2	4670	Potential.|Cytoplasmic (Potential).				centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)		GAGTGTTGCTGAACAGCTTCA	0.358													44	205	---	---	---	---	PASS
MTHFD1	4522	broad.mit.edu	37	14	64908778	64908778	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64908778C>G	uc001xhb.2	+	20	2278	c.1891C>G	c.(1891-1893)CCA>GCA	p.P631A	MTHFD1_uc010aqf.2_Missense_Mutation_p.P687A	NM_005956	NP_005947	P11586	C1TC_HUMAN	methylenetetrahydrofolate dehydrogenase 1	631	Formyltetrahydrofolate synthetase.				folic acid metabolic process|folic acid-containing compound biosynthetic process|histidine biosynthetic process|methionine biosynthetic process|one-carbon metabolic process|purine nucleotide biosynthetic process	cytosol|mitochondrion	ATP binding|formate-tetrahydrofolate ligase activity|methenyltetrahydrofolate cyclohydrolase activity|methylenetetrahydrofolate dehydrogenase (NADP+) activity|methylenetetrahydrofolate dehydrogenase|protein binding			ovary(2)	2				OV - Ovarian serous cystadenocarcinoma(108;8.7e-12)|all cancers(60;3.29e-11)|BRCA - Breast invasive adenocarcinoma(234;0.0488)	NADH(DB00157)|Tetrahydrofolic acid(DB00116)	ACAGGGCACTCCAGTGTTTGT	0.522													14	59	---	---	---	---	PASS
RDH12	145226	broad.mit.edu	37	14	68189388	68189388	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:68189388C>T	uc001xjz.3	+	3	353	c.29C>T	c.(28-30)TCC>TTC	p.S10F		NM_152443	NP_689656	Q96NR8	RDH12_HUMAN	retinol dehydrogenase 12	10					photoreceptor cell maintenance|response to stimulus|retinol metabolic process	intracellular	binding|retinol dehydrogenase activity			ovary(1)	1				all cancers(60;0.000704)|OV - Ovarian serous cystadenocarcinoma(108;0.00161)|BRCA - Breast invasive adenocarcinoma(234;0.00953)	Vitamin A(DB00162)	CTGCTCACCTCCTTCTTCTCG	0.502													10	298	---	---	---	---	PASS
ZFYVE26	23503	broad.mit.edu	37	14	68234552	68234552	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:68234552C>G	uc001xka.2	-	31	5798	c.5659G>C	c.(5659-5661)GAC>CAC	p.D1887H	ZFYVE26_uc010tsz.1_RNA|ZFYVE26_uc001xkc.3_Missense_Mutation_p.D1887H	NM_015346	NP_056161	Q68DK2	ZFY26_HUMAN	zinc finger, FYVE domain containing 26	1887					cell cycle|cell death|cytokinesis|double-strand break repair via homologous recombination	centrosome|midbody	metal ion binding|phosphatidylinositol-3-phosphate binding|protein binding			ovary(9)|breast(2)	11				all cancers(60;0.000763)|OV - Ovarian serous cystadenocarcinoma(108;0.0011)|BRCA - Breast invasive adenocarcinoma(234;0.0115)		TTGGAGCTGTCTAGAGCTGAG	0.478													10	165	---	---	---	---	PASS
PCNX	22990	broad.mit.edu	37	14	71500230	71500230	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:71500230C>T	uc001xmo.2	+	17	4089	c.3643C>T	c.(3643-3645)CAA>TAA	p.Q1215*	PCNX_uc010are.1_Nonsense_Mutation_p.Q1104*|PCNX_uc010arf.1_Nonsense_Mutation_p.Q75*	NM_014982	NP_055797	Q96RV3	PCX1_HUMAN	pecanex-like 1	1215						integral to membrane				ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(12;0.206)	all cancers(60;0.00835)|BRCA - Breast invasive adenocarcinoma(234;0.00951)|OV - Ovarian serous cystadenocarcinoma(108;0.0417)		TCTCAGCCGACAAAGCAGTGA	0.348													46	124	---	---	---	---	PASS
NUMB	8650	broad.mit.edu	37	14	73763914	73763914	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:73763914C>G	uc001xny.1	-						NUMB_uc010aro.1_Intron|NUMB_uc010arp.1_Intron|NUMB_uc010arq.1_Intron|NUMB_uc010arr.1_Intron|NUMB_uc001xoa.1_Intron|NUMB_uc001xnz.1_Intron|NUMB_uc001xob.1_Intron|NUMB_uc001xod.1_Intron|NUMB_uc001xoc.1_Intron|NUMB_uc010ars.1_Intron|NUMB_uc001xof.1_Intron|NUMB_uc001xog.2_Intron|NUMB_uc001xoh.1_Intron	NM_001005743	NP_001005743	P49757	NUMB_HUMAN	numb homolog isoform 1						axon guidance|lateral ventricle development|neuroblast division in subventricular zone|positive regulation of neurogenesis	integral to plasma membrane				ovary(2)|central_nervous_system(1)|skin(1)	4				BRCA - Breast invasive adenocarcinoma(234;0.00471)|OV - Ovarian serous cystadenocarcinoma(108;0.161)		aaTAAAGAATCTTACCTTAGT	0.204													4	339	---	---	---	---	PASS
C14orf115	55237	broad.mit.edu	37	14	74823770	74823770	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:74823770G>T	uc001xpw.3	+	2	475	c.284G>T	c.(283-285)TGG>TTG	p.W95L		NM_018228	NP_060698	Q9H8Y1	VRTN_HUMAN	hypothetical protein LOC55237	95					transposition, DNA-mediated		DNA binding|transposase activity				0				BRCA - Breast invasive adenocarcinoma(234;0.00147)		ATGCTGCTGTGGGGTGACGCA	0.637													8	65	---	---	---	---	PASS
FOS	2353	broad.mit.edu	37	14	75747808	75747808	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75747808C>A	uc001xrn.2	+	4	1029	c.824C>A	c.(823-825)CCA>CAA	p.P275Q	FOS_uc010tva.1_Missense_Mutation_p.P239Q|FOS_uc010asi.2_Missense_Mutation_p.P161Q|FOS_uc001xro.2_Missense_Mutation_p.P127Q	NM_005252	NP_005243	P01100	FOS_HUMAN	v-fos FBJ murine osteosarcoma viral oncogene	275					cellular response to reactive oxygen species|DNA methylation|inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|regulation of sequence-specific DNA binding transcription factor activity|SMAD protein signal transduction|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway|transcription from RNA polymerase II promoter|transforming growth factor beta receptor signaling pathway		protein dimerization activity|R-SMAD binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			lung(2)|ovary(1)	3		all_lung(585;0.0138)|all_epithelial(191;0.0263)|all_neural(303;0.112)		BRCA - Breast invasive adenocarcinoma(234;0.0117)		TTCCTGTTCCCAGCATCATCC	0.582													37	93	---	---	---	---	PASS
C14orf174	161394	broad.mit.edu	37	14	77844289	77844289	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77844289C>G	uc001xtq.1	+	1	528	c.528C>G	c.(526-528)GTC>GTG	p.V176V	TMED8_uc010ast.1_5'Flank|TMED8_uc001xto.1_5'Flank	NM_001010860	NP_001010860	Q9P1V8	SAM15_HUMAN	hypothetical protein LOC161394	176											0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0278)		GGGCCACAGTCAGAGAGAGAA	0.488													4	219	---	---	---	---	PASS
NDUFB1	4707	broad.mit.edu	37	14	92588099	92588099	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:92588099G>A	uc001yaf.2	-	1	55	c.23C>T	c.(22-24)TCT>TTT	p.S8F	NDUFB1_uc001yag.1_RNA|CPSF2_uc001yah.1_5'Flank	NM_004545	NP_004536	O75438	NDUB1_HUMAN	NADH dehydrogenase (ubiquinone) 1 beta	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					mitochondrial electron transport, NADH to ubiquinone|transport	integral to membrane|mitochondrial respiratory chain complex I	NADH dehydrogenase (ubiquinone) activity				0		all_cancers(154;0.0766)		COAD - Colon adenocarcinoma(157;0.205)	NADH(DB00157)	GCACGGAGCAGAGGGGTGACG	0.532													19	120	---	---	---	---	PASS
SERPINA13	388007	broad.mit.edu	37	14	95107883	95107883	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95107883C>A	uc001ydt.2	+	2	488	c.400C>A	c.(400-402)CCA>ACA	p.P134T		NR_015340				RecName: Full=Serpin A13; Flags: Precursor;											lung(1)|skin(1)	2						TCTCTTCTCCCCAGTGAGCAT	0.592													6	17	---	---	---	---	PASS
DICER1	23405	broad.mit.edu	37	14	95578573	95578573	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95578573C>G	uc001ydw.2	-	14	2234	c.2052G>C	c.(2050-2052)ATG>ATC	p.M684I	DICER1_uc001ydv.2_Missense_Mutation_p.M674I|DICER1_uc001ydx.2_Missense_Mutation_p.M684I	NM_030621	NP_085124	Q9UPY3	DICER_HUMAN	dicer1	684	Dicer dsRNA-binding fold.				negative regulation of Schwann cell proliferation|negative regulation of transcription from RNA polymerase II promoter|nerve development|neuron projection morphogenesis|peripheral nervous system myelin formation|positive regulation of myelination|positive regulation of Schwann cell differentiation|pre-miRNA processing|production of siRNA involved in RNA interference|targeting of mRNA for destruction involved in RNA interference	cytosol|RNA-induced silencing complex	ATP binding|ATP-dependent helicase activity|double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity			skin(2)|ovary(1)|pancreas(1)|lung(1)	5		all_cancers(154;0.0621)|all_epithelial(191;0.223)		Epithelial(152;0.211)|COAD - Colon adenocarcinoma(157;0.215)		GTACACAGCTCATTGGTGGAC	0.388			Mis F|N			pleuropulmonary blastoma			DICER_1_syndrome_|Familial_Multinodular_Goiter_				6	152	---	---	---	---	PASS
DICER1	23405	broad.mit.edu	37	14	95582871	95582871	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95582871G>C	uc001ydw.2	-	11	1853	c.1671C>G	c.(1669-1671)ATC>ATG	p.I557M	DICER1_uc001ydv.2_Missense_Mutation_p.I547M|DICER1_uc001ydx.2_Missense_Mutation_p.I557M	NM_030621	NP_085124	Q9UPY3	DICER_HUMAN	dicer1	557	Helicase C-terminal.|Required for interaction with PRKRA and TARBP2.				negative regulation of Schwann cell proliferation|negative regulation of transcription from RNA polymerase II promoter|nerve development|neuron projection morphogenesis|peripheral nervous system myelin formation|positive regulation of myelination|positive regulation of Schwann cell differentiation|pre-miRNA processing|production of siRNA involved in RNA interference|targeting of mRNA for destruction involved in RNA interference	cytosol|RNA-induced silencing complex	ATP binding|ATP-dependent helicase activity|double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity			skin(2)|ovary(1)|pancreas(1)|lung(1)	5		all_cancers(154;0.0621)|all_epithelial(191;0.223)		Epithelial(152;0.211)|COAD - Colon adenocarcinoma(157;0.215)		TATAATTAGAGATGGGTGCCC	0.348			Mis F|N			pleuropulmonary blastoma			DICER_1_syndrome_|Familial_Multinodular_Goiter_				58	348	---	---	---	---	PASS
CLMN	79789	broad.mit.edu	37	14	95696401	95696401	+	Intron	SNP	G	A	A	rs138831842	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95696401G>A	uc001yef.2	-							NM_024734	NP_079010	Q96JQ2	CLMN_HUMAN	calmin							integral to membrane	actin binding				0				Epithelial(152;0.193)		ACCCAAGTGCGCCATTACCTT	0.433													5	158	---	---	---	---	PASS
C14orf49	161176	broad.mit.edu	37	14	95912339	95912339	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95912339C>G	uc001yei.3	-	8	1554	c.1539G>C	c.(1537-1539)GAG>GAC	p.E513D	C14orf49_uc010avi.2_Missense_Mutation_p.E513D|C14orf49_uc001yej.1_Missense_Mutation_p.E513D	NM_152592	NP_689805	Q6ZMZ3	SYNE3_HUMAN	nesprin-3	513	Cytoplasmic (Potential).				cytoskeletal anchoring at nuclear membrane	integral to membrane|nuclear outer membrane|SUN-KASH complex	actin binding			central_nervous_system(1)	1		all_cancers(154;0.0937)		COAD - Colon adenocarcinoma(157;0.245)		CCGTGGCTCTCTCCTGGCCAA	0.577													135	172	---	---	---	---	PASS
C14orf49	161176	broad.mit.edu	37	14	95932538	95932538	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95932538C>G	uc001yei.3	-	3	372	c.357G>C	c.(355-357)CTG>CTC	p.L119L	C14orf49_uc010avi.2_Silent_p.L119L|C14orf49_uc001yej.1_Silent_p.L119L	NM_152592	NP_689805	Q6ZMZ3	SYNE3_HUMAN	nesprin-3	119	Cytoplasmic (Potential).				cytoskeletal anchoring at nuclear membrane	integral to membrane|nuclear outer membrane|SUN-KASH complex	actin binding			central_nervous_system(1)	1		all_cancers(154;0.0937)		COAD - Colon adenocarcinoma(157;0.245)		CTCGGGCCAGCAGGTACTCGC	0.627													26	49	---	---	---	---	PASS
DEGS2	123099	broad.mit.edu	37	14	100615443	100615443	+	Silent	SNP	G	A	A	rs145891510		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:100615443G>A	uc001ygx.2	-	2	775	c.687C>T	c.(685-687)TTC>TTT	p.F229F		NM_206918	NP_996801	Q6QHC5	DEGS2_HUMAN	degenerative spermatocyte homolog 2, lipid	229	Helical; (Potential).				fatty acid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	sphingosine hydroxylase activity				0		Melanoma(154;0.212)				GCTCGGCCACGAAGTGGCCCG	0.622													86	116	---	---	---	---	PASS
DLK1	8788	broad.mit.edu	37	14	101201015	101201015	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:101201015G>A	uc001yhs.3	+	5	1087	c.934G>A	c.(934-936)GTG>ATG	p.V312M	DLK1_uc001yhu.3_Missense_Mutation_p.V239M	NM_003836	NP_003827	P80370	DLK1_HUMAN	delta-like 1 homolog precursor	312	Helical; (Potential).				multicellular organismal development	extracellular space|integral to membrane|soluble fraction				ovary(2)|breast(1)|skin(1)	4		Melanoma(154;0.155)				CATCCTGGGCGTGCTCACCAG	0.597													32	173	---	---	---	---	PASS
PPP2R5C	5527	broad.mit.edu	37	14	102391487	102391487	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:102391487G>C	uc001yko.2	+	14	1593	c.1453G>C	c.(1453-1455)GAT>CAT	p.D485H	PPP2R5C_uc010txr.1_Missense_Mutation_p.D516H|PPP2R5C_uc001ykk.2_Missense_Mutation_p.D501H|PPP2R5C_uc001ykp.2_Missense_Mutation_p.D446H	NM_002719	NP_002710	Q13362	2A5G_HUMAN	gamma isoform of regulatory subunit B56, protein	485					DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|negative regulation of cell proliferation|proteasomal ubiquitin-dependent protein catabolic process|signal transduction	chromosome, centromeric region|nucleus|protein phosphatase type 2A complex	protein binding|protein binding|protein phosphatase type 2A regulator activity|protein phosphatase type 2A regulator activity			ovary(1)|breast(1)	2						GGCACAGAAAGATCCGAAGAA	0.522													74	433	---	---	---	---	PASS
DYNC1H1	1778	broad.mit.edu	37	14	102498736	102498736	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:102498736G>T	uc001yks.2	+	52	10175	c.10011G>T	c.(10009-10011)CAG>CAT	p.Q3337H		NM_001376	NP_001367	Q14204	DYHC1_HUMAN	cytoplasmic dynein 1 heavy chain 1	3337	Stalk (By similarity).				cytoplasmic mRNA processing body assembly|G2/M transition of mitotic cell cycle|microtubule-based movement|mitotic spindle organization|stress granule assembly|transport	centrosome|cytoplasmic dynein complex|cytosol|Golgi apparatus|microtubule	ATP binding|ATPase activity, coupled|microtubule motor activity|protein binding			ovary(7)|central_nervous_system(2)|pancreas(1)	10						ACTGGAAGCAGATCCGCTCCA	0.572													8	224	---	---	---	---	PASS
CDC42BPB	9578	broad.mit.edu	37	14	103470347	103470347	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103470347C>T	uc001ymi.1	-	4	597	c.365G>A	c.(364-366)CGA>CAA	p.R122Q		NM_006035	NP_006026	Q9Y5S2	MRCKB_HUMAN	CDC42-binding protein kinase beta	122	Protein kinase.				actin cytoskeleton reorganization|establishment or maintenance of cell polarity|intracellular signal transduction	cell leading edge|cell-cell junction|cytoplasm|cytoskeleton	ATP binding|magnesium ion binding|protein serine/threonine kinase activity|small GTPase regulator activity			large_intestine(3)|skin(3)|lung(2)|stomach(1)|breast(1)|ovary(1)	11		Melanoma(154;0.155)		Colorectal(3;0.0129)|READ - Rectum adenocarcinoma(2;0.0419)|Epithelial(152;0.0474)|all cancers(159;0.199)		GCGCTCCTCTCGGAAGCACGC	0.627													6	43	---	---	---	---	PASS
CRIP2	1397	broad.mit.edu	37	14	105945519	105945519	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:105945519G>T	uc001yrd.1	+	6	533	c.464G>T	c.(463-465)CGC>CTC	p.R155L	CRIP2_uc010tyr.1_Missense_Mutation_p.R229L|CRIP2_uc001yre.1_Missense_Mutation_p.R155L|CRIP2_uc001yrf.1_RNA|CRIP2_uc001yrg.2_RNA|CRIP2_uc001yrh.1_RNA	NM_001312	NP_001303	P52943	CRIP2_HUMAN	cysteine-rich protein 2	155	LIM zinc-binding 2.						zinc ion binding				0		Melanoma(154;0.226)	OV - Ovarian serous cystadenocarcinoma(23;0.00897)|Epithelial(46;0.026)	Epithelial(152;0.235)		CGCTGCGAGCGCTGCGGGAAG	0.687													5	19	---	---	---	---	PASS
ADAM6	8755	broad.mit.edu	37	14	106518709	106518709	+	Intron	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:106518709A>G	uc010tyt.1	-											Parts of antibodies, mostly variable regions.												0						GGACACCTGCAAACAAAGAGA	0.527													30	180	---	---	---	---	PASS
OR4N4	283694	broad.mit.edu	37	15	22382511	22382511	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22382511C>A	uc001yuc.1	+	7	1020	c.39C>A	c.(37-39)ATC>ATA	p.I13I	LOC727924_uc001yub.1_RNA|OR4N4_uc010tzv.1_Silent_p.I13I	NM_001005241	NP_001005241	Q8N0Y3	OR4N4_HUMAN	olfactory receptor, family 4, subfamily N,	13	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(4)|skin(1)	5		all_cancers(20;1.94e-20)|all_epithelial(15;3.94e-18)|Lung NSC(15;8.53e-15)|all_lung(15;2.87e-14)|Breast(32;0.00519)|Colorectal(260;0.101)	GBM - Glioblastoma multiforme(6;0.124)	all cancers(64;1.64e-11)|Epithelial(43;5.81e-10)|BRCA - Breast invasive adenocarcinoma(123;0.000255)|Kidney(6;0.00736)|KIRC - Kidney renal clear cell carcinoma(6;0.0135)|GBM - Glioblastoma multiforme(186;0.0963)		CAGAATTTATCCTCCTTGGTC	0.343													82	384	---	---	---	---	PASS
SNORD116-4	100033416	broad.mit.edu	37	15	25337003	25337003	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25337003C>T	uc001yxh.1	+						SNORD116-4_uc001yxm.1_Intron|IPW_uc001yxn.3_Intron|SNORD116-28_uc001yxy.2_Intron|IPW_uc001yyb.3_Intron|uc001yyd.2_Intron|SNORD116-23_uc001yyh.2_RNA|SNORD116-24_uc001yyj.2_5'Flank					Homo sapiens clone kid4 SNURF-SNRPN mRNA, downstream untranslated exons, alternatively spliced.												0						TCTATACCGTCGTCCTCGTCA	0.478													9	215	---	---	---	---	PASS
GABRA5	2558	broad.mit.edu	37	15	27182355	27182355	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:27182355G>A	uc001zbd.1	+	9	943	c.604G>A	c.(604-606)GTT>ATT	p.V202I	GABRB3_uc001zbb.2_Intron	NM_000810	NP_000801	P31644	GBRA5_HUMAN	gamma-aminobutyric acid A receptor, alpha 5	202	Extracellular (Potential).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity			ovary(1)	1		all_lung(180;4.59e-13)|Breast(32;0.000563)|Colorectal(260;0.227)		all cancers(64;1.45e-08)|Epithelial(43;4.96e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0232)|Lung(196;0.182)	Alprazolam(DB00404)|Ethchlorvynol(DB00189)|Flunitrazepam(DB01544)|Flurazepam(DB00690)|Lorazepam(DB00186)|Meprobamate(DB00371)|Midazolam(DB00683)	TTCTGAAGTCGTTTACGTCTG	0.512													39	112	---	---	---	---	PASS
GABRG3	2567	broad.mit.edu	37	15	27572057	27572057	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:27572057G>T	uc001zbg.1	+	4	538	c.372G>T	c.(370-372)GGG>GGT	p.G124G	GABRG3_uc001zbf.2_Silent_p.G124G	NM_033223	NP_150092	Q99928	GBRG3_HUMAN	gamma-aminobutyric acid (GABA) A receptor, gamma	124	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity				0		all_lung(180;4.58e-12)|Breast(32;0.000625)|Colorectal(260;0.235)		all cancers(64;3.15e-07)|Epithelial(43;1.17e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0261)		ACATGGTGGGGTTAATCTGGA	0.458													13	204	---	---	---	---	PASS
OCA2	4948	broad.mit.edu	37	15	28202874	28202874	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28202874C>T	uc001zbh.3	-	16	1754	c.1644G>A	c.(1642-1644)AAG>AAA	p.K548K	OCA2_uc010ayv.2_Silent_p.K524K	NM_000275	NP_000266	Q04671	P_HUMAN	oculocutaneous albinism II	548	Cytoplasmic (Potential).				eye pigment biosynthetic process	endoplasmic reticulum membrane|endosome membrane|integral to membrane|lysosomal membrane|melanosome membrane	arsenite transmembrane transporter activity|citrate transmembrane transporter activity|L-tyrosine transmembrane transporter activity|protein binding			ovary(3)|breast(1)|pancreas(1)	5		all_lung(180;2.93e-12)|Breast(32;0.000315)|Colorectal(260;0.234)		all cancers(64;5.03e-07)|Epithelial(43;2.13e-06)|BRCA - Breast invasive adenocarcinoma(123;0.045)		GAATCTCGTGCTTCAGTTCTG	0.612									Oculocutaneous_Albinism				7	62	---	---	---	---	PASS
HERC2	8924	broad.mit.edu	37	15	28491051	28491051	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28491051C>T	uc001zbj.2	-	23	3659	c.3553G>A	c.(3553-3555)GAG>AAG	p.E1185K		NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2	1185					DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)		CAGGCTAACTCTTCATGATCA	0.478													22	108	---	---	---	---	PASS
APBA2	321	broad.mit.edu	37	15	29367139	29367139	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:29367139G>T	uc001zck.2	+	4	1174	c.967G>T	c.(967-969)GAG>TAG	p.E323*	APBA2_uc010azj.2_Nonsense_Mutation_p.E323*|APBA2_uc010uat.1_Nonsense_Mutation_p.E323*|APBA2_uc001zcl.2_Nonsense_Mutation_p.E323*|APBA2_uc001zcm.1_Nonsense_Mutation_p.E27*	NM_005503	NP_005494	Q99767	APBA2_HUMAN	amyloid beta A4 precursor protein-binding,	323					nervous system development|protein transport		protein binding				0		all_lung(180;1.73e-12)|Breast(32;2.89e-05)|Colorectal(260;0.234)		all cancers(64;7.44e-11)|Epithelial(43;5.74e-10)|GBM - Glioblastoma multiforme(186;0.026)|BRCA - Breast invasive adenocarcinoma(123;0.0286)|Lung(196;0.24)		CAATGGTCTGGAGCAGCCAAG	0.413													8	56	---	---	---	---	PASS
SCG5	6447	broad.mit.edu	37	15	32935813	32935813	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:32935813C>G	uc001zha.2	+	2	137	c.20C>G	c.(19-21)TCT>TGT	p.S7C	SCG5_uc001zgz.2_Missense_Mutation_p.S7C	NM_001144757	NP_001138229	P05408	7B2_HUMAN	secretogranin V isoform 1	7					intracellular protein transport|neuropeptide signaling pathway|peptide hormone processing|regulation of hormone secretion	extracellular region|stored secretory granule	enzyme inhibitor activity|GTP binding|unfolded protein binding				0		all_lung(180;7.32e-08)		all cancers(64;6.48e-17)|Epithelial(43;1.23e-11)|GBM - Glioblastoma multiforme(186;1.39e-05)|BRCA - Breast invasive adenocarcinoma(123;0.0212)		AGGATGGTCTCTACCATGCTA	0.463													70	201	---	---	---	---	PASS
RYR3	6263	broad.mit.edu	37	15	33895559	33895559	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:33895559T>G	uc001zhi.2	+	18	2228	c.2158T>G	c.(2158-2160)TGG>GGG	p.W720G	RYR3_uc010bar.2_Missense_Mutation_p.W720G	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	720	Cytoplasmic (By similarity).|B30.2/SPRY 1.				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)		ACTTCACCTTTGGTCAGGTGA	0.468													101	327	---	---	---	---	PASS
C15orf55	256646	broad.mit.edu	37	15	34647258	34647258	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34647258C>G	uc001zif.2	+	6	1470	c.1315C>G	c.(1315-1317)CTG>GTG	p.L439V	C15orf55_uc010ucc.1_Missense_Mutation_p.L467V|C15orf55_uc010ucd.1_Missense_Mutation_p.L457V	NM_175741	NP_786883	Q86Y26	NUT_HUMAN	nuclear protein in testis	439						cytoplasm|nucleus			BRD4_ENST00000263377/C15orf55(24)|BRD3/C15orf55(3)	midline_organs(25)|ovary(2)|lung(2)|skin(1)	30		all_lung(180;2.78e-08)		all cancers(64;4.53e-18)|GBM - Glioblastoma multiforme(113;8.29e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0249)		TCTGGCAGATCTGCTGTCCCC	0.473			T	BRD3|BRD4	lethal midline carcinoma								32	175	---	---	---	---	PASS
MEIS2	4212	broad.mit.edu	37	15	37387754	37387754	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:37387754G>C	uc001zjr.2	-						MEIS2_uc001zjl.2_Intron|MEIS2_uc010ucj.1_Intron|MEIS2_uc001zjm.2_Intron|MEIS2_uc001zjn.2_Intron|MEIS2_uc001zjo.2_Intron|MEIS2_uc001zjp.2_Intron|MEIS2_uc001zjs.2_Intron|MEIS2_uc001zju.2_Intron|MEIS2_uc001zjt.2_Intron	NM_170675	NP_733775	O14770	MEIS2_HUMAN	Meis homeobox 2 isoform c						negative regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(2)	2		all_epithelial(112;9.77e-14)|Lung NSC(122;1.42e-09)|all_lung(180;2.2e-08)|Ovarian(310;0.134)|Melanoma(134;0.155)		all cancers(64;9.33e-21)|GBM - Glioblastoma multiforme(113;1.71e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0288)		ACAAGGAACAGAGAGCCTTAC	0.502													9	77	---	---	---	---	PASS
C15orf57	90416	broad.mit.edu	37	15	40849575	40849575	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40849575G>C	uc001zmc.1	-						uc001zlx.1_RNA|C15orf57_uc001zly.2_Intron|C15orf57_uc001zma.1_Intron|C15orf57_uc001zmb.1_Intron|C15orf57_uc010bbr.2_Intron	NM_001080792	NP_001074261	Q9BV29	CO057_HUMAN	coiled-coil domain containing 32 isoform a											ovary(1)	1						TTCTTCTCTAGAGAGAGAAGT	0.383													11	86	---	---	---	---	PASS
CHP	11261	broad.mit.edu	37	15	41555038	41555038	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41555038G>A	uc001znl.2	+	4	450	c.306G>A	c.(304-306)GTG>GTA	p.V102V		NM_007236	NP_009167	Q99653	CHP1_HUMAN	calcium binding protein P22	102					potassium ion transport|small GTPase mediated signal transduction		potassium channel regulator activity			ovary(1)	1		all_cancers(109;1.19e-18)|all_epithelial(112;5.87e-16)|Lung NSC(122;8.86e-12)|all_lung(180;2.47e-10)|Melanoma(134;0.0574)|Colorectal(260;0.0946)|Ovarian(310;0.143)		GBM - Glioblastoma multiforme(113;1.68e-06)|LUSC - Lung squamous cell carcinoma(244;0.008)|Lung(196;0.00802)|BRCA - Breast invasive adenocarcinoma(123;0.169)		GCAAAGATGTGAATGGACCCG	0.413													35	107	---	---	---	---	PASS
RPAP1	26015	broad.mit.edu	37	15	41812753	41812753	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41812753A>T	uc001zod.2	-	22	3755	c.3631T>A	c.(3631-3633)TAT>AAT	p.Y1211N	RPAP1_uc001zoc.2_Missense_Mutation_p.Y230N	NM_015540	NP_056355	Q9BWH6	RPAP1_HUMAN	RNA polymerase II associated protein 1	1211	Leu-rich.					nucleus	DNA binding|DNA-directed RNA polymerase activity			large_intestine(1)	1		all_cancers(109;6.59e-20)|all_epithelial(112;7.67e-17)|Lung NSC(122;5.34e-11)|all_lung(180;4.17e-10)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.173)		OV - Ovarian serous cystadenocarcinoma(18;2.84e-17)|GBM - Glioblastoma multiforme(113;1.68e-06)|Colorectal(105;0.0163)|BRCA - Breast invasive adenocarcinoma(123;0.117)		AAGTTGGCATAGAGGTCAGGG	0.592													9	51	---	---	---	---	PASS
JMJD7-PLA2G4B	8681	broad.mit.edu	37	15	42139651	42139651	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42139651C>T	uc010bco.2	+	19	2165	c.2064C>T	c.(2062-2064)ACC>ACT	p.T688T	JMJD7-PLA2G4B_uc001zoo.3_Silent_p.T919T|JMJD7-PLA2G4B_uc010bcn.2_Intron|JMJD7-PLA2G4B_uc001zoq.3_Silent_p.T389T	NM_001114633	NP_001108105	P0C869	PA24B_HUMAN	phospholipase A2, group IVB	688	PLA2c.				arachidonic acid metabolic process|calcium-mediated signaling|glycerophospholipid catabolic process|inflammatory response|parturition	cytosol|early endosome membrane|extracellular region|mitochondrial membrane	calcium ion binding|calcium-dependent phospholipase A2 activity|calcium-dependent phospholipid binding|lysophospholipase activity			large_intestine(1)	1						CCGACCCCACCTGCCCCGGAG	0.677													11	180	---	---	---	---	PASS
SPTBN5	51332	broad.mit.edu	37	15	42178428	42178428	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42178428C>T	uc001zos.2	-	7	1253	c.920G>A	c.(919-921)CGG>CAG	p.R307Q		NM_016642	NP_057726	Q9NRC6	SPTN5_HUMAN	spectrin, beta, non-erythrocytic 5	342	Spectrin 1.				actin cytoskeleton organization|actin filament capping|axon guidance	cytosol|membrane|spectrin				ovary(1)|central_nervous_system(1)	2		all_cancers(109;1.84e-17)|all_epithelial(112;1.12e-15)|Lung NSC(122;7.6e-10)|all_lung(180;4.15e-09)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.173)		all cancers(2;4.33e-34)|Epithelial(2;1.72e-25)|OV - Ovarian serous cystadenocarcinoma(18;8.32e-20)|GBM - Glioblastoma multiforme(94;4.69e-07)|Colorectal(2;0.00104)|COAD - Colon adenocarcinoma(120;0.0405)|READ - Rectum adenocarcinoma(92;0.0908)		CAGTAGCTGCCGCATGGCGGG	0.632													6	17	---	---	---	---	PASS
ZFP106	64397	broad.mit.edu	37	15	42727711	42727711	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42727711C>T	uc001zpw.2	-	11	5018	c.4683G>A	c.(4681-4683)CGG>CGA	p.R1561R	ZFP106_uc001zpu.2_Silent_p.R659R|ZFP106_uc001zpv.2_Silent_p.R746R|ZFP106_uc001zpx.2_Silent_p.R789R	NM_022473	NP_071918	Q9H2Y7	ZF106_HUMAN	zinc finger protein 106 homolog	1561	WD 1.					nucleolus	zinc ion binding			central_nervous_system(2)|ovary(1)	3		all_cancers(109;1.63e-12)|all_epithelial(112;3.97e-11)|Lung NSC(122;2.04e-07)|all_lung(180;8.31e-07)|Melanoma(134;0.091)		GBM - Glioblastoma multiforme(94;8.6e-07)		CAATACATTTCCGACTCTAAA	0.398													12	196	---	---	---	---	PASS
CDAN1	146059	broad.mit.edu	37	15	43026155	43026155	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43026155G>A	uc001zql.2	-	8	1465	c.1348C>T	c.(1348-1350)CAT>TAT	p.H450Y	CDAN1_uc001zqk.2_5'UTR|CDAN1_uc010bcx.1_RNA	NM_138477	NP_612486	Q8IWY9	CDAN1_HUMAN	codanin 1	450						integral to membrane	protein binding			ovary(2)	2		all_cancers(109;5.4e-16)|all_epithelial(112;2.97e-14)|Lung NSC(122;1.75e-08)|all_lung(180;5.99e-08)|Melanoma(134;0.0179)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;2.49e-07)		TTAAAAGTATGAAAGGCTCGG	0.433													13	51	---	---	---	---	PASS
ZSCAN29	146050	broad.mit.edu	37	15	43662016	43662016	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43662016C>T	uc001zrk.1	-	1	243	c.96G>A	c.(94-96)CCG>CCA	p.P32P	ZSCAN29_uc001zrj.1_5'Flank|ZSCAN29_uc010bdf.1_Silent_p.P31P|ZSCAN29_uc001zrl.1_RNA|ZSCAN29_uc010bdg.1_Silent_p.P31P|ZSCAN29_uc001zrm.2_Silent_p.P31P|TUBGCP4_uc001zrn.2_5'Flank|TUBGCP4_uc001zro.2_5'Flank	NM_152455	NP_689668	Q8IWY8	ZSC29_HUMAN	zinc finger protein 690	32	SCAN box.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(1)	1		all_cancers(109;2.12e-14)|all_epithelial(112;1.99e-12)|Lung NSC(122;2.46e-08)|all_lung(180;2.75e-07)|Melanoma(134;0.0476)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;8.97e-07)		AAGCCTCCCGCGGCCCAGCCA	0.532													5	122	---	---	---	---	PASS
WDR76	79968	broad.mit.edu	37	15	44149268	44149268	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:44149268C>T	uc001zti.1	+	10	1339	c.1316C>T	c.(1315-1317)TCT>TTT	p.S439F		NM_024908	NP_079184	Q9H967	WDR76_HUMAN	WD repeat domain 76	439	WD 3.										0		all_cancers(109;3.26e-11)|all_epithelial(112;4.82e-09)|Lung NSC(122;1.61e-06)|all_lung(180;1.5e-05)|Melanoma(134;0.0417)		all cancers(107;3.78e-21)|GBM - Glioblastoma multiforme(94;5.04e-07)		CCTGGAACTTCTTATGAGAAA	0.428													10	132	---	---	---	---	PASS
DUOX1	53905	broad.mit.edu	37	15	45444182	45444182	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45444182G>T	uc001zus.1	+	25	3471	c.3125G>T	c.(3124-3126)CGG>CTG	p.R1042L	DUOX1_uc001zut.1_Missense_Mutation_p.R1042L|DUOX1_uc010bee.1_Missense_Mutation_p.R422L|DUOX1_uc001zuu.2_Missense_Mutation_p.R184L	NM_017434	NP_059130	Q9NRD9	DUOX1_HUMAN	dual oxidase 1 precursor	1042	Cytoplasmic (Potential).|Interaction with TXNDC11 (By similarity).				cuticle development|cytokine-mediated signaling pathway|hormone biosynthetic process|hydrogen peroxide biosynthetic process|hydrogen peroxide catabolic process|response to cAMP|superoxide anion generation	apical plasma membrane|integral to membrane	calcium ion binding|electron carrier activity|flavin adenine dinucleotide binding|heme binding|NAD(P)H oxidase activity|NADP binding|peroxidase activity			ovary(5)|skin(2)|breast(1)	8		all_cancers(109;5.7e-11)|all_epithelial(112;4.65e-09)|Lung NSC(122;3.55e-06)|all_lung(180;2.56e-05)|Melanoma(134;0.027)		all cancers(107;5.77e-18)|GBM - Glioblastoma multiforme(94;5.11e-07)|COAD - Colon adenocarcinoma(120;0.071)|Colorectal(133;0.0717)		GAGAACTACCGGCGCCACATC	0.587													3	64	---	---	---	---	PASS
SLC30A4	7782	broad.mit.edu	37	15	45779760	45779760	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45779760C>T	uc001zvj.2	-	6	1277	c.965G>A	c.(964-966)CGA>CAA	p.R322Q		NM_013309	NP_037441	O14863	ZNT4_HUMAN	solute carrier family 30 (zinc transporter),	322	Helical; (Potential).				regulation of sequestering of zinc ion|response to toxin	endosome membrane|integral to membrane|late endosome	zinc ion transmembrane transporter activity				0		Lung NSC(122;3.55e-06)|all_lung(180;2.56e-05)|Melanoma(134;0.027)		all cancers(107;1.58e-16)|GBM - Glioblastoma multiforme(94;2.15e-06)		CCATATGATTCGAAATGTTGT	0.348													55	123	---	---	---	---	PASS
SLC12A1	6557	broad.mit.edu	37	15	48541786	48541786	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48541786A>G	uc001zwn.3	+	14	1915	c.1699A>G	c.(1699-1701)ATT>GTT	p.I567V	SLC12A1_uc010uew.1_Missense_Mutation_p.I373V|SLC12A1_uc010bem.2_Missense_Mutation_p.I567V|SLC12A1_uc001zwq.3_Missense_Mutation_p.I338V|SLC12A1_uc001zwr.3_Missense_Mutation_p.I294V	NM_000338	NP_000329	Q13621	S12A1_HUMAN	sodium potassium chloride cotransporter 2	567	Helical; (Potential).				potassium ion transport|sodium ion transport	integral to membrane|membrane fraction	sodium:potassium:chloride symporter activity			ovary(1)|central_nervous_system(1)	2		all_lung(180;0.00219)		all cancers(107;1.76e-09)|GBM - Glioblastoma multiforme(94;1.48e-06)	Bumetanide(DB00887)|Chlormerodrin(DB00534)|Chlorthalidone(DB00310)|Ethacrynic acid(DB00903)|Furosemide(DB00695)|Hydroflumethiazide(DB00774)|Methyclothiazide(DB00232)|Metolazone(DB00524)|Potassium Chloride(DB00761)|Torasemide(DB00214)|Trichlormethiazide(DB01021)	ACTGAACACCATTGCTCCCAT	0.433													29	104	---	---	---	---	PASS
SLC12A1	6557	broad.mit.edu	37	15	48591428	48591428	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48591428C>A	uc001zwn.3	+	25	3268	c.3052C>A	c.(3052-3054)CCG>ACG	p.P1018T	SLC12A1_uc001zwq.3_Missense_Mutation_p.P789T|SLC12A1_uc001zwr.3_Missense_Mutation_p.P745T	NM_000338	NP_000329	Q13621	S12A1_HUMAN	sodium potassium chloride cotransporter 2	1018	Cytoplasmic (Potential).				potassium ion transport|sodium ion transport	integral to membrane|membrane fraction	sodium:potassium:chloride symporter activity			ovary(1)|central_nervous_system(1)	2		all_lung(180;0.00219)		all cancers(107;1.76e-09)|GBM - Glioblastoma multiforme(94;1.48e-06)	Bumetanide(DB00887)|Chlormerodrin(DB00534)|Chlorthalidone(DB00310)|Ethacrynic acid(DB00903)|Furosemide(DB00695)|Hydroflumethiazide(DB00774)|Methyclothiazide(DB00232)|Metolazone(DB00524)|Potassium Chloride(DB00761)|Torasemide(DB00214)|Trichlormethiazide(DB01021)	AAGAGAAACTCCGTGGAAAAT	0.353													12	29	---	---	---	---	PASS
TRPM7	54822	broad.mit.edu	37	15	50904981	50904981	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:50904981C>T	uc001zyt.3	-	16	2080	c.1816G>A	c.(1816-1818)GAA>AAA	p.E606K	TRPM7_uc010bew.1_Missense_Mutation_p.E606K|TRPM7_uc001zyu.2_Missense_Mutation_p.E164K	NM_017672	NP_060142	Q96QT4	TRPM7_HUMAN	transient receptor potential cation channel,	606	Cytoplasmic (Potential).				cell death	integral to membrane	ATP binding|calcium channel activity|metal ion binding|protein serine/threonine kinase activity			ovary(4)|stomach(3)|breast(1)|central_nervous_system(1)|skin(1)	10				all cancers(107;0.000819)|GBM - Glioblastoma multiforme(94;0.0045)		TCTACAATTTCATCTTTGGTT	0.358													25	183	---	---	---	---	PASS
CCPG1	9236	broad.mit.edu	37	15	55651990	55651990	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:55651990G>A	uc002acv.1	-	8	2146	c.1981C>T	c.(1981-1983)CAA>TAA	p.Q661*	CCPG1_uc002acy.2_Nonsense_Mutation_p.Q661*|CCPG1_uc002acu.1_Nonsense_Mutation_p.Q517*|CCPG1_uc002acw.1_Nonsense_Mutation_p.Q386*|CCPG1_uc002acx.2_Intron|CCPG1_uc010bfk.1_Nonsense_Mutation_p.Q661*|CCPG1_uc002acz.1_Nonsense_Mutation_p.Q661*	NM_020739	NP_065790	Q9ULG6	CCPG1_HUMAN	cell cycle progression 1 isoform 2	661	Lumenal (Potential).				cell cycle	integral to membrane				ovary(1)	1				all cancers(107;0.0354)		ATGTACCTTTGAATTATCTGT	0.358													14	80	---	---	---	---	PASS
CCPG1	9236	broad.mit.edu	37	15	55669255	55669255	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:55669255C>T	uc002acv.1	-	5	511	c.346G>A	c.(346-348)GAA>AAA	p.E116K	CCPG1_uc002acy.2_Missense_Mutation_p.E116K|DYX1C1_uc010ugh.1_RNA|CCPG1_uc002acw.1_5'UTR|CCPG1_uc002acx.2_Missense_Mutation_p.E116K|CCPG1_uc010bfk.1_Missense_Mutation_p.E116K|CCPG1_uc002acz.1_Missense_Mutation_p.E116K	NM_020739	NP_065790	Q9ULG6	CCPG1_HUMAN	cell cycle progression 1 isoform 2	116	Cytoplasmic (Potential).|Interaction with MCF2L and SRC (By similarity).				cell cycle	integral to membrane				ovary(1)	1				all cancers(107;0.0354)		TTTCCAATTTCTTCTAACTTA	0.413													30	210	---	---	---	---	PASS
ALDH1A2	8854	broad.mit.edu	37	15	58247467	58247467	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:58247467C>A	uc002aex.2	-	13	1543	c.1485G>T	c.(1483-1485)ATG>ATT	p.M495I	ALDH1A2_uc002aey.2_Missense_Mutation_p.M457I|ALDH1A2_uc010ugv.1_Missense_Mutation_p.M474I|ALDH1A2_uc010ugw.1_Missense_Mutation_p.M466I|ALDH1A2_uc002aew.2_Missense_Mutation_p.M399I	NM_003888	NP_003879	O94788	AL1A2_HUMAN	aldehyde dehydrogenase 1A2 isoform 1	495					negative regulation of cell proliferation|neural tube development|response to cytokine stimulus	nucleus	3-chloroallyl aldehyde dehydrogenase activity|retinal binding|retinal dehydrogenase activity			central_nervous_system(1)	1				GBM - Glioblastoma multiforme(80;0.152)|all cancers(107;0.18)	NADH(DB00157)|Tretinoin(DB00755)|Vitamin A(DB00162)	CAAATTCTCCCCTGAAACACA	0.537													43	152	---	---	---	---	PASS
ALDH1A2	8854	broad.mit.edu	37	15	58247468	58247468	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:58247468C>T	uc002aex.2	-						ALDH1A2_uc002aey.2_Intron|ALDH1A2_uc010ugv.1_Intron|ALDH1A2_uc010ugw.1_Intron|ALDH1A2_uc002aew.2_Intron	NM_003888	NP_003879	O94788	AL1A2_HUMAN	aldehyde dehydrogenase 1A2 isoform 1						negative regulation of cell proliferation|neural tube development|response to cytokine stimulus	nucleus	3-chloroallyl aldehyde dehydrogenase activity|retinal binding|retinal dehydrogenase activity			central_nervous_system(1)	1				GBM - Glioblastoma multiforme(80;0.152)|all cancers(107;0.18)	NADH(DB00157)|Tretinoin(DB00755)|Vitamin A(DB00162)	AAATTCTCCCCTGAAACACAG	0.532													43	154	---	---	---	---	PASS
ADAM10	102	broad.mit.edu	37	15	58925402	58925402	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:58925402C>A	uc002afd.1	-	9	1613	c.1169G>T	c.(1168-1170)GGA>GTA	p.G390V	ADAM10_uc010bgc.1_RNA|ADAM10_uc010ugz.1_Missense_Mutation_p.G89V|ADAM10_uc002afe.1_Intron	NM_001110	NP_001101	O14672	ADA10_HUMAN	ADAM metallopeptidase domain 10 precursor	390	Peptidase M12B.|Extracellular (Potential).				cell-cell signaling|constitutive protein ectodomain proteolysis|epidermal growth factor receptor signaling pathway|in utero embryonic development|integrin-mediated signaling pathway|monocyte activation|negative regulation of cell adhesion|Notch receptor processing|Notch signaling pathway|PMA-inducible membrane protein ectodomain proteolysis|positive regulation of cell growth|positive regulation of cell proliferation|positive regulation of T cell chemotaxis|protein phosphorylation|response to tumor necrosis factor	cell surface|endomembrane system|Golgi-associated vesicle|integral to membrane|nucleus|plasma membrane	integrin binding|metalloendopeptidase activity|protein homodimerization activity|protein kinase binding|SH3 domain binding|zinc ion binding			skin(2)	2				GBM - Glioblastoma multiforme(80;0.202)		TACTGGGGATCCAAAGTTATG	0.318													11	62	---	---	---	---	PASS
MYO1E	4643	broad.mit.edu	37	15	59519720	59519720	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59519720G>C	uc002aga.2	-	7	952	c.580C>G	c.(580-582)CTG>GTG	p.L194V		NM_004998	NP_004989	Q12965	MYO1E_HUMAN	myosin IE	194	Myosin head-like.				actin filament-based movement	myosin complex	actin binding|ATP binding|ATPase activity, coupled|calmodulin binding|microfilament motor activity			central_nervous_system(3)	3				all cancers(107;0.207)		GATTTTTCCAGAAGGAAGTTG	0.443													52	120	---	---	---	---	PASS
GCNT3	9245	broad.mit.edu	37	15	59911741	59911741	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59911741G>A	uc002age.2	+	3	1753	c.1304G>A	c.(1303-1305)GGG>GAG	p.G435E	GCNT3_uc002agd.2_Missense_Mutation_p.G435E	NM_004751	NP_004742	O95395	GCNT3_HUMAN	glucosaminyl (N-acetyl) transferase 3, mucin	435	Lumenal (Potential).				protein O-linked glycosylation	Golgi membrane|integral to membrane|membrane fraction	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity|N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity			ovary(1)|central_nervous_system(1)	2						GCCATCTATGGGACTGAACTT	0.468													32	261	---	---	---	---	PASS
TLN2	83660	broad.mit.edu	37	15	62993335	62993335	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:62993335G>A	uc002alb.3	+	14	1618	c.1618G>A	c.(1618-1620)GAC>AAC	p.D540N		NM_015059	NP_055874	Q9Y4G6	TLN2_HUMAN	talin 2	540					cell adhesion|cell-cell junction assembly|cytoskeletal anchoring at plasma membrane	actin cytoskeleton|cytoplasm|focal adhesion|ruffle|synapse	actin binding|insulin receptor binding|structural constituent of cytoskeleton			ovary(5)|upper_aerodigestive_tract(2)|lung(2)|breast(2)	11						GAACAAAGTCGACGAATCCAA	0.512													10	108	---	---	---	---	PASS
CILP	8483	broad.mit.edu	37	15	65489732	65489732	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65489732C>T	uc002aon.2	-	9	3073	c.2892G>A	c.(2890-2892)CTG>CTA	p.L964L		NM_003613	NP_003604	O75339	CILP1_HUMAN	cartilage intermediate layer protein	964					negative regulation of insulin-like growth factor receptor signaling pathway	extracellular matrix part|extracellular space|proteinaceous extracellular matrix				ovary(4)|pancreas(2)|skin(1)	7						CATTCACTTCCAGTGGCCCCA	0.552													22	103	---	---	---	---	PASS
LRRC49	54839	broad.mit.edu	37	15	71188191	71188191	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:71188191G>C	uc002asw.2	+	3	356	c.109G>C	c.(109-111)GAA>CAA	p.E37Q	LRRC49_uc002asu.2_Missense_Mutation_p.E27Q|LRRC49_uc002asx.2_5'UTR|LRRC49_uc010ukf.1_Missense_Mutation_p.E42Q|LRRC49_uc002asy.2_5'UTR|LRRC49_uc002asz.2_5'UTR	NM_017691	NP_060161	Q8IUZ0	LRC49_HUMAN	leucine rich repeat containing 49	37						cytoplasm|microtubule				ovary(1)	1						TTTTCAGGTTGAATTCAAGCT	0.274													14	89	---	---	---	---	PASS
NEO1	4756	broad.mit.edu	37	15	73418810	73418810	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:73418810C>G	uc002avm.3	+	4	919	c.777C>G	c.(775-777)GTC>GTG	p.V259V	NEO1_uc010ukx.1_Silent_p.V259V|NEO1_uc010uky.1_Silent_p.V259V|NEO1_uc010ukz.1_5'UTR	NM_002499	NP_002490	Q92859	NEO1_HUMAN	neogenin homolog 1 precursor	259	Extracellular (Potential).|Ig-like C2-type 3.				axon guidance|cell adhesion|positive regulation of muscle cell differentiation	Golgi apparatus|integral to plasma membrane|nucleus				pancreas(1)	1						CTCCCTTAGTCAGAGTCATTG	0.363													70	190	---	---	---	---	PASS
NEO1	4756	broad.mit.edu	37	15	73418923	73418923	+	Intron	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:73418923C>A	uc002avm.3	+						NEO1_uc010ukx.1_Intron|NEO1_uc010uky.1_Intron|NEO1_uc010ukz.1_Intron	NM_002499	NP_002490	Q92859	NEO1_HUMAN	neogenin homolog 1 precursor						axon guidance|cell adhesion|positive regulation of muscle cell differentiation	Golgi apparatus|integral to plasma membrane|nucleus				pancreas(1)	1						TAAGTGTTGTCTGCCTAAAAG	0.383													28	83	---	---	---	---	PASS
STOML1	9399	broad.mit.edu	37	15	74281457	74281457	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:74281457G>T	uc002awe.2	-	3	453	c.382C>A	c.(382-384)CCC>ACC	p.P128T	STOML1_uc002awf.2_Missense_Mutation_p.P128T|STOML1_uc010bje.2_Missense_Mutation_p.P128T|STOML1_uc010uld.1_Missense_Mutation_p.P86T|STOML1_uc002awh.2_Intron|STOML1_uc002awg.2_Intron|STOML1_uc002awi.2_Missense_Mutation_p.P41T	NM_004809	NP_004800	Q9UBI4	STML1_HUMAN	stomatin (EPB72)-like 1	128	Cytoplasmic (Potential).					integral to membrane	sterol binding			skin(1)	1						ACCTTGCAGGGAGGGACGTTG	0.597													6	87	---	---	---	---	PASS
MAN2C1	4123	broad.mit.edu	37	15	75655061	75655061	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75655061C>G	uc002baf.2	-	7	836	c.819G>C	c.(817-819)GTG>GTC	p.V273V	MAN2C1_uc002bag.2_Silent_p.V273V|MAN2C1_uc002bah.2_Silent_p.V273V|MAN2C1_uc010bkk.2_Intron|MAN2C1_uc010umi.1_Silent_p.V55V|MAN2C1_uc010umj.1_RNA	NM_006715	NP_006706	Q9NTJ4	MA2C1_HUMAN	mannosidase, alpha, class 2C, member 1	273					mannose metabolic process		alpha-mannosidase activity|carbohydrate binding|protein binding|zinc ion binding				0						CACATTTCCTCACAGTCTCTT	0.622													10	60	---	---	---	---	PASS
SCAPER	49855	broad.mit.edu	37	15	76668498	76668498	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:76668498C>G	uc002bby.2	-						SCAPER_uc010bkr.2_Intron|SCAPER_uc002bbx.2_Intron	NM_020843	NP_065894	Q9BY12	SCAPE_HUMAN	S-phase cyclin A-associated protein in the ER							endoplasmic reticulum|nucleus	zinc ion binding			large_intestine(1)|lung(1)|ovary(1)	3						TCCAGGGCCTCTTACCTGGTT	0.542													13	84	---	---	---	---	PASS
DNAJA4	55466	broad.mit.edu	37	15	78563008	78563008	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:78563008G>C	uc002bdj.1	+	2	419	c.302G>C	c.(301-303)AGA>ACA	p.R101T	DNAJA4_uc002bdi.2_Missense_Mutation_p.R130T|DNAJA4_uc002bdk.2_Missense_Mutation_p.R74T|DNAJA4_uc002bdl.2_Missense_Mutation_p.R16T	NM_001130182	NP_001123654	Q8WW22	DNJA4_HUMAN	DnaJ (Hsp40) homolog, subfamily A, member 4	101					protein folding|response to heat	membrane	ATP binding|heat shock protein binding|metal ion binding|unfolded protein binding			skin(1)	1						CGGATGGCTAGAGAGAGAAGA	0.428													38	112	---	---	---	---	PASS
CHRNB4	1143	broad.mit.edu	37	15	78921717	78921717	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:78921717G>A	uc002bed.1	-	5	1042	c.930C>T	c.(928-930)ATC>ATT	p.I310I	CHRNB4_uc002bee.1_Intron|CHRNB4_uc010blh.1_Silent_p.I128I	NM_000750	NP_000741	P30926	ACHB4_HUMAN	cholinergic receptor, nicotinic, beta 4	310	Helical; (Potential).				regulation of neurotransmitter secretion|synaptic transmission involved in micturition|synaptic transmission, cholinergic	cell junction|nicotinic acetylcholine-gated receptor-channel complex|postsynaptic membrane	acetylcholine receptor activity|nicotinic acetylcholine-activated cation-selective channel activity				0						CGCTGGTGACGATGGAGAAGG	0.597													14	76	---	---	---	---	PASS
KIAA1024	23251	broad.mit.edu	37	15	79749984	79749984	+	Missense_Mutation	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:79749984A>C	uc002bew.1	+	2	1570	c.1495A>C	c.(1495-1497)AGT>CGT	p.S499R	KIAA1024_uc010unk.1_Missense_Mutation_p.S499R	NM_015206	NP_056021	Q9UPX6	K1024_HUMAN	hypothetical protein LOC23251	499						integral to membrane				pancreas(2)|ovary(1)|central_nervous_system(1)	4						GGGCAAGTACAGTGACAGGCA	0.532													23	59	---	---	---	---	PASS
FAH	2184	broad.mit.edu	37	15	80465390	80465390	+	Silent	SNP	C	T	T	rs145851627		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:80465390C>T	uc002bfj.2	+	10	823	c.741C>T	c.(739-741)CTC>CTT	p.L247L	FAH_uc002bfk.1_Silent_p.L247L|FAH_uc002bfm.1_Silent_p.L247L|FAH_uc002bfn.1_Silent_p.L177L	NM_000137	NP_000128	P16930	FAAA_HUMAN	fumarylacetoacetase	247					L-phenylalanine catabolic process|tyrosine catabolic process	cytosol	fumarylacetoacetase activity|metal ion binding				0						ATGTCCCTCTCGGGCCATTCC	0.572									Tyrosinemia_type_1		OREG0023354	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	44	192	---	---	---	---	PASS
ADAMTSL3	57188	broad.mit.edu	37	15	84651319	84651319	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:84651319A>T	uc002bjz.3	+	21	3163	c.2939A>T	c.(2938-2940)TAC>TTC	p.Y980F	ADAMTSL3_uc010bmt.1_Missense_Mutation_p.Y980F|ADAMTSL3_uc010bmu.1_Missense_Mutation_p.Y980F	NM_207517	NP_997400	P82987	ATL3_HUMAN	ADAMTS-like 3 precursor	980	Ig-like C2-type 1.					proteinaceous extracellular matrix	metallopeptidase activity|zinc ion binding			ovary(6)|central_nervous_system(5)|lung(5)|large_intestine(4)|breast(3)|skin(2)|kidney(1)|pancreas(1)	27			BRCA - Breast invasive adenocarcinoma(143;0.211)			ATCGGCGTGTACCGGTGCATT	0.572													18	105	---	---	---	---	PASS
MRPL46	26589	broad.mit.edu	37	15	89010599	89010599	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:89010599G>C	uc002bmj.2	-	1	35	c.10C>G	c.(10-12)CCC>GCC	p.P4A	MRPL46_uc002bmi.1_5'Flank|MRPL46_uc002bmk.2_Missense_Mutation_p.P4A|MRPS11_uc002bmm.2_5'Flank|MRPS11_uc002bml.2_5'Flank|MRPS11_uc002bmn.2_5'Flank|MRPS11_uc010bnj.2_5'Flank	NM_022163	NP_071446	Q9H2W6	RM46_HUMAN	mitochondrial ribosomal protein L46 precursor	4						mitochondrion|ribosome	hydrolase activity			central_nervous_system(1)	1	Lung NSC(78;0.203)		BRCA - Breast invasive adenocarcinoma(143;0.188)			CGCCTTACGGGCGCCGCCATC	0.672													3	4	---	---	---	---	PASS
RHBDL1	9028	broad.mit.edu	37	16	726323	726323	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:726323C>T	uc002cis.1	+	1	249	c.222C>T	c.(220-222)GGC>GGT	p.G74G	RHBDL1_uc002cir.1_Intron|RHBDL1_uc010uun.1_Intron	NM_003961	NP_003952	O75783	RHBL1_HUMAN	rhomboid protease 1	74					proteolysis|signal transduction	integral to plasma membrane|membrane fraction	calcium ion binding|serine-type endopeptidase activity				0		Hepatocellular(780;0.0218)				TGGCTGGCGGCTCCTCACTGC	0.672													6	6	---	---	---	---	PASS
SSTR5	6755	broad.mit.edu	37	16	1129885	1129885	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1129885G>C	uc002ckq.2	+	1	1105	c.1017G>C	c.(1015-1017)AGG>AGC	p.R339S	LOC146336_uc002cko.2_5'Flank|LOC146336_uc002ckp.1_5'Flank	NM_001053	NP_001044	P35346	SSR5_HUMAN	somatostatin receptor 5	339	Cytoplasmic (Potential).				negative regulation of cell proliferation	integral to plasma membrane	somatostatin receptor activity			lung(1)	1		Hepatocellular(780;0.00369)			Octreotide(DB00104)	GTCCAGACAGGATCCGGCAGC	0.677													3	20	---	---	---	---	PASS
BAIAP3	8938	broad.mit.edu	37	16	1388632	1388632	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1388632G>A	uc002clk.1	+	2	187	c.187G>A	c.(187-189)GAC>AAC	p.D63N	BAIAP3_uc002clj.2_Missense_Mutation_p.D28N|BAIAP3_uc010uuz.1_Missense_Mutation_p.D28N|BAIAP3_uc010uva.1_Missense_Mutation_p.D28N|BAIAP3_uc010uvb.1_Missense_Mutation_p.D63N|BAIAP3_uc010uvc.1_Missense_Mutation_p.D28N	NM_003933	NP_003924	O94812	BAIP3_HUMAN	BAI1-associated protein 3	63					G-protein coupled receptor protein signaling pathway|neurotransmitter secretion		protein C-terminus binding			pancreas(1)	1		Hepatocellular(780;0.0893)				GACTGAGCAGGACCCAGGGAG	0.697													3	12	---	---	---	---	PASS
BAIAP3	8938	broad.mit.edu	37	16	1392908	1392908	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1392908C>T	uc002clk.1	+						BAIAP3_uc002clj.2_Intron|BAIAP3_uc010uuz.1_Intron|BAIAP3_uc010uva.1_Intron|BAIAP3_uc010uvc.1_Intron	NM_003933	NP_003924	O94812	BAIP3_HUMAN	BAI1-associated protein 3						G-protein coupled receptor protein signaling pathway|neurotransmitter secretion		protein C-terminus binding			pancreas(1)	1		Hepatocellular(780;0.0893)				AGACCTCCTCCCCCAGCCCAA	0.672													7	48	---	---	---	---	PASS
HS3ST6	64711	broad.mit.edu	37	16	1961753	1961753	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1961753G>C	uc002cnf.2	-	2	774	c.774C>G	c.(772-774)CTC>CTG	p.L258L		NM_001009606	NP_001009606	C9JH64	C9JH64_HUMAN	heparan sulfate (glucosamine)	258											0						GGGCCTTCTTGAGGCAGGGGA	0.701													14	35	---	---	---	---	PASS
E4F1	1877	broad.mit.edu	37	16	2282589	2282589	+	Intron	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2282589G>T	uc002cpm.2	+						E4F1_uc010bsi.2_Intron|E4F1_uc010bsj.2_Intron	NM_004424	NP_004415	Q66K89	E4F1_HUMAN	p120E4F						cell division|cell proliferation|interspecies interaction between organisms|mitosis|regulation of growth	cytoplasm|nucleoplasm	DNA binding|ligase activity|protein binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription corepressor activity|zinc ion binding			ovary(1)	1						TGAGCTGGCCGCACCTCGGGC	0.711													17	22	---	---	---	---	PASS
MEFV	4210	broad.mit.edu	37	16	3304210	3304210	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3304210C>A	uc002cun.1	-	2	898	c.858G>T	c.(856-858)GGG>GGT	p.G286G		NM_000243	NP_000234	O15553	MEFV_HUMAN	Mediterranean fever protein	286					inflammatory response	cytoplasm|microtubule|microtubule associated complex|nucleus	actin binding|zinc ion binding			central_nervous_system(2)|skin(2)|ovary(1)|lung(1)	6					Colchicine(DB01394)	CCGCAGATGCCCCTCCATCCG	0.418													42	222	---	---	---	---	PASS
VASN	114990	broad.mit.edu	37	16	4431739	4431739	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:4431739C>A	uc002cwj.1	+	2	1016	c.861C>A	c.(859-861)TTC>TTA	p.F287L	CORO7_uc002cwe.2_Intron|CORO7_uc002cwf.2_Intron|CORO7_uc002cwg.3_Intron|CORO7_uc002cwh.3_Intron|CORO7_uc010uxh.1_Intron|CORO7_uc010uxi.1_Intron|CORO7_uc002cwi.1_Intron|CORO7_uc010uxj.1_Intron|CORO7_uc010btp.1_Intron	NM_138440	NP_612449	Q6EMK4	VASN_HUMAN	slit-like 2 precursor	287	LRR 10.|Extracellular (Potential).					extracellular region|integral to membrane					0						CGGGCCTCTTCCCCCGCCTGC	0.706													5	35	---	---	---	---	PASS
ZNF500	26048	broad.mit.edu	37	16	4802659	4802659	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:4802659C>G	uc002cxp.1	-	6	1408	c.1161G>C	c.(1159-1161)GGG>GGC	p.G387G	ZNF500_uc002cxo.1_Silent_p.G179G|ZNF500_uc010uxt.1_Silent_p.G387G	NM_021646	NP_067678	O60304	ZN500_HUMAN	zinc finger protein 500	387	C2H2-type 3.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)|skin(1)	3						TGAAGCGCTTCCCACACTCGG	0.637													4	26	---	---	---	---	PASS
TXNDC11	51061	broad.mit.edu	37	16	11785193	11785193	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11785193G>C	uc010buu.1	-	9	1996	c.1934C>G	c.(1933-1935)TCT>TGT	p.S645C	TXNDC11_uc002dbg.1_Missense_Mutation_p.S618C	NM_015914	NP_056998	Q6PKC3	TXD11_HUMAN	thioredoxin domain containing 11	645					cell redox homeostasis	endoplasmic reticulum membrane|integral to membrane					0						GATGTAATGAGATTCTTCTTT	0.423													4	234	---	---	---	---	PASS
MKL2	57496	broad.mit.edu	37	16	14280899	14280899	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:14280899C>T	uc010uza.1	+						MKL2_uc002dcg.2_Intron|MKL2_uc002dch.2_Intron	NM_014048	NP_054767	Q9ULH7	MKL2_HUMAN	megakaryoblastic leukemia 2 protein						cell differentiation|muscle organ development|positive regulation of striated muscle tissue development|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		identical protein binding|nucleic acid binding|transcription coactivator activity			ovary(3)|kidney(1)|pancreas(1)	5						GAAGGTCAGTCTGTCTGTGGA	0.473													12	23	---	---	---	---	PASS
SMG1	23049	broad.mit.edu	37	16	18840913	18840913	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:18840913G>A	uc002dfm.2	-	54	9661	c.9298C>T	c.(9298-9300)CAA>TAA	p.Q3100*	SMG1_uc010bwb.2_Nonsense_Mutation_p.Q2960*|SMG1_uc010bwa.2_Nonsense_Mutation_p.Q1831*	NM_015092	NP_055907	Q96Q15	SMG1_HUMAN	PI-3-kinase-related kinase SMG-1	3100					DNA repair|mRNA export from nucleus|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|peptidyl-serine phosphorylation|phosphatidylinositol phosphorylation|protein autophosphorylation	cytoplasm|nucleus	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			breast(5)|stomach(4)|lung(4)|kidney(2)|ovary(1)	16						CCGAGGGCTTGGTTGGGTAGC	0.468													29	61	---	---	---	---	PASS
GP2	2813	broad.mit.edu	37	16	20331610	20331610	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20331610C>G	uc002dgv.2	-	6	924	c.841G>C	c.(841-843)GCT>CCT	p.A281P	GP2_uc002dgw.2_Missense_Mutation_p.A278P|GP2_uc002dgx.2_Missense_Mutation_p.A134P|GP2_uc002dgy.2_Missense_Mutation_p.A131P	NM_001007240	NP_001007241	P55259	GP2_HUMAN	zymogen granule membrane glycoprotein 2 isoform	281	ZP.					anchored to membrane|extracellular region|plasma membrane				ovary(3)|skin(1)	4						CAGGCACTAGCCTGGACGGGG	0.517													6	175	---	---	---	---	PASS
PDILT	204474	broad.mit.edu	37	16	20395985	20395985	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20395985C>G	uc002dhc.1	-	3	614	c.391G>C	c.(391-393)GAG>CAG	p.E131Q		NM_174924	NP_777584	Q8N807	PDILT_HUMAN	protein disulfide isomerase-like, testis	131					cell differentiation|cell redox homeostasis|multicellular organismal development|spermatogenesis	endoplasmic reticulum	isomerase activity			large_intestine(1)	1						CTGATGGGCTCTGACCTGTTG	0.353													43	272	---	---	---	---	PASS
VWA3A	146177	broad.mit.edu	37	16	22134981	22134981	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:22134981G>C	uc010vbq.1	+	16	1581	c.1485G>C	c.(1483-1485)TGG>TGC	p.W495C	VWA3A_uc010bxd.2_RNA|VWA3A_uc010bxc.2_Missense_Mutation_p.W503C	NM_173615	NP_775886	A6NCI4	VWA3A_HUMAN	von Willebrand factor A domain containing 3A	495						extracellular region				skin(1)	1				GBM - Glioblastoma multiforme(48;0.0439)		GGATTGAGTGGCTCTCCCTGG	0.537													7	159	---	---	---	---	PASS
POLR3E	55718	broad.mit.edu	37	16	22335672	22335672	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:22335672C>G	uc002dkk.2	+						POLR3E_uc002dkj.1_Intron|POLR3E_uc002dkm.2_Intron|POLR3E_uc010vbr.1_Intron|POLR3E_uc002dkl.2_Intron|POLR3E_uc010vbs.1_Intron|POLR3E_uc010vbt.1_Intron	NM_018119	NP_060589	Q9NVU0	RPC5_HUMAN	RNA polymerase III polypeptide E						innate immune response|response to virus|termination of RNA polymerase III transcription|transcription elongation from RNA polymerase III promoter	nucleoplasm	DNA-directed RNA polymerase activity			ovary(1)|central_nervous_system(1)	2				GBM - Glioblastoma multiforme(48;0.012)		TCTTCTCCCTCAGATGTGGAA	0.612													4	116	---	---	---	---	PASS
CHP2	63928	broad.mit.edu	37	16	23766387	23766387	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23766387C>A	uc002dmb.1	+	1	440	c.17C>A	c.(16-18)TCC>TAC	p.S6Y		NM_022097	NP_071380	O43745	CHP2_HUMAN	hepatocellular carcinoma antigen gene 520	6							calcium ion binding			central_nervous_system(1)	1				GBM - Glioblastoma multiforme(48;0.0144)		TCGCGCAGCTCCCACGCCGCG	0.751													5	31	---	---	---	---	PASS
PRKCB	5579	broad.mit.edu	37	16	24105581	24105581	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24105581G>C	uc002dmd.2	+	7	981	c.784G>C	c.(784-786)GGG>CGG	p.G262R	PRKCB_uc002dme.2_Missense_Mutation_p.G262R	NM_212535	NP_997700	P05771	KPCB_HUMAN	protein kinase C, beta isoform 1	262					apoptosis|B cell activation|B cell receptor signaling pathway|intracellular signal transduction|lipoprotein transport|platelet activation|positive regulation of I-kappaB kinase/NF-kappaB cascade|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|synaptic transmission|transcription, DNA-dependent	cytosol|nucleus|plasma membrane	androgen receptor binding|ATP binding|chromatin binding|histone binding|histone kinase activity (H3-T6 specific)|ligand-dependent nuclear receptor transcription coactivator activity|protein kinase C activity|protein kinase C binding|zinc ion binding	p.G262V(1)		ovary(3)|central_nervous_system(3)|lung(2)|large_intestine(1)	9					Vitamin E(DB00163)	TTTGTCCTTTGGGATTTCTGA	0.448													25	266	---	---	---	---	PASS
JMJD5	79831	broad.mit.edu	37	16	27221549	27221549	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:27221549G>T	uc002doh.2	+	2	287	c.105G>T	c.(103-105)TTG>TTT	p.L35F	JMJD5_uc010bxv.2_Missense_Mutation_p.L35F|JMJD5_uc010vcn.1_Missense_Mutation_p.L73F|JMJD5_uc010bxw.2_Missense_Mutation_p.L35F	NM_024773	NP_079049	Q8N371	KDM8_HUMAN	jumonji domain containing 5 isoform 2	35					G2/M transition of mitotic cell cycle|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	chromatin binding|histone demethylase activity (H3-K36 specific)|metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			ovary(2)|upper_aerodigestive_tract(1)	3						ACCTGAAGTTGGACCTCGGGG	0.617													34	77	---	---	---	---	PASS
MAZ	4150	broad.mit.edu	37	16	29819011	29819011	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29819011C>T	uc002dty.2	+	2	1073	c.905C>T	c.(904-906)TCG>TTG	p.S302L	uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|MAZ_uc002dtv.1_Intron|MAZ_uc010vdx.1_Missense_Mutation_p.S279L|MAZ_uc002dtw.2_Intron|MAZ_uc002dtx.2_Missense_Mutation_p.S302L|MAZ_uc010bzg.2_Intron|MAZ_uc002dtz.1_Missense_Mutation_p.S20L|MAZ_uc002dua.2_5'Flank|MAZ_uc010vdy.1_5'Flank	NM_002383	NP_002374	P56270	MAZ_HUMAN	MYC-associated zinc finger protein isoform 1	302					regulation of transcription, DNA-dependent|termination of RNA polymerase II transcription|transcription initiation from RNA polymerase II promoter	nucleus	DNA binding|protein binding|RNA binding|zinc ion binding			ovary(1)	1						CTGTCGCACTCGGACGAGAAG	0.632													26	139	---	---	---	---	PASS
ZNF768	79724	broad.mit.edu	37	16	30536455	30536455	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30536455G>T	uc002dyk.3	-	2	1182	c.1006C>A	c.(1006-1008)CAG>AAG	p.Q336K	ZNF768_uc010vex.1_Missense_Mutation_p.Q305K|uc002dyl.1_5'Flank|ZNF768_uc010vew.1_Missense_Mutation_p.Q305K	NM_024671	NP_078947	Q9H5H4	ZN768_HUMAN	zinc finger protein 768	336	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	DNA-directed RNA polymerase II, core complex	DNA binding|zinc ion binding				0						TGAGTGCGCTGGTGGCGAAGC	0.627													13	48	---	---	---	---	PASS
ORAI3	93129	broad.mit.edu	37	16	30964632	30964632	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30964632C>A	uc002eac.2	+	2	561	c.355C>A	c.(355-357)CTG>ATG	p.L119M		NM_152288	NP_689501	Q9BRQ5	ORAI3_HUMAN	ORAI calcium release-activated calcium modulator	119						integral to membrane	protein binding				0						CTCCACGTGTCTGCTGCCCCA	0.612											OREG0023742	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	7	178	---	---	---	---	PASS
ITGAX	3687	broad.mit.edu	37	16	31374072	31374072	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31374072C>T	uc002ebu.1	+	12	1424	c.1357C>T	c.(1357-1359)CAG>TAG	p.Q453*	ITGAX_uc002ebt.2_Nonsense_Mutation_p.Q453*|ITGAX_uc010vfk.1_Nonsense_Mutation_p.Q103*	NM_000887	NP_000878	P20702	ITAX_HUMAN	integrin alpha X precursor	453	FG-GAP 5.|Extracellular (Potential).				blood coagulation|cell adhesion|integrin-mediated signaling pathway|leukocyte migration|organ morphogenesis	integrin complex	protein binding|receptor activity			ovary(2)|central_nervous_system(1)|pancreas(1)	4						CACGGGGACTCAGGTTGGGCG	0.662													6	54	---	---	---	---	PASS
TGFB1I1	7041	broad.mit.edu	37	16	31487877	31487877	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31487877G>C	uc002ecd.1	+	9	990	c.964G>C	c.(964-966)GAT>CAT	p.D322H	TGFB1I1_uc002ece.1_Missense_Mutation_p.D305H|TGFB1I1_uc010caq.1_Missense_Mutation_p.D161H	NM_001042454	NP_001035919	O43294	TGFI1_HUMAN	transforming growth factor beta 1 induced	322	LIM zinc-binding 2.				androgen receptor signaling pathway|cell adhesion|negative regulation of cell proliferation|negative regulation of transforming growth factor beta receptor signaling pathway|positive regulation of epithelial to mesenchymal transition|positive regulation of transcription, DNA-dependent|positive regulation of transforming growth factor beta receptor signaling pathway|transcription from RNA polymerase II promoter|ubiquitin-dependent SMAD protein catabolic process|Wnt receptor signaling pathway	cytoplasm|cytoskeleton|focal adhesion|nuclear matrix	androgen receptor binding|I-SMAD binding|Roundabout binding|transcription coactivator activity|zinc ion binding				0						GCCCTTCGGAGATGAGGGTGA	0.632													5	18	---	---	---	---	PASS
VPS35	55737	broad.mit.edu	37	16	46697018	46697018	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:46697018G>A	uc002eef.3	-	14	1803	c.1704C>T	c.(1702-1704)ATC>ATT	p.I568I	VPS35_uc002eed.2_Silent_p.I389I|VPS35_uc002eee.2_Silent_p.I529I	NM_018206	NP_060676	Q96QK1	VPS35_HUMAN	vacuolar protein sorting 35	568					protein transport|retrograde transport, endosome to Golgi	cytosol|endosome|membrane	protein binding				0		all_cancers(37;7.65e-05)|all_epithelial(9;0.000154)|all_lung(18;0.00585)|Lung NSC(13;0.0496)|Breast(268;0.116)				TCAAAGCACTGATAGTCTGGT	0.363													57	57	---	---	---	---	PASS
SIAH1	6477	broad.mit.edu	37	16	48395889	48395889	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:48395889G>C	uc002efo.1	-	2	568	c.451C>G	c.(451-453)CAG>GAG	p.Q151E	uc002efk.1_RNA|SIAH1_uc002efl.2_RNA|SIAH1_uc002efn.1_Missense_Mutation_p.Q182E	NM_003031	NP_003022	Q8IUQ4	SIAH1_HUMAN	seven in absentia homolog 1 isoform a	151	SIAH-type.|SBD.			Q->A: In E; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-142.	axon guidance|cell cycle|neuron apoptosis|proteasomal ubiquitin-dependent protein catabolic process|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|spermatogenesis	beta-catenin destruction complex|cytosol|nucleus	protein C-terminus binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1		all_cancers(37;0.157)|all_lung(18;0.11)|Breast(268;0.238)				GACTTATGCTGATGCATCAGA	0.478													6	109	---	---	---	---	PASS
ZNF423	23090	broad.mit.edu	37	16	49557553	49557553	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:49557553G>T	uc002efs.2	-	8	4105	c.3807C>A	c.(3805-3807)TTC>TTA	p.F1269L	ZNF423_uc010vgn.1_Missense_Mutation_p.F1152L	NM_015069	NP_055884	Q2M1K9	ZN423_HUMAN	zinc finger protein 423	1269	C2H2-type 30.				cell differentiation|negative regulation of transcription, DNA-dependent|nervous system development|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(1)|lung(1)|kidney(1)|pancreas(1)	4		all_cancers(37;0.0155)				CGGTCTGGAAGAAGAACTTCT	0.602													5	63	---	---	---	---	PASS
ADCY7	113	broad.mit.edu	37	16	50342626	50342626	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:50342626G>A	uc002egd.1	+	16	2252	c.1984G>A	c.(1984-1986)GAG>AAG	p.E662K	ADCY7_uc002egc.1_Missense_Mutation_p.E662K	NM_001114	NP_001105	P51828	ADCY7_HUMAN	adenylate cyclase 7	662					activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to ethanol|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|positive regulation of cAMP biosynthetic process|synaptic transmission|transmembrane transport|water transport	integral to membrane|plasma membrane	adenylate cyclase activity|ATP binding|metal ion binding			skin(1)	1		all_cancers(37;0.0127)		GBM - Glioblastoma multiforme(240;0.195)	Bromocriptine(DB01200)	TGAGAGGGTGGAGACACAGCC	0.647													4	99	---	---	---	---	PASS
GPR56	9289	broad.mit.edu	37	16	57685308	57685308	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57685308C>G	uc002emb.2	+	4	553	c.261C>G	c.(259-261)CTC>CTG	p.L87L	GPR56_uc002elz.1_Intron|GPR56_uc002ema.1_5'UTR|GPR56_uc002emc.2_Silent_p.L87L|GPR56_uc002emf.2_Silent_p.L87L|GPR56_uc010vhs.1_Silent_p.L87L|GPR56_uc002emd.2_Silent_p.L87L|GPR56_uc002eme.2_Silent_p.L87L|GPR56_uc010vht.1_Silent_p.L92L|GPR56_uc002emg.3_Silent_p.L87L|GPR56_uc010vhu.1_5'UTR	NM_005682	NP_005673	Q9Y653	GPR56_HUMAN	G protein-coupled receptor 56 isoform a	87	Extracellular (Potential).				brain development|cell adhesion|cell-cell signaling|neuropeptide signaling pathway	integral to plasma membrane	G-protein coupled receptor activity				0						CCAGGGGCCTCTACCACTTCT	0.572													5	181	---	---	---	---	PASS
CNGB1	1258	broad.mit.edu	37	16	57998082	57998082	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57998082G>T	uc002emt.2	-	4	307	c.242C>A	c.(241-243)TCC>TAC	p.S81Y	CNGB1_uc010cdh.2_Missense_Mutation_p.S81Y|CNGB1_uc002emu.2_Missense_Mutation_p.S81Y	NM_001297	NP_001288	Q14028	CNGB1_HUMAN	cyclic nucleotide gated channel beta 1 isoform	81					sensory perception of smell	intracellular cyclic nucleotide activated cation channel complex	cAMP binding|intracellular cAMP activated cation channel activity			breast(3)|pancreas(1)	4						GGATATGGTGGAAGTAAGGGC	0.562													11	74	---	---	---	---	PASS
CCDC113	29070	broad.mit.edu	37	16	58287906	58287906	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:58287906G>A	uc002ene.2	+	3	312	c.233G>A	c.(232-234)CGA>CAA	p.R78Q	CCDC113_uc010vid.1_Intron	NM_014157	NP_054876	Q9H0I3	CC113_HUMAN	coiled-coil domain containing 113 isoform 1	78						protein complex					0						TTGCAGTTTCGAGGCAGGCGT	0.498													10	125	---	---	---	---	PASS
LRRC29	26231	broad.mit.edu	37	16	67241837	67241837	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67241837C>T	uc002esd.2	-	3	1339	c.442G>A	c.(442-444)GCC>ACC	p.A148T	LRRC29_uc002ese.2_Missense_Mutation_p.A148T|LRRC29_uc002esf.2_Missense_Mutation_p.A148T|LRRC29_uc002esg.2_Missense_Mutation_p.A148T	NM_012163	NP_036295	Q8WV35	LRC29_HUMAN	F-box and leucine-rich repeat protein 9	148	F-box.|LRR 5.										0		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.000691)|Epithelial(162;0.00462)|all cancers(182;0.0434)		CAGGAGCTGGCTGCCTGGGCC	0.617													16	75	---	---	---	---	PASS
FAM65A	79567	broad.mit.edu	37	16	67578699	67578699	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67578699G>T	uc010vjp.1	+	16	2991	c.2895G>T	c.(2893-2895)AGG>AGT	p.R965S	FAM65A_uc002eth.2_Missense_Mutation_p.R945S|FAM65A_uc010cej.2_Missense_Mutation_p.R948S|FAM65A_uc010vjq.1_Missense_Mutation_p.R959S|FAM65A_uc002etk.2_Missense_Mutation_p.R943S	NM_024519	NP_078795	Q6ZS17	FA65A_HUMAN	hypothetical protein LOC79567	949						cytoplasm	binding			ovary(2)|central_nervous_system(1)	3		Acute lymphoblastic leukemia(13;3.76e-06)|all_hematologic(13;0.000303)|Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0474)|Epithelial(162;0.117)		AGTTCAGCAGGCGGTGGGAGA	0.652													12	150	---	---	---	---	PASS
CTCF	10664	broad.mit.edu	37	16	67671757	67671757	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67671757C>G	uc002etl.2	+	12	2456	c.2166C>G	c.(2164-2166)CTC>CTG	p.L722L	CTCF_uc010cek.2_Silent_p.L394L|CTCF_uc002etm.1_Silent_p.L209L	NM_006565	NP_006556	P49711	CTCF_HUMAN	CCCTC-binding factor	722					chromatin modification|chromosome segregation|negative regulation of transcription, DNA-dependent|nucleosome positioning|positive regulation of transcription, DNA-dependent|regulation of centromeric sister chromatid cohesion|regulation of molecular function, epigenetic	chromosome, centromeric region|condensed chromosome|nucleolus|nucleoplasm	chromatin insulator sequence binding|protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(1)	1		Acute lymphoblastic leukemia(13;3.76e-06)|all_hematologic(13;0.000303)|Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0166)|Epithelial(162;0.0577)		AGATGATCCTCAGCATGATGG	0.572													8	57	---	---	---	---	PASS
PRMT7	54496	broad.mit.edu	37	16	68373336	68373336	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68373336G>A	uc002evy.1	+	8	892	c.616G>A	c.(616-618)GGA>AGA	p.G206R	PRMT7_uc002evx.1_Missense_Mutation_p.G206R|PRMT7_uc010vlg.1_Missense_Mutation_p.G156R|PRMT7_uc002evz.1_Missense_Mutation_p.G52R	NM_019023	NP_061896	Q9NVM4	ANM7_HUMAN	protein arginine methyltransferase 7	206					cell differentiation|DNA methylation involved in gamete generation|regulation of gene expression by genetic imprinting|regulation of transcription, DNA-dependent|spliceosomal snRNP assembly|transcription, DNA-dependent	cytosol|nucleus	[myelin basic protein]-arginine N-methyltransferase activity|histone methyltransferase activity (H4-R3 specific)|protein-arginine omega-N monomethyltransferase activity|protein-arginine omega-N symmetric methyltransferase activity|ribonucleoprotein binding				0		Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0155)|Epithelial(162;0.0629)		GACCAGCCTCGGAGAGCAGGT	0.612													73	82	---	---	---	---	PASS
CHTF8	54921	broad.mit.edu	37	16	69154385	69154385	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:69154385C>G	uc002ewn.1	-	4	410	c.309G>C	c.(307-309)AAG>AAC	p.K103N	CHTF8_uc002ewm.1_5'UTR|CHTF8_uc002ewo.1_Missense_Mutation_p.K84N|CHTF8_uc002ewp.1_Missense_Mutation_p.K103N	NM_001040146	NP_001035236	P0CG13	CTF8_HUMAN	chromosome transmission fidelity factor 8	103					cell cycle|DNA replication	nucleus	DNA binding				0						TGAAAAGGATCTTGTCTTTGA	0.532													5	110	---	---	---	---	PASS
NFAT5	10725	broad.mit.edu	37	16	69704161	69704161	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:69704161A>T	uc002exm.1	+	8	2681	c.1473A>T	c.(1471-1473)GAA>GAT	p.E491D	NFAT5_uc002exh.1_Missense_Mutation_p.E285D|NFAT5_uc002exi.2_Missense_Mutation_p.E415D|NFAT5_uc002exj.1_Missense_Mutation_p.E415D|NFAT5_uc002exk.1_Missense_Mutation_p.E415D|NFAT5_uc002exl.1_Missense_Mutation_p.E509D|NFAT5_uc002exn.1_Missense_Mutation_p.E509D	NM_006599	NP_006590	O94916	NFAT5_HUMAN	nuclear factor of activated T-cells 5 isoform c	491					excretion|signal transduction|transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0						GGAAGTCAGAAGCTGAAATTG	0.249													4	74	---	---	---	---	PASS
VAC14	55697	broad.mit.edu	37	16	70818111	70818111	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70818111C>G	uc002ezm.2	-	5	757	c.499G>C	c.(499-501)GAG>CAG	p.E167Q	VAC14_uc010cfw.2_5'UTR|VAC14_uc002ezn.2_Intron	NM_018052	NP_060522	Q08AM6	VAC14_HUMAN	Vac14 homolog	167					interspecies interaction between organisms	endoplasmic reticulum|endosome membrane|microsome	protein binding|receptor activity			pancreas(1)|skin(1)	2		Ovarian(137;0.0699)				TTGTTGCTCTCAGTCACAATG	0.557													30	31	---	---	---	---	PASS
FTSJD1	55783	broad.mit.edu	37	16	71317774	71317774	+	Missense_Mutation	SNP	C	T	T	rs148258352	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71317774C>T	uc010cga.2	-	3	2456	c.2050G>A	c.(2050-2052)GCA>ACA	p.A684T	FTSJD1_uc002ezy.3_Missense_Mutation_p.A684T|FTSJD1_uc002ezz.3_Missense_Mutation_p.A684T	NM_001099642	NP_001093112	Q8IYT2	FTSJ1_HUMAN	FtsJ methyltransferase domain containing 1	684						integral to membrane	methyltransferase activity|nucleic acid binding			skin(1)	1						AGCAGGACTGCGCAGGTCCTC	0.433													8	184	---	---	---	---	PASS
ZNF19	7567	broad.mit.edu	37	16	71509875	71509875	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71509875C>G	uc010cgc.1	-	6	1081	c.575G>C	c.(574-576)AGT>ACT	p.S192T	ZNF23_uc002fai.2_Intron|ZNF19_uc002fak.1_Missense_Mutation_p.S180T|ZNF19_uc002fal.1_Missense_Mutation_p.S180T|ZNF19_uc002fam.1_Missense_Mutation_p.S192T	NM_006961	NP_008892	P17023	ZNF19_HUMAN	zinc finger protein 19	192	C2H2-type 2.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Ovarian(137;0.00965)		BRCA - Breast invasive adenocarcinoma(221;0.0161)|Kidney(780;0.0598)		TCCACACTCACTACACTCAAA	0.458													4	139	---	---	---	---	PASS
MARVELD3	91862	broad.mit.edu	37	16	71663343	71663343	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71663343G>C	uc002fat.2	+	2	604	c.541G>C	c.(541-543)GAG>CAG	p.E181Q	MARVELD3_uc002fas.1_Missense_Mutation_p.E181Q|MARVELD3_uc002fau.2_Missense_Mutation_p.E181Q|MARVELD3_uc010cge.2_Missense_Mutation_p.Q126H	NM_052858	NP_443090	Q96A59	MALD3_HUMAN	MARVEL domain containing 3 isoform 2	181	Cytoplasmic (Potential).					integral to membrane				skin(1)	1		Ovarian(137;0.125)				TTACCAGTCAGAGGCGGAAGG	0.507													6	141	---	---	---	---	PASS
MARVELD3	91862	broad.mit.edu	37	16	71668506	71668506	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71668506G>T	uc002fat.2	+	3	1069	c.1006G>T	c.(1006-1008)GTG>TTG	p.V336L	MARVELD3_uc002fau.2_Intron|MARVELD3_uc010cge.2_Intron	NM_052858	NP_443090	Q96A59	MALD3_HUMAN	MARVEL domain containing 3 isoform 2	336	MARVEL.|Extracellular (Potential).					integral to membrane				skin(1)	1		Ovarian(137;0.125)				TGGCTCTCCTGTGTGTAAAGA	0.557													5	67	---	---	---	---	PASS
MARVELD3	91862	broad.mit.edu	37	16	71674663	71674663	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71674663C>G	uc002fau.2	+	3	1029	c.966C>G	c.(964-966)CTC>CTG	p.L322L	PHLPP2_uc002fav.2_RNA|MARVELD3_uc010cge.2_3'UTR	NM_001017967	NP_001017967	Q96A59	MALD3_HUMAN	MARVEL domain containing 3 isoform 1	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment						integral to membrane				skin(1)	1		Ovarian(137;0.125)				GTGTTTACCTCCACGTGGCTC	0.577													41	55	---	---	---	---	PASS
PHLPP2	23035	broad.mit.edu	37	16	71748541	71748541	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71748541G>A	uc002fax.2	-	1	164	c.158C>T	c.(157-159)TCT>TTT	p.S53F	PHLPP2_uc010cgf.2_Missense_Mutation_p.S53F|PHLPP2_uc002fay.1_Missense_Mutation_p.S53F	NM_015020	NP_055835	Q6ZVD8	PHLP2_HUMAN	PH domain and leucine rich repeat protein	53	Poly-Ser.					cytoplasm|membrane|nucleus	metal ion binding|phosphoprotein phosphatase activity			ovary(1)|central_nervous_system(1)	2						ggaggaggaagaggaagagga	0.373													5	66	---	---	---	---	PASS
PMFBP1	83449	broad.mit.edu	37	16	72158677	72158677	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72158677C>A	uc002fcc.3	-	17	2765	c.2593G>T	c.(2593-2595)GAC>TAC	p.D865Y	PMFBP1_uc002fcd.2_Missense_Mutation_p.D860Y|PMFBP1_uc002fce.2_RNA|PMFBP1_uc002fcf.2_Missense_Mutation_p.D715Y|PMFBP1_uc010cgo.1_Missense_Mutation_p.D156Y	NM_031293	NP_112583	Q8TBY8	PMFBP_HUMAN	polyamine modulated factor 1 binding protein 1	865	Potential.									ovary(2)	2		Ovarian(137;0.179)				TCCTTATCGTCCTCAAGGAGG	0.572											OREG0023927	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	109	132	---	---	---	---	PASS
CHST5	23563	broad.mit.edu	37	16	75563946	75563946	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:75563946C>T	uc002fei.2	-	3	1732	c.337G>A	c.(337-339)GCC>ACC	p.A113T	CHST5_uc002fej.1_Missense_Mutation_p.A119T	NM_024533	NP_078809	Q9GZS9	CHST5_HUMAN	carbohydrate (N-acetylglucosamine 6-O)	113	Lumenal (Potential).				N-acetylglucosamine metabolic process|protein sulfation	integral to membrane|intrinsic to Golgi membrane	N-acetylglucosamine 6-O-sulfotransferase activity				0						TCGCGCACGGCCATGTGCAGC	0.607													57	51	---	---	---	---	PASS
CNTNAP4	85445	broad.mit.edu	37	16	76528891	76528891	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:76528891G>A	uc002feu.1	+	16	2550	c.2165G>A	c.(2164-2166)TGT>TAT	p.C722Y	CNTNAP4_uc002fev.1_Missense_Mutation_p.C586Y|CNTNAP4_uc010chb.1_Missense_Mutation_p.C649Y|CNTNAP4_uc002fex.1_Missense_Mutation_p.C725Y|CNTNAP4_uc002few.2_Missense_Mutation_p.C697Y	NM_033401	NP_207837	Q9C0A0	CNTP4_HUMAN	cell recognition protein CASPR4 isoform 1	722	Extracellular (Potential).|Fibrinogen C-terminal.				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(1)|pancreas(1)	2						CTTCAAAAATGTACTTGTGGA	0.418													16	280	---	---	---	---	PASS
CDYL2	124359	broad.mit.edu	37	16	80666953	80666953	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:80666953G>C	uc002ffs.2	-	3	902	c.797C>G	c.(796-798)TCC>TGC	p.S266C		NM_152342	NP_689555	Q8N8U2	CDYL2_HUMAN	chromodomain protein, Y-like 2	266						nucleus	catalytic activity|protein binding			central_nervous_system(1)	1						GGTCTGACTGGACAGCAGGAT	0.552													78	102	---	---	---	---	PASS
PKD1L2	114780	broad.mit.edu	37	16	81194499	81194499	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:81194499G>A	uc002fgh.1	-	22	3489	c.3489C>T	c.(3487-3489)CCC>CCT	p.P1163P	PKD1L2_uc002fgg.1_RNA	NM_052892	NP_443124	Q7Z442	PK1L2_HUMAN	polycystin 1-like 2 isoform a	1163	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane	calcium ion binding|ion channel activity|sugar binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3						GTGAATGCCGGGGCAGCAGGA	0.567													12	34	---	---	---	---	PASS
NECAB2	54550	broad.mit.edu	37	16	84024221	84024221	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84024221G>A	uc002fhd.2	+	6	599	c.582G>A	c.(580-582)CAG>CAA	p.Q194Q	NECAB2_uc002fhe.2_Silent_p.Q111Q	NM_019065	NP_061938	Q7Z6G3	NECA2_HUMAN	neuronal calcium-binding protein 2	194	Potential.				antibiotic biosynthetic process	cytoplasm	calcium ion binding|oxidoreductase activity|protein binding			ovary(2)	2						TCGAGGAACAGACCAGCCAGC	0.612													8	81	---	---	---	---	PASS
KCNG4	93107	broad.mit.edu	37	16	84270759	84270759	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84270759G>A	uc010voc.1	-	2	454	c.333C>T	c.(331-333)TTC>TTT	p.F111F	KCNG4_uc002fhu.1_Silent_p.F111F	NM_172347	NP_758857	Q8TDN1	KCNG4_HUMAN	potassium voltage-gated channel, subfamily G,	111	Cytoplasmic (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity			breast(3)	3						TGTCGAAGAAGAACTCCTGGC	0.627													42	41	---	---	---	---	PASS
FOXF1	2294	broad.mit.edu	37	16	86544562	86544562	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:86544562G>T	uc002fjl.2	+	1	430	c.387G>T	c.(385-387)GAG>GAT	p.E129D	uc002fjk.1_5'Flank	NM_001451	NP_001442	Q12946	FOXF1_HUMAN	forkhead box F1	129	Fork-head.				branching involved in open tracheal system development|cardiac left ventricle morphogenesis|embryonic ectodermal digestive tract morphogenesis|endocardial cushion development|in utero embryonic development|lung vasculature development|midgut development|pancreas development|positive regulation of transcription, DNA-dependent|regulation of sequence-specific DNA binding transcription factor activity|ureter development|venous blood vessel development	transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription factor binding				0						CGGCCAGCGAGTTCATGTTCG	0.642													10	271	---	---	---	---	PASS
ZCCHC14	23174	broad.mit.edu	37	16	87446239	87446239	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:87446239C>G	uc002fjz.1	-	12	1704	c.1677G>C	c.(1675-1677)ATG>ATC	p.M559I	ZCCHC14_uc002fka.1_RNA|ZCCHC14_uc002fkb.2_Missense_Mutation_p.M335I	NM_015144	NP_055959	Q8WYQ9	ZCH14_HUMAN	zinc finger, CCHC domain containing 14	559					cell communication		nucleic acid binding|phosphatidylinositol binding|zinc ion binding			upper_aerodigestive_tract(1)|breast(1)	2				BRCA - Breast invasive adenocarcinoma(80;0.0285)		GCACGTCCATCATGGCGCTGC	0.557													72	96	---	---	---	---	PASS
CPNE7	27132	broad.mit.edu	37	16	89650455	89650455	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89650455C>T	uc002fnp.2	+	6	807	c.677C>T	c.(676-678)TCG>TTG	p.S226L	CPNE7_uc002fnq.2_Missense_Mutation_p.S151L	NM_014427	NP_055242	Q9UBL6	CPNE7_HUMAN	copine 7 isoform b	226					lipid metabolic process		transporter activity				0		all_hematologic(23;0.0748)		all cancers(4;3.63e-08)|OV - Ovarian serous cystadenocarcinoma(4;1.7e-06)|BRCA - Breast invasive adenocarcinoma(80;0.0147)		GAGGACATCTCGGGGAACAAC	0.711													47	44	---	---	---	---	PASS
DEF8	54849	broad.mit.edu	37	16	90020690	90020690	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:90020690C>T	uc002fpn.1	+	3	302	c.213C>T	c.(211-213)TTC>TTT	p.F71F	DEF8_uc002fpl.2_Silent_p.F10F|DEF8_uc002fpm.2_Silent_p.F10F|DEF8_uc002fpo.1_Silent_p.F10F|DEF8_uc002fpp.1_Silent_p.F10F|DEF8_uc010vpq.1_Intron|DEF8_uc010vpr.1_Silent_p.F10F	NM_207514	NP_997397	Q6ZN54	DEFI8_HUMAN	differentially expressed in FDCP 8 isoform 1	71					intracellular signal transduction		zinc ion binding			central_nervous_system(1)	1		all_cancers(9;7.59e-13)|Lung NSC(15;1.56e-06)|all_lung(18;2.18e-06)|all_neural(9;0.0019)|all_hematologic(23;0.0194)		BRCA - Breast invasive adenocarcinoma(80;0.0274)		TGGCCCGTTTCCGGCAGGCCC	0.642													15	107	---	---	---	---	PASS
VPS53	55275	broad.mit.edu	37	17	489614	489614	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:489614C>G	uc002frn.2	-						VPS53_uc002frk.2_Intron|VPS53_uc010cjo.1_Intron|VPS53_uc002frl.2_Intron|VPS53_uc002frm.2_Intron|VPS53_uc002fro.2_Intron|VPS53_uc010cjp.1_Intron	NM_018289	NP_060759	Q5VIR6	VPS53_HUMAN	vacuolar protein sorting 53 isoform 2						protein transport	endosome membrane|Golgi apparatus					0				UCEC - Uterine corpus endometrioid carcinoma (25;0.0265)		GCTGTAAAAACAAAGAAAAAT	0.353													45	48	---	---	---	---	PASS
ABR	29	broad.mit.edu	37	17	1028535	1028535	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1028535C>T	uc002fsd.2	-	2	339	c.229G>A	c.(229-231)GAG>AAG	p.E77K	ABR_uc002fse.2_Missense_Mutation_p.E31K|ABR_uc010cjq.1_Missense_Mutation_p.E89K	NM_021962	NP_068781	Q12979	ABR_HUMAN	active breakpoint cluster region-related	77					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity|protein binding|Rho guanyl-nucleotide exchange factor activity			upper_aerodigestive_tract(1)	1				UCEC - Uterine corpus endometrioid carcinoma (25;0.0228)		GCCAGTCCCTCAGGTGGAGTC	0.667													4	97	---	---	---	---	PASS
OR3A1	4994	broad.mit.edu	37	17	3195370	3195370	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3195370G>C	uc002fvh.1	-	1	507	c.507C>G	c.(505-507)CTC>CTG	p.L169L		NM_002550	NP_002541	P47881	OR3A1_HUMAN	olfactory receptor, family 3, subfamily A,	169	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			kidney(2)|central_nervous_system(1)	3						CACAGAAGTTGAGCGTGGACA	0.562													5	220	---	---	---	---	PASS
OR3A1	4994	broad.mit.edu	37	17	3195694	3195694	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3195694G>T	uc002fvh.1	-	1	183	c.183C>A	c.(181-183)CCC>CCA	p.P61P		NM_002550	NP_002541	P47881	OR3A1_HUMAN	olfactory receptor, family 3, subfamily A,	61	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			kidney(2)|central_nervous_system(1)	3						AGAAGTACATGGGGGTGTGGA	0.557													31	49	---	---	---	---	PASS
ASPA	443	broad.mit.edu	37	17	3392563	3392563	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3392563G>C	uc010ckg.2	+	5	652	c.561G>C	c.(559-561)CTG>CTC	p.L187L	SPATA22_uc010vrg.1_Intron|ASPA_uc002fvq.2_Silent_p.L187L	NM_001128085	NP_001121557	P45381	ACY2_HUMAN	aspartoacylase	187					aspartate catabolic process	cytoplasm|nucleus	aminoacylase activity|aspartoacylase activity|hydrolase activity, acting on ester bonds|metal ion binding				0					L-Aspartic Acid(DB00128)	AAGGGGTTCTGAGAGCTGATA	0.318													13	220	---	---	---	---	PASS
TRPV1	7442	broad.mit.edu	37	17	3495371	3495371	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3495371T>G	uc010vrr.1	-	1	801	c.274A>C	c.(274-276)ACC>CCC	p.T92P	TRPV1_uc010vro.1_Missense_Mutation_p.T92P|TRPV1_uc010vrp.1_Missense_Mutation_p.T92P|TRPV1_uc010vrq.1_Silent_p.P66P|TRPV1_uc010vrs.1_Missense_Mutation_p.T92P|TRPV1_uc010vrt.1_Missense_Mutation_p.T92P|TRPV1_uc010vru.1_Missense_Mutation_p.T92P	NM_080706	NP_542437	Q8NER1	TRPV1_HUMAN	transient receptor potential cation channel,	92	Cytoplasmic (Potential).				cell surface receptor linked signaling pathway|chemosensory behavior|thermoception	cell junction|dendritic spine membrane|integral to plasma membrane|postsynaptic membrane	ATP binding|calcium channel activity|calmodulin binding			ovary(1)	1				Lung(1;0.055)|COAD - Colon adenocarcinoma(5;0.0896)|LUAD - Lung adenocarcinoma(1115;0.131)	Alpha-Linolenic Acid(DB00132)|Aspartame(DB00168)|Icosapent(DB00159)	CTGGCACCGGTGGGGCCGTCT	0.637													15	25	---	---	---	---	PASS
C17orf85	55421	broad.mit.edu	37	17	3724582	3724582	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3724582C>A	uc010ckl.1	-	9	984	c.961G>T	c.(961-963)GAT>TAT	p.D321Y	C17orf85_uc002fwr.2_Missense_Mutation_p.D31Y|C17orf85_uc002fwq.2_Missense_Mutation_p.D41Y	NM_001114118	NP_001107590	Q53F19	CQ085_HUMAN	ELG protein isoform a	321							nucleotide binding			skin(1)	1				UCEC - Uterine corpus endometrioid carcinoma (3;0.0725)		CCAACGTCATCCCCAATCAGG	0.443													50	76	---	---	---	---	PASS
ATP2A3	489	broad.mit.edu	37	17	3846764	3846764	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3846764C>A	uc002fxb.1	-	11	1491	c.1340G>T	c.(1339-1341)TGC>TTC	p.C447F	ATP2A3_uc002fwx.1_Missense_Mutation_p.C447F|ATP2A3_uc002fwy.1_Missense_Mutation_p.C447F|ATP2A3_uc002fwz.1_Missense_Mutation_p.C447F|ATP2A3_uc002fxa.1_Missense_Mutation_p.C447F|ATP2A3_uc002fxc.1_Missense_Mutation_p.C447F|ATP2A3_uc002fxd.1_Missense_Mutation_p.C447F	NM_174955	NP_777615	Q93084	AT2A3_HUMAN	ATPase, Ca++ transporting, ubiquitous isoform b	447	Cytoplasmic (By similarity).				ATP biosynthetic process|platelet activation	integral to membrane|nuclear membrane|platelet dense tubular network membrane|sarcoplasmic reticulum membrane	ATP binding|calcium-transporting ATPase activity|metal ion binding|protein binding			ovary(3)|breast(1)|central_nervous_system(1)	5				LUAD - Lung adenocarcinoma(1115;0.000692)|Lung(3;0.0766)		CTCCACCAGGCAAGTCAGAGC	0.642													99	148	---	---	---	---	PASS
ZZEF1	23140	broad.mit.edu	37	17	3981258	3981258	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3981258T>A	uc002fxe.2	-	19	2972	c.2908A>T	c.(2908-2910)AGC>TGC	p.S970C	ZZEF1_uc002fxk.1_Missense_Mutation_p.S971C	NM_015113	NP_055928	O43149	ZZEF1_HUMAN	zinc finger, ZZ type with EF hand domain 1	970							calcium ion binding|zinc ion binding			ovary(2)|central_nervous_system(1)|pancreas(1)	4						GATAGCAGGCTGCCTTGGACG	0.527													49	70	---	---	---	---	PASS
MYBBP1A	10514	broad.mit.edu	37	17	4445961	4445961	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:4445961T>A	uc002fyb.3	-	21	3030	c.2968A>T	c.(2968-2970)AAC>TAC	p.N990Y	MYBBP1A_uc002fxz.3_Missense_Mutation_p.N990Y|MYBBP1A_uc002fya.3_5'Flank|MYBBP1A_uc010vsa.1_Missense_Mutation_p.N32Y	NM_014520	NP_055335	Q9BQG0	MBB1A_HUMAN	MYB binding protein 1a isoform 2	990					nucleocytoplasmic transport|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|NLS-dependent protein nuclear import complex|nucleolus	DNA binding|DNA-directed DNA polymerase activity|transcription factor binding			ovary(1)|skin(1)	2						AGGGGGCTGTTGCGCTTGGTC	0.642													53	71	---	---	---	---	PASS
KIF1C	10749	broad.mit.edu	37	17	4908139	4908139	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:4908139C>G	uc002gan.1	+							NM_006612	NP_006603	O43896	KIF1C_HUMAN	kinesin family member 1C						microtubule-based movement|retrograde vesicle-mediated transport, Golgi to ER	endoplasmic reticulum|Golgi apparatus|microtubule	ATP binding|microtubule motor activity			breast(2)	2						CCCTGCTCCTCTGTCACCCAG	0.592													3	122	---	---	---	---	PASS
ZNF594	84622	broad.mit.edu	37	17	5087060	5087060	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:5087060A>G	uc010cla.1	-	2	648	c.492T>C	c.(490-492)TCT>TCC	p.S164S		NM_032530	NP_115919	Q96JF6	ZN594_HUMAN	zinc finger protein 594	164	C2H2-type 2.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|skin(1)	3						AACTTTGATTAGAGTCTTTCC	0.333													22	152	---	---	---	---	PASS
TP53	7157	broad.mit.edu	37	17	7578212	7578212	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7578212G>A	uc002gim.2	-	6	831	c.637C>T	c.(637-639)CGA>TGA	p.R213*	TP53_uc002gig.1_Nonsense_Mutation_p.R213*|TP53_uc002gih.2_Nonsense_Mutation_p.R213*|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Nonsense_Mutation_p.R81*|TP53_uc010cng.1_Nonsense_Mutation_p.R81*|TP53_uc002gii.1_Nonsense_Mutation_p.R81*|TP53_uc010cnh.1_Nonsense_Mutation_p.R213*|TP53_uc010cni.1_Nonsense_Mutation_p.R213*|TP53_uc002gij.2_Nonsense_Mutation_p.R213*|TP53_uc010cnj.1_Intron|TP53_uc002gin.2_Nonsense_Mutation_p.R120*|TP53_uc002gio.2_Nonsense_Mutation_p.R81*|TP53_uc010vug.1_Nonsense_Mutation_p.R174*	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	213	Required for interaction with FBXO42.||Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).		R -> L (in sporadic cancers; somatic mutation).|R -> W (in sporadic cancers; somatic mutation).|R -> Q (in LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> G (in sporadic cancers; somatic mutation).|R -> P (in LFS; germline mutation and in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.R213*(186)|p.R213L(25)|p.R213Q(22)|p.R213fs*34(10)|p.0?(7)|p.R213P(5)|p.R81*(2)|p.R120*(2)|p.R213G(2)|p.K164_P219del(1)|p.D208_V216delDRNTFRHSV(1)|p.D207_R213delDDRNTFR(1)|p.T211_S215delTFRHS(1)|p.R213*33(1)|p.D208fs*1(1)|p.R213>L(1)|p.R209_R213delRNTFR(1)|p.R213fs*2(1)|p.T211fs*28(1)|p.R213_S215>X(1)|p.D207_V216del10(1)|p.R213R(1)|p.R213fs*32(1)|p.R209fs*6(1)|p.R213W(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)		ACACTATGTCGAAAAGTGTTT	0.532		111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			30	42	---	---	---	---	PASS
PER1	5187	broad.mit.edu	37	17	8045131	8045131	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8045131C>G	uc002gkd.2	-	22	3830	c.3592G>C	c.(3592-3594)GAT>CAT	p.D1198H	PER1_uc010cns.2_Missense_Mutation_p.D72H|PER1_uc010vuq.1_RNA	NM_002616	NP_002607	O15534	PER1_HUMAN	period 1	1198	CRY binding domain (By similarity).				circadian rhythm|entrainment of circadian clock|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	signal transducer activity			lung(2)|breast(2)|skin(2)|large_intestine(1)|ovary(1)|kidney(1)	9						ACCATCACATCAAGAGCCCGA	0.547			T	ETV6	AML|CMML			Other_conserved_DNA_damage_response_genes					16	218	---	---	---	---	PASS
MYH8	4626	broad.mit.edu	37	17	10295205	10295205	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10295205C>A	uc002gmm.2	-	39	5753	c.5658G>T	c.(5656-5658)GAG>GAT	p.E1886D	uc002gml.1_Intron	NM_002472	NP_002463	P13535	MYH8_HUMAN	myosin, heavy chain 8, skeletal muscle,	1886	Potential.				muscle filament sliding	cytosol|muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			skin(6)|ovary(3)|breast(2)	11						TTACAGCCTCCTCAGCTTGTC	0.398									Trismus-Pseudocamptodactyly_Syndrome_with_Cardiac_Myxoma_and_Freckling				17	270	---	---	---	---	PASS
MYH8	4626	broad.mit.edu	37	17	10312884	10312884	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10312884G>A	uc002gmm.2	-	16	1704	c.1609C>T	c.(1609-1611)CTG>TTG	p.L537L	uc002gml.1_Intron	NM_002472	NP_002463	P13535	MYH8_HUMAN	myosin, heavy chain 8, skeletal muscle,	537	Myosin head-like.				muscle filament sliding	cytosol|muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			skin(6)|ovary(3)|breast(2)	11						TCCTCTTCCAGGATGGAGAAG	0.473									Trismus-Pseudocamptodactyly_Syndrome_with_Cardiac_Myxoma_and_Freckling				18	98	---	---	---	---	PASS
MYH8	4626	broad.mit.edu	37	17	10315812	10315812	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10315812C>A	uc002gmm.2	-	14	1386	c.1291G>T	c.(1291-1293)GCC>TCC	p.A431S	uc002gml.1_Intron	NM_002472	NP_002463	P13535	MYH8_HUMAN	myosin, heavy chain 8, skeletal muscle,	431	Myosin head-like.				muscle filament sliding	cytosol|muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			skin(6)|ovary(3)|breast(2)	11						ACGGCTTTGGCCAGAGCACCC	0.502									Trismus-Pseudocamptodactyly_Syndrome_with_Cardiac_Myxoma_and_Freckling				157	293	---	---	---	---	PASS
MYH1	4619	broad.mit.edu	37	17	10411765	10411765	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10411765C>T	uc002gmo.2	-	16	1906	c.1812G>A	c.(1810-1812)CTG>CTA	p.L604L	uc002gml.1_Intron	NM_005963	NP_005954	P12882	MYH1_HUMAN	myosin, heavy chain 1, skeletal muscle, adult	604	Myosin head-like.					muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity			ovary(10)|skin(6)|breast(3)|upper_aerodigestive_tract(1)|kidney(1)	21						CAGTCTCATTCAGGGGGTCCT	0.522													42	64	---	---	---	---	PASS
MYH2	4620	broad.mit.edu	37	17	10440603	10440603	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10440603G>C	uc010coi.2	-	16	1972	c.1844C>G	c.(1843-1845)TCT>TGT	p.S615C	uc002gml.1_Intron|MYH2_uc002gmp.3_Missense_Mutation_p.S615C|MYH2_uc010coj.2_Missense_Mutation_p.S615C	NM_001100112	NP_001093582	Q9UKX2	MYH2_HUMAN	myosin heavy chain IIa	615	Myosin head-like.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(5)|pancreas(4)|skin(3)|lung(1)|kidney(1)	14						TTTCATTGCAGACTTCTGGTA	0.448													41	289	---	---	---	---	PASS
MYH3	4621	broad.mit.edu	37	17	10537469	10537469	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10537469C>T	uc002gmq.1	-	31	4464	c.4387G>A	c.(4387-4389)GAG>AAG	p.E1463K		NM_002470	NP_002461	P11055	MYH3_HUMAN	myosin, heavy chain 3, skeletal muscle,	1463	Potential.				muscle filament sliding|muscle organ development	cytosol|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(4)|central_nervous_system(2)|pancreas(1)	7						GCTTGGCTCTCCTCACACTTT	0.483													7	173	---	---	---	---	PASS
DNAH9	1770	broad.mit.edu	37	17	11572751	11572751	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:11572751G>C	uc002gne.2	+	17	3061	c.2993G>C	c.(2992-2994)AGA>ACA	p.R998T	DNAH9_uc010coo.2_Missense_Mutation_p.R292T	NM_001372	NP_001363	Q9NYC9	DYH9_HUMAN	dynein, axonemal, heavy chain 9 isoform 2	998	Stem (By similarity).				cell projection organization|cellular component movement|microtubule-based movement|spermatogenesis	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			skin(10)|ovary(4)|breast(3)|central_nervous_system(2)|pancreas(1)	20		Breast(5;0.0122)|all_epithelial(5;0.131)		Colorectal(4;6.88e-05)|COAD - Colon adenocarcinoma(4;0.000813)|READ - Rectum adenocarcinoma(10;0.157)		AGAGTCCAGAGAATGATGGGC	0.552													29	40	---	---	---	---	PASS
DNAH9	1770	broad.mit.edu	37	17	11631152	11631152	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:11631152C>A	uc002gne.2	+	28	5795	c.5727C>A	c.(5725-5727)TAC>TAA	p.Y1909*	DNAH9_uc010coo.2_Nonsense_Mutation_p.Y1203*	NM_001372	NP_001363	Q9NYC9	DYH9_HUMAN	dynein, axonemal, heavy chain 9 isoform 2	1909	AAA 1 (By similarity).				cell projection organization|cellular component movement|microtubule-based movement|spermatogenesis	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			skin(10)|ovary(4)|breast(3)|central_nervous_system(2)|pancreas(1)	20		Breast(5;0.0122)|all_epithelial(5;0.131)		Colorectal(4;6.88e-05)|COAD - Colon adenocarcinoma(4;0.000813)|READ - Rectum adenocarcinoma(10;0.157)		GCAACATCTACAAAGGCCTTG	0.473													38	42	---	---	---	---	PASS
NCOR1	9611	broad.mit.edu	37	17	16068381	16068381	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:16068381G>C	uc002gpo.2	-	5	770	c.530C>G	c.(529-531)TCA>TGA	p.S177*	NCOR1_uc002gpn.2_Nonsense_Mutation_p.S177*|NCOR1_uc002gpp.1_Nonsense_Mutation_p.S68*|NCOR1_uc002gpr.2_Nonsense_Mutation_p.S68*|NCOR1_uc002gps.1_Nonsense_Mutation_p.S177*|NCOR1_uc010coz.1_5'UTR|NCOR1_uc010cpb.1_Nonsense_Mutation_p.S177*|NCOR1_uc010cpa.1_Nonsense_Mutation_p.S177*|NCOR1_uc002gpu.2_Nonsense_Mutation_p.S177*	NM_006311	NP_006302	O75376	NCOR1_HUMAN	nuclear receptor co-repressor 1	177	Potential.|Interaction with ZBTB33 and HEXIM1.				cellular lipid metabolic process|chromatin modification|negative regulation of JNK cascade|regulation of glycolysis by negative regulation of transcription from an RNA polymerase II promoter|regulation of lipid transport by negative regulation of transcription from an RNA polymerase II promoter|spindle assembly|transcription from RNA polymerase II promoter	nuclear chromatin|spindle microtubule|transcriptional repressor complex	histone deacetylase binding|transcription corepressor activity|transcription regulatory region DNA binding			upper_aerodigestive_tract(2)|ovary(1)|central_nervous_system(1)|kidney(1)	5				UCEC - Uterine corpus endometrioid carcinoma (92;0.101)		CTCTTCCTTTGAGAGTTTTGA	0.398													6	187	---	---	---	---	PASS
SMCR7	125170	broad.mit.edu	37	17	18167409	18167409	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18167409C>A	uc002gst.2	+	4	907	c.696C>A	c.(694-696)TTC>TTA	p.F232L	SMCR7_uc002gsu.2_3'UTR|SMCR7_uc010vxq.1_Missense_Mutation_p.F243L	NM_139162	NP_631901	Q96C03	SMCR7_HUMAN	Smith-Magenis syndrome chromosome region,	232						integral to membrane	protein binding				0	all_neural(463;0.228)					AGCTTGAGTTCTGCCCCCGTG	0.711													5	6	---	---	---	---	PASS
SMCR7	125170	broad.mit.edu	37	17	18167821	18167821	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18167821C>T	uc002gst.2	+	4	1319	c.1108C>T	c.(1108-1110)CTG>TTG	p.L370L	SMCR7_uc002gsu.2_3'UTR|SMCR7_uc010vxq.1_Silent_p.L381L	NM_139162	NP_631901	Q96C03	SMCR7_HUMAN	Smith-Magenis syndrome chromosome region,	370						integral to membrane	protein binding				0	all_neural(463;0.228)					TTGCTCGGCTCTGGGGCAGCT	0.677													40	57	---	---	---	---	PASS
CCDC144B	284047	broad.mit.edu	37	17	18525829	18525829	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18525829G>C	uc002gub.1	-	2	483	c.398C>G	c.(397-399)CCT>CGT	p.P133R	CCDC144B_uc002gua.3_RNA|CCDC144B_uc010vyc.1_RNA|CCDC144B_uc002guc.1_Missense_Mutation_p.P133R	NM_182568	NP_872374			coiled-coil domain containing 144B											ovary(1)|skin(1)	2						GTTATTTTGAGGAAGACTTTC	0.299													23	101	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	17	19091380	19091380	+	IGR	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:19091380T>C								GRAPL (29232 upstream) : EPN2 (49310 downstream)																							gagaagtttctctgaacgtgt	0.129													28	326	---	---	---	---	PASS
EPN2	22905	broad.mit.edu	37	17	19232925	19232925	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:19232925C>T	uc002gvd.3	+	9	1824	c.1376C>T	c.(1375-1377)TCT>TTT	p.S459F	EPN2_uc010cql.1_Missense_Mutation_p.S168F|EPN2_uc002gve.3_Missense_Mutation_p.S402F|EPN2_uc002gvf.3_Missense_Mutation_p.S174F|EPN2_uc010vyo.1_Missense_Mutation_p.S167F|EPN2_uc010vyp.1_Missense_Mutation_p.S395F|EPN2_uc010vyq.1_Missense_Mutation_p.S396F|EPN2_uc002gvh.1_Missense_Mutation_p.S459F|EPN2_uc002gvj.3_Missense_Mutation_p.S122F	NM_014964	NP_055779	O95208	EPN2_HUMAN	epsin 2 isoform b	459	6 X 3 AA repeats of [DE]-P-W.				endocytosis		lipid binding			skin(1)	1	all_cancers(12;3.11e-05)|all_epithelial(12;0.00121)|Hepatocellular(7;0.00345)|Breast(13;0.143)					GATGACTTTTCTGAATTTGAC	0.428													13	335	---	---	---	---	PASS
AKAP10	11216	broad.mit.edu	37	17	19861529	19861529	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:19861529C>G	uc002gwo.2	-	4	812	c.675G>C	c.(673-675)CTG>CTC	p.L225L	AKAP10_uc002gwp.1_Silent_p.L225L|AKAP10_uc010cqw.1_Silent_p.L225L|AKAP10_uc010vze.1_Silent_p.L146L	NM_007202	NP_009133	O43572	AKA10_HUMAN	A-kinase anchor protein 10 precursor	225	RGS 1.				blood coagulation|protein localization	cytosol|mitochondrion|plasma membrane	signal transducer activity			skin(1)	1	all_cancers(12;2.08e-05)|all_epithelial(12;0.00158)|Breast(13;0.165)					TTCTATTATTCAGGTCAATTC	0.428													5	196	---	---	---	---	PASS
PIGS	94005	broad.mit.edu	37	17	26881331	26881331	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26881331G>A	uc002hbo.2	-	12	1948	c.1575C>T	c.(1573-1575)CTC>CTT	p.L525L	UNC119_uc002hbk.2_5'Flank|UNC119_uc002hbm.2_5'Flank|PIGS_uc002hbn.2_Silent_p.L517L|PIGS_uc010wap.1_Silent_p.L464L	NM_033198	NP_149975	Q96S52	PIGS_HUMAN	phosphatidylinositol glycan anchor biosynthesis,	525	Helical; (Potential).				attachment of GPI anchor to protein|C-terminal protein lipidation	GPI-anchor transamidase complex	protein binding			breast(2)|urinary_tract(1)|kidney(1)	4	Lung NSC(42;0.00431)					TAGGCAGGAAGAGTGGGATGT	0.542													11	213	---	---	---	---	PASS
GIT1	28964	broad.mit.edu	37	17	27901841	27901841	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27901841G>T	uc002hef.2	-	20	2379	c.2165C>A	c.(2164-2166)CCA>CAA	p.P722Q	GIT1_uc002heg.2_Missense_Mutation_p.P731Q|GIT1_uc010wbg.1_Missense_Mutation_p.P708Q|GIT1_uc010csb.1_3'UTR	NM_014030	NP_054749	Q9Y2X7	GIT1_HUMAN	G protein-coupled receptor kinase interactor 1	722	Interaction with PXN and TGFB1I1 (By similarity).				regulation of ARF GTPase activity|regulation of G-protein coupled receptor protein signaling pathway	cytoplasm|focal adhesion	ARF GTPase activator activity|protein binding|zinc ion binding				0				READ - Rectum adenocarcinoma(3;0.0419)|Colorectal(3;0.069)		GCCGGGCTCTGGGGGCACTGT	0.667													7	23	---	---	---	---	PASS
ANKRD13B	124930	broad.mit.edu	37	17	27936431	27936431	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27936431G>A	uc002hei.2	+	7	927	c.814G>A	c.(814-816)GAA>AAA	p.E272K	ANKRD13B_uc002heh.2_Missense_Mutation_p.E140K|ANKRD13B_uc002hej.2_RNA	NM_152345	NP_689558	Q86YJ7	AN13B_HUMAN	ankyrin repeat domain 13B	272											0						GAATGGGTATGAAGCTAAGGT	0.607													6	52	---	---	---	---	PASS
CRLF3	51379	broad.mit.edu	37	17	29120551	29120551	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:29120551C>G	uc002hfr.3	-	5	852	c.743G>C	c.(742-744)AGA>ACA	p.R248T	CRLF3_uc010wbr.1_Missense_Mutation_p.R132T	NM_015986	NP_057070	Q8IUI8	CRLF3_HUMAN	cytokine receptor-like factor 3	248	Fibronectin type-III.				negative regulation of cell growth|negative regulation of S phase of mitotic cell cycle|positive regulation of cell cycle arrest|positive regulation of JAK-STAT cascade|positive regulation of transcription from RNA polymerase II promoter	cytoplasm					0		all_hematologic(16;0.014)|Acute lymphoblastic leukemia(14;0.0236)|Myeloproliferative disorder(56;0.0255)				GGCGCAGACTCTGAACTGGTA	0.453													53	156	---	---	---	---	PASS
ATAD5	79915	broad.mit.edu	37	17	29185178	29185178	+	Splice_Site	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:29185178G>T	uc002hfs.1	+	9	3140	c.2794_splice	c.e9-1	p.F932_splice	ATAD5_uc002hft.1_Splice_Site_p.F829_splice	NM_024857	NP_079133	Q96QE3	ATAD5_HUMAN	ATPase family, AAA domain containing 5						response to DNA damage stimulus	nucleus	ATP binding|nucleoside-triphosphatase activity			ovary(3)	3		all_hematologic(16;0.0202)|Acute lymphoblastic leukemia(14;0.0238)|Myeloproliferative disorder(56;0.0393)				CTTTATTGCAGTTCATGAGGA	0.308													27	104	---	---	---	---	PASS
C17orf42	79736	broad.mit.edu	37	17	29227467	29227467	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:29227467C>T	uc002hfu.2	-	3	679	c.609G>A	c.(607-609)ATG>ATA	p.M203I	C17orf42_uc002hfv.2_RNA|C17orf42_uc002hfw.2_Missense_Mutation_p.M203I	NM_024683	NP_078959	Q96QE5	TEFM_HUMAN	hypothetical protein LOC79736	203					oxidative phosphorylation|regulation of transcription, DNA-dependent|transcription from mitochondrial promoter	mitochondrial nucleoid|ribonucleoprotein complex	DNA polymerase processivity factor activity|nucleic acid binding|protein binding			ovary(1)	1		all_cancers(10;4.64e-07)|all_hematologic(16;0.014)|Acute lymphoblastic leukemia(14;0.0236)|Myeloproliferative disorder(56;0.0255)				ATATTCCTCTCATTAAACTCC	0.438													20	196	---	---	---	---	PASS
ADAP2	55803	broad.mit.edu	37	17	29261292	29261292	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:29261292C>T	uc002hfx.2	+	5	766	c.487C>T	c.(487-489)CTG>TTG	p.L163L	ADAP2_uc010csk.2_Silent_p.L169L|ADAP2_uc002hfy.2_Silent_p.L163L|ADAP2_uc010csl.2_RNA	NM_018404	NP_060874	Q9NPF8	ADAP2_HUMAN	centaurin-alpha 2 protein	163	PH 1.				heart development|regulation of ARF GTPase activity	mitochondrial envelope|plasma membrane	ARF GTPase activator activity|inositol 1,3,4,5 tetrakisphosphate binding|phosphatidylinositol-3,4,5-trisphosphate binding|phosphatidylinositol-3,4-bisphosphate binding|phosphatidylinositol-4,5-bisphosphate binding|protein binding, bridging|zinc ion binding	p.?(1)		ovary(1)	1						AGAAGGCCTCCTGAAGTACTT	0.488													25	58	---	---	---	---	PASS
NF1	4763	broad.mit.edu	37	17	29587397	29587397	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:29587397G>C	uc002hgg.2	+	34	4774	c.4441G>C	c.(4441-4443)GAT>CAT	p.D1481H	NF1_uc002hgh.2_Missense_Mutation_p.D1460H|NF1_uc002hgi.1_Missense_Mutation_p.D493H	NM_001042492	NP_001035957	P21359	NF1_HUMAN	neurofibromin isoform 1	1481					actin cytoskeleton organization|adrenal gland development|artery morphogenesis|camera-type eye morphogenesis|cerebral cortex development|collagen fibril organization|forebrain astrocyte development|forebrain morphogenesis|heart development|liver development|MAPKKK cascade|metanephros development|myelination in peripheral nervous system|negative regulation of cell migration|negative regulation of endothelial cell proliferation|negative regulation of MAP kinase activity|negative regulation of MAPKKK cascade|negative regulation of neuroblast proliferation|negative regulation of oligodendrocyte differentiation|negative regulation of transcription factor import into nucleus|osteoblast differentiation|phosphatidylinositol 3-kinase cascade|pigmentation|positive regulation of adenylate cyclase activity|positive regulation of neuron apoptosis|Ras protein signal transduction|regulation of blood vessel endothelial cell migration|regulation of bone resorption|response to hypoxia|smooth muscle tissue development|spinal cord development|sympathetic nervous system development|visual learning|wound healing	axon|cytoplasm|dendrite|intrinsic to internal side of plasma membrane|nucleus	protein binding|Ras GTPase activator activity	p.?(3)		soft_tissue(159)|central_nervous_system(56)|lung(28)|large_intestine(27)|haematopoietic_and_lymphoid_tissue(18)|ovary(18)|autonomic_ganglia(12)|breast(3)|skin(3)|stomach(2)|thyroid(1)|prostate(1)|kidney(1)|pancreas(1)	330		all_cancers(10;1.29e-12)|all_epithelial(10;0.00347)|all_hematologic(16;0.00556)|Acute lymphoblastic leukemia(14;0.00593)|Breast(31;0.014)|Myeloproliferative disorder(56;0.0255)|all_lung(9;0.0321)|Lung NSC(157;0.0659)		UCEC - Uterine corpus endometrioid carcinoma (4;4.38e-05)|all cancers(4;1.64e-26)|Epithelial(4;9.15e-23)|OV - Ovarian serous cystadenocarcinoma(4;3.58e-21)|GBM - Glioblastoma multiforme(4;0.00146)		GTTTTTCCTTGATATAGCATC	0.343			D|Mis|N|F|S|O		neurofibroma|glioma	neurofibroma|glioma			Neurofibromatosis_type_1	TCGA GBM(6;<1E-08)|TSP Lung(7;0.0071)|TCGA Ovarian(3;0.0088)			12	284	---	---	---	---	PASS
RHBDL3	162494	broad.mit.edu	37	17	30611719	30611719	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30611719C>T	uc002hhe.1	+	3	191	c.177C>T	c.(175-177)TTC>TTT	p.F59F	RHBDL3_uc010csw.1_Silent_p.F51F|RHBDL3_uc010csx.1_Silent_p.F59F|RHBDL3_uc010csy.1_Intron|RHBDL3_uc002hhf.1_Intron	NM_138328	NP_612201	P58872	RHBL3_HUMAN	rhomboid protease 3	59	EF-hand 1.				proteolysis	integral to membrane	calcium ion binding|serine-type endopeptidase activity			ovary(1)	1		Breast(31;0.116)|Ovarian(249;0.182)				CAGGCAAGTTCCGGAGTCTTC	0.592													36	51	---	---	---	---	PASS
ACCN1	40	broad.mit.edu	37	17	31355356	31355356	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:31355356C>G	uc002hhu.2	-	4	1163	c.889G>C	c.(889-891)GAC>CAC	p.D297H	ACCN1_uc002hht.2_Missense_Mutation_p.D348H	NM_001094	NP_001085	Q16515	ACCN1_HUMAN	amiloride-sensitive cation channel 1, neuronal	297	Extracellular (By similarity).				central nervous system development|peripheral nervous system development|synaptic transmission	integral to plasma membrane	ligand-gated sodium channel activity|protein binding			ovary(2)|large_intestine(1)|central_nervous_system(1)	4		Breast(31;0.042)|Ovarian(249;0.202)		UCEC - Uterine corpus endometrioid carcinoma (308;0.13)|BRCA - Breast invasive adenocarcinoma(366;0.215)	Amiloride(DB00594)	GGAAAAAAGTCGAGGCCCATC	0.562													7	85	---	---	---	---	PASS
CCL3	6348	broad.mit.edu	37	17	34416616	34416616	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:34416616C>G	uc002hkv.2	-	2	203	c.101G>C	c.(100-102)TGC>TCC	p.C34S		NM_002983	NP_002974	P10147	CCL3_HUMAN	chemokine (C-C motif) ligand 3	34					cell-cell signaling|cellular calcium ion homeostasis|cellular component movement|cytoskeleton organization|exocytosis|G-protein coupled receptor protein signaling pathway|immune response|inflammatory response|regulation of viral genome replication	extracellular space|soluble fraction	chemoattractant activity|chemokine activity|signal transducer activity				0		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0182)		GTAGCTGAAGCAGCAGGCGGT	0.552													55	113	---	---	---	---	PASS
DDX52	11056	broad.mit.edu	37	17	35980966	35980966	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:35980966C>T	uc002hoi.1	-	12	1567	c.1529G>A	c.(1528-1530)GGA>GAA	p.G510E	DDX52_uc002hoh.1_Missense_Mutation_p.G402E	NM_007010	NP_008941	Q9Y2R4	DDX52_HUMAN	ATP-dependent RNA helicase ROK1 isoform a	510	Helicase C-terminal.					nucleolus	ATP binding|ATP-dependent helicase activity|RNA binding			ovary(1)|skin(1)	2		Breast(25;0.00637)|Ovarian(249;0.15)				AATTGCTTTTCCCTTATTCCC	0.323													40	87	---	---	---	---	PASS
STAC2	342667	broad.mit.edu	37	17	37373068	37373068	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37373068G>T	uc002hrs.2	-	4	800	c.581C>A	c.(580-582)CCC>CAC	p.P194H	STAC2_uc010cvt.2_Missense_Mutation_p.P52H	NM_198993	NP_945344	Q6ZMT1	STAC2_HUMAN	SH3 and cysteine rich domain 2	194					intracellular signal transduction		metal ion binding			pancreas(1)	1						CTCACCAGTGGGTGGGGACTC	0.512													9	10	---	---	---	---	PASS
IKZF3	22806	broad.mit.edu	37	17	37949016	37949016	+	Silent	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37949016T>G	uc002hsu.2	-	4	396	c.334A>C	c.(334-336)AGG>CGG	p.R112R	IKZF3_uc002htd.2_Silent_p.R78R|IKZF3_uc010cwd.2_Intron|IKZF3_uc002hsv.2_Silent_p.R78R|IKZF3_uc010cwe.2_Silent_p.R112R|IKZF3_uc010cwf.2_Intron|IKZF3_uc010cwg.2_Intron|IKZF3_uc002hsw.2_Silent_p.R112R|IKZF3_uc002hsx.2_Silent_p.R112R|IKZF3_uc002hsy.2_Silent_p.R112R|IKZF3_uc002hsz.2_Silent_p.R112R|IKZF3_uc002hta.2_Silent_p.R112R|IKZF3_uc002htb.2_RNA|IKZF3_uc010cwh.2_Intron|IKZF3_uc002htc.2_5'UTR	NM_012481	NP_036613	Q9UKT9	IKZF3_HUMAN	aiolos isoform 1	112					B cell activation|mesoderm development|regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(2)|kidney(2)|skin(2)	6	Breast(7;4.5e-103)|Colorectal(19;0.000442)|Esophageal squamous(10;0.052)		UCEC - Uterine corpus endometrioid carcinoma (11;0.000126)|Colorectal(5;6.23e-08)|COAD - Colon adenocarcinoma(5;8.58e-06)|Lung(15;0.00193)|LUAD - Lung adenocarcinoma(14;0.0664)|LUSC - Lung squamous cell carcinoma(15;0.171)			CTGGTTGGCCTGCTACTATCG	0.393													28	197	---	---	---	---	PASS
PSMD3	5709	broad.mit.edu	37	17	38152561	38152561	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38152561C>A	uc002htn.1	+	10	1610	c.1446C>A	c.(1444-1446)TTC>TTA	p.F482L	PSMD3_uc010wen.1_RNA|PSMD3_uc010weo.1_Missense_Mutation_p.F383L	NM_002809	NP_002800	O43242	PSMD3_HUMAN	proteasome 26S non-ATPase subunit 3	482					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|regulation of protein catabolic process|S phase of mitotic cell cycle|viral reproduction	proteasome complex	enzyme regulator activity|protein binding			ovary(1)|pancreas(1)	2	Colorectal(19;0.000442)					GCATCTCCTTCTGCCTAGATA	0.557													54	300	---	---	---	---	PASS
THRA	7067	broad.mit.edu	37	17	38230776	38230776	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38230776C>G	uc002htw.2	+	2	518	c.35C>G	c.(34-36)TCA>TGA	p.S12*	THRA_uc010cwp.1_Nonsense_Mutation_p.S12*|THRA_uc002htv.2_Nonsense_Mutation_p.S12*|THRA_uc002htx.2_Nonsense_Mutation_p.S12*	NM_003250	NP_003241	P10827	THA_HUMAN	thyroid hormone receptor, alpha isoform 2	12	Modulating.				negative regulation of RNA polymerase II transcriptional preinitiation complex assembly|negative regulation of transcription initiation, DNA-dependent|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|transcription from RNA polymerase II promoter	cytosol|nucleoplasm	protein domain specific binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|TBP-class protein binding|thyroid hormone binding|thyroid hormone receptor activity|transcription regulatory region DNA binding|zinc ion binding				0	Colorectal(19;0.000442)	Myeloproliferative disorder(1115;0.0255)			Levothyroxine(DB00451)|Liothyronine(DB00279)	GAGTGTGGGTCAGACCCAGAG	0.582													8	62	---	---	---	---	PASS
WIPF2	147179	broad.mit.edu	37	17	38421164	38421164	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38421164C>T	uc002hug.1	+	5	976	c.736C>T	c.(736-738)CAG>TAG	p.Q246*	WIPF2_uc002huh.1_Nonsense_Mutation_p.Q96*|WIPF2_uc010cww.1_Nonsense_Mutation_p.Q96*|WIPF2_uc002hui.1_Nonsense_Mutation_p.Q246*|WIPF2_uc010cwx.1_Intron|WIPF2_uc010cwy.1_Nonsense_Mutation_p.Q246*	NM_133264	NP_573571	Q8TF74	WIPF2_HUMAN	WIRE protein	246						cytoplasm|cytoskeleton	actin binding			upper_aerodigestive_tract(1)|ovary(1)|pancreas(1)	3						ACCAAGTGGCCAGTCTCTGGC	0.617										HNSCC(43;0.11)			12	255	---	---	---	---	PASS
KRT28	162605	broad.mit.edu	37	17	38956043	38956043	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38956043C>A	uc002hvh.1	-	1	169	c.103G>T	c.(103-105)GCA>TCA	p.A35S		NM_181535	NP_853513	Q7Z3Y7	K1C28_HUMAN	keratin 25D	35	Gly-rich.|Head.					cytoplasm|intermediate filament	structural molecule activity			ovary(1)	1		Breast(137;0.000301)				CCACCACATGCACTGCTGCCT	0.547													15	180	---	---	---	---	PASS
KRT12	3859	broad.mit.edu	37	17	39023065	39023065	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39023065T>A	uc002hvk.2	-	1	398	c.374A>T	c.(373-375)GAA>GTA	p.E125V		NM_000223	NP_000214	Q99456	K1C12_HUMAN	keratin 12	125	Rod.|Coil 1A.				visual perception	intermediate filament	structural molecule activity			ovary(1)	1		Breast(137;0.000301)				AGTTTCTTTTTCTGATCCAGA	0.463													23	403	---	---	---	---	PASS
HAP1	9001	broad.mit.edu	37	17	39883619	39883619	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39883619C>T	uc002hxm.1	-	9	1374	c.1362G>A	c.(1360-1362)GTG>GTA	p.V454V	JUP_uc010wfs.1_Intron|HAP1_uc002hxn.1_Intron|HAP1_uc002hxo.1_Intron|HAP1_uc002hxp.1_Intron	NM_177977	NP_817084	P54257	HAP1_HUMAN	huntingtin-associated protein 1 isoform 2	454	Glu-rich.|HAP1 N-terminal.				brain development|protein localization|synaptic transmission	actin cytoskeleton	protein binding			ovary(2)	2		Breast(137;0.000162)	BRCA - Breast invasive adenocarcinoma(4;0.0677)			GGAGGGTCTTCACCTCCTCCT	0.627													24	119	---	---	---	---	PASS
ACLY	47	broad.mit.edu	37	17	40030069	40030069	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40030069C>T	uc002hyg.2	-	23	2800	c.2637G>A	c.(2635-2637)CAG>CAA	p.Q879Q	ACLY_uc002hyh.2_Silent_p.Q869Q|ACLY_uc002hyi.2_Silent_p.Q933Q|ACLY_uc010wfx.1_Silent_p.Q923Q|ACLY_uc010wfy.1_Silent_p.Q608Q	NM_001096	NP_001087	P53396	ACLY_HUMAN	ATP citrate lyase isoform 1	879					ATP catabolic process|cellular carbohydrate metabolic process|citrate metabolic process|coenzyme A metabolic process|energy reserve metabolic process|long-chain fatty-acyl-CoA biosynthetic process|positive regulation of cellular metabolic process|triglyceride biosynthetic process	citrate lyase complex|cytosol|nucleus	ATP binding|ATP citrate synthase activity|citrate (pro-3S)-lyase activity|metal ion binding|protein binding|succinate-CoA ligase (ADP-forming) activity			ovary(2)|central_nervous_system(1)	3		Breast(137;0.000143)				CTCACCTTTTCTGGAACCAGA	0.577													44	215	---	---	---	---	PASS
UBTF	7343	broad.mit.edu	37	17	42289010	42289010	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42289010C>T	uc002igb.2	-	9	1078	c.1011G>A	c.(1009-1011)CAG>CAA	p.Q337Q	UBTF_uc002igc.2_Silent_p.Q300Q|UBTF_uc010czs.2_Silent_p.Q337Q|UBTF_uc002igd.2_Silent_p.Q300Q|UBTF_uc010czt.2_Silent_p.Q337Q|UBTF_uc002ige.2_Silent_p.Q300Q	NM_014233	NP_055048	P17480	UBF1_HUMAN	upstream binding transcription factor, RNA	337	HMG box 3.				positive regulation of transcription from RNA polymerase I promoter|termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription initiation from RNA polymerase I promoter	nucleolus|nucleoplasm	DNA binding|protein binding				0		Breast(137;0.00765)|Prostate(33;0.0181)		BRCA - Breast invasive adenocarcinoma(366;0.114)		CCTTCTCCTTCTGGGACAGCA	0.582													25	147	---	---	---	---	PASS
NMT1	4836	broad.mit.edu	37	17	43138687	43138687	+	5'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43138687C>T	uc002ihz.2	+	1					DCAKD_uc010dab.1_5'Flank|NMT1_uc010dac.1_RNA|NMT1_uc002iia.2_RNA	NM_021079	NP_066565	P30419	NMT1_HUMAN	N-myristoyltransferase 1						activation of pro-apoptotic gene products|induction of apoptosis by intracellular signals|N-terminal protein myristoylation|protein lipoylation	actin cytoskeleton|cell junction|cytosol	glycylpeptide N-tetradecanoyltransferase activity				0		Prostate(33;0.155)				GCCCTGCTCTCGCAACTCAAG	0.597													16	16	---	---	---	---	PASS
PLEKHM1	9842	broad.mit.edu	37	17	43531063	43531063	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43531063C>T	uc002ija.2	-	7	2325	c.2155G>A	c.(2155-2157)GAG>AAG	p.E719K	PLEKHM1_uc010wjm.1_Missense_Mutation_p.E691K|PLEKHM1_uc002ijb.2_Missense_Mutation_p.E194K|PLEKHM1_uc010wjn.1_Missense_Mutation_p.E668K|PLEKHM1_uc002ijc.2_Missense_Mutation_p.E173K	NM_014798	NP_055613	Q9Y4G2	PKHM1_HUMAN	pleckstrin homology domain containing, family M	719	PH 2.				intracellular signal transduction	cytoplasm	metal ion binding				0	Renal(3;0.0405)					AGCATCTTCTCATTGTTCCTG	0.527													12	54	---	---	---	---	PASS
PLEKHM1	9842	broad.mit.edu	37	17	43552830	43552830	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43552830C>T	uc002ija.2	-	4	729	c.559G>A	c.(559-561)GAG>AAG	p.E187K	PLEKHM1_uc010wjm.1_Missense_Mutation_p.E159K|PLEKHM1_uc002ijb.2_5'UTR|PLEKHM1_uc010wjn.1_Missense_Mutation_p.E136K|hsa-mir-4315-1|MI0015844_5'Flank	NM_014798	NP_055613	Q9Y4G2	PKHM1_HUMAN	pleckstrin homology domain containing, family M	187					intracellular signal transduction	cytoplasm	metal ion binding				0	Renal(3;0.0405)					AGCGTCCACTCATTTAAGATG	0.572													18	123	---	---	---	---	PASS
PLEKHM1	9842	broad.mit.edu	37	17	43552914	43552914	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43552914C>A	uc002ija.2	-	4	645	c.475G>T	c.(475-477)GAG>TAG	p.E159*	PLEKHM1_uc010wjm.1_Nonsense_Mutation_p.E131*|PLEKHM1_uc002ijb.2_5'UTR|PLEKHM1_uc010wjn.1_Nonsense_Mutation_p.E108*|hsa-mir-4315-1|MI0015844_5'Flank	NM_014798	NP_055613	Q9Y4G2	PKHM1_HUMAN	pleckstrin homology domain containing, family M	159	RUN.				intracellular signal transduction	cytoplasm	metal ion binding				0	Renal(3;0.0405)					TCGCCCTCCTCAGCATCCCGG	0.597													11	82	---	---	---	---	PASS
C17orf57	124989	broad.mit.edu	37	17	45412602	45412602	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45412602C>G	uc002iln.2	+	5	482	c.71C>G	c.(70-72)TCT>TGT	p.S24C	ITGB3_uc010wkr.1_RNA|C17orf57_uc002ilm.2_Missense_Mutation_p.S24C|C17orf57_uc002ill.1_5'UTR|C17orf57_uc010daz.1_Missense_Mutation_p.S24C	NM_152347	NP_689560	Q8IY85	CQ057_HUMAN	hypothetical protein LOC124989	24							calcium ion binding			breast(1)|central_nervous_system(1)|skin(1)	3						GGCTCTAATTCTTTTGCAACT	0.343													45	303	---	---	---	---	PASS
SP6	80320	broad.mit.edu	37	17	45925390	45925390	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45925390G>C	uc002img.1	-	2	738	c.406C>G	c.(406-408)CAG>GAG	p.Q136E	SP6_uc002imh.1_Missense_Mutation_p.Q136E	NM_199262	NP_954871	Q3SY56	SP6_HUMAN	Sp6 transcription factor	136					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)	1						AGCGCGCCCTGAGTGTGGGGG	0.687													6	20	---	---	---	---	PASS
SKAP1	8631	broad.mit.edu	37	17	46247982	46247982	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:46247982C>G	uc002ini.1	-	10	978	c.866G>C	c.(865-867)CGA>CCA	p.R289P	SKAP1_uc002inj.1_Missense_Mutation_p.R289P|SKAP1_uc010dbd.1_Missense_Mutation_p.R195P|SKAP1_uc010dbe.1_Missense_Mutation_p.R289P	NM_003726	NP_003717	Q86WV1	SKAP1_HUMAN	src kinase associated phosphoprotein 1 isoform	289					positive regulation of transcription from RNA polymerase II promoter|T cell receptor signaling pathway	cytoplasm|nucleus|plasma membrane	antigen binding|protein kinase binding|SH2 domain binding				0						TCCTTTTCGTCGAGTGCCACT	0.403													135	266	---	---	---	---	PASS
CACNA1G	8913	broad.mit.edu	37	17	48696040	48696040	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48696040G>C	uc002irk.1	+	33	5824	c.5452G>C	c.(5452-5454)GAG>CAG	p.E1818Q	CACNA1G_uc002irj.1_Missense_Mutation_p.E1784Q|CACNA1G_uc002irl.1_Missense_Mutation_p.E1795Q|CACNA1G_uc002irm.1_Missense_Mutation_p.E1784Q|CACNA1G_uc002irn.1_Missense_Mutation_p.E1777Q|CACNA1G_uc002iro.1_Missense_Mutation_p.E1784Q|CACNA1G_uc002irp.1_Missense_Mutation_p.E1818Q|CACNA1G_uc002irq.1_Missense_Mutation_p.E1795Q|CACNA1G_uc002irr.1_Missense_Mutation_p.E1818Q|CACNA1G_uc002irs.1_Missense_Mutation_p.E1807Q|CACNA1G_uc002irt.1_Missense_Mutation_p.E1800Q|CACNA1G_uc002irv.1_Missense_Mutation_p.E1807Q|CACNA1G_uc002irw.1_Missense_Mutation_p.E1795Q|CACNA1G_uc002iru.1_Missense_Mutation_p.E1784Q|CACNA1G_uc002irx.1_Missense_Mutation_p.E1731Q|CACNA1G_uc002iry.1_Missense_Mutation_p.E1720Q|CACNA1G_uc002irz.1_Missense_Mutation_p.E1724Q|CACNA1G_uc002isa.1_Missense_Mutation_p.E1697Q|CACNA1G_uc002isb.1_Missense_Mutation_p.E1738Q|CACNA1G_uc002isc.1_Missense_Mutation_p.E1720Q|CACNA1G_uc002isd.1_Missense_Mutation_p.E1706Q|CACNA1G_uc002ise.1_Missense_Mutation_p.E1686Q|CACNA1G_uc002isf.1_Missense_Mutation_p.E1713Q|CACNA1G_uc002isg.1_Missense_Mutation_p.E1679Q|CACNA1G_uc002ish.1_Missense_Mutation_p.E1686Q|CACNA1G_uc002isi.1_Missense_Mutation_p.E1674Q	NM_018896	NP_061496	O43497	CAC1G_HUMAN	voltage-dependent calcium channel alpha 1G	1818	IV.|Extracellular (Potential).				axon guidance	voltage-gated calcium channel complex	low voltage-gated calcium channel activity			breast(1)	1	Breast(11;6.7e-17)		BRCA - Breast invasive adenocarcinoma(22;7.52e-09)		Ethosuximide(DB00593)|Flunarizine(DB04841)|Levetiracetam(DB01202)|Mibefradil(DB01388)|Pimozide(DB01100)|Trimethadione(DB00347)|Verapamil(DB00661)|Zonisamide(DB00909)	CTGTGACCAGGAGTCCACCTG	0.572													11	62	---	---	---	---	PASS
WFIKKN2	124857	broad.mit.edu	37	17	48916857	48916857	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48916857C>T	uc002isv.3	+						WFIKKN2_uc010dbu.2_Intron	NM_175575	NP_783165	Q8TEU8	WFKN2_HUMAN	WFIKKN2 protein							extracellular region	metalloendopeptidase inhibitor activity|protein binding|serine-type endopeptidase inhibitor activity			ovary(2)|skin(1)	3			BRCA - Breast invasive adenocarcinoma(22;1.09e-08)			CTGGCTCTTTCAGGAGTGTGA	0.567													9	50	---	---	---	---	PASS
SPAG9	9043	broad.mit.edu	37	17	49197929	49197929	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:49197929G>C	uc002itc.2	-	1	298	c.89C>G	c.(88-90)TCC>TGC	p.S30C	SPAG9_uc002itb.2_Missense_Mutation_p.S30C|SPAG9_uc002itd.2_Missense_Mutation_p.S30C	NM_001130528	NP_001124000	O60271	JIP4_HUMAN	sperm associated antigen 9 isoform 1	30					positive regulation of cell migration|positive regulation of muscle cell differentiation|retrograde transport, endosome to Golgi|spermatogenesis	acrosomal vesicle|integral to membrane|perinuclear region of cytoplasm				lung(4)|breast(1)	5			BRCA - Breast invasive adenocarcinoma(22;4.24e-07)			GCGGTAGATGGAGCCGGCCAG	0.667													7	14	---	---	---	---	PASS
CA10	56934	broad.mit.edu	37	17	49710972	49710972	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:49710972G>C	uc002itw.3	-	8	1815	c.829C>G	c.(829-831)CAG>GAG	p.Q277E	CA10_uc002itu.3_Missense_Mutation_p.Q206E|CA10_uc002itv.3_Missense_Mutation_p.Q283E|CA10_uc002itx.3_Missense_Mutation_p.Q277E|CA10_uc002ity.3_Missense_Mutation_p.Q277E|CA10_uc002itz.2_Missense_Mutation_p.Q277E	NM_020178	NP_064563	Q9NS85	CAH10_HUMAN	carbonic anhydrase X	277					brain development					ovary(1)|skin(1)	2			BRCA - Breast invasive adenocarcinoma(22;4.74e-06)			AGAAAGATCTGAGATGGCTGG	0.507													35	77	---	---	---	---	PASS
C17orf47	284083	broad.mit.edu	37	17	56620706	56620706	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56620706G>C	uc002iwq.1	-	1	978	c.842C>G	c.(841-843)TCT>TGT	p.S281C	SEPT4_uc010wnx.1_5'Flank|SEPT4_uc010wny.1_5'Flank	NM_001038704	NP_001033793	Q8NEP4	CQ047_HUMAN	hypothetical protein LOC284083	281										breast(1)	1	Medulloblastoma(34;0.127)|all_neural(34;0.237)					TACACCATCAGAATCTTTAAG	0.448													9	247	---	---	---	---	PASS
TRIM37	4591	broad.mit.edu	37	17	57181689	57181689	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57181689G>T	uc002iwy.3	-	2	532	c.88C>A	c.(88-90)CAT>AAT	p.H30N	TRIM37_uc002iwz.3_Missense_Mutation_p.H30N|TRIM37_uc002ixa.3_5'UTR|TRIM37_uc010woc.1_Intron|uc002ixb.2_5'Flank	NM_001005207	NP_001005207	O94972	TRI37_HUMAN	tripartite motif-containing 37 protein	30	RING-type; degenerate.					perinuclear region of cytoplasm|peroxisome	ligase activity|protein binding|zinc ion binding			lung(2)|pancreas(2)|ovary(1)|skin(1)|breast(1)	7	Medulloblastoma(34;0.0922)|all_neural(34;0.101)					TTGGAGCAATGAGGACACAGG	0.368									Mulibrey_Nanism				4	103	---	---	---	---	PASS
BCAS3	54828	broad.mit.edu	37	17	59001762	59001762	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59001762G>A	uc002iyv.3	+						BCAS3_uc010wow.1_Intron|BCAS3_uc002iyu.3_Intron|BCAS3_uc002iyw.3_Intron|BCAS3_uc002iyx.1_Intron|BCAS3_uc002iyy.3_Intron	NM_001099432	NP_001092902	Q9H6U6	BCAS3_HUMAN	breast carcinoma amplified sequence 3 isoform 1							nucleus				ovary(2)|central_nervous_system(2)|skin(1)	5			BRCA - Breast invasive adenocarcinoma(1;3.11e-12)|Epithelial(12;8.2e-07)|all cancers(12;5.33e-06)			TTATTTCTTTGTGAAGGTGCT	0.433													4	140	---	---	---	---	PASS
BCAS3	54828	broad.mit.edu	37	17	59161929	59161929	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59161929G>C	uc002iyv.3	+						BCAS3_uc002iyu.3_Intron|BCAS3_uc002iyw.3_Intron|BCAS3_uc002iyy.3_Intron|BCAS3_uc002iyz.3_Intron|BCAS3_uc002iza.3_Intron	NM_001099432	NP_001092902	Q9H6U6	BCAS3_HUMAN	breast carcinoma amplified sequence 3 isoform 1							nucleus				ovary(2)|central_nervous_system(2)|skin(1)	5			BRCA - Breast invasive adenocarcinoma(1;3.11e-12)|Epithelial(12;8.2e-07)|all cancers(12;5.33e-06)			GCCTCAGGTAGAAAACCACCT	0.468													15	60	---	---	---	---	PASS
BRIP1	83990	broad.mit.edu	37	17	59761290	59761290	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59761290C>T	uc002izk.1	-	20	3258	c.3117G>A	c.(3115-3117)GAG>GAA	p.E1039E		NM_032043	NP_114432	Q9BX63	FANCJ_HUMAN	BRCA1 interacting protein C-terminal helicase 1	1039	Interaction with BRCA1.				DNA damage checkpoint|double-strand break repair|regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding			ovary(1)	1						TTTCCATCTTCTCTGTTTTGA	0.418			F|N|Mis			AML|leukemia|breast		Direct_reversal_of_damage|Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia				40	298	---	---	---	---	PASS
CCDC47	57003	broad.mit.edu	37	17	61842099	61842099	+	Splice_Site	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61842099C>G	uc002jbs.3	-	3	708	c.372_splice	c.e3+1	p.D124_splice	CCDC47_uc010ddx.2_Splice_Site_p.D124_splice|CCDC47_uc002jbt.2_Splice_Site_p.D124_splice	NM_020198	NP_064583	Q96A33	CCD47_HUMAN	coiled-coil domain containing 47 precursor							integral to membrane	protein binding				0						TGGATACCTACATCAACAATC	0.333													25	156	---	---	---	---	PASS
FTSJ3	117246	broad.mit.edu	37	17	61904193	61904193	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61904193C>T	uc002jbz.2	-						FTSJ3_uc002jca.2_Intron|PSMC5_uc002jcb.2_5'Flank|PSMC5_uc010ddy.2_5'Flank|PSMC5_uc010ddz.2_5'Flank|PSMC5_uc002jcc.2_5'Flank|PSMC5_uc002jcd.2_5'Flank	NM_017647	NP_060117	Q8IY81	RRMJ3_HUMAN	FtsJ homolog 3						RNA methylation|rRNA processing	nucleolus	methyltransferase activity|nucleic acid binding			ovary(1)	1						AATCCGGACTCACCCGTCTCC	0.577													9	75	---	---	---	---	PASS
CSH2	1443	broad.mit.edu	37	17	61950643	61950643	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61950643C>A	uc002jch.2	-	2	182	c.67G>T	c.(67-69)GAG>TAG	p.E23*	CSH2_uc002jcg.2_Nonsense_Mutation_p.E23*|CSH2_uc002jci.2_Nonsense_Mutation_p.E23*|GH2_uc002jcj.2_Intron|CSH2_uc002jck.2_Nonsense_Mutation_p.E23*	NM_020991	NP_066271	P01243	CSH_HUMAN	chorionic somatomammotropin hormone 2 isoform 1	23					female pregnancy|signal transduction	extracellular region	hormone activity|metal ion binding				0						GCACCAGCCTCTTGAAGCCAG	0.622													10	70	---	---	---	---	PASS
ABCA6	23460	broad.mit.edu	37	17	67111632	67111632	+	Intron	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:67111632T>A	uc002jhw.1	-						ABCA6_uc002jhx.1_Intron	NM_080284	NP_525023	Q8N139	ABCA6_HUMAN	ATP-binding cassette, sub-family A, member 6						transport	integral to membrane	ATP binding|ATPase activity			upper_aerodigestive_tract(2)|large_intestine(2)|ovary(2)|skin(1)	7	Breast(10;5.65e-12)					GCAAGCCTATTTTTAGAACAA	0.368													45	96	---	---	---	---	PASS
ABCA5	23461	broad.mit.edu	37	17	67270115	67270115	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:67270115G>T	uc002jif.2	-	19	3967	c.2749C>A	c.(2749-2751)CTT>ATT	p.L917I	ABCA5_uc002jic.2_Missense_Mutation_p.L140I|ABCA5_uc002jid.2_5'UTR|ABCA5_uc002jie.2_RNA|ABCA5_uc002jig.2_Missense_Mutation_p.L917I|ABCA5_uc002jih.2_Missense_Mutation_p.L917I|ABCA5_uc010dfe.2_Missense_Mutation_p.L917I	NM_018672	NP_061142	Q8WWZ7	ABCA5_HUMAN	ATP-binding cassette, sub-family A , member 5	917					cholesterol efflux|high-density lipoprotein particle remodeling|negative regulation of macrophage derived foam cell differentiation	Golgi membrane|integral to membrane|late endosome membrane|lysosomal membrane	ATP binding|ATPase activity			ovary(2)|central_nervous_system(1)|skin(1)	4	Breast(10;3.72e-11)					GAATTTTGAAGAAGCAGACTT	0.398													6	178	---	---	---	---	PASS
SDK2	54549	broad.mit.edu	37	17	71346925	71346925	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:71346925C>G	uc010dfm.2	-	42	5763	c.5763G>C	c.(5761-5763)CAG>CAC	p.Q1921H	SDK2_uc002jjt.3_Missense_Mutation_p.Q1061H	NM_001144952	NP_001138424	Q58EX2	SDK2_HUMAN	sidekick 2	1921	Extracellular (Potential).				cell adhesion	integral to membrane				ovary(2)	2						GGTTGGCTTTCTGGGCTGGAG	0.542													19	164	---	---	---	---	PASS
ARMC7	79637	broad.mit.edu	37	17	73106666	73106666	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73106666C>G	uc002jmw.1	+	2	502	c.200C>G	c.(199-201)TCG>TGG	p.S67W	ARMC7_uc002jmv.1_Missense_Mutation_p.S67W|ARMC7_uc010wru.1_Intron	NM_024585	NP_078861	Q9H6L4	ARMC7_HUMAN	armadillo repeat containing 7	67	ARM 1.						binding			pancreas(1)	1	all_lung(278;0.14)|Lung NSC(278;0.168)		LUSC - Lung squamous cell carcinoma(166;0.162)|Lung(188;0.235)			GATTCGCTGTCGGAGGAGAAT	0.537													15	125	---	---	---	---	PASS
SOCS3	9021	broad.mit.edu	37	17	76354523	76354523	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:76354523C>T	uc002jvl.2	-	2	1070	c.654G>A	c.(652-654)CTG>CTA	p.L218L		NM_003955	NP_003946	O14543	SOCS3_HUMAN	suppressor of cytokine signaling 3	218	SOCS box.				anti-apoptosis|interferon-gamma-mediated signaling pathway|JAK-STAT cascade|regulation of growth|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|type I interferon-mediated signaling pathway	cytosol	protein kinase inhibitor activity			ovary(1)	1			BRCA - Breast invasive adenocarcinoma(99;0.000688)|OV - Ovarian serous cystadenocarcinoma(97;0.0554)			CGTACTGGTCCAGGAACTCCC	0.622													4	84	---	---	---	---	PASS
CCDC40	55036	broad.mit.edu	37	17	78073442	78073442	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78073442C>G	uc010dht.2	+	20	3324	c.3297C>G	c.(3295-3297)CGC>CGG	p.R1099R	CCDC40_uc002jxm.3_Silent_p.R882R|CCDC40_uc002jxn.3_Silent_p.R495R|GAA_uc002jxo.2_5'Flank|GAA_uc002jxp.2_5'Flank|GAA_uc002jxq.2_5'Flank	NM_017950	NP_060420	Q4G0X9	CCD40_HUMAN	coiled-coil domain containing 40	1099					axonemal dynein complex assembly|ciliary cell motility|cilium movement involved in determination of left/right asymmetry|flagellar cell motility	cilium|cytoplasm				ovary(3)	3	all_neural(118;0.167)		OV - Ovarian serous cystadenocarcinoma(97;0.0292)|BRCA - Breast invasive adenocarcinoma(99;0.149)			AGCGCCAGCGCCTGGACAAGC	0.642													7	65	---	---	---	---	PASS
RNF213	57674	broad.mit.edu	37	17	78360162	78360162	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78360162C>T	uc002jyh.1	+	37	9094	c.8871C>T	c.(8869-8871)GTC>GTT	p.V2957V	uc002jyi.1_Intron|RNF213_uc010dhx.1_5'UTR	NM_020914	NP_065965	Q9HCF4	ALO17_HUMAN	ring finger protein 213	Error:Variant_position_missing_in_Q9HCF4_after_alignment										ovary(8)|lung(6)|breast(3)|large_intestine(2)|central_nervous_system(1)|pancreas(1)	21	all_neural(118;0.0538)		BRCA - Breast invasive adenocarcinoma(99;0.0252)|OV - Ovarian serous cystadenocarcinoma(97;0.057)			CCGCTCTCGTCAGCTACTTGA	0.532													10	180	---	---	---	---	PASS
C17orf70	80233	broad.mit.edu	37	17	79516348	79516348	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79516348C>G	uc002kaq.2	-	4	1342	c.1287G>C	c.(1285-1287)CTG>CTC	p.L429L	C17orf70_uc002kao.1_5'Flank|C17orf70_uc010wuq.1_RNA|C17orf70_uc002kap.2_Silent_p.L278L	NM_001109760	NP_001103230	Q0VG06	FP100_HUMAN	Fanconi anemia core complex 100 kDa subunit	429					DNA repair	cytoplasm|intermediate filament cytoskeleton|nucleoplasm	DNA binding			ovary(1)|skin(1)	2	all_neural(118;0.0878)|Melanoma(429;0.242)		BRCA - Breast invasive adenocarcinoma(99;0.0282)|OV - Ovarian serous cystadenocarcinoma(97;0.0371)			TGCAGGTCATCAGGCGGCCTT	0.607													6	77	---	---	---	---	PASS
FASN	2194	broad.mit.edu	37	17	80054246	80054246	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80054246G>A	uc002kdu.2	-	2	193	c.76C>T	c.(76-78)CTC>TTC	p.L26F		NM_004104	NP_004095	P49327	FAS_HUMAN	fatty acid synthase	26	Beta-ketoacyl synthase (By similarity).				energy reserve metabolic process|fatty acid biosynthetic process|long-chain fatty-acyl-CoA biosynthetic process|pantothenate metabolic process|positive regulation of cellular metabolic process|triglyceride biosynthetic process	cytosol|Golgi apparatus|melanosome|plasma membrane	3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity|3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity|3-oxoacyl-[acyl-carrier-protein] synthase activity|[acyl-carrier-protein] S-acetyltransferase activity|[acyl-carrier-protein] S-malonyltransferase activity|acyl carrier activity|cofactor binding|enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific) activity|myristoyl-[acyl-carrier-protein] hydrolase activity|oleoyl-[acyl-carrier-protein] hydrolase activity|palmitoyl-[acyl-carrier-protein] hydrolase activity|phosphopantetheine binding|protein binding|zinc ion binding			central_nervous_system(1)	1	all_neural(118;0.0878)|Ovarian(332;0.227)|all_lung(278;0.246)		OV - Ovarian serous cystadenocarcinoma(97;0.0211)|BRCA - Breast invasive adenocarcinoma(99;0.0237)		Cerulenin(DB01034)|Orlistat(DB01083)|Pyrazinamide(DB00339)	CCGCCGATGAGGTTGTCCCAG	0.647													19	100	---	---	---	---	PASS
COLEC12	81035	broad.mit.edu	37	18	333090	333090	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:333090C>G	uc002kkm.2	-	7	2085	c.1870G>C	c.(1870-1872)GAG>CAG	p.E624Q		NM_130386	NP_569057	Q5KU26	COL12_HUMAN	collectin sub-family member 12	624	Extracellular (Potential).|C-type lectin.				carbohydrate mediated signaling|innate immune response|phagocytosis, recognition|protein homooligomerization	collagen|integral to membrane	galactose binding|low-density lipoprotein particle binding|metal ion binding|pattern recognition receptor activity|scavenger receptor activity			ovary(1)|pancreas(1)	2		all_cancers(4;0.0442)|Myeloproliferative disorder(11;0.0426)				ATTTCTTTCTCAACTGAAAAA	0.393													26	351	---	---	---	---	PASS
COLEC12	81035	broad.mit.edu	37	18	335072	335072	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:335072G>T	uc002kkm.2	-	6	1701	c.1486C>A	c.(1486-1488)CGT>AGT	p.R496S		NM_130386	NP_569057	Q5KU26	COL12_HUMAN	collectin sub-family member 12	496	Collagen-like 2.|Extracellular (Potential).				carbohydrate mediated signaling|innate immune response|phagocytosis, recognition|protein homooligomerization	collagen|integral to membrane	galactose binding|low-density lipoprotein particle binding|metal ion binding|pattern recognition receptor activity|scavenger receptor activity			ovary(1)|pancreas(1)	2		all_cancers(4;0.0442)|Myeloproliferative disorder(11;0.0426)				TTGCCGCCACGCTCTCCGGGG	0.677													14	250	---	---	---	---	PASS
COLEC12	81035	broad.mit.edu	37	18	335092	335092	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:335092G>A	uc002kkm.2	-	6	1681	c.1466C>T	c.(1465-1467)CCA>CTA	p.P489L		NM_130386	NP_569057	Q5KU26	COL12_HUMAN	collectin sub-family member 12	489	Collagen-like 2.|Extracellular (Potential).				carbohydrate mediated signaling|innate immune response|phagocytosis, recognition|protein homooligomerization	collagen|integral to membrane	galactose binding|low-density lipoprotein particle binding|metal ion binding|pattern recognition receptor activity|scavenger receptor activity			ovary(1)|pancreas(1)	2		all_cancers(4;0.0442)|Myeloproliferative disorder(11;0.0426)				GGGACCAGCTGGTCCAATTGG	0.677													19	282	---	---	---	---	PASS
CLUL1	27098	broad.mit.edu	37	18	627255	627255	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:627255C>G	uc002kkp.2	+	5	727	c.582C>G	c.(580-582)CTC>CTG	p.L194L	CLUL1_uc010wys.1_Silent_p.L246L|CLUL1_uc002kkq.2_Silent_p.L194L	NM_014410	NP_055225	Q15846	CLUL1_HUMAN	clusterin-like 1 (retinal) precursor	194					cell death	extracellular region				ovary(2)	2						TGAATTCTCTCTTTAACAGGA	0.408													63	826	---	---	---	---	PASS
SMCHD1	23347	broad.mit.edu	37	18	2705786	2705786	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2705786G>A	uc002klm.3	+	14	2126	c.1937G>A	c.(1936-1938)GGA>GAA	p.G646E	SMCHD1_uc002klk.3_RNA|SMCHD1_uc002kll.3_5'Flank	NM_015295	NP_056110	A6NHR9	SMHD1_HUMAN	structural maintenance of chromosomes flexible	646					chromosome organization		ATP binding				0						GCTACAGGAGGAGAGGTTCAA	0.343													17	201	---	---	---	---	PASS
SMCHD1	23347	broad.mit.edu	37	18	2750347	2750347	+	Splice_Site	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2750347G>T	uc002klm.3	+	32	4197	c.4008_splice	c.e32-1	p.R1336_splice	SMCHD1_uc002klk.3_Splice_Site|SMCHD1_uc002kll.3_Splice_Site	NM_015295	NP_056110	A6NHR9	SMHD1_HUMAN	structural maintenance of chromosomes flexible						chromosome organization		ATP binding				0						TGTTTTGTTAGGGGAGAGCAT	0.338													13	164	---	---	---	---	PASS
SMCHD1	23347	broad.mit.edu	37	18	2750348	2750348	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2750348G>T	uc002klm.3	+	32	4197	c.4008G>T	c.(4006-4008)AGG>AGT	p.R1336S	SMCHD1_uc002klk.3_RNA|SMCHD1_uc002kll.3_RNA	NM_015295	NP_056110	A6NHR9	SMHD1_HUMAN	structural maintenance of chromosomes flexible	1336					chromosome organization		ATP binding				0						GTTTTGTTAGGGGAGAGCATA	0.343													13	163	---	---	---	---	PASS
EMILIN2	84034	broad.mit.edu	37	18	2891883	2891883	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2891883C>G	uc002kln.2	+	4	1917	c.1758C>G	c.(1756-1758)CTC>CTG	p.L586L		NM_032048	NP_114437	Q9BXX0	EMIL2_HUMAN	elastin microfibril interfacer 2 precursor	586	Potential.				cell adhesion	collagen	extracellular matrix constituent conferring elasticity|protein binding			skin(2)|ovary(1)	3				READ - Rectum adenocarcinoma(2;0.1)		TGAAATCTCTCAACGACACGA	0.463													15	190	---	---	---	---	PASS
LPIN2	9663	broad.mit.edu	37	18	2960699	2960699	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2960699G>T	uc002klo.2	-	2	379	c.140C>A	c.(139-141)CCT>CAT	p.P47H		NM_014646	NP_055461	Q92539	LPIN2_HUMAN	lipin 2	47	N-LIP.				fatty acid metabolic process|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent|triglyceride biosynthetic process	cytosol|endoplasmic reticulum membrane|nucleus	phosphatidate phosphatase activity|transcription coactivator activity			ovary(1)|skin(1)	2				READ - Rectum adenocarcinoma(2;0.0419)|Colorectal(6;0.156)		AACGTGAAAAGGTGAACACTG	0.488													24	386	---	---	---	---	PASS
MYOM1	8736	broad.mit.edu	37	18	3086147	3086147	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3086147C>A	uc002klp.2	-	30	4474	c.4140G>T	c.(4138-4140)GTG>GTT	p.V1380V	MYOM1_uc002klq.2_Silent_p.V1284V	NM_003803	NP_003794	P52179	MYOM1_HUMAN	myomesin 1 isoform a	1380	Ig-like C2-type 4.					striated muscle myosin thick filament	structural constituent of muscle			ovary(3)|central_nervous_system(1)|pancreas(1)	5						TAATATTTGCCACCTAGGAGA	0.343													14	265	---	---	---	---	PASS
MYOM1	8736	broad.mit.edu	37	18	3134771	3134771	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3134771G>A	uc002klp.2	-	16	2595	c.2261C>T	c.(2260-2262)TCA>TTA	p.S754L	MYOM1_uc002klq.2_Missense_Mutation_p.S754L	NM_003803	NP_003794	P52179	MYOM1_HUMAN	myomesin 1 isoform a	754	Fibronectin type-III 3.					striated muscle myosin thick filament	structural constituent of muscle			ovary(3)|central_nervous_system(1)|pancreas(1)	5						AACTACCACTGAGGTGTCTGT	0.488													16	260	---	---	---	---	PASS
DLGAP1	9229	broad.mit.edu	37	18	3502631	3502631	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3502631G>A	uc002kmf.2	-	9	2651	c.2584C>T	c.(2584-2586)CAT>TAT	p.H862Y	DLGAP1_uc010wyz.1_Missense_Mutation_p.H862Y|DLGAP1_uc002kme.1_Missense_Mutation_p.H560Y|DLGAP1_uc010dkn.2_Missense_Mutation_p.H570Y|DLGAP1_uc010wyw.1_Missense_Mutation_p.H568Y|DLGAP1_uc010wyx.1_Missense_Mutation_p.H584Y|DLGAP1_uc010wyy.1_Missense_Mutation_p.H546Y|DLGAP1_uc002kmg.2_Missense_Mutation_p.H560Y	NM_004746	NP_004737	O14490	DLGP1_HUMAN	discs large homolog-associated protein 1 isoform	862					synaptic transmission	cell junction|postsynaptic density|postsynaptic membrane				ovary(2)|pancreas(1)|skin(1)	4		Colorectal(8;0.0257)				GGTCTTGGATGAGCATTAGGA	0.383													36	367	---	---	---	---	PASS
DLGAP1	9229	broad.mit.edu	37	18	3879723	3879723	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3879723C>T	uc002kmf.2	-	1	413	c.346G>A	c.(346-348)GAT>AAT	p.D116N	DLGAP1_uc010wyz.1_Missense_Mutation_p.D116N|DLGAP1_uc002kmk.2_Missense_Mutation_p.D116N|uc002kml.1_Intron	NM_004746	NP_004737	O14490	DLGP1_HUMAN	discs large homolog-associated protein 1 isoform	116					synaptic transmission	cell junction|postsynaptic density|postsynaptic membrane				ovary(2)|pancreas(1)|skin(1)	4		Colorectal(8;0.0257)				TGATAGCCATCGCGGCTGAGT	0.687													12	132	---	---	---	---	PASS
DLGAP1	9229	broad.mit.edu	37	18	3879819	3879819	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3879819C>T	uc002kmf.2	-	1	317	c.250G>A	c.(250-252)GAG>AAG	p.E84K	DLGAP1_uc010wyz.1_Missense_Mutation_p.E84K|DLGAP1_uc002kmk.2_Missense_Mutation_p.E84K|uc002kml.1_Intron	NM_004746	NP_004737	O14490	DLGP1_HUMAN	discs large homolog-associated protein 1 isoform	84					synaptic transmission	cell junction|postsynaptic density|postsynaptic membrane				ovary(2)|pancreas(1)|skin(1)	4		Colorectal(8;0.0257)				AGGGCACACTCGTCCTTCAGC	0.682													13	282	---	---	---	---	PASS
DLGAP1	9229	broad.mit.edu	37	18	3879831	3879831	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3879831C>G	uc002kmf.2	-	1	305	c.238G>C	c.(238-240)GAG>CAG	p.E80Q	DLGAP1_uc010wyz.1_Missense_Mutation_p.E80Q|DLGAP1_uc002kmk.2_Missense_Mutation_p.E80Q|uc002kml.1_Intron	NM_004746	NP_004737	O14490	DLGP1_HUMAN	discs large homolog-associated protein 1 isoform	80					synaptic transmission	cell junction|postsynaptic density|postsynaptic membrane				ovary(2)|pancreas(1)|skin(1)	4		Colorectal(8;0.0257)				TCCTTCAGCTCTTGCTGCGAG	0.677													12	279	---	---	---	---	PASS
DLGAP1	9229	broad.mit.edu	37	18	3879957	3879957	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3879957C>T	uc002kmf.2	-	1	179	c.112G>A	c.(112-114)GAG>AAG	p.E38K	DLGAP1_uc010wyz.1_Missense_Mutation_p.E38K|DLGAP1_uc002kmk.2_Missense_Mutation_p.E38K|uc002kml.1_Intron	NM_004746	NP_004737	O14490	DLGP1_HUMAN	discs large homolog-associated protein 1 isoform	38					synaptic transmission	cell junction|postsynaptic density|postsynaptic membrane				ovary(2)|pancreas(1)|skin(1)	4		Colorectal(8;0.0257)				GGGTGGTGCTCCACTGGGCTC	0.672													19	263	---	---	---	---	PASS
EPB41L3	23136	broad.mit.edu	37	18	5395691	5395691	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:5395691C>T	uc002kmt.1	-	20	3075	c.2989G>A	c.(2989-2991)GAT>AAT	p.D997N	EPB41L3_uc010wzh.1_Missense_Mutation_p.D828N|EPB41L3_uc002kmu.1_Missense_Mutation_p.D775N|EPB41L3_uc010dkq.1_Missense_Mutation_p.D666N|EPB41L3_uc002kms.1_Missense_Mutation_p.D232N|EPB41L3_uc010wze.1_Missense_Mutation_p.D302N|EPB41L3_uc010wzf.1_Missense_Mutation_p.D294N|EPB41L3_uc010wzg.1_Missense_Mutation_p.D269N|EPB41L3_uc010dkr.2_Missense_Mutation_p.D389N	NM_012307	NP_036439	Q9Y2J2	E41L3_HUMAN	erythrocyte membrane protein band 4.1-like 3	997	Carboxyl-terminal (CTD).				cortical actin cytoskeleton organization	cell-cell junction|cytoplasm|cytoskeleton|extrinsic to membrane	actin binding|structural molecule activity			ovary(5)	5						GGCTCCAGATCTGTGCCTGGA	0.512													59	415	---	---	---	---	PASS
ARHGAP28	79822	broad.mit.edu	37	18	6859846	6859846	+	Missense_Mutation	SNP	G	T	T	rs147162571		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:6859846G>T	uc010wzi.1	+	4	383	c.145G>T	c.(145-147)GCA>TCA	p.A49S	ARHGAP28_uc002knc.2_Missense_Mutation_p.A174S|ARHGAP28_uc002knd.2_Missense_Mutation_p.A67S|ARHGAP28_uc002kne.2_Missense_Mutation_p.A67S|ARHGAP28_uc002knf.2_Missense_Mutation_p.A58S			B4DXL2	B4DXL2_HUMAN	SubName: Full=Putative uncharacterized protein ARHGAP28;	49					signal transduction	intracellular				pancreas(1)	1		Colorectal(10;0.168)				CCTGTCTGACGCATCCCAGGA	0.428													62	395	---	---	---	---	PASS
LAMA1	284217	broad.mit.edu	37	18	6977865	6977865	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:6977865C>G	uc002knm.2	-	44	6300	c.6206G>C	c.(6205-6207)AGA>ACA	p.R2069T	LAMA1_uc010wzj.1_Missense_Mutation_p.R1545T	NM_005559	NP_005550	P25391	LAMA1_HUMAN	laminin, alpha 1 precursor	2069	Domain II and I.				axon guidance|cell adhesion|cell surface receptor linked signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	extracellular space|laminin-1 complex|laminin-3 complex	extracellular matrix structural constituent|receptor binding			ovary(8)|large_intestine(4)|upper_aerodigestive_tract(2)|breast(2)|skin(2)|pancreas(2)|central_nervous_system(1)	21		Colorectal(10;0.172)			Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)	TTTGACTTTTCTTCCAGCCAA	0.398													9	56	---	---	---	---	PASS
LAMA1	284217	broad.mit.edu	37	18	7037697	7037697	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:7037697G>C	uc002knm.2	-	12	1711	c.1617C>G	c.(1615-1617)ATC>ATG	p.I539M	LAMA1_uc010wzj.1_Missense_Mutation_p.I15M	NM_005559	NP_005550	P25391	LAMA1_HUMAN	laminin, alpha 1 precursor	539	Laminin IV type A 1.				axon guidance|cell adhesion|cell surface receptor linked signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	extracellular space|laminin-1 complex|laminin-3 complex	extracellular matrix structural constituent|receptor binding			ovary(8)|large_intestine(4)|upper_aerodigestive_tract(2)|breast(2)|skin(2)|pancreas(2)|central_nervous_system(1)	21		Colorectal(10;0.172)			Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)	GCTGAGACGGGATCTTCCTGG	0.507													22	135	---	---	---	---	PASS
ANKRD12	23253	broad.mit.edu	37	18	9258259	9258259	+	Missense_Mutation	SNP	A	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:9258259A>C	uc002knv.2	+	9	5251	c.4994A>C	c.(4993-4995)AAT>ACT	p.N1665T	ANKRD12_uc002knw.2_Missense_Mutation_p.N1642T|ANKRD12_uc002knx.2_Missense_Mutation_p.N1642T|ANKRD12_uc010dkx.1_Missense_Mutation_p.N1372T	NM_015208	NP_056023	Q6UB98	ANR12_HUMAN	ankyrin repeat domain 12 isoform 1	1665						nucleus				ovary(2)|central_nervous_system(1)	3						GGAAACCTAAATGAACAAGAT	0.348													13	97	---	---	---	---	PASS
ANKRD12	23253	broad.mit.edu	37	18	9263833	9263833	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:9263833C>T	uc002knv.2	+	10	5967	c.5710C>T	c.(5710-5712)CGA>TGA	p.R1904*	ANKRD12_uc002knw.2_Nonsense_Mutation_p.R1881*|ANKRD12_uc002knx.2_Nonsense_Mutation_p.R1881*	NM_015208	NP_056023	Q6UB98	ANR12_HUMAN	ankyrin repeat domain 12 isoform 1	1904						nucleus				ovary(2)|central_nervous_system(1)	3						AGAGCTTTTTCGACAACAGGA	0.299													26	174	---	---	---	---	PASS
SPIRE1	56907	broad.mit.edu	37	18	12506643	12506643	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:12506643G>C	uc002kre.2	-						SPIRE1_uc002krc.2_Intron|SPIRE1_uc010wzw.1_Intron|SPIRE1_uc010wzx.1_Intron|SPIRE1_uc010wzy.1_Intron	NM_001128626	NP_001122098	Q08AE8	SPIR1_HUMAN	spire homolog 1 isoform a							cytoskeleton|perinuclear region of cytoplasm	actin binding				0						AATCGTGCCTGAAAGAACCAA	0.393													29	343	---	---	---	---	PASS
CEP192	55125	broad.mit.edu	37	18	13048854	13048854	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13048854C>G	uc010xac.1	+						CEP192_uc010dlf.1_Intron|CEP192_uc010xad.1_Intron|CEP192_uc002kru.2_Intron|CEP192_uc002krs.1_Intron	NM_032142	NP_115518	E9PF99	E9PF99_HUMAN	centrosomal protein 192kDa											ovary(4)|pancreas(1)	5						TTTCTCACTTCTAGGACACTT	0.289													11	92	---	---	---	---	PASS
CEP192	55125	broad.mit.edu	37	18	13071029	13071029	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13071029C>G	uc010xac.1	+						CEP192_uc010dlf.1_Intron|CEP192_uc010xad.1_Intron|CEP192_uc002kru.2_Intron|CEP192_uc002krv.2_Intron|CEP192_uc002krw.2_Intron|CEP192_uc002krx.2_5'Flank	NM_032142	NP_115518	E9PF99	E9PF99_HUMAN	centrosomal protein 192kDa											ovary(4)|pancreas(1)	5						AGAATTCTTTCTTTCTTAGGA	0.244													5	223	---	---	---	---	PASS
C18orf1	753	broad.mit.edu	37	18	13438368	13438368	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13438368C>T	uc002ksa.2	+	4	834	c.166C>T	c.(166-168)CCG>TCG	p.P56S	C18orf1_uc002ksb.2_Missense_Mutation_p.P56S	NM_181481	NP_852146	O15165	CR001_HUMAN	hypothetical protein LOC753 isoform alpha 1	56	Extracellular (Potential).					integral to membrane|plasma membrane				ovary(2)|skin(1)	3				READ - Rectum adenocarcinoma(73;0.0642)		GCACCCGCCTCCGGGCATCTT	0.542													32	257	---	---	---	---	PASS
C18orf1	753	broad.mit.edu	37	18	13438379	13438379	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13438379C>T	uc002ksa.2	+	4	845	c.177C>T	c.(175-177)TTC>TTT	p.F59F	C18orf1_uc002ksb.2_Silent_p.F59F	NM_181481	NP_852146	O15165	CR001_HUMAN	hypothetical protein LOC753 isoform alpha 1	59	Extracellular (Potential).					integral to membrane|plasma membrane				ovary(2)|skin(1)	3				READ - Rectum adenocarcinoma(73;0.0642)		CGGGCATCTTCAACTGTAAGT	0.547													41	247	---	---	---	---	PASS
C18orf1	753	broad.mit.edu	37	18	13645550	13645550	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13645550G>A	uc002ksa.2	+	7	1483	c.815G>A	c.(814-816)CGC>CAC	p.R272H	C18orf1_uc002ksb.2_Missense_Mutation_p.R254H|C18orf1_uc002kse.2_Missense_Mutation_p.R235H|C18orf1_uc002ksf.2_Missense_Mutation_p.R217H|C18orf1_uc002ksg.1_Missense_Mutation_p.R195H|C18orf1_uc002ksh.1_Missense_Mutation_p.R214H|C18orf1_uc002ksi.1_Missense_Mutation_p.R196H	NM_181481	NP_852146	O15165	CR001_HUMAN	hypothetical protein LOC753 isoform alpha 1	272	Cytoplasmic (Potential).					integral to membrane|plasma membrane				ovary(2)|skin(1)	3				READ - Rectum adenocarcinoma(73;0.0642)		CATCACCAGCGCAGCAACGCA	0.587													4	161	---	---	---	---	PASS
GATA6	2627	broad.mit.edu	37	18	19780796	19780796	+	3'UTR	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:19780796G>T	uc002ktt.1	+	7					GATA6_uc002ktu.1_3'UTR	NM_005257	NP_005248	Q92908	GATA6_HUMAN	GATA binding protein 6						blood coagulation|cardiac vascular smooth muscle cell differentiation|cellular response to hypoxia|intestinal epithelial cell differentiation|male gonad development|negative regulation of apoptosis|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transforming growth factor-beta1 production|negative regulation of transforming growth factor-beta2 production|outflow tract septum morphogenesis|positive regulation of angiogenesis|positive regulation of cell cycle arrest|positive regulation of transcription from RNA polymerase II promoter|response to drug|response to growth factor stimulus		protein binding|protein kinase binding|sequence-specific DNA binding transcription factor activity|transcription factor binding|transcription regulatory region DNA binding|zinc ion binding			central_nervous_system(3)	3	all_cancers(21;0.00271)|all_epithelial(16;7.31e-05)|Ovarian(2;0.116)|Lung NSC(20;0.123)|all_lung(20;0.246)		STAD - Stomach adenocarcinoma(5;0.106)			AGCCCACGCCGCCAGGAGGCA	0.677													8	17	---	---	---	---	PASS
DSG2	1829	broad.mit.edu	37	18	29104399	29104399	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29104399A>T	uc002kwu.3	+							NM_001943	NP_001934	Q14126	DSG2_HUMAN	desmoglein 2 preproprotein						cellular component disassembly involved in apoptosis|homophilic cell adhesion	desmosome|integral to membrane	calcium ion binding			central_nervous_system(5)|ovary(2)|breast(1)|skin(1)	9			OV - Ovarian serous cystadenocarcinoma(10;0.0068)			GACATTTTTCATTGCTCTGCA	0.398													8	76	---	---	---	---	PASS
ASXL3	80816	broad.mit.edu	37	18	31323250	31323250	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:31323250T>C	uc010dmg.1	+	12	3493	c.3438T>C	c.(3436-3438)TCT>TCC	p.S1146S	ASXL3_uc002kxq.2_Silent_p.S853S	NM_030632	NP_085135	Q9C0F0	ASXL3_HUMAN	additional sex combs like 3	1146					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	metal ion binding			ovary(2)|pancreas(1)	3						AAGTCTCTTCTACCCCTGAAA	0.507													9	38	---	---	---	---	PASS
ME2	4200	broad.mit.edu	37	18	48473422	48473422	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:48473422C>G	uc002ley.2	+	16	1879	c.1623C>G	c.(1621-1623)TTC>TTG	p.F541L	ME2_uc010dpd.2_3'UTR	NM_002396	NP_002387	P23368	MAOM_HUMAN	malic enzyme 2, NAD(+)-dependent, mitochondrial	541					malate metabolic process	mitochondrial matrix	electron carrier activity|malate dehydrogenase (decarboxylating) activity|malate dehydrogenase (oxaloacetate-decarboxylating) activity|metal ion binding|NAD binding				0		Colorectal(6;0.0273)|all_epithelial(6;0.118)		Colorectal(21;0.0313)|READ - Rectum adenocarcinoma(32;0.105)|STAD - Stomach adenocarcinoma(97;0.184)	NADH(DB00157)	AAATGGCTTTCCGATACCCAG	0.383													23	319	---	---	---	---	PASS
TCF4	6925	broad.mit.edu	37	18	52899786	52899786	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:52899786C>G	uc002lfz.2	-	17	2215	c.1603G>C	c.(1603-1605)GAT>CAT	p.D535H	TCF4_uc002lfw.3_Missense_Mutation_p.D375H|TCF4_uc010xdu.1_Missense_Mutation_p.D405H|TCF4_uc010xdv.1_Missense_Mutation_p.D405H|TCF4_uc002lfx.2_Missense_Mutation_p.D464H|TCF4_uc010xdw.1_Missense_Mutation_p.D405H|TCF4_uc002lfy.2_Missense_Mutation_p.D493H|TCF4_uc010xdx.1_Missense_Mutation_p.D511H|TCF4_uc010dph.1_Missense_Mutation_p.D535H|TCF4_uc010xdy.1_Missense_Mutation_p.D511H|TCF4_uc002lga.2_Missense_Mutation_p.D637H|TCF4_uc002lgb.1_Missense_Mutation_p.D375H|TCF4_uc010dpi.2_Missense_Mutation_p.D541H|TCF4_uc002lfv.2_Missense_Mutation_p.D318H	NM_003199	NP_003190	P15884	ITF2_HUMAN	transcription factor 4 isoform b	535			D -> G (in PTHS; loss of function).		positive regulation of neuron differentiation|protein-DNA complex assembly|transcription initiation from RNA polymerase II promoter	transcription factor complex	E-box binding|protein C-terminus binding|protein heterodimerization activity|RNA polymerase II core promoter proximal region sequence-specific DNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|sequence-specific DNA binding RNA polymerase recruiting transcription factor activity|TFIIB-class binding transcription factor activity|TFIIB-class transcription factor binding			ovary(1)|lung(1)	2				Colorectal(16;0.00108)|READ - Rectum adenocarcinoma(59;0.0649)|COAD - Colon adenocarcinoma(17;0.0718)		TTGTCGTCATCTAATTTCTTG	0.413													6	116	---	---	---	---	PASS
CDH19	28513	broad.mit.edu	37	18	64197089	64197089	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:64197089G>T	uc002lkc.1	-	9	1589	c.1451C>A	c.(1450-1452)TCT>TAT	p.S484Y	CDH19_uc010dql.1_RNA|CDH19_uc010xey.1_Missense_Mutation_p.S484Y	NM_021153	NP_066976	Q9H159	CAD19_HUMAN	cadherin 19, type 2 preproprotein	484	Cadherin 5.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(1)|skin(1)	2		Esophageal squamous(42;0.0132)				TACCTGACCAGAGCCTGCATT	0.279													42	143	---	---	---	---	PASS
NETO1	81832	broad.mit.edu	37	18	70417456	70417456	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:70417456T>A	uc002lkw.2	-	9	1666	c.1382A>T	c.(1381-1383)CAG>CTG	p.Q461L	NETO1_uc002lkx.1_Missense_Mutation_p.Q460L|NETO1_uc002lky.1_Missense_Mutation_p.Q461L	NM_138966	NP_620416	Q8TDF5	NETO1_HUMAN	neuropilin- and tolloid-like protein 1 isoform 3	461	Cytoplasmic (Potential).				memory|regulation of long-term neuronal synaptic plasticity|visual learning	cell junction|excitatory synapse|extracellular region|integral to membrane|postsynaptic density|postsynaptic membrane	receptor activity			ovary(2)|skin(2)	4		Esophageal squamous(42;0.129)		READ - Rectum adenocarcinoma(1;0.0487)		TTTTCCTGGCTGTGTGGGCAT	0.483													4	90	---	---	---	---	PASS
FBXO15	201456	broad.mit.edu	37	18	71791809	71791809	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:71791809G>A	uc002lle.2	-						FBXO15_uc002llf.2_Intron	NM_152676	NP_689889	Q8NCQ5	FBX15_HUMAN	F-box protein 15 isoform 1											ovary(2)|pancreas(1)	3		Esophageal squamous(42;0.103)|Prostate(75;0.173)		BRCA - Breast invasive adenocarcinoma(31;0.143)		TCCTCCTTCTGAAAAGTTAAT	0.363													4	187	---	---	---	---	PASS
FBXO15	201456	broad.mit.edu	37	18	71796839	71796839	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:71796839A>G	uc002lle.2	-	5	694	c.358T>C	c.(358-360)TTA>CTA	p.L120L	FBXO15_uc002llf.2_Silent_p.L196L	NM_152676	NP_689889	Q8NCQ5	FBX15_HUMAN	F-box protein 15 isoform 1	120										ovary(2)|pancreas(1)	3		Esophageal squamous(42;0.103)|Prostate(75;0.173)		BRCA - Breast invasive adenocarcinoma(31;0.143)		GCCCAACCTAAACCAAATATT	0.303													21	55	---	---	---	---	PASS
ZNF236	7776	broad.mit.edu	37	18	74635112	74635112	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74635112C>G	uc002lmi.2	+	21	3835	c.3637C>G	c.(3637-3639)CAT>GAT	p.H1213D	ZNF236_uc002lmj.2_RNA	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	1213	C2H2-type 23.				cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)		TCTCGATTGTCATGTGAAGAC	0.383													13	59	---	---	---	---	PASS
ZNF236	7776	broad.mit.edu	37	18	74639006	74639006	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74639006G>C	uc002lmi.2	+	23	4233	c.4035G>C	c.(4033-4035)CTG>CTC	p.L1345L	ZNF236_uc002lmj.2_RNA	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	1345					cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)		GGGGTGACCTGACCGTGTCTC	0.418													22	117	---	---	---	---	PASS
ADNP2	22850	broad.mit.edu	37	18	77895042	77895042	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77895042G>A	uc002lnw.2	+	4	2201	c.1746G>A	c.(1744-1746)GTG>GTA	p.V582V		NM_014913	NP_055728	Q6IQ32	ADNP2_HUMAN	ADNP homeobox 2	582					cellular response to oxidative stress|cellular response to retinoic acid|negative regulation of cell death|neuron differentiation|positive regulation of cell growth	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)|breast(3)|central_nervous_system(1)	8		all_cancers(4;1.06e-15)|all_epithelial(4;2.36e-10)|all_lung(4;0.000302)|Lung NSC(4;0.000518)|Esophageal squamous(42;0.0212)|Ovarian(4;0.0256)|all_hematologic(56;0.15)|Melanoma(33;0.2)		Epithelial(2;1.1e-11)|OV - Ovarian serous cystadenocarcinoma(15;7.54e-09)|BRCA - Breast invasive adenocarcinoma(31;0.00247)|STAD - Stomach adenocarcinoma(84;0.164)		ATCAGCCAGTGAGACCTGGTG	0.537													18	83	---	---	---	---	PASS
MED16	10025	broad.mit.edu	37	19	875362	875362	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:875362G>C	uc002lqd.1	-	10	1804	c.1653C>G	c.(1651-1653)CTC>CTG	p.L551L	MED16_uc010drw.1_Silent_p.L376L|MED16_uc002lqe.2_Silent_p.L540L|MED16_uc002lqf.2_Silent_p.L540L|MED16_uc010xfv.1_Intron|MED16_uc010xfw.1_Silent_p.L471L|MED16_uc010xfx.1_Silent_p.L396L|MED16_uc010xfy.1_Intron|MED16_uc010xfz.1_5'Flank	NM_005481	NP_005472	Q9Y2X0	MED16_HUMAN	mediator complex subunit 16	551					androgen receptor signaling pathway|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	receptor activity|thyroid hormone receptor binding|thyroid hormone receptor coactivator activity|vitamin D receptor binding				0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;6.59e-06)|all_lung(49;9.97e-06)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		CGATGAGGAAGAGCTTGGTGT	0.647													30	50	---	---	---	---	PASS
MUM1	84939	broad.mit.edu	37	19	1360266	1360266	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1360266G>C	uc010xgm.1	+	4	415	c.346G>C	c.(346-348)GAC>CAC	p.D116H	MUM1_uc010dsi.2_Missense_Mutation_p.D48H|MUM1_uc002lrz.2_Missense_Mutation_p.D117H|MUM1_uc002lsb.2_Missense_Mutation_p.D48H|MUM1_uc002lsc.1_Missense_Mutation_p.D48H			Q2TAK8	MUM1_HUMAN	SubName: Full=MUM1 protein;	116					chromatin organization|DNA repair	nucleus	nucleosome binding|protein binding				0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;3.55e-06)|all_lung(49;5.41e-06)|Breast(49;0.000172)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		AGGTAGAGCTGACCGGTCTCT	0.597											OREG0025088	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	70	107	---	---	---	---	PASS
MUM1	84939	broad.mit.edu	37	19	1360504	1360504	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1360504G>C	uc010xgm.1	+	4	653	c.584G>C	c.(583-585)GGA>GCA	p.G195A	MUM1_uc010dsi.2_Missense_Mutation_p.G127A|MUM1_uc002lrz.2_Missense_Mutation_p.G196A|MUM1_uc002lsb.2_Missense_Mutation_p.G127A|MUM1_uc002lsc.1_Missense_Mutation_p.G127A			Q2TAK8	MUM1_HUMAN	SubName: Full=MUM1 protein;	195					chromatin organization|DNA repair	nucleus	nucleosome binding|protein binding				0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;3.55e-06)|all_lung(49;5.41e-06)|Breast(49;0.000172)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		CTCCCAGCTGGAGGTGGTGCC	0.532											OREG0025088	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	35	42	---	---	---	---	PASS
MOBKL2A	126308	broad.mit.edu	37	19	2078284	2078284	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2078284C>T	uc002luu.2	-	1	435	c.276G>A	c.(274-276)TCG>TCA	p.S92S	MOBKL2A_uc002luv.2_Silent_p.S92S	NM_130807	NP_570719	Q96BX8	MOL2A_HUMAN	MOB-LAK	92						intracellular	metal ion binding			lung(1)	1		Ovarian(11;1.78e-06)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		TGGGGCCCCCCGACATGACGG	0.612													5	30	---	---	---	---	PASS
NFIC	4782	broad.mit.edu	37	19	3381931	3381931	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3381931C>G	uc010xhi.1	+	2	314	c.252C>G	c.(250-252)ATC>ATG	p.I84M	NFIC_uc002lxo.2_Missense_Mutation_p.I75M|NFIC_uc010xhh.1_Missense_Mutation_p.I75M|NFIC_uc002lxp.2_Missense_Mutation_p.I84M|NFIC_uc010xhj.1_Missense_Mutation_p.I84M|NFIC_uc002lxq.1_Missense_Mutation_p.I36M	NM_205843	NP_995315	P08651	NFIC_HUMAN	nuclear factor I/C isoform 2	84	CTF/NF-I.				DNA replication|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;7.8e-05)|Epithelial(107;2.94e-108)|BRCA - Breast invasive adenocarcinoma(158;0.00154)|STAD - Stomach adenocarcinoma(1328;0.191)		GCAAGGACATCCGGCCCGAGT	0.677													6	149	---	---	---	---	PASS
PIP5K1C	23396	broad.mit.edu	37	19	3642902	3642902	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3642902C>T	uc002lyj.1	-						PIP5K1C_uc010xhq.1_Intron|PIP5K1C_uc010xhr.1_Intron	NM_012398	NP_036530	O60331	PI51C_HUMAN	phosphatidylinositol-4-phosphate 5-kinase, type						axon guidance	cytosol|plasma membrane	1-phosphatidylinositol-4-phosphate 5-kinase activity|ATP binding			stomach(2)|skin(2)	4		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.95e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0026)|STAD - Stomach adenocarcinoma(1328;0.183)		GGTTGGGTCTCACCTGCCATC	0.552													6	127	---	---	---	---	PASS
PTPRS	5802	broad.mit.edu	37	19	5244280	5244280	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5244280C>G	uc002mbv.2	-	11	1436	c.1202G>C	c.(1201-1203)TGG>TCG	p.W401S	PTPRS_uc002mbu.1_Missense_Mutation_p.W388S|PTPRS_uc010xin.1_Missense_Mutation_p.W388S|PTPRS_uc002mbw.2_Missense_Mutation_p.W388S|PTPRS_uc002mbx.2_Missense_Mutation_p.W392S|PTPRS_uc002mby.2_Missense_Mutation_p.W388S	NM_002850	NP_002841	Q13332	PTPRS_HUMAN	protein tyrosine phosphatase, receptor type,	401	Fibronectin type-III 1.|Extracellular (Potential).				cell adhesion	integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			large_intestine(2)|ovary(1)|central_nervous_system(1)	4				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0321)|Lung(535;0.182)		GGCCGACACCCAGATCTCGTA	0.647													9	81	---	---	---	---	PASS
LONP1	9361	broad.mit.edu	37	19	5692044	5692044	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5692044C>T	uc002mcx.2	-	18	2912	c.2879G>A	c.(2878-2880)TGA>TAA	p.*960*	LONP1_uc002mcy.2_Silent_p.*896*|LONP1_uc010duh.2_Silent_p.*701*|LONP1_uc010dui.2_Silent_p.*944*|LONP1_uc002mcz.2_Silent_p.*764*	NM_004793	NP_004784	P36776	LONM_HUMAN	mitochondrial lon peptidase 1 precursor	960					cellular chaperone-mediated protein complex assembly|cellular response to oxidative stress|misfolded or incompletely synthesized protein catabolic process|mitochondrial DNA metabolic process|oxidation-dependent protein catabolic process|protein homooligomerization|response to hypoxia	mitochondrial nucleoid	ADP binding|ATP binding|ATP-dependent peptidase activity|DNA polymerase binding|G-quadruplex DNA binding|mitochondrial heavy strand promoter anti-sense binding|mitochondrial light strand promoter anti-sense binding|sequence-specific DNA binding|serine-type endopeptidase activity|single-stranded DNA binding|single-stranded RNA binding				0						GGGTGGCCGTCACCGTTCCAC	0.687													4	92	---	---	---	---	PASS
VAV1	7409	broad.mit.edu	37	19	6825109	6825109	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6825109G>C	uc002mfu.1	+	7	797	c.700G>C	c.(700-702)GAG>CAG	p.E234Q	VAV1_uc010xjh.1_Missense_Mutation_p.E202Q|VAV1_uc010dva.1_Missense_Mutation_p.E234Q|VAV1_uc002mfv.1_Missense_Mutation_p.E179Q	NM_005428	NP_005419	P15498	VAV_HUMAN	vav 1 guanine nucleotide exchange factor	234	DH.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|platelet activation|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|T cell costimulation	cytosol|plasma membrane	metal ion binding|protein binding|sequence-specific DNA binding transcription factor activity			lung(4)|ovary(4)|breast(3)|central_nervous_system(2)|kidney(2)|skin(1)	16						TCAAGACATTGAGATCATCTT	0.537													58	165	---	---	---	---	PASS
EMR1	2015	broad.mit.edu	37	19	6896534	6896534	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6896534C>T	uc002mfw.2	+	3	258	c.220C>T	c.(220-222)CCA>TCA	p.P74S	EMR1_uc010dvc.2_Missense_Mutation_p.P74S|EMR1_uc010dvb.2_Missense_Mutation_p.P74S|EMR1_uc010xji.1_Missense_Mutation_p.P74S|EMR1_uc010xjj.1_Missense_Mutation_p.P74S	NM_001974	NP_001965	Q14246	EMR1_HUMAN	egf-like module containing, mucin-like, hormone	74	Extracellular (Potential).|EGF-like 1.				cell adhesion|neuropeptide signaling pathway	integral to plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(3)|lung(1)|skin(1)	5	all_hematologic(4;0.166)					CTTCAAGGATCCAGGAGTGCG	0.483													71	75	---	---	---	---	PASS
FBN3	84467	broad.mit.edu	37	19	8150300	8150300	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8150300G>A	uc002mjf.2	-	55	7055	c.7034C>T	c.(7033-7035)TCT>TTT	p.S2345F	FBN3_uc002mje.2_Missense_Mutation_p.S184F	NM_032447	NP_115823	Q75N90	FBN3_HUMAN	fibrillin 3 precursor	2345	TB 9.					proteinaceous extracellular matrix	calcium ion binding|extracellular matrix structural constituent			ovary(6)|skin(3)|pancreas(1)|central_nervous_system(1)	11						CCTGTAGGCAGAGGTGCCGGG	0.706													5	10	---	---	---	---	PASS
NDUFA7	4701	broad.mit.edu	37	19	8381519	8381519	+	Missense_Mutation	SNP	G	T	T	rs142961225	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8381519G>T	uc002mjm.1	-	3	150	c.112C>A	c.(112-114)CCT>ACT	p.P38T		NM_005001	NP_004992	O95182	NDUA7_HUMAN	NADH dehydrogenase (ubiquinone) 1 alpha	38					mitochondrial electron transport, NADH to ubiquinone|transport	mitochondrial respiratory chain complex I	NADH dehydrogenase (ubiquinone) activity				0					NADH(DB00157)	AGCTTGGGAGGAGGCTGAGTT	0.552													8	114	---	---	---	---	PASS
ADAMTS10	81794	broad.mit.edu	37	19	8670048	8670048	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8670048G>T	uc002mkj.1	-	4	558	c.284C>A	c.(283-285)TCC>TAC	p.S95Y	ADAMTS10_uc002mkk.1_5'UTR	NM_030957	NP_112219	Q9H324	ATS10_HUMAN	ADAM metallopeptidase with thrombospondin type 1	95					proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			pancreas(2)|skin(2)	4						CAGTAGACGGGAGCTGCGGGT	0.706													18	22	---	---	---	---	PASS
OR1M1	125963	broad.mit.edu	37	19	9204718	9204718	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9204718C>T	uc010xkj.1	+	1	798	c.798C>T	c.(796-798)CTC>CTT	p.L266L		NM_001004456	NP_001004456	Q8NGA1	OR1M1_HUMAN	olfactory receptor, family 1, subfamily M,	266	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(3)	3						CCTCGGTCCTCACCACTGTGA	0.547													26	299	---	---	---	---	PASS
OR7D4	125958	broad.mit.edu	37	19	9325149	9325149	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9325149C>T	uc002mla.1	-	1	365	c.365G>A	c.(364-366)CGG>CAG	p.R122Q		NM_001005191	NP_001005191	Q8NG98	OR7D4_HUMAN	olfactory receptor, family 7, subfamily D,	122	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|central_nervous_system(1)|skin(1)	4						GGCCACAAACCGGTCATAGGC	0.502													5	131	---	---	---	---	PASS
RAVER1	125950	broad.mit.edu	37	19	10432272	10432272	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10432272G>C	uc002moa.2	-	7	1327	c.1247C>G	c.(1246-1248)TCA>TGA	p.S416*		NM_133452	NP_597709	Q8IY67	RAVR1_HUMAN	RAVER1	399						cytoplasm|nucleus	nucleotide binding|protein binding|RNA binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(20;1.81e-09)|Epithelial(33;3.65e-06)|all cancers(31;8.35e-06)			GCCCAGGGGTGAGTCTCCCAG	0.687													5	33	---	---	---	---	PASS
RAVER1	125950	broad.mit.edu	37	19	10439679	10439679	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10439679G>T	uc002moa.2	-	3	526	c.446C>A	c.(445-447)GCC>GAC	p.A149D		NM_133452	NP_597709	Q8IY67	RAVR1_HUMAN	RAVER1	132	RRM 2.					cytoplasm|nucleus	nucleotide binding|protein binding|RNA binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(20;1.81e-09)|Epithelial(33;3.65e-06)|all cancers(31;8.35e-06)			ACACAGCAGGGCATCCGTGGG	0.662													4	14	---	---	---	---	PASS
SLC44A2	57153	broad.mit.edu	37	19	10736982	10736982	+	Intron	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10736982G>C	uc002mpf.2	+						SLC44A2_uc002mpe.3_Intron	NM_020428	NP_065161	Q8IWA5	CTL2_HUMAN	solute carrier family 44, member 2 isoform 1						positive regulation of I-kappaB kinase/NF-kappaB cascade	integral to membrane|plasma membrane	choline transmembrane transporter activity|signal transducer activity			ovary(1)	1			Epithelial(33;8.7e-06)|all cancers(31;2.77e-05)		Choline(DB00122)	CAATAGGTAAGAGCTCTGGGT	0.468													13	187	---	---	---	---	PASS
DNM2	1785	broad.mit.edu	37	19	10912958	10912958	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10912958C>T	uc002mps.1	+						DNM2_uc010dxk.2_Intron|DNM2_uc002mpt.1_Intron|DNM2_uc002mpv.1_Intron|DNM2_uc002mpu.1_Intron|DNM2_uc010dxl.1_Intron|DNM2_uc002mpw.2_Intron	NM_001005361	NP_001005361	P50570	DYN2_HUMAN	dynamin 2 isoform 2						G2/M transition of mitotic cell cycle|positive regulation of apoptosis|positive regulation of transcription, DNA-dependent|post-Golgi vesicle-mediated transport|receptor internalization|signal transduction|synaptic vesicle transport|transferrin transport	cell junction|cytosol|Golgi membrane|microtubule|postsynaptic density|postsynaptic membrane	GTP binding|GTPase activity|microtubule binding			central_nervous_system(2)|skin(2)|ovary(1)|breast(1)	6			Epithelial(33;4.17e-05)|all cancers(31;8.48e-05)			CCCCGCTCTCCCCCAGATTCT	0.567													7	86	---	---	---	---	PASS
DNM2	1785	broad.mit.edu	37	19	10912999	10912999	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10912999C>G	uc002mps.1	+	12	1622	c.1458C>G	c.(1456-1458)ATC>ATG	p.I486M	DNM2_uc010dxk.2_RNA|DNM2_uc002mpt.1_Missense_Mutation_p.I486M|DNM2_uc002mpv.1_Missense_Mutation_p.I486M|DNM2_uc002mpu.1_Missense_Mutation_p.I486M|DNM2_uc010dxl.1_Missense_Mutation_p.I486M|DNM2_uc002mpw.2_Missense_Mutation_p.I219M	NM_001005361	NP_001005361	P50570	DYN2_HUMAN	dynamin 2 isoform 2	486					G2/M transition of mitotic cell cycle|positive regulation of apoptosis|positive regulation of transcription, DNA-dependent|post-Golgi vesicle-mediated transport|receptor internalization|signal transduction|synaptic vesicle transport|transferrin transport	cell junction|cytosol|Golgi membrane|microtubule|postsynaptic density|postsynaptic membrane	GTP binding|GTPase activity|microtubule binding			central_nervous_system(2)|skin(2)|ovary(1)|breast(1)	6			Epithelial(33;4.17e-05)|all cancers(31;8.48e-05)			AGTCCTACATCAACACGAACC	0.562													8	114	---	---	---	---	PASS
DNM2	1785	broad.mit.edu	37	19	10913020	10913020	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10913020C>T	uc002mps.1	+	12	1643	c.1479C>T	c.(1477-1479)TTC>TTT	p.F493F	DNM2_uc010dxk.2_RNA|DNM2_uc002mpt.1_Silent_p.F493F|DNM2_uc002mpv.1_Silent_p.F493F|DNM2_uc002mpu.1_Silent_p.F493F|DNM2_uc010dxl.1_Silent_p.F493F|DNM2_uc002mpw.2_Silent_p.F226F	NM_001005361	NP_001005361	P50570	DYN2_HUMAN	dynamin 2 isoform 2	493					G2/M transition of mitotic cell cycle|positive regulation of apoptosis|positive regulation of transcription, DNA-dependent|post-Golgi vesicle-mediated transport|receptor internalization|signal transduction|synaptic vesicle transport|transferrin transport	cell junction|cytosol|Golgi membrane|microtubule|postsynaptic density|postsynaptic membrane	GTP binding|GTPase activity|microtubule binding			central_nervous_system(2)|skin(2)|ovary(1)|breast(1)	6			Epithelial(33;4.17e-05)|all cancers(31;8.48e-05)			ATGAGGACTTCATCGGGTTTG	0.537													8	112	---	---	---	---	PASS
DOCK6	57572	broad.mit.edu	37	19	11338084	11338084	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11338084C>A	uc002mqs.3	-	24	2925	c.2884G>T	c.(2884-2886)GGA>TGA	p.G962*	DOCK6_uc010xlq.1_Nonsense_Mutation_p.G301*	NM_020812	NP_065863	Q96HP0	DOCK6_HUMAN	dedicator of cytokinesis 6	962					blood coagulation	cytosol	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(2)|skin(1)	3						AGGAAGCGTCCGGGGAAGCGC	0.517													26	33	---	---	---	---	PASS
ZNF440	126070	broad.mit.edu	37	19	11943147	11943147	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11943147C>G	uc002msp.1	+	4	1312	c.1156C>G	c.(1156-1158)CAT>GAT	p.H386D		NM_152357	NP_689570	Q8IYI8	ZN440_HUMAN	zinc finger protein 440	386	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						CCTTCGATATCATGAAAGGAC	0.438													8	131	---	---	---	---	PASS
ZNF799	90576	broad.mit.edu	37	19	12502916	12502916	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12502916C>G	uc010dyt.2	-	4	446	c.296G>C	c.(295-297)GGA>GCA	p.G99A	ZNF799_uc002mts.3_Intron	NM_001080821	NP_001074290	Q96GE5	ZN799_HUMAN	zinc finger protein 799	99					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			breast(3)|ovary(2)|skin(1)	6						TGGACCTACTCCAGGAAGAGT	0.413													73	112	---	---	---	---	PASS
TRMT1	55621	broad.mit.edu	37	19	13216201	13216201	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:13216201C>A	uc002mwj.2	-	15	1963	c.1713G>T	c.(1711-1713)GCG>GCT	p.A571A	LYL1_uc002mwi.2_5'Flank|TRMT1_uc010xmy.1_Silent_p.A175A|TRMT1_uc002mwk.2_Silent_p.A542A|TRMT1_uc002mwl.3_Silent_p.A571A|TRMT1_uc010xmz.1_3'UTR	NM_017722	NP_060192	Q9NXH9	TRM1_HUMAN	tRNA methyltransferase 1 isoform 1	571							RNA binding|tRNA (guanine-N2-)-methyltransferase activity|zinc ion binding			ovary(1)|pancreas(1)	2			OV - Ovarian serous cystadenocarcinoma(19;6.08e-22)	GBM - Glioblastoma multiforme(1328;0.0356)		CTTCGTCGGCCGCCTTGCCCC	0.642													10	186	---	---	---	---	PASS
PRKACA	5566	broad.mit.edu	37	19	14224937	14224937	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:14224937C>G	uc002myc.2	-						PRKACA_uc002myb.2_Intron|PRKACA_uc010xnm.1_5'Flank	NM_002730	NP_002721	P17612	KAPCA_HUMAN	cAMP-dependent protein kinase catalytic subunit						activation of phospholipase C activity|activation of protein kinase A activity|blood coagulation|cellular response to glucagon stimulus|energy reserve metabolic process|G2/M transition of mitotic cell cycle|gluconeogenesis|intracellular protein kinase cascade|nerve growth factor receptor signaling pathway|peptidyl-serine phosphorylation|regulation of insulin secretion|transmembrane transport|triglyceride catabolic process|water transport	cAMP-dependent protein kinase complex|centrosome|cytosol|nucleoplasm|plasma membrane	ATP binding|cAMP-dependent protein kinase activity|cAMP-dependent protein kinase inhibitor activity|protein kinase binding			lung(1)	1						TAACAGGACTCAGCCTCACCA	0.587											OREG0025306	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	4	27	---	---	---	---	PASS
OR7C2	26658	broad.mit.edu	37	19	15053102	15053102	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15053102A>G	uc010xoc.1	+	1	802	c.802A>G	c.(802-804)AGG>GGG	p.R268G		NM_012377	NP_036509	O60412	OR7C2_HUMAN	olfactory receptor, family 7, subfamily C,	268	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(1)	3	Ovarian(108;0.203)					ACCACCTTCTAGGACAAGTCT	0.542													86	139	---	---	---	---	PASS
SYDE1	85360	broad.mit.edu	37	19	15224645	15224645	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15224645G>A	uc002nah.1	+	8	2110	c.2079G>A	c.(2077-2079)CCG>CCA	p.P693P	SYDE1_uc002nai.1_Silent_p.P626P|SYDE1_uc002naj.1_Silent_p.P350P	NM_033025	NP_149014	Q6ZW31	SYDE1_HUMAN	synapse defective 1, Rho GTPase, homolog 1	693					activation of Rho GTPase activity|small GTPase mediated signal transduction	cytosol	Rho GTPase activator activity			ovary(1)|pancreas(1)	2						TCGGCGAGCCGAGGGTCACCG	0.627													16	169	---	---	---	---	PASS
NOTCH3	4854	broad.mit.edu	37	19	15298024	15298024	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15298024G>C	uc002nan.2	-	11	1808	c.1732C>G	c.(1732-1734)CGC>GGC	p.R578G	NOTCH3_uc002nao.1_Missense_Mutation_p.R578G	NM_000435	NP_000426	Q9UM47	NOTC3_HUMAN	Notch homolog 3 precursor	578	Extracellular (Potential).|EGF-like 14; calcium-binding (Potential).		R -> C (in CADASIL).		Notch receptor processing|Notch signaling pathway|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to membrane|nucleoplasm|plasma membrane	calcium ion binding|protein binding|receptor activity			lung(8)|ovary(5)|skin(4)|prostate(2)|central_nervous_system(1)|breast(1)	21			OV - Ovarian serous cystadenocarcinoma(3;2.6e-20)|Epithelial(3;1.34e-16)|all cancers(3;5.13e-15)			CTCTCGCAGCGTGTGCCCGTG	0.647													18	45	---	---	---	---	PASS
WIZ	58525	broad.mit.edu	37	19	15537819	15537819	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15537819C>A	uc002nbc.2	-	4	1600	c.1577G>T	c.(1576-1578)CGG>CTG	p.R526L	WIZ_uc002nba.3_Missense_Mutation_p.R393L|WIZ_uc002nbb.3_Missense_Mutation_p.R352L	NM_021241	NP_067064	O95785	WIZ_HUMAN	widely-interspaced zinc finger motifs	1209						nucleus	zinc ion binding				0						CATGTCTTCCCGTGGTGCCCC	0.617													7	167	---	---	---	---	PASS
NWD1	284434	broad.mit.edu	37	19	16918790	16918790	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16918790C>A	uc002neu.3	+	18	4552	c.4130C>A	c.(4129-4131)GCA>GAA	p.A1377E	NWD1_uc002net.3_Missense_Mutation_p.A1242E|NWD1_uc002nev.3_Missense_Mutation_p.A1171E			Q149M9	NWD1_HUMAN	RecName: Full=NACHT and WD repeat domain-containing protein 1;	1377							ATP binding			skin(3)|ovary(2)|pancreas(2)	7						TACGAGTGTGCAACTTCCAAA	0.587													38	299	---	---	---	---	PASS
USHBP1	83878	broad.mit.edu	37	19	17370132	17370132	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17370132C>T	uc002nfs.1	-	7	1125	c.1012G>A	c.(1012-1014)GAG>AAG	p.E338K	USHBP1_uc002nfr.1_5'Flank|USHBP1_uc002nft.1_RNA|USHBP1_uc010xpk.1_Missense_Mutation_p.E274K|USHBP1_uc010eam.1_Missense_Mutation_p.E266K	NM_031941	NP_114147	Q8N6Y0	USBP1_HUMAN	Usher syndrome 1C binding protein 1	338							PDZ domain binding			ovary(1)	1						GCTGTGGCCTCAGCCTCCCGC	0.577													4	71	---	---	---	---	PASS
BST2	684	broad.mit.edu	37	19	17516377	17516377	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17516377G>C	uc002ngl.2	-	1	17	c.8C>G	c.(7-9)TCT>TGT	p.S3C	uc010eat.1_5'Flank|uc002ngm.1_5'Flank	NM_004335	NP_004326	Q10589	BST2_HUMAN	bone marrow stromal cell antigen 2 precursor	3	Cytoplasmic (Potential).				B cell activation|cell proliferation|cell-cell signaling|defense response to virus|humoral immune response|innate immune response|multicellular organismal development|positive regulation of I-kappaB kinase/NF-kappaB cascade	anchored to membrane|Golgi apparatus|integral to plasma membrane|late endosome	protein homodimerization activity|signal transducer activity			ovary(3)	3						ATACGAAGTAGATGCCATCCA	0.512													11	164	---	---	---	---	PASS
SLC27A1	376497	broad.mit.edu	37	19	17612072	17612072	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17612072C>T	uc002ngu.1	+						SLC27A1_uc010xpp.1_Intron|SLC27A1_uc002ngv.1_Intron	NM_198580	NP_940982	Q6PCB7	S27A1_HUMAN	solute carrier family 27, member 1						cardiolipin biosynthetic process|fatty acid metabolic process|long-chain fatty acid transport|negative regulation of phospholipid biosynthetic process|phosphatidic acid biosynthetic process|phosphatidylcholine biosynthetic process|phosphatidylethanolamine biosynthetic process|phosphatidylinositol biosynthetic process|phosphatidylserine biosynthetic process|transmembrane transport	endomembrane system|integral to membrane	fatty acid transporter activity|nucleotide binding				0						AGCTGAGCCTCTGCCTCCAGG	0.622													4	49	---	---	---	---	PASS
UNC13A	23025	broad.mit.edu	37	19	17735674	17735674	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17735674C>G	uc002nhd.2	-	35	4425	c.4425G>C	c.(4423-4425)GAG>GAC	p.E1475D		NM_001080421	NP_001073890	Q9UPW8	UN13A_HUMAN	unc-13 homolog A	1387	MHD2.				exocytosis|intracellular signal transduction	cell junction|cytoplasm|presynaptic membrane	metal ion binding			ovary(3)	3						CGATGGTTTTCTCCATGGTGT	0.587													11	66	---	---	---	---	PASS
SLC5A5	6528	broad.mit.edu	37	19	17986877	17986877	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17986877C>G	uc002nhr.3	+	5	1007	c.660C>G	c.(658-660)CTC>CTG	p.L220L		NM_000453	NP_000444	Q92911	SC5A5_HUMAN	solute carrier family 5 (sodium iodide	220	Extracellular (Potential).				cellular nitrogen compound metabolic process|cellular response to cAMP|cellular response to gonadotropin stimulus|hormone biosynthetic process	integral to membrane|nucleus|plasma membrane	iodide transmembrane transporter activity|sodium:iodide symporter activity			skin(2)|ovary(1)|central_nervous_system(1)	4						GCCAGGTGCTCACGCTGGCCC	0.557													72	97	---	---	---	---	PASS
SLC5A5	6528	broad.mit.edu	37	19	17992823	17992823	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17992823C>G	uc002nhr.3	+	9	1460	c.1113C>G	c.(1111-1113)ATC>ATG	p.I371M		NM_000453	NP_000444	Q92911	SC5A5_HUMAN	solute carrier family 5 (sodium iodide	371	Cytoplasmic (Potential).				cellular nitrogen compound metabolic process|cellular response to cAMP|cellular response to gonadotropin stimulus|hormone biosynthetic process	integral to membrane|nucleus|plasma membrane	iodide transmembrane transporter activity|sodium:iodide symporter activity			skin(2)|ovary(1)|central_nervous_system(1)	4						AAGACCTCATCAAACCTCGGC	0.592													6	90	---	---	---	---	PASS
ELL	8178	broad.mit.edu	37	19	18561345	18561345	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:18561345C>G	uc002njh.2	-	8	1479	c.1407G>C	c.(1405-1407)CAG>CAC	p.Q469H	ELL_uc010ebq.2_Missense_Mutation_p.Q412H|ELL_uc002njg.2_Missense_Mutation_p.Q336H	NM_006532	NP_006523	P55199	ELL_HUMAN	elongation factor RNA polymerase II	469					positive regulation of transcription elongation, DNA-dependent|positive regulation of viral transcription|transcription elongation from RNA polymerase II promoter|viral reproduction	Cajal body|nuclear speck|transcription elongation factor complex	protein binding			lung(1)	1				GBM - Glioblastoma multiforme(1328;7.81e-07)		AGTCTGGAAGCTGGGCCCGGG	0.667			T	MLL	AL								4	71	---	---	---	---	PASS
SFRS14	10147	broad.mit.edu	37	19	19141784	19141784	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19141784C>T	uc002nkx.2	-	2	243	c.97G>A	c.(97-99)GAA>AAA	p.E33K	SFRS14_uc002nkz.1_Missense_Mutation_p.E47K|SFRS14_uc002nla.1_Missense_Mutation_p.E33K|SFRS14_uc002nlb.2_Missense_Mutation_p.E33K|SFRS14_uc010xqk.1_5'UTR|ARMC6_uc002nlc.2_5'Flank|ARMC6_uc002nld.2_5'Flank|ARMC6_uc010xql.1_5'Flank|ARMC6_uc002nle.2_5'Flank	NM_014884	NP_055699	Q8IX01	SUGP2_HUMAN	splicing factor, arginine/serine-rich 14	33					mRNA processing|RNA splicing	nucleus	RNA binding				0			OV - Ovarian serous cystadenocarcinoma(5;3.05e-05)|Epithelial(12;0.00161)			TGAAGAGTTTCGCTTACAGCC	0.408													30	503	---	---	---	---	PASS
NR2C2AP	126382	broad.mit.edu	37	19	19312455	19312455	+	3'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19312455C>T	uc002nlx.2	-	5					RFXANK_uc002nls.2_Intron|RFXANK_uc002nlt.2_Intron|RFXANK_uc002nlu.2_Intron|RFXANK_uc002nlv.2_Intron|RFXANK_uc002nlw.2_Intron|NR2C2AP_uc010xqq.1_Intron|NR2C2AP_uc002nly.2_3'UTR	NM_176880	NP_795361	Q86WQ0	NR2CA_HUMAN	TR4 orphan receptor associated protein TRA16						cell adhesion|gene expression|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm				ovary(1)	1			Epithelial(12;0.00235)			TGCCCCATCTCAGTGCAACAG	0.612													106	130	---	---	---	---	PASS
NDUFA13	51079	broad.mit.edu	37	19	19636994	19636994	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19636994A>G	uc010xqy.1	+	2	606	c.347A>G	c.(346-348)TAC>TGC	p.Y116C	NDUFA13_uc002nms.2_Missense_Mutation_p.Y116C|NDUFA13_uc010xqx.1_Missense_Mutation_p.Y116C|YJEFN3_uc002nmt.1_5'Flank|YJEFN3_uc010ecf.1_5'Flank|YJEFN3_uc002nmu.1_5'Flank	NM_015965	NP_057049	Q9P0J0	NDUAD_HUMAN	NADH dehydrogenase (ubiquinone) 1 alpha	33	Helical; (Potential).				apoptotic nuclear change|induction of apoptosis by extracellular signals|negative regulation of cell growth|negative regulation of transcription, DNA-dependent|negative regulation of translation|protein import into nucleus|reactive oxygen species metabolic process|respiratory electron transport chain	integral to membrane|mitochondrial respiratory chain complex I|nucleoplasm	ATP binding|NADH dehydrogenase (ubiquinone) activity|protein binding				0					NADH(DB00157)	TTCACAGGCTACAGCATGCTG	0.637													18	21	---	---	---	---	PASS
CILP2	148113	broad.mit.edu	37	19	19654817	19654817	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19654817T>A	uc002nmv.3	+	8	1548	c.1463T>A	c.(1462-1464)CTA>CAA	p.L488Q	CILP2_uc002nmw.3_Missense_Mutation_p.L494Q	NM_153221	NP_694953	Q8IUL8	CILP2_HUMAN	cartilage intermediate layer protein 2	488						proteinaceous extracellular matrix	carbohydrate binding|carboxypeptidase activity			ovary(1)	1						GGGGAGCCGCTACGCTTCGCC	0.677													10	13	---	---	---	---	PASS
ZNF253	56242	broad.mit.edu	37	19	20002737	20002737	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:20002737C>G	uc002noj.2	+	4	773	c.681C>G	c.(679-681)CCC>CCG	p.P227P	ZNF253_uc002nok.2_Silent_p.P151P|ZNF253_uc002nol.2_RNA	NM_021047	NP_066385	O75346	ZN253_HUMAN	zinc finger protein 253	227				Missing (in Ref. 1; AAC26844).	negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						GAGAGAAACCCTACAGATGTG	0.383													10	105	---	---	---	---	PASS
ZNF714	148206	broad.mit.edu	37	19	21281065	21281065	+	5'UTR	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:21281065G>A	uc002npo.3	+	3					ZNF714_uc002npl.2_5'UTR|ZNF714_uc010ecp.1_5'UTR|ZNF714_uc002npn.2_RNA	NM_182515	NP_872321	Q96N38	ZN714_HUMAN	zinc finger protein 714						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						CTGCTCAGCAGAATTTATATA	0.388													6	181	---	---	---	---	PASS
ZNF492	57615	broad.mit.edu	37	19	22846599	22846599	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22846599C>G	uc002nqw.3	+							NM_020855	NP_065906	Q9P255	ZN492_HUMAN	zinc finger protein 492						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(12;0.0266)|all_lung(12;0.00187)|Lung NSC(12;0.0019)|all_epithelial(12;0.00203)|Hepatocellular(1079;0.244)				TTATTTCTTTCAGTTGTATGT	0.294													3	17	---	---	---	---	PASS
ZNF91	7644	broad.mit.edu	37	19	23544021	23544021	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:23544021G>C	uc002nre.2	-	4	1873	c.1760C>G	c.(1759-1761)TCA>TGA	p.S587*	ZNF91_uc002nrd.2_5'Flank|ZNF91_uc010xrj.1_Nonsense_Mutation_p.S555*	NM_003430	NP_003421	Q05481	ZNF91_HUMAN	zinc finger protein 91	587	C2H2-type 16.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		all_lung(12;0.0349)|Lung NSC(12;0.0538)|all_epithelial(12;0.0611)				AGAAAGACTTGAGGAATGATT	0.353													10	169	---	---	---	---	PASS
ZNF91	7644	broad.mit.edu	37	19	23544679	23544679	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:23544679G>C	uc002nre.2	-	4	1215	c.1102C>G	c.(1102-1104)CAT>GAT	p.H368D	ZNF91_uc010xrj.1_Missense_Mutation_p.H336D	NM_003430	NP_003421	Q05481	ZNF91_HUMAN	zinc finger protein 91	368	C2H2-type 8.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		all_lung(12;0.0349)|Lung NSC(12;0.0538)|all_epithelial(12;0.0611)				GTTATCTTATGATTAGCAAGG	0.348													79	133	---	---	---	---	PASS
ZNF254	9534	broad.mit.edu	37	19	24289358	24289358	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:24289358G>C	uc002nru.2	+	3	300	c.166G>C	c.(166-168)GTC>CTC	p.V56L	ZNF254_uc010xrk.1_Intron|ZNF254_uc002nrt.1_RNA	NM_203282	NP_975011	O75437	ZN254_HUMAN	zinc finger protein 254	56	KRAB.				negative regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(12;0.086)|all_lung(12;0.00528)|Lung NSC(12;0.00731)|all_epithelial(12;0.0186)				AGGTATTGCTGTCTCTAAGCC	0.398													61	126	---	---	---	---	PASS
LRP3	4037	broad.mit.edu	37	19	33695573	33695573	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33695573A>T	uc010edh.2	+	4	383	c.290A>T	c.(289-291)CAC>CTC	p.H97L	LRP3_uc010xrp.1_5'UTR|LRP3_uc002nuk.3_5'UTR	NM_002333	NP_002324	O75074	LRP3_HUMAN	low density lipoprotein receptor-related protein	97	Extracellular (Potential).|CUB 1.				receptor-mediated endocytosis	coated pit|integral to membrane	receptor activity			pancreas(2)|ovary(1)	3	Esophageal squamous(110;0.137)					GAGGAGTCCCACCAGTGCTCC	0.672													98	102	---	---	---	---	PASS
LSM14A	26065	broad.mit.edu	37	19	34718260	34718260	+	Intron	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:34718260T>C	uc002nvb.3	+						LSM14A_uc002nva.3_Intron|LSM14A_uc010xru.1_Intron|LSM14A_uc002nvc.3_Intron	NM_001114093	NP_001107565	Q8ND56	LS14A_HUMAN	LSM14 homolog A isoform a						cytoplasmic mRNA processing body assembly|multicellular organismal development|regulation of translation	cytoplasmic mRNA processing body|intracellular membrane-bounded organelle|stress granule				skin(1)	1	Esophageal squamous(110;0.162)					AATTTTTTTTTCTTTTTTAGA	0.289													4	108	---	---	---	---	PASS
FFAR3	2865	broad.mit.edu	37	19	35849879	35849879	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35849879C>G	uc002nzd.2	+	2	162	c.87C>G	c.(85-87)CTC>CTG	p.L29L	FFAR3_uc010xsu.1_RNA	NM_005304	NP_005295	O14843	FFAR3_HUMAN	free fatty acid receptor 3	29	Helical; Name=1; (Potential).					integral to plasma membrane	G-protein coupled receptor activity|lipid binding				0	all_lung(56;9.78e-09)|Lung NSC(56;1.46e-08)|Esophageal squamous(110;0.162)		Epithelial(14;1.29e-19)|OV - Ovarian serous cystadenocarcinoma(14;4.63e-18)|all cancers(14;5.19e-17)|LUSC - Lung squamous cell carcinoma(66;0.0221)			TGGTGGGGCTCCCCCTCAACC	0.647													7	198	---	---	---	---	PASS
NPHS1	4868	broad.mit.edu	37	19	36342189	36342189	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36342189A>G	uc002oby.2	-	3	372	c.372T>C	c.(370-372)TCT>TCC	p.S124S		NM_004646	NP_004637	O60500	NPHN_HUMAN	nephrin precursor	124	Extracellular (Potential).|Ig-like C2-type 1.				cell adhesion|excretion|muscle organ development	integral to plasma membrane				ovary(4)|skin(1)	5	all_lung(56;7.14e-07)|Lung NSC(56;1.12e-06)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0515)			TCACTCTGGGAGACACGAGCT	0.622													5	78	---	---	---	---	PASS
KIRREL2	84063	broad.mit.edu	37	19	36348353	36348353	+	Nonsense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36348353G>A	uc002ocb.3	+	2	380	c.168G>A	c.(166-168)TGG>TGA	p.W56*	KIRREL2_uc002obz.3_Nonsense_Mutation_p.W56*|KIRREL2_uc002oca.3_Intron|KIRREL2_uc002occ.3_Intron|KIRREL2_uc002ocd.3_Nonsense_Mutation_p.W53*	NM_199180	NP_954649	Q6UWL6	KIRR2_HUMAN	kin of IRRE-like 2 isoform c	56	Ig-like C2-type 1.|Extracellular (Potential).				cell adhesion	integral to membrane|plasma membrane				ovary(1)|central_nervous_system(1)|skin(1)	3	all_lung(56;7.14e-07)|Lung NSC(56;1.12e-06)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0515)			TAGTTCAGTGGACTAAGAGTG	0.652													8	207	---	---	---	---	PASS
ZNF345	25850	broad.mit.edu	37	19	37369115	37369115	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37369115G>A	uc002oex.2	+	3	1761	c.1383G>A	c.(1381-1383)AAG>AAA	p.K461K	ZNF345_uc002oey.3_Silent_p.K461K|ZNF345_uc002oez.2_Intron	NM_003419	NP_003410	Q14585	ZN345_HUMAN	zinc finger protein 345	461	C2H2-type 15.				negative regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase III promoter|transcription from RNA polymerase II promoter|transcription from RNA polymerase III promoter	nucleus	DNA binding|zinc ion binding			ovary(1)	1	Esophageal squamous(110;0.183)		COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)			ACTGTGGGAAGGCTTATGGGA	0.388													79	334	---	---	---	---	PASS
ZNF527	84503	broad.mit.edu	37	19	37879981	37879981	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37879981C>G	uc010efk.1	+	5	1141	c.1030C>G	c.(1030-1032)CAC>GAC	p.H344D	ZNF527_uc002ogf.3_Missense_Mutation_p.H312D|ZNF527_uc010xtq.1_RNA	NM_032453	NP_115829	Q8NB42	ZN527_HUMAN	zinc finger protein 527	344	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2			COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)			ACAGAGTGCTCACCTTGCTCA	0.438													9	267	---	---	---	---	PASS
ZNF781	163115	broad.mit.edu	37	19	38160578	38160578	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38160578G>C	uc002ogy.2	-	4	1214	c.472C>G	c.(472-474)CAA>GAA	p.Q158E	ZNF781_uc002ogz.2_Missense_Mutation_p.Q153E	NM_152605	NP_689818	Q8N8C0	ZN781_HUMAN	zinc finger protein 781	158					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						AATAAGAGTTGAGCGATTGTT	0.388													78	407	---	---	---	---	PASS
FAM98C	147965	broad.mit.edu	37	19	38896018	38896018	+	Missense_Mutation	SNP	C	G	G	rs139841886		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38896018C>G	uc002oin.1	+	5	609	c.590C>G	c.(589-591)TCC>TGC	p.S197C	FAM98C_uc002oio.1_Intron|FAM98C_uc010xtz.1_Intron	NM_174905	NP_777565	Q17RN3	FA98C_HUMAN	hypothetical protein LOC147965	197								p.S197F(1)		skin(1)	1	all_cancers(60;3.95e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)			CCCCCAGGGTCCCTGCAGCCC	0.582													34	141	---	---	---	---	PASS
RYR1	6261	broad.mit.edu	37	19	38980838	38980838	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38980838C>T	uc002oit.2	+	36	6067	c.5937C>T	c.(5935-5937)CTC>CTT	p.L1979L	RYR1_uc002oiu.2_Silent_p.L1979L	NM_000540	NP_000531	P21817	RYR1_HUMAN	skeletal muscle ryanodine receptor isoform 1	1979	Cytoplasmic.|6 X approximate repeats.				muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)	GCTATGGCCTCCTCATAAAAG	0.617													19	58	---	---	---	---	PASS
RYR1	6261	broad.mit.edu	37	19	39055641	39055641	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39055641G>A	uc002oit.2	+	91	12797	c.12667G>A	c.(12667-12669)GAG>AAG	p.E4223K	RYR1_uc002oiu.2_Missense_Mutation_p.E4218K|RYR1_uc002oiv.1_Missense_Mutation_p.E1132K	NM_000540	NP_000531	P21817	RYR1_HUMAN	skeletal muscle ryanodine receptor isoform 1	4223					muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)	CGTGGTGAACGAGGGCGGCGA	0.637													4	6	---	---	---	---	PASS
MAP4K1	11184	broad.mit.edu	37	19	39086131	39086131	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39086131C>T	uc002oix.1	-	29	2442	c.2334G>A	c.(2332-2334)TCG>TCA	p.S778S	MAP4K1_uc002oiw.1_Silent_p.S365S|MAP4K1_uc002oiy.1_Silent_p.S778S	NM_007181	NP_009112	Q92918	M4K1_HUMAN	mitogen-activated protein kinase kinase kinase	778	CNH.				activation of JUN kinase activity|peptidyl-serine phosphorylation		ATP binding|MAP kinase kinase kinase kinase activity|protein binding|small GTPase regulator activity			skin(4)|lung(3)|ovary(1)	8	all_cancers(60;6.42e-06)|Ovarian(47;0.103)		Lung(45;0.000751)|LUSC - Lung squamous cell carcinoma(53;0.00272)			TTACCTGATCCGAGCCTAGAG	0.567													6	97	---	---	---	---	PASS
CAPN12	147968	broad.mit.edu	37	19	39227206	39227206	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39227206G>A	uc002ojd.1	-						CAPN12_uc010egd.1_5'Flank|CAPN12_uc002ojc.1_5'Flank	NM_144691	NP_653292	Q6ZSI9	CAN12_HUMAN	calpain 12						proteolysis	intracellular	calcium ion binding|calcium-dependent cysteine-type endopeptidase activity			central_nervous_system(1)|pancreas(1)	2	all_cancers(60;2.87e-05)|Ovarian(47;0.0454)		Lung(45;0.00416)|LUSC - Lung squamous cell carcinoma(53;0.00741)			TCTGGAATCTGAAAGAAGCAA	0.642													11	14	---	---	---	---	PASS
FBXO27	126433	broad.mit.edu	37	19	39521733	39521733	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39521733C>T	uc002okh.2	-	4	590	c.508G>A	c.(508-510)GAG>AAG	p.E170K		NM_178820	NP_849142	Q8NI29	FBX27_HUMAN	F-box protein 27	170	FBA.				protein catabolic process	SCF ubiquitin ligase complex	glycoprotein binding			ovary(1)	1	all_cancers(60;3.79e-07)|all_lung(34;1.26e-07)|Lung NSC(34;1.46e-07)|all_epithelial(25;4.69e-07)|Ovarian(47;0.0454)		Lung(45;0.000419)|LUSC - Lung squamous cell carcinoma(53;0.000554)			CCCTCCTCCTCTAGGTCCAAG	0.522													191	204	---	---	---	---	PASS
PLEKHG2	64857	broad.mit.edu	37	19	39914967	39914967	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39914967A>T	uc010xuz.1	+	19	3519	c.3194A>T	c.(3193-3195)CAG>CTG	p.Q1065L	PLEKHG2_uc010xuy.1_Missense_Mutation_p.Q1006L|PLEKHG2_uc002olj.2_Intron|PLEKHG2_uc010xva.1_Missense_Mutation_p.Q843L	NM_022835	NP_073746	Q9H7P9	PKHG2_HUMAN	common-site lymphoma/leukemia guanine nucleotide	1065					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	Rho guanyl-nucleotide exchange factor activity			skin(2)|pancreas(1)|breast(1)	4	all_cancers(60;3.08e-07)|all_lung(34;2.66e-08)|Lung NSC(34;3e-08)|all_epithelial(25;6.57e-07)|Ovarian(47;0.0569)		Epithelial(26;2.92e-26)|all cancers(26;2.01e-23)|Lung(45;0.000499)|LUSC - Lung squamous cell carcinoma(53;0.000657)			AGGGATGTTCAGGGCCCAGAC	0.587													51	296	---	---	---	---	PASS
DYRK1B	9149	broad.mit.edu	37	19	40316475	40316475	+	Silent	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40316475T>A	uc002omj.2	-	11	2050	c.1770A>T	c.(1768-1770)TCA>TCT	p.S590S	DYRK1B_uc002omi.2_Silent_p.S562S|DYRK1B_uc002omk.2_Silent_p.S550S	NM_004714	NP_004705	Q9Y463	DYR1B_HUMAN	dual-specificity tyrosine-(Y)-phosphorylation	590					positive regulation of transcription, DNA-dependent	nucleus	ATP binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity|transcription coactivator activity			ovary(4)|stomach(1)|central_nervous_system(1)|skin(1)	7	all_cancers(60;5.79e-06)|all_lung(34;5.2e-08)|Lung NSC(34;6.14e-08)|Ovarian(47;0.06)		Epithelial(26;5.74e-25)|OV - Ovarian serous cystadenocarcinoma(5;3.13e-24)|all cancers(26;8.59e-23)			TCCGGAGGGCTGAGGCAGCCG	0.706													8	24	---	---	---	---	PASS
LTBP4	8425	broad.mit.edu	37	19	41120352	41120352	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41120352G>A	uc002ooh.1	+	22	3013	c.3013G>A	c.(3013-3015)GAT>AAT	p.D1005N	LTBP4_uc002oog.1_Missense_Mutation_p.D968N|LTBP4_uc002ooi.1_Missense_Mutation_p.D938N|LTBP4_uc002ooj.1_5'UTR|LTBP4_uc002ook.1_Missense_Mutation_p.D225N|LTBP4_uc002ool.1_Missense_Mutation_p.D103N|LTBP4_uc002oom.1_RNA|LTBP4_uc010xvp.1_5'UTR	NM_001042544	NP_001036009	Q8N2S1	LTBP4_HUMAN	latent transforming growth factor beta binding	1005	Cys-rich.				growth hormone secretion|multicellular organismal development|protein folding|regulation of cell differentiation|regulation of cell growth|regulation of proteolysis|regulation of transforming growth factor beta receptor signaling pathway	extracellular space|proteinaceous extracellular matrix	calcium ion binding|glycosaminoglycan binding|integrin binding|transforming growth factor beta binding|transforming growth factor beta receptor activity			central_nervous_system(1)	1			Lung(22;0.000158)|LUSC - Lung squamous cell carcinoma(20;0.000384)			CACCTGTGACGGTGAGCCTGC	0.697													3	16	---	---	---	---	PASS
CNFN	84518	broad.mit.edu	37	19	42891373	42891373	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42891373C>A	uc002otp.3	-	4	326	c.271G>T	c.(271-273)GCG>TCG	p.A91S	CNFN_uc002otq.3_Missense_Mutation_p.A104S	NM_032488	NP_115877	Q9BYD5	CNFN_HUMAN	cornifelin	91					keratinization	cornified envelope|cytoplasm					0		Prostate(69;0.00899)				GTGAGGGCCGCCCAGTCGTGC	0.667													10	39	---	---	---	---	PASS
CEACAM8	1088	broad.mit.edu	37	19	43098952	43098952	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43098952C>A	uc002oud.2	-	1	131	c.29G>T	c.(28-30)AGA>ATA	p.R10I	uc010eif.1_Intron|uc010eig.1_Intron|uc010eih.1_Intron	NM_001816	NP_001807	P31997	CEAM8_HUMAN	carcinoembryonic antigen-related cell adhesion	10					immune response	anchored to membrane|extracellular space|integral to plasma membrane				ovary(1)	1		Prostate(69;0.00899)				GATGCGCCATCTGCAGGAAGG	0.607													26	210	---	---	---	---	PASS
PSG1	5669	broad.mit.edu	37	19	43372279	43372279	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43372279G>T	uc002ovb.2	-	5	1355	c.1217C>A	c.(1216-1218)TCC>TAC	p.S406Y	PSG3_uc002ouf.2_Intron|PSG1_uc002oug.1_Intron|PSG11_uc002ouw.2_Intron|PSG7_uc002ous.1_Intron|PSG7_uc002out.1_Intron|PSG10_uc002ouv.1_Intron|PSG1_uc002oun.2_Intron|PSG1_uc002our.1_Missense_Mutation_p.S406Y|PSG1_uc010eio.1_Missense_Mutation_p.S406Y|PSG1_uc002oux.1_Missense_Mutation_p.S335Y|PSG1_uc002ouy.1_Missense_Mutation_p.S313Y|PSG1_uc002ouz.1_Missense_Mutation_p.S406Y|PSG1_uc002ova.1_Missense_Mutation_p.S313Y|PSG1_uc002ovc.2_Missense_Mutation_p.S313Y|PSG1_uc002ovd.1_Missense_Mutation_p.S406Y	NM_006905	NP_008836	P11464	PSG1_HUMAN	pregnancy specific beta-1-glycoprotein 1	406	Ig-like C2-type 3.				female pregnancy	extracellular region				ovary(2)	2		Prostate(69;0.00682)				CATGGATTTGGAGCTTTCCTT	0.473													74	367	---	---	---	---	PASS
PSG5	5673	broad.mit.edu	37	19	43674284	43674284	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43674284G>A	uc002ovu.2	-	5	1102	c.971C>T	c.(970-972)TCA>TTA	p.S324L	PSG6_uc010xwk.1_Intron|PSG5_uc010eir.2_Missense_Mutation_p.S199L|PSG5_uc002ovx.2_Missense_Mutation_p.S324L|PSG5_uc002ovv.2_Missense_Mutation_p.S417L|PSG5_uc002ovw.2_Missense_Mutation_p.S146L	NM_002781	NP_002772	Q15238	PSG5_HUMAN	pregnancy specific beta-1-glycoprotein 5	324					female pregnancy	extracellular region				skin(3)	3		Prostate(69;0.00899)				TCCTATTCCTGAAGGAGCTGT	0.428													29	144	---	---	---	---	PASS
ZNF221	7638	broad.mit.edu	37	19	44471455	44471455	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44471455G>A	uc002oxx.2	+	6	2129	c.1801G>A	c.(1801-1803)GAA>AAA	p.E601K	ZNF221_uc010ejb.1_Missense_Mutation_p.E601K|ZNF221_uc010xws.1_Missense_Mutation_p.E601K	NM_013359	NP_037491	Q9UK13	ZN221_HUMAN	zinc finger protein 221	601					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)	1		Prostate(69;0.0352)				GATCTACTCAGAATTCACAGC	0.443													42	139	---	---	---	---	PASS
ZNF230	7773	broad.mit.edu	37	19	44514653	44514653	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44514653C>G	uc002oyb.1	+	5	713	c.462C>G	c.(460-462)ATC>ATG	p.I154M		NM_006300	NP_006291	Q9UIE0	ZN230_HUMAN	zinc finger protein 230	154	KRNB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Prostate(69;0.0352)				ATGTTGCCATCTTTGATCCTC	0.448													36	251	---	---	---	---	PASS
ZNF234	10780	broad.mit.edu	37	19	44661248	44661248	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44661248A>G	uc002oym.2	+	6	1386	c.1079A>G	c.(1078-1080)CAG>CGG	p.Q360R	ZNF234_uc002oyl.3_Missense_Mutation_p.Q360R	NM_006630	NP_006621	Q14588	ZN234_HUMAN	zinc finger protein 234	360	C2H2-type 8.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Prostate(69;0.0435)				TCACAATTTCAGGCCCATCGG	0.443													3	82	---	---	---	---	PASS
ZNF226	7769	broad.mit.edu	37	19	44680253	44680253	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44680253C>T	uc002oyp.2	+	6	982	c.838C>T	c.(838-840)CTT>TTT	p.L280F	ZNF226_uc002oyq.2_Missense_Mutation_p.L163F|ZNF226_uc002oyr.2_Missense_Mutation_p.L163F|ZNF226_uc010ejg.2_3'UTR|ZNF226_uc002oys.2_Missense_Mutation_p.L280F|ZNF226_uc002oyt.2_Missense_Mutation_p.L280F	NM_001032373	NP_001027545	Q9NYT6	ZN226_HUMAN	zinc finger protein 226 isoform a	280	C2H2-type 2; degenerate.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Prostate(69;0.0352)|all_neural(266;0.202)				AGAGAAGTCTCTTACATGTGT	0.428													12	92	---	---	---	---	PASS
ZNF227	7770	broad.mit.edu	37	19	44738912	44738912	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44738912C>G	uc002oyu.2	+	6	534	c.329C>G	c.(328-330)TCA>TGA	p.S110*	ZNF227_uc010xwu.1_Nonsense_Mutation_p.S59*|ZNF227_uc002oyv.2_Nonsense_Mutation_p.S110*|ZNF227_uc010xwv.1_Nonsense_Mutation_p.S59*|ZNF227_uc010xww.1_Nonsense_Mutation_p.S31*|ZNF227_uc002oyw.2_Nonsense_Mutation_p.S82*|ZNF227_uc010ejh.2_Nonsense_Mutation_p.S103*|ZNF235_uc002oyx.1_RNA	NM_182490	NP_872296	Q86WZ6	ZN227_HUMAN	zinc finger protein 227	110					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Prostate(69;0.0435)				AAATACCTTTCAAATCAAGAG	0.383													38	124	---	---	---	---	PASS
ZNF285	26974	broad.mit.edu	37	19	44891432	44891432	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44891432G>C	uc002ozd.3	-	4	1062	c.975C>G	c.(973-975)TTC>TTG	p.F325L	ZFP112_uc010xwz.1_Intron|ZNF285_uc010xxa.1_Missense_Mutation_p.F332L	NM_152354	NP_689567	Q96NJ3	ZN285_HUMAN	zinc finger protein 285	325	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|skin(2)	4						AGCTGCGCCTGAAGCCCTTGC	0.493													34	249	---	---	---	---	PASS
CEACAM20	125931	broad.mit.edu	37	19	45024764	45024764	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45024764G>A	uc010ejn.1	-	5	790	c.774C>T	c.(772-774)GTC>GTT	p.V258V	CEACAM20_uc010ejo.1_Silent_p.V258V|CEACAM20_uc010ejp.1_Silent_p.V258V|CEACAM20_uc010ejq.1_Silent_p.V258V	NM_001102597	NP_001096067	Q6UY09	CEA20_HUMAN	carcinoembryonic antigen-related cell adhesion	258	Extracellular (Potential).|Ig-like C2-type 3.					integral to membrane				large_intestine(2)	2		Prostate(69;0.0352)				TTGAAGGCACGACTTGAGGCA	0.522													62	96	---	---	---	---	PASS
SFRS16	11129	broad.mit.edu	37	19	45573275	45573275	+	Intron	SNP	C	T	T	rs147506970	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45573275C>T	uc002pak.2	+						SFRS16_uc002pal.2_Intron|SFRS16_uc010xxh.1_Intron|SFRS16_uc002pam.2_Intron	NM_007056	NP_008987	Q8N2M8	CLASR_HUMAN	splicing factor, arginine/serine-rich 16						mRNA processing|RNA splicing	nucleus					0		Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0102)		GCCATGCCTTCGCAGGGAGCG	0.607													10	119	---	---	---	---	PASS
ERCC2	2068	broad.mit.edu	37	19	45856557	45856557	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45856557G>C	uc002pbj.2	-	18	1748	c.1701C>G	c.(1699-1701)CTC>CTG	p.L567L	ERCC2_uc002pbh.2_Silent_p.L130L|ERCC2_uc002pbi.2_Silent_p.L260L|ERCC2_uc010ejz.2_Silent_p.L489L|ERCC2_uc002pbk.2_Silent_p.L543L	NM_000400	NP_000391	P18074	ERCC2_HUMAN	excision repair cross-complementing rodent	567	Mediates interaction with MMS19.				cell cycle checkpoint|chromosome segregation|hair cell differentiation|induction of apoptosis|interspecies interaction between organisms|mRNA capping|nucleotide-excision repair, DNA damage removal|nucleotide-excision repair, DNA incision|positive regulation of transcription from RNA polymerase II promoter|positive regulation of viral transcription|protein phosphorylation|response to oxidative stress|termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase I promoter|transcription initiation from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair|UV protection|viral reproduction	cytoplasm|holo TFIIH complex|MMXD complex	5'-3' DNA helicase activity|ATP binding|ATP-dependent DNA helicase activity|DNA binding|iron-sulfur cluster binding|metal ion binding|protein C-terminus binding|protein N-terminus binding			lung(2)|pancreas(1)	3		Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0226)		TCTCAATAAAGAGCAGCTTGT	0.607			Mis|N|F|S			skin basal cell|skin squamous cell|melanoma		Direct_reversal_of_damage|NER	Xeroderma_Pigmentosum				5	52	---	---	---	---	PASS
SYMPK	8189	broad.mit.edu	37	19	46355782	46355782	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46355782C>G	uc002pdn.2	-	4	428	c.183G>C	c.(181-183)CTG>CTC	p.L61L	SYMPK_uc002pdo.1_Silent_p.L61L|SYMPK_uc002pdp.1_Silent_p.L61L|SYMPK_uc002pdq.1_Silent_p.L61L	NM_004819	NP_004810	Q92797	SYMPK_HUMAN	symplekin	61	Interaction with HSF1.				cell adhesion|mRNA processing	cytoplasm|cytoskeleton|nucleoplasm|tight junction	protein binding			ovary(1)	1		all_neural(266;0.0299)|Ovarian(192;0.0308)		OV - Ovarian serous cystadenocarcinoma(262;0.00509)|GBM - Glioblastoma multiforme(486;0.0593)		TGTTGATGATCAGCTCCTGGA	0.453													3	110	---	---	---	---	PASS
GRLF1	2909	broad.mit.edu	37	19	47423195	47423195	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:47423195G>A	uc010ekv.2	+	1	1263	c.1263G>A	c.(1261-1263)GAG>GAA	p.E421E		NM_004491	NP_004482	Q9NRY4	RHG35_HUMAN	glucocorticoid receptor DNA binding factor 1	421	FF 2.				axon guidance|negative regulation of transcription, DNA-dependent|small GTPase mediated signal transduction|transcription, DNA-dependent	cytosol	DNA binding|Rho GTPase activator activity|transcription corepressor activity			central_nervous_system(1)	1		all_cancers(25;1.51e-09)|all_epithelial(76;1.87e-07)|all_lung(116;7.86e-06)|Lung NSC(112;2.31e-05)|Ovarian(192;0.0129)|all_neural(266;0.026)|Breast(70;0.077)		all cancers(93;2.03e-05)|OV - Ovarian serous cystadenocarcinoma(262;2.57e-05)|Epithelial(262;0.00135)|GBM - Glioblastoma multiforme(486;0.0289)		CCCACTTAGAGAAGCTGAGGA	0.483													48	112	---	---	---	---	PASS
KPTN	11133	broad.mit.edu	37	19	47986776	47986776	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:47986776C>T	uc002pgy.2	-	2	396	c.292G>A	c.(292-294)GGG>AGG	p.G98R	KPTN_uc010xys.1_RNA|uc002pgz.1_5'Flank	NM_007059	NP_008990	Q9Y664	KPTN_HUMAN	kaptin (actin binding protein)	98					actin filament organization|cellular component movement|sensory perception of sound	actin cytoskeleton|growth cone|microtubule organizing center|nucleus|perinuclear region of cytoplasm|stereocilium	actin binding			ovary(1)	1		all_cancers(25;1.55e-10)|all_epithelial(76;3.4e-08)|all_lung(116;1.73e-07)|Lung NSC(112;3.95e-07)|Ovarian(192;0.0139)|all_neural(266;0.026)|Breast(70;0.0503)		OV - Ovarian serous cystadenocarcinoma(262;0.000428)|all cancers(93;0.000631)|Epithelial(262;0.0153)|GBM - Glioblastoma multiforme(486;0.0694)		AACGTGATCCCCACAACCAGA	0.582											OREG0025593	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	3	5	---	---	---	---	PASS
ELSPBP1	64100	broad.mit.edu	37	19	48517417	48517417	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:48517417C>G	uc002pht.2	+							NM_022142	NP_071425	Q96BH3	ESPB1_HUMAN	epididymal sperm binding protein 1 precursor						single fertilization	extracellular region					0		all_cancers(25;8.7e-09)|all_lung(116;1.15e-06)|all_epithelial(76;1.17e-06)|Lung NSC(112;2.56e-06)|all_neural(266;0.0138)|Ovarian(192;0.0261)|Breast(70;0.203)		OV - Ovarian serous cystadenocarcinoma(262;0.000253)|all cancers(93;0.00129)|Epithelial(262;0.0314)|GBM - Glioblastoma multiforme(486;0.0606)		TTTTCTCCTTCTGCCCTTCAG	0.378													64	314	---	---	---	---	PASS
CCDC114	93233	broad.mit.edu	37	19	48801295	48801295	+	Silent	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:48801295A>G	uc002pir.2	-	12	2036	c.1353T>C	c.(1351-1353)CTT>CTC	p.L451L	CCDC114_uc002piq.2_Silent_p.L260L|CCDC114_uc002pio.2_Silent_p.L488L|CCDC114_uc002pis.1_Silent_p.L131L	NM_144577	NP_653178	Q96M63	CC114_HUMAN	coiled-coil domain containing 114 isoform 2	451										ovary(1)	1		all_epithelial(76;9.64e-05)|all_lung(116;0.000147)|Lung NSC(112;0.000251)|Prostate(7;0.0187)|all_neural(266;0.0228)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.000134)|all cancers(93;0.000162)|Epithelial(262;0.0134)|GBM - Glioblastoma multiforme(486;0.0143)		TCTTCTTCGGAAGGTCCTCCA	0.682													12	56	---	---	---	---	PASS
SPHK2	56848	broad.mit.edu	37	19	49131269	49131269	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49131269G>C	uc002pjr.2	+	5	1065	c.699G>C	c.(697-699)CTG>CTC	p.L233L	SPHK2_uc010xzt.1_Silent_p.L174L|SPHK2_uc002pjs.2_Silent_p.L233L|SPHK2_uc002pjt.2_Silent_p.L27L|SPHK2_uc002pju.2_Silent_p.L197L|SPHK2_uc002pjv.2_Silent_p.L197L|SPHK2_uc002pjw.2_Silent_p.L295L|SPHK2_uc010xzu.1_Silent_p.L197L	NM_020126	NP_064511	Q9NRA0	SPHK2_HUMAN	sphingosine kinase 2	233	DAGKc.				activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|anti-apoptosis|cell proliferation|sphinganine-1-phosphate biosynthetic process	cytosol|lysosomal membrane|membrane fraction	ATP binding|D-erythro-sphingosine kinase activity|diacylglycerol kinase activity|Ras GTPase binding|sphinganine kinase activity			lung(1)	1		all_lung(116;0.000125)|Lung NSC(112;0.000202)|all_epithelial(76;0.000283)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.000102)|all cancers(93;0.000117)|GBM - Glioblastoma multiforme(486;0.00627)|Epithelial(262;0.0158)		TCCAGGGGCTGAGCCTGAGTG	0.662													6	100	---	---	---	---	PASS
SNRNP70	6625	broad.mit.edu	37	19	49593537	49593537	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49593537C>G	uc002pmk.2	+						SNRNP70_uc002pmh.1_Intron|SNRNP70_uc002pmi.1_Intron|SNRNP70_uc002pml.2_Intron|SNRNP70_uc002pmm.2_Intron	NM_003089	NP_003080	P08621	RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa						nuclear mRNA splicing, via spliceosome|regulation of RNA splicing	nucleoplasm|spliceosomal complex	nucleotide binding|protein binding|RNA binding				0						CACCTCTCTTCTTGTTCCCAG	0.547													4	107	---	---	---	---	PASS
MYH14	79784	broad.mit.edu	37	19	50796543	50796543	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50796543G>C	uc002prr.1	+	36	5234	c.5187G>C	c.(5185-5187)GAG>GAC	p.E1729D	MYH14_uc010enu.1_Missense_Mutation_p.E1770D|MYH14_uc002prq.1_Missense_Mutation_p.E1737D|MYH14_uc010ycb.1_Missense_Mutation_p.E80D|MYH14_uc002prs.1_Missense_Mutation_p.E80D	NM_024729	NP_079005	Q7Z406	MYH14_HUMAN	myosin, heavy chain 14 isoform 2	1729	Potential.				axon guidance|regulation of cell shape	myosin complex	actin binding|ATP binding|calmodulin binding|motor activity			central_nervous_system(1)	1		all_neural(266;0.0571)|Ovarian(192;0.0728)		OV - Ovarian serous cystadenocarcinoma(262;0.00389)|GBM - Glioblastoma multiforme(134;0.0195)		ACCGGGATGAGATGGCAGATG	0.617													3	13	---	---	---	---	PASS
C19orf48	84798	broad.mit.edu	37	19	51301373	51301373	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:51301373C>T	uc002ptf.2	-	5	1255	c.333G>A	c.(331-333)CTG>CTA	p.L111L	C19orf48_uc002pte.2_RNA|C19orf48_uc002ptg.2_Silent_p.L111L	NM_199249	NP_954857	Q6RUI8	CS048_HUMAN	multidrug resistance-related protein	111										ovary(1)	1		all_neural(266;0.057)		OV - Ovarian serous cystadenocarcinoma(262;0.00531)|GBM - Glioblastoma multiforme(134;0.0145)		GCAGCTCCCCCAGGATTCTGG	0.627													57	224	---	---	---	---	PASS
ZNF577	84765	broad.mit.edu	37	19	52376400	52376400	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52376400C>T	uc010yde.1	-	7	1234	c.843G>A	c.(841-843)CAG>CAA	p.Q281Q	ZNF577_uc010ydd.1_Intron|ZNF577_uc002pxx.3_Silent_p.Q222Q|ZNF577_uc002pxv.2_Silent_p.Q274Q|ZNF577_uc002pxw.2_Silent_p.Q215Q	NM_032679	NP_116068	Q9BSK1	ZN577_HUMAN	zinc finger protein 577 isoform a	281	C2H2-type 5.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		all_neural(266;0.0602)		GBM - Glioblastoma multiforme(134;0.00161)|OV - Ovarian serous cystadenocarcinoma(262;0.019)		GGTATGCCTTCTGAGAAAAGG	0.468													20	95	---	---	---	---	PASS
ZNF137	7696	broad.mit.edu	37	19	53100135	53100135	+	RNA	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53100135T>A	uc002pzt.2	+	1		c.199T>A				NR_023311				Homo sapiens zinc finger protein 137, mRNA (cDNA clone IMAGE:40016639).												0				GBM - Glioblastoma multiforme(134;0.0212)|OV - Ovarian serous cystadenocarcinoma(262;0.0221)		AATCAAACCTTGCACAACATC	0.383													7	37	---	---	---	---	PASS
ZNF765	91661	broad.mit.edu	37	19	53911436	53911436	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53911436A>G	uc010ydx.1	+	6	955	c.628A>G	c.(628-630)ATG>GTG	p.M210V	ZNF765_uc002qbm.2_Missense_Mutation_p.M210V|ZNF765_uc002qbn.2_Intron	NM_001040185	NP_001035275	Q7L2R6	ZN765_HUMAN	zinc finger protein 765	210					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.00379)		GGAAGTACATATGAGGGAAAA	0.348													5	97	---	---	---	---	PASS
ZNF765	91661	broad.mit.edu	37	19	53911925	53911925	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53911925C>A	uc010ydx.1	+	6	1444	c.1117C>A	c.(1117-1119)CAT>AAT	p.H373N	ZNF765_uc002qbm.2_Missense_Mutation_p.H373N|ZNF765_uc002qbn.2_Intron	NM_001040185	NP_001035275	Q7L2R6	ZN765_HUMAN	zinc finger protein 765	373	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.00379)		TTTTACATGCCATCATAGAGT	0.413													48	191	---	---	---	---	PASS
MIR519A1	574496	broad.mit.edu	37	19	54255684	54255684	+	RNA	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54255684C>T	hsa-mir-519a-1|MI0003178	+			c.34C>T			MIR527_hsa-mir-527|MI0003179_5'Flank																	0						GAAGCGCTTTCTGTTGTCTGA	0.418													34	157	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	19	54291000	54291000	+	5'Flank	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54291000T>A	uc010yed.1	+						MIR372_hsa-mir-372|MI0000780_5'Flank|uc010yee.1_5'Flank|MIR373_hsa-mir-373|MI0000781_5'Flank					DM004700																		TGTTACCGCTTGAGAAGACTC	0.562													15	63	---	---	---	---	PASS
LILRA6	79168	broad.mit.edu	37	19	54744149	54744149	+	Splice_Site	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54744149C>A	uc002qeu.1	-	6	1382	c.1258_splice	c.e6+1	p.G420_splice	LILRB3_uc002qeh.1_Intron|LILRB3_uc002qeg.1_Intron|LILRB3_uc002qei.1_Intron|LILRA6_uc002qek.1_Splice_Site_p.G420_splice|LILRB3_uc010erh.1_Intron|LILRB3_uc002qej.1_Intron|LILRA6_uc002qel.1_Splice_Site_p.G420_splice|LILRA6_uc002qem.1_Splice_Site|LILRB3_uc002qen.1_Splice_Site|LILRB3_uc002qeo.1_Intron|LILRB3_uc002qep.1_Intron|LILRB3_uc002qeq.1_Intron|LILRB3_uc002qer.1_Intron|LILRB3_uc002qes.1_Intron|LILRA6_uc010yep.1_Splice_Site_p.G420_splice|LILRA6_uc010yeq.1_Splice_Site_p.G420_splice|LILRA6_uc002qet.3_Splice_Site|LILRA6_uc002qev.1_Splice_Site_p.A281_splice	NM_024318	NP_077294	Q6PI73	LIRA6_HUMAN	leukocyte immunoglobulin-like receptor,							integral to membrane	receptor activity			skin(2)	2	all_cancers(19;0.00723)|all_epithelial(19;0.00389)|all_lung(19;0.0175)|Lung NSC(19;0.0325)|Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.105)		AGCGCCCTCACCTGAGACCAT	0.652													3	81	---	---	---	---	PASS
FCAR	2204	broad.mit.edu	37	19	55399578	55399578	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55399578G>A	uc002qhr.1	+	4	763	c.566G>A	c.(565-567)GGG>GAG	p.G189E	FCAR_uc002qhq.2_Missense_Mutation_p.G189E|FCAR_uc002qhs.1_Intron|FCAR_uc002qht.1_Missense_Mutation_p.G162E|FCAR_uc010esi.1_Intron|FCAR_uc002qhu.1_Intron|FCAR_uc002qhv.1_Missense_Mutation_p.G189E|FCAR_uc002qhw.1_Missense_Mutation_p.G177E|FCAR_uc002qhx.1_Intron|FCAR_uc002qhy.1_Missense_Mutation_p.G177E|FCAR_uc002qhz.1_Missense_Mutation_p.G177E|FCAR_uc002qia.1_Missense_Mutation_p.G80E	NM_002000	NP_001991	P24071	FCAR_HUMAN	Fc alpha receptor isoform a precursor	189	Ig-like C2-type 2.|Extracellular (Potential).				immune response	extracellular region|integral to plasma membrane	IgA binding|receptor activity			ovary(1)|skin(1)	2				GBM - Glioblastoma multiforme(193;0.0443)		AATGTCTCAGGGATCTACAGG	0.557													10	45	---	---	---	---	PASS
NCR1	9437	broad.mit.edu	37	19	55424101	55424101	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55424101G>A	uc002qib.2	+	7	815	c.777G>A	c.(775-777)ATG>ATA	p.M259I	NCR1_uc002qic.2_Missense_Mutation_p.M258I|NCR1_uc002qie.2_Missense_Mutation_p.M242I|NCR1_uc002qid.2_Missense_Mutation_p.M164I|NCR1_uc002qif.2_Missense_Mutation_p.M147I|NCR1_uc010esj.2_Missense_Mutation_p.M152I	NM_004829	NP_004820	O76036	NCTR1_HUMAN	natural cytotoxicity triggering receptor 1	259	Helical; (Potential).				cellular defense response|natural killer cell activation|regulation of natural killer cell mediated cytotoxicity	integral to plasma membrane|SWI/SNF complex	receptor activity|receptor signaling protein activity			large_intestine(1)|ovary(1)	2				GBM - Glioblastoma multiforme(193;0.0449)		TCCTTCGGATGGGCCTGGCCT	0.552													12	106	---	---	---	---	PASS
NLRP7	199713	broad.mit.edu	37	19	55447743	55447743	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55447743C>A	uc002qih.3	-	6	2262	c.2186G>T	c.(2185-2187)GGG>GTG	p.G729V	NLRP7_uc002qig.3_Missense_Mutation_p.G701V|NLRP7_uc002qii.3_Missense_Mutation_p.G729V|NLRP7_uc010esk.2_Missense_Mutation_p.G729V|NLRP7_uc010esl.2_Missense_Mutation_p.G757V	NM_206828	NP_996611	Q8WX94	NALP7_HUMAN	NACHT, leucine rich repeat and PYD containing 7	729							ATP binding			large_intestine(1)|breast(1)|central_nervous_system(1)	3				GBM - Glioblastoma multiforme(193;0.0325)		GGTCTTCTTCCCAATGAAAGC	0.502													14	49	---	---	---	---	PASS
C19orf51	352909	broad.mit.edu	37	19	55670794	55670794	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55670794T>A	uc002qji.1	-	12	1296	c.1262A>T	c.(1261-1263)GAG>GTG	p.E421V	TNNI3_uc002qjg.3_5'Flank|TNNI3_uc010yft.1_5'Flank|C19orf51_uc002qjh.1_Missense_Mutation_p.E236V|C19orf51_uc002qjj.1_Missense_Mutation_p.E468V|C19orf51_uc002qjk.1_Missense_Mutation_p.E367V|C19orf51_uc002qjl.1_Missense_Mutation_p.E488V			Q8N9W5	CS051_HUMAN	RecName: Full=UPF0470 protein C19orf51;	421											0			BRCA - Breast invasive adenocarcinoma(297;0.209)	GBM - Glioblastoma multiforme(193;0.044)		CTGCAGCTGCTCCTGCCGCAC	0.627													27	96	---	---	---	---	PASS
PTPRH	5794	broad.mit.edu	37	19	55693527	55693527	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55693527G>A	uc002qjq.2	-						PTPRH_uc010esv.2_Intron|SYT5_uc002qjm.1_5'Flank|SYT5_uc002qjp.2_5'Flank|SYT5_uc002qjn.1_5'Flank|SYT5_uc002qjo.1_5'Flank	NM_002842	NP_002833	Q9HD43	PTPRH_HUMAN	protein tyrosine phosphatase, receptor type, H						apoptosis	cytoplasm|integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(2)|large_intestine(1)|skin(1)	4		Renal(1328;0.245)	BRCA - Breast invasive adenocarcinoma(297;0.209)	GBM - Glioblastoma multiforme(193;0.0479)		GCACTAGGCAGAACAAGGGAA	0.577													30	109	---	---	---	---	PASS
SBK2	646643	broad.mit.edu	37	19	56047654	56047654	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56047654C>G	uc010ygc.1	-	1	8	c.8G>C	c.(7-9)GGC>GCC	p.G3A		NM_001101401	NP_001094871	P0C263	SBK2_HUMAN	SH3-binding domain kinase family, member 2	3							ATP binding|protein serine/threonine kinase activity				0						AGACTGTTTGCCGGGCATCTC	0.478													7	29	---	---	---	---	PASS
EPN1	29924	broad.mit.edu	37	19	56206529	56206529	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56206529G>T	uc002qlw.2	+	11	1880	c.1538G>T	c.(1537-1539)GGC>GTC	p.G513V	EPN1_uc002qlv.2_Missense_Mutation_p.G487V|EPN1_uc010etd.2_Missense_Mutation_p.G512V|EPN1_uc002qlx.2_Missense_Mutation_p.G599V	NM_001130072	NP_001123544	Q9Y6I3	EPN1_HUMAN	epsin 1 isoform b	513	Ala/Gly/Pro-rich.|3 X 3 AA repeats of N-P-F.				endocytosis|epidermal growth factor receptor signaling pathway|negative regulation of epidermal growth factor receptor signaling pathway	coated pit|cytoplasm|nucleus|plasma membrane	lipid binding				0		Colorectal(82;0.00244)|Ovarian(87;0.133)		GBM - Glioblastoma multiforme(193;0.112)		CCAGCCACTGGCCCTTCCGTC	0.667													4	23	---	---	---	---	PASS
NLRP13	126204	broad.mit.edu	37	19	56423149	56423149	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56423149T>C	uc010ygg.1	-	5	2059	c.2034A>G	c.(2032-2034)CTA>CTG	p.L678L		NM_176810	NP_789780	Q86W25	NAL13_HUMAN	NACHT, leucine rich repeat and PYD containing	678							ATP binding			skin(4)|ovary(3)|pancreas(1)|lung(1)	9		Colorectal(82;3.48e-05)|Ovarian(87;0.0481)|Renal(1328;0.218)		GBM - Glioblastoma multiforme(193;0.0642)		TACAGTGCTTTAGGCAAAATG	0.393													55	193	---	---	---	---	PASS
ZNF470	388566	broad.mit.edu	37	19	57089033	57089033	+	Silent	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57089033T>A	uc002qnl.3	+	6	1912	c.1236T>A	c.(1234-1236)CTT>CTA	p.L412L	ZNF470_uc010etn.2_Intron	NM_001001668	NP_001001668	Q6ECI4	ZN470_HUMAN	zinc finger protein 470	412	C2H2-type 7.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|pancreas(1)	2		Colorectal(82;5.46e-05)|Ovarian(87;0.0822)|Renal(1328;0.157)		GBM - Glioblastoma multiforme(193;0.0294)		ACATAGGACTTATTCAGCATA	0.413													23	105	---	---	---	---	PASS
ZNF470	388566	broad.mit.edu	37	19	57089034	57089034	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57089034A>T	uc002qnl.3	+	6	1913	c.1237A>T	c.(1237-1239)ATT>TTT	p.I413F	ZNF470_uc010etn.2_Intron	NM_001001668	NP_001001668	Q6ECI4	ZN470_HUMAN	zinc finger protein 470	413	C2H2-type 7.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|pancreas(1)	2		Colorectal(82;5.46e-05)|Ovarian(87;0.0822)|Renal(1328;0.157)		GBM - Glioblastoma multiforme(193;0.0294)		CATAGGACTTATTCAGCATAA	0.413													23	102	---	---	---	---	PASS
ZNF548	147694	broad.mit.edu	37	19	57909923	57909923	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57909923G>C	uc002qom.2	+	3	518	c.268G>C	c.(268-270)GGC>CGC	p.G90R	ZNF547_uc002qpm.3_Intron|ZNF548_uc002qon.2_Missense_Mutation_p.G93R	NM_152909	NP_690873	Q8NEK5	ZN548_HUMAN	zinc finger protein 548	90					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			breast(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.221)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)		TGAGACATGTGGCCCACCCTT	0.488													12	124	---	---	---	---	PASS
ZSCAN4	201516	broad.mit.edu	37	19	58187739	58187739	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58187739G>A	uc002qpu.2	+	3	923	c.226G>A	c.(226-228)GAA>AAA	p.E76K		NM_152677	NP_689890	Q8NAM6	ZSCA4_HUMAN	zinc finger and SCAN domain containing 4	76	SCAN box.				telomere maintenance via telomere lengthening|viral reproduction	nuclear chromosome, telomeric region	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)		GCTGCAACCAGAAAAGCACAG	0.398													7	137	---	---	---	---	PASS
ZNF135	7694	broad.mit.edu	37	19	58579503	58579503	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58579503G>T	uc010yhq.1	+	5	1783	c.1687G>T	c.(1687-1689)GAA>TAA	p.E563*	ZNF135_uc002qre.2_Nonsense_Mutation_p.E551*|ZNF135_uc002qrd.1_Intron|ZNF135_uc002qrf.2_Nonsense_Mutation_p.E509*|ZNF135_uc002qrg.2_Nonsense_Mutation_p.E521*|ZNF135_uc010yhr.1_Nonsense_Mutation_p.E372*	NM_003436	NP_003427	B4DHH9	B4DHH9_HUMAN	zinc finger protein 135 isoform 2	563					regulation of transcription, DNA-dependent	intracellular	nucleic acid binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0412)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0161)		GAAACCCTATGAATGTAACCA	0.537													19	84	---	---	---	---	PASS
ZNF274	10782	broad.mit.edu	37	19	58718552	58718552	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58718552G>C	uc002qrq.1	+	7	1182	c.723G>C	c.(721-723)TGG>TGC	p.W241C	ZNF274_uc010yhu.1_RNA|ZNF274_uc010yhv.1_RNA|ZNF274_uc002qrr.1_Missense_Mutation_p.W209C|ZNF274_uc002qrs.1_Missense_Mutation_p.W136C|ZNF274_uc010eum.1_5'UTR	NM_133502	NP_598009	Q96GC6	ZN274_HUMAN	zinc finger protein 274 isoform c	241	SCAN box.				viral reproduction	centrosome|nucleolus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(1)	1		Colorectal(82;5.46e-05)|all_neural(62;0.0182)|Ovarian(87;0.0443)|Breast(46;0.0889)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0168)|Lung(386;0.215)		GTGTGACCTGGATGTCTGAGG	0.562													5	22	---	---	---	---	PASS
CSNK2A1	1457	broad.mit.edu	37	20	470443	470443	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:470443C>G	uc002wdw.1	-	10	1097	c.704G>C	c.(703-705)GGA>GCA	p.G235A	CSNK2A1_uc002wdx.1_Missense_Mutation_p.G235A|CSNK2A1_uc002wdy.1_Missense_Mutation_p.G99A	NM_177559	NP_808227	P68400	CSK21_HUMAN	casein kinase II alpha 1 subunit isoform a	235	Protein kinase.				axon guidance|Wnt receptor signaling pathway	cytosol|NuRD complex|plasma membrane|Sin3 complex	ATP binding|protein N-terminus binding|protein serine/threonine kinase activity			ovary(1)	1		Breast(17;0.231)	OV - Ovarian serous cystadenocarcinoma(29;0.0969)			ATTGTCATGTCCATGGAAAAA	0.383													4	129	---	---	---	---	PASS
SNPH	9751	broad.mit.edu	37	20	1281296	1281296	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:1281296G>C	uc002wes.2	+	5	485	c.249G>C	c.(247-249)GAG>GAC	p.E83D	SNPH_uc002wet.2_Missense_Mutation_p.E127D	NM_014723	NP_055538	O15079	SNPH_HUMAN	syntaphilin	83	Potential.				synaptic vesicle docking involved in exocytosis	cell junction|integral to membrane|synapse|synaptosome	syntaxin-1 binding			ovary(2)	2						AGCAGAAGGAGGTGTGCATCC	0.657													4	68	---	---	---	---	PASS
SIRPG	55423	broad.mit.edu	37	20	1617154	1617154	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:1617154A>T	uc002wfm.1	-						SIRPG_uc002wfn.1_Intron|SIRPG_uc002wfo.1_Intron|uc002wfp.1_Intron	NM_018556	NP_061026	Q9P1W8	SIRPG_HUMAN	signal-regulatory protein gamma isoform 1						blood coagulation|cell adhesion|cell junction assembly|cell-cell signaling|intracellular signal transduction|leukocyte migration|negative regulation of cell proliferation|positive regulation of cell proliferation|positive regulation of cell-cell adhesion|positive regulation of T cell activation	integral to membrane|intracellular|plasma membrane	protein binding			ovary(1)	1						GGGTTTGGCTACAAAAGGGGC	0.418													6	81	---	---	---	---	PASS
TGM3	7053	broad.mit.edu	37	20	2290881	2290881	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:2290881G>A	uc002wfx.3	+	3	336	c.239G>A	c.(238-240)AGT>AAT	p.S80N		NM_003245	NP_003236	Q08188	TGM3_HUMAN	transglutaminase 3 precursor	80					cell envelope organization|hair follicle morphogenesis|keratinization|peptide cross-linking|protein tetramerization	cytoplasm|extrinsic to internal side of plasma membrane	acyltransferase activity|calcium ion binding|GDP binding|GTP binding|GTPase activity|magnesium ion binding|protein-glutamine gamma-glutamyltransferase activity			large_intestine(4)|ovary(3)|breast(1)|skin(1)	9					L-Glutamine(DB00130)	TCCAATGGCAGTAGTGGTGGC	0.542													69	139	---	---	---	---	PASS
FASTKD5	60493	broad.mit.edu	37	20	3129718	3129718	+	5'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3129718C>T	uc002whz.2	-	2					uc002whv.1_Intron|UBOX5_uc002whw.2_Intron|UBOX5_uc002whx.2_Intron|UBOX5_uc002why.1_Intron	NM_021826	NP_068598	Q7L8L6	FAKD5_HUMAN	FAST kinase domains 5						apoptosis|cellular respiration	mitochondrion	ATP binding|protein kinase activity				0						AGCTGCCATTCTGGTGTCAGT	0.443													37	100	---	---	---	---	PASS
ProSAPiP1	9762	broad.mit.edu	37	20	3146652	3146652	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3146652C>A	uc002wia.1	-	2	2212	c.814G>T	c.(814-816)GAC>TAC	p.D272Y	ProSAPiP1_uc002wib.1_Missense_Mutation_p.D272Y	NM_014731	NP_055546	O60299	PRIP1_HUMAN	ProSAPiP1 protein	272						cell junction|cytoplasm|postsynaptic density|postsynaptic membrane				pancreas(1)	1						GTCCCCAGGTCCTGGTAGCCC	0.672													7	60	---	---	---	---	PASS
PROKR2	128674	broad.mit.edu	37	20	5294721	5294721	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:5294721C>T	uc010zqw.1	-	1	295	c.295G>A	c.(295-297)GAC>AAC	p.D99N	PROKR2_uc010zqx.1_Missense_Mutation_p.D99N|PROKR2_uc010zqy.1_Missense_Mutation_p.D99N|uc002wly.1_5'Flank	NM_144773	NP_658986	Q8NFJ6	PKR2_HUMAN	prokineticin receptor 2	99	Helical; Name=2; (Potential).					integral to membrane|plasma membrane	neuropeptide Y receptor activity			ovary(3)|central_nervous_system(1)|pancreas(1)	5						ACCAGGAAGTCGGAGATGGCC	0.572										HNSCC(71;0.22)			31	84	---	---	---	---	PASS
PLCB1	23236	broad.mit.edu	37	20	8678350	8678350	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:8678350G>C	uc002wnb.2	+	11	1090	c.1087G>C	c.(1087-1089)GAC>CAC	p.D363H	PLCB1_uc010zrb.1_Missense_Mutation_p.D262H|PLCB1_uc002wna.2_Missense_Mutation_p.D363H|PLCB1_uc002wnc.1_Missense_Mutation_p.D262H	NM_015192	NP_056007	Q9NQ66	PLCB1_HUMAN	phosphoinositide-specific phospholipase C beta 1	363	PI-PLC X-box.				activation of meiosis involved in egg activation|CD24 biosynthetic process|cerebral cortex development|G1 phase|G2/M transition of mitotic cell cycle|glutamate signaling pathway|insulin-like growth factor receptor signaling pathway|interleukin-1-mediated signaling pathway|interleukin-12-mediated signaling pathway|interleukin-15-mediated signaling pathway|intracellular signal transduction|lipid catabolic process|memory|muscarinic acetylcholine receptor signaling pathway|negative regulation of monocyte extravasation|negative regulation of transcription, DNA-dependent|phosphatidylinositol metabolic process|positive regulation of acrosome reaction|positive regulation of developmental growth|positive regulation of embryonic development|positive regulation of interleukin-12 production|positive regulation of JNK cascade|positive regulation of myoblast differentiation|positive regulation of transcription, DNA-dependent|regulation of fertilization|regulation of G-protein coupled receptor protein signaling pathway|synaptic transmission	cytosol|nuclear chromatin|nuclear speck	calcium ion binding|calmodulin binding|enzyme binding|GTPase activator activity|phosphatidylinositol phospholipase C activity|phosphatidylinositol-4,5-bisphosphate binding|protein homodimerization activity|signal transducer activity			ovary(4)|breast(3)|upper_aerodigestive_tract(2)|skin(2)|lung(1)	12						TGTGGAGCTGGACTGCTGGAA	0.473													25	257	---	---	---	---	PASS
PLCB1	23236	broad.mit.edu	37	20	8862500	8862500	+	3'UTR	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:8862500C>T	uc002wnb.2	+	32					PLCB1_uc002wna.2_3'UTR	NM_015192	NP_056007	Q9NQ66	PLCB1_HUMAN	phosphoinositide-specific phospholipase C beta 1						activation of meiosis involved in egg activation|CD24 biosynthetic process|cerebral cortex development|G1 phase|G2/M transition of mitotic cell cycle|glutamate signaling pathway|insulin-like growth factor receptor signaling pathway|interleukin-1-mediated signaling pathway|interleukin-12-mediated signaling pathway|interleukin-15-mediated signaling pathway|intracellular signal transduction|lipid catabolic process|memory|muscarinic acetylcholine receptor signaling pathway|negative regulation of monocyte extravasation|negative regulation of transcription, DNA-dependent|phosphatidylinositol metabolic process|positive regulation of acrosome reaction|positive regulation of developmental growth|positive regulation of embryonic development|positive regulation of interleukin-12 production|positive regulation of JNK cascade|positive regulation of myoblast differentiation|positive regulation of transcription, DNA-dependent|regulation of fertilization|regulation of G-protein coupled receptor protein signaling pathway|synaptic transmission	cytosol|nuclear chromatin|nuclear speck	calcium ion binding|calmodulin binding|enzyme binding|GTPase activator activity|phosphatidylinositol phospholipase C activity|phosphatidylinositol-4,5-bisphosphate binding|protein homodimerization activity|signal transducer activity			ovary(4)|breast(3)|upper_aerodigestive_tract(2)|skin(2)|lung(1)	12						TCTGTGAATGCTCCTGCCAGG	0.522													26	91	---	---	---	---	PASS
SNAP25	6616	broad.mit.edu	37	20	10286827	10286827	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:10286827G>C	uc002wnq.1	+	8	815	c.603G>C	c.(601-603)AAG>AAC	p.K201N	SNAP25_uc002wnr.1_Missense_Mutation_p.K201N|SNAP25_uc002wns.1_Missense_Mutation_p.K138N|SNAP25_uc010gca.1_Missense_Mutation_p.K201N|SNAP25_uc010gcb.1_Missense_Mutation_p.K138N|SNAP25_uc010gcc.1_Missense_Mutation_p.K95N	NM_130811	NP_570824	P60880	SNP25_HUMAN	synaptosomal-associated protein 25 isoform	201	t-SNARE coiled-coil homology 2.				energy reserve metabolic process|glutamate secretion|neurotransmitter uptake|synaptic vesicle docking involved in exocytosis	cell junction|growth cone|perinuclear region of cytoplasm|synapse|synaptosome				skin(2)	2					Botulinum Toxin Type A(DB00083)	GTGCAACAAAGATGCTGGGAA	0.453													17	57	---	---	---	---	PASS
MACROD2	140733	broad.mit.edu	37	20	14066369	14066369	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:14066369A>G	uc002wou.2	+	3	530	c.266A>G	c.(265-267)AAT>AGT	p.N89S	MACROD2_uc002wot.2_Missense_Mutation_p.N89S	NM_080676	NP_542407	A1Z1Q3	MACD2_HUMAN	MACRO domain containing 2 isoform 1	89	Macro.										0		all_neural(2;0.0381)|Acute lymphoblastic leukemia(2;0.175)				GCTATAGTCAATGCCGGTGAG	0.308													14	53	---	---	---	---	PASS
PAX1	5075	broad.mit.edu	37	20	21687476	21687476	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:21687476G>C	uc002wsj.2	+	2	741	c.687G>C	c.(685-687)GCG>GCC	p.A229A	PAX1_uc010zsl.1_Silent_p.A229A|PAX1_uc010zsm.1_Silent_p.A205A	NM_006192	NP_006183	P15863	PAX1_HUMAN	paired box 1	229					regulation of transcription, DNA-dependent|skeletal system development|transcription from RNA polymerase II promoter	nucleus	DNA binding			upper_aerodigestive_tract(1)|kidney(1)	2						GCAGCCTGGCGCAGCCCGGAC	0.647													10	35	---	---	---	---	PASS
NAPB	63908	broad.mit.edu	37	20	23361892	23361892	+	Silent	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:23361892T>C	uc002wta.2	-	8	741	c.624A>G	c.(622-624)AAA>AAG	p.K208K	NAPB_uc002wtc.2_Silent_p.K114K|NAPB_uc002wtb.2_Silent_p.K212K|NAPB_uc002wtd.3_RNA|NAPB_uc010zss.1_Silent_p.K95K|NAPB_uc010zst.1_Silent_p.K169K	NM_022080	NP_071363	Q9H115	SNAB_HUMAN	N-ethylmaleimide-sensitive factor attachment	208					intracellular protein transport|vesicle-mediated transport	membrane				ovary(1)	1	Lung NSC(19;0.0646)|Colorectal(13;0.0993)|all_lung(19;0.143)					AGAGGGCAGCTTTGAAGAAGT	0.398													44	236	---	---	---	---	PASS
TMEM90B	79953	broad.mit.edu	37	20	24523908	24523908	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:24523908C>A	uc002wtw.1	+	2	808	c.175C>A	c.(175-177)CCG>ACG	p.P59T		NM_024893	NP_079169	Q9H7V2	SYNG1_HUMAN	transmembrane protein 90B	59	Cytoplasmic (Potential).				response to biotic stimulus	early endosome membrane|integral to membrane|plasma membrane					0						CAGCACAGTGCCGGCCAGCCT	0.617													32	80	---	---	---	---	PASS
PLAGL2	5326	broad.mit.edu	37	20	30784767	30784767	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:30784767G>C	uc002wxn.2	-	3	1196	c.979C>G	c.(979-981)CTG>GTG	p.L327V		NM_002657	NP_002648	Q9UPG8	PLAL2_HUMAN	pleiomorphic adenoma gene-like 2	327						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|skin(1)	2			UCEC - Uterine corpus endometrioid carcinoma (5;0.0241)			GAGGATTCCAGAGGGTAGCTC	0.572													9	289	---	---	---	---	PASS
C20orf186	149954	broad.mit.edu	37	20	31685537	31685537	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31685537G>A	uc010zue.1	+	11	1528	c.1513G>A	c.(1513-1515)GAG>AAG	p.E505K		NM_182519	NP_872325	P59827	LPLC4_HUMAN	antimicrobial peptide RY2G5 precursor	505						cytoplasm|extracellular region	lipid binding				0						GGCCACTGCCGAGGTCATGGT	0.582													11	120	---	---	---	---	PASS
EIF2S2	8894	broad.mit.edu	37	20	32677584	32677584	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:32677584G>T	uc002xaf.2	-	9	1123	c.954C>A	c.(952-954)TTC>TTA	p.F318L	EIF2S2_uc002xag.2_Missense_Mutation_p.F315L|EIF2S2_uc010ges.2_Missense_Mutation_p.F258L	NM_003908	NP_003899	P20042	IF2B_HUMAN	eukaryotic translation initiation factor 2 beta	318						cytosol|eukaryotic translation initiation factor 2 complex	metal ion binding|protein binding|translation initiation factor activity			large_intestine(1)	1						TGACAGCCTGGAAGCCGGTTT	0.488													18	122	---	---	---	---	PASS
GGT7	2686	broad.mit.edu	37	20	33442668	33442668	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33442668G>A	uc002xay.2	-	9	1204	c.1161C>T	c.(1159-1161)CTC>CTT	p.L387L	GGT7_uc002xaz.1_Silent_p.L404L	NM_178026	NP_821158	Q9UJ14	GGT7_HUMAN	gamma-glutamyltransferase 7	387	Extracellular (Potential).				glutathione biosynthetic process	integral to membrane	acyltransferase activity|gamma-glutamyltransferase activity			ovary(1)	1						CCAGGATGTTGAGAGCACTGA	0.592													4	86	---	---	---	---	PASS
TRPC4AP	26133	broad.mit.edu	37	20	33591291	33591291	+	Silent	SNP	G	C	C	rs151041246		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33591291G>C	uc002xbk.2	-	18	2212	c.2178C>G	c.(2176-2178)CTC>CTG	p.L726L	TRPC4AP_uc002xbj.2_RNA|TRPC4AP_uc010zuq.1_Silent_p.L317L|TRPC4AP_uc002xbl.2_Silent_p.L718L|TRPC4AP_uc010zur.1_Silent_p.L687L	NM_015638	NP_056453	Q8TEL6	TP4AP_HUMAN	TRPC4-associated protein isoform a	726					protein ubiquitination|ubiquitin-dependent protein catabolic process	Cul4A-RING ubiquitin ligase complex	protein binding			central_nervous_system(1)|skin(1)	2			BRCA - Breast invasive adenocarcinoma(18;0.00936)			GGAAGTTGTTGAGCAGGAAGC	0.612													14	68	---	---	---	---	PASS
TRPC4AP	26133	broad.mit.edu	37	20	33595396	33595396	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33595396G>A	uc002xbk.2	-	14	1677	c.1643C>T	c.(1642-1644)TCC>TTC	p.S548F	TRPC4AP_uc002xbj.2_5'Flank|TRPC4AP_uc010zuq.1_Missense_Mutation_p.S139F|TRPC4AP_uc002xbl.2_Missense_Mutation_p.S540F|TRPC4AP_uc010zur.1_Missense_Mutation_p.S509F|TRPC4AP_uc002xbm.1_3'UTR	NM_015638	NP_056453	Q8TEL6	TP4AP_HUMAN	TRPC4-associated protein isoform a	548					protein ubiquitination|ubiquitin-dependent protein catabolic process	Cul4A-RING ubiquitin ligase complex	protein binding			central_nervous_system(1)|skin(1)	2			BRCA - Breast invasive adenocarcinoma(18;0.00936)			GTCTGCATAGGAGGTGGTCCC	0.607													19	92	---	---	---	---	PASS
SPAG4	6676	broad.mit.edu	37	20	34205126	34205126	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34205126G>C	uc002xdb.1	+	2	490	c.373G>C	c.(373-375)GAG>CAG	p.E125Q	SPAG4_uc010zvi.1_Missense_Mutation_p.E48Q	NM_003116	NP_003107	Q9NPE6	SPAG4_HUMAN	sperm associated antigen 4	125					spermatogenesis	cilium|flagellar axoneme|integral to membrane	structural molecule activity				0	Lung NSC(9;0.0053)|all_lung(11;0.00785)		BRCA - Breast invasive adenocarcinoma(18;0.0127)			TCTGAGGCAGGAGATGCCTCC	0.637													2	7	---	---	---	---	PASS
EPB41L1	2036	broad.mit.edu	37	20	34773052	34773052	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34773052C>T	uc002xfb.2	+	7	751	c.580C>T	c.(580-582)CTG>TTG	p.L194L	EPB41L1_uc002xeu.2_Silent_p.L132L|EPB41L1_uc010zvo.1_Silent_p.L194L|EPB41L1_uc002xev.2_Silent_p.L194L|EPB41L1_uc002xew.2_Silent_p.L97L|EPB41L1_uc002xex.2_Silent_p.L163L|EPB41L1_uc002xey.2_Intron|EPB41L1_uc002xez.2_Silent_p.L132L	NM_012156	NP_036288	Q9H4G0	E41L1_HUMAN	erythrocyte membrane protein band 4.1-like 1	194	FERM.				cortical actin cytoskeleton organization|synaptic transmission	cytoskeleton|cytosol|extrinsic to membrane|plasma membrane	actin binding|structural molecule activity			ovary(2)|pancreas(1)	3	Breast(12;0.0239)					CTACCTGTGCCTGCAGCTGCG	0.592													4	94	---	---	---	---	PASS
ACTR5	79913	broad.mit.edu	37	20	37383748	37383748	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:37383748C>A	uc002xjd.2	+	4	949	c.924C>A	c.(922-924)CTC>CTA	p.L308L		NM_024855	NP_079131	Q9H9F9	ARP5_HUMAN	ARP5 actin-related protein 5 homolog	308	Potential.				DNA recombination|double-strand break repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent|UV-damage excision repair	cytoplasm|Ino80 complex	ATP binding|protein binding				0		Myeloproliferative disorder(115;0.00878)				TGCAGGAGCTCAATGCCCGGC	0.602													3	34	---	---	---	---	PASS
PTPRT	11122	broad.mit.edu	37	20	40980734	40980734	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:40980734G>T	uc002xkg.2	-	10	1936	c.1752C>A	c.(1750-1752)ACC>ACA	p.T584T	PTPRT_uc010ggj.2_Silent_p.T584T	NM_007050	NP_008981	O14522	PTPRT_HUMAN	protein tyrosine phosphatase, receptor type, T	584	Extracellular (Potential).|Fibronectin type-III 3.				homophilic cell adhesion|transmembrane receptor protein tyrosine kinase signaling pathway	cell surface|integral to membrane|plasma membrane	alpha-catenin binding|beta-catenin binding|cadherin binding|delta-catenin binding|gamma-catenin binding|protein tyrosine phosphatase activity|receptor activity			skin(8)|ovary(7)|lung(5)	20		Myeloproliferative disorder(115;0.00452)|Lung NSC(126;0.0573)|all_lung(126;0.0783)				CTGAAATTTTGGTGGCAATCC	0.468													48	76	---	---	---	---	PASS
MATN4	8785	broad.mit.edu	37	20	43926926	43926926	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43926926G>A	uc002xnn.2	-	7	1497	c.1310C>T	c.(1309-1311)TCC>TTC	p.S437F	MATN4_uc002xno.2_Missense_Mutation_p.S396F|MATN4_uc002xnp.2_Missense_Mutation_p.S355F|MATN4_uc010zwr.1_Missense_Mutation_p.S385F|MATN4_uc002xnr.1_Missense_Mutation_p.S437F	NM_003833	NP_003824	O95460	MATN4_HUMAN	matrilin 4 isoform 1 precursor	478	VWFA 2.					extracellular region	protein binding				0		Myeloproliferative disorder(115;0.0122)				CTGCGCCTCGGAGAAGCTGTG	0.667													11	60	---	---	---	---	PASS
SLC13A3	64849	broad.mit.edu	37	20	45204214	45204214	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:45204214C>G	uc002xsf.1	-	10	1368	c.1330G>C	c.(1330-1332)GAG>CAG	p.E444Q	SLC13A3_uc010ghn.1_Missense_Mutation_p.E413Q|SLC13A3_uc010zxw.1_Missense_Mutation_p.E394Q|SLC13A3_uc002xsg.1_Missense_Mutation_p.E397Q|SLC13A3_uc010gho.1_Missense_Mutation_p.E362Q|SLC13A3_uc010zxx.1_Missense_Mutation_p.E346Q|SLC13A3_uc010zxv.1_Intron	NM_022829	NP_073740	Q8WWT9	S13A3_HUMAN	solute carrier family 13 member 3 isoform a	444	Cytoplasmic (Potential).					integral to membrane|plasma membrane	high affinity sodium:dicarboxylate symporter activity			ovary(1)	1		Myeloproliferative disorder(115;0.0122)			Succinic acid(DB00139)	GGTCTTACCTCACAGCCTTTG	0.632													3	12	---	---	---	---	PASS
PREX1	57580	broad.mit.edu	37	20	47266640	47266640	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47266640G>C	uc002xtw.1	-	24	2945	c.2922C>G	c.(2920-2922)ATC>ATG	p.I974M	PREX1_uc002xtv.1_Missense_Mutation_p.I271M	NM_020820	NP_065871	Q8TCU6	PREX1_HUMAN	phosphatidylinositol-3,4,	974					actin filament polymerization|apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|neutrophil activation|small GTPase mediated signal transduction|superoxide metabolic process	cytosol|plasma membrane	enzyme binding|phospholipid binding|Rho GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			lung(3)|ovary(2)|pancreas(1)	6			BRCA - Breast invasive adenocarcinoma(12;0.0135)|Colorectal(8;0.198)			CCATGAGGTTGATGTGGCAAT	0.622													42	197	---	---	---	---	PASS
TSHZ2	128553	broad.mit.edu	37	20	51871800	51871800	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:51871800G>C	uc002xwo.2	+	2	2759	c.1803G>C	c.(1801-1803)AAG>AAC	p.K601N		NM_173485	NP_775756	Q9NRE2	TSH2_HUMAN	teashirt zinc finger homeobox 2	601					multicellular organismal development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(5)|haematopoietic_and_lymphoid_tissue(1)	6			STAD - Stomach adenocarcinoma(23;0.1)			CTCAAGTCAAGAAAGAGTCAG	0.512													10	189	---	---	---	---	PASS
TSHZ2	128553	broad.mit.edu	37	20	51871975	51871975	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:51871975G>C	uc002xwo.2	+	2	2934	c.1978G>C	c.(1978-1980)GAG>CAG	p.E660Q		NM_173485	NP_775756	Q9NRE2	TSH2_HUMAN	teashirt zinc finger homeobox 2	660					multicellular organismal development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(5)|haematopoietic_and_lymphoid_tissue(1)	6			STAD - Stomach adenocarcinoma(23;0.1)			GCTGATGAAAGAGGGCAGCGA	0.597													40	48	---	---	---	---	PASS
CDH26	60437	broad.mit.edu	37	20	58571034	58571034	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:58571034G>A	uc002ybe.2	+	12	2113	c.1813G>A	c.(1813-1815)GAG>AAG	p.E605K	CDH26_uc002ybf.1_Missense_Mutation_p.E185K|CDH26_uc010zzy.1_RNA|CDH26_uc002ybg.2_Missense_Mutation_p.E119K|CDH26_uc002ybh.2_5'Flank|CDH26_uc002ybi.2_5'Flank	NM_177980	NP_817089	Q8IXH8	CAD26_HUMAN	cadherin-like 26 isoform a	605	Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|central_nervous_system(1)	4	all_lung(29;0.00963)		BRCA - Breast invasive adenocarcinoma(7;5.58e-09)			CACATGTGTGGAGCTTGCAGA	0.552													4	85	---	---	---	---	PASS
DIDO1	11083	broad.mit.edu	37	20	61525358	61525358	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61525358G>A	uc002ydr.1	-	12	3025	c.2761C>T	c.(2761-2763)CAT>TAT	p.H921Y	DIDO1_uc002yds.1_Missense_Mutation_p.H921Y|DIDO1_uc002ydt.1_Missense_Mutation_p.H921Y|DIDO1_uc002ydu.1_Missense_Mutation_p.H921Y	NM_033081	NP_149072	Q9BTC0	DIDO1_HUMAN	death inducer-obliterator 1 isoform c	921					apoptosis|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(3)|skin(3)	6	Breast(26;5.68e-08)					ACATTTGGATGAGAAGCACTT	0.607													5	130	---	---	---	---	PASS
BIRC7	79444	broad.mit.edu	37	20	61870880	61870880	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61870880G>A	uc002yej.2	+	6	993	c.820G>A	c.(820-822)GAG>AAG	p.E274K	BIRC7_uc010gkc.1_3'UTR|BIRC7_uc002yei.2_Missense_Mutation_p.E256K	NM_139317	NP_647478	Q96CA5	BIRC7_HUMAN	livin inhibitor of apoptosis isoform alpha	274	RING-type.				activation of JUN kinase activity|anti-apoptosis|DNA fragmentation involved in apoptotic nuclear change	cytoplasm|nucleus	enzyme binding|zinc ion binding			ovary(1)|lung(1)|kidney(1)	3	all_cancers(38;2.72e-09)					GGTCTGTGCTGAGTGTGCCCC	0.706													8	49	---	---	---	---	PASS
MYT1	4661	broad.mit.edu	37	20	62871199	62871199	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62871199G>A	uc002yii.2	+	22	3544	c.3180G>A	c.(3178-3180)CTG>CTA	p.L1060L	MYT1_uc002yij.2_Silent_p.L719L|MYT1_uc002yik.2_Silent_p.L26L	NM_004535	NP_004526	Q01538	MYT1_HUMAN	myelin transcription factor 1	1060					cell differentiation|nervous system development	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2	all_cancers(38;1.82e-11)|all_epithelial(29;3.3e-13)|Lung NSC(23;5.21e-10)|all_lung(23;1.92e-09)					TTCTGGAGCTGTCCGGCCTGA	0.587													11	191	---	---	---	---	PASS
TPTE	7179	broad.mit.edu	37	21	10922002	10922002	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:10922002A>T	uc002yip.1	-						TPTE_uc002yis.1_Intron|TPTE_uc002yiq.1_Intron|TPTE_uc002yir.1_Intron|TPTE_uc010gkv.1_Intron	NM_199261	NP_954870	P56180	TPTE_HUMAN	transmembrane phosphatase with tensin homology						signal transduction	integral to membrane	ion channel activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			ovary(2)|lung(1)|breast(1)|skin(1)	5			Colorectal(6;3.44e-05)|COAD - Colon adenocarcinoma(6;0.00727)|READ - Rectum adenocarcinoma(6;0.0723)	UCEC - Uterine corpus endometrioid carcinoma (6;0.0974)|all cancers(6;2.54e-22)|Epithelial(6;4.21e-19)|OV - Ovarian serous cystadenocarcinoma(6;1.16e-09)|BRCA - Breast invasive adenocarcinoma(6;7.72e-05)|Lung(8;0.000189)|LUSC - Lung squamous cell carcinoma(6;0.00379)|GBM - Glioblastoma multiforme(6;0.00391)|Kidney(17;0.0773)|LUAD - Lung adenocarcinoma(8;0.247)		CTATCTAGAAAAGAAAAGAAG	0.294													14	204	---	---	---	---	PASS
LIPI	149998	broad.mit.edu	37	21	15538675	15538675	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:15538675C>T	uc002yjm.2	-						LIPI_uc010gkw.1_Intron	NM_198996	NP_945347	Q6XZB0	LIPI_HUMAN	lipase, member I						lipid catabolic process	extracellular region|extracellular space|membrane|plasma membrane	heparin binding|phospholipase activity			ovary(2)	2				Epithelial(23;0.000155)|COAD - Colon adenocarcinoma(22;0.0015)|Colorectal(24;0.00693)|Lung(58;0.166)		AAAATACTGTCAGTATACCTG	0.338													10	227	---	---	---	---	PASS
RBM11	54033	broad.mit.edu	37	21	15599481	15599481	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:15599481A>G	uc002yjo.3	+	5	755	c.713A>G	c.(712-714)GAC>GGC	p.D238G	RBM11_uc002yjn.3_Missense_Mutation_p.D124G|RBM11_uc002yjp.3_Missense_Mutation_p.D124G	NM_144770	NP_658983	P57052	RBM11_HUMAN	RNA binding motif protein 11	238							nucleotide binding|RNA binding				0				Epithelial(23;0.000314)|COAD - Colon adenocarcinoma(22;0.00242)|Colorectal(24;0.0129)|Lung(58;0.141)		CAACCAAGTGACTCTGACCTT	0.428													80	335	---	---	---	---	PASS
TMPRSS15	5651	broad.mit.edu	37	21	19651328	19651328	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:19651328G>T	uc002ykw.2	-	23	2748	c.2717C>A	c.(2716-2718)CCA>CAA	p.P906Q		NM_002772	NP_002763	P98073	ENTK_HUMAN	enterokinase precursor	906	Extracellular (Potential).|Peptidase S1.				proteolysis	brush border|integral to membrane	scavenger receptor activity|serine-type endopeptidase activity			ovary(5)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	8						ATTTCTTCCTGGAGGAAAAAC	0.323													8	88	---	---	---	---	PASS
NCAM2	4685	broad.mit.edu	37	21	22849633	22849633	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:22849633C>G	uc002yld.1	+	15	2167	c.1918C>G	c.(1918-1920)CTA>GTA	p.L640V	NCAM2_uc011acb.1_Missense_Mutation_p.L498V	NM_004540	NP_004531	O15394	NCAM2_HUMAN	neural cell adhesion molecule 2 precursor	640	Fibronectin type-III 2.|Extracellular (Potential).				neuron cell-cell adhesion	integral to membrane|plasma membrane				ovary(4)	4		Lung NSC(9;0.195)		all cancers(11;0.00102)|OV - Ovarian serous cystadenocarcinoma(11;0.00121)|Epithelial(23;0.00147)|Colorectal(24;0.174)		AGACCAATGGCTAGAGAAAAA	0.353													14	55	---	---	---	---	PASS
NCAM2	4685	broad.mit.edu	37	21	22849675	22849675	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:22849675G>T	uc002yld.1	+	15	2209	c.1960G>T	c.(1960-1962)GAG>TAG	p.E654*	NCAM2_uc011acb.1_Nonsense_Mutation_p.E512*	NM_004540	NP_004531	O15394	NCAM2_HUMAN	neural cell adhesion molecule 2 precursor	654	Fibronectin type-III 2.|Extracellular (Potential).				neuron cell-cell adhesion	integral to membrane|plasma membrane				ovary(4)	4		Lung NSC(9;0.195)		all cancers(11;0.00102)|OV - Ovarian serous cystadenocarcinoma(11;0.00121)|Epithelial(23;0.00147)|Colorectal(24;0.174)		CATCATTTTGGAGCATCTCCA	0.388													14	84	---	---	---	---	PASS
GRIK1	2897	broad.mit.edu	37	21	31023509	31023509	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:31023509C>G	uc002yno.1	-	6	1347	c.883G>C	c.(883-885)GAG>CAG	p.E295Q	GRIK1_uc002ynn.2_Missense_Mutation_p.E295Q|GRIK1_uc011acs.1_Missense_Mutation_p.E295Q|GRIK1_uc011act.1_Missense_Mutation_p.E239Q|GRIK1_uc010glq.1_Missense_Mutation_p.E153Q|GRIK1_uc002ynr.2_Missense_Mutation_p.E295Q	NM_000830	NP_000821	P39086	GRIK1_HUMAN	glutamate receptor, ionotropic, kainate 1	295	Extracellular (Potential).				central nervous system development|synaptic transmission	cell junction|postsynaptic membrane	kainate selective glutamate receptor activity			large_intestine(1)|ovary(1)|skin(1)	3					L-Glutamic Acid(DB00142)|Topiramate(DB00273)	GACCACTTCTCAATGATGGAT	0.473													18	88	---	---	---	---	PASS
TIAM1	7074	broad.mit.edu	37	21	32526612	32526612	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:32526612G>A	uc002yow.1	-	18	3596	c.3124C>T	c.(3124-3126)CGC>TGC	p.R1042C	TIAM1_uc011adk.1_Missense_Mutation_p.R1042C|TIAM1_uc011adl.1_Missense_Mutation_p.R982C	NM_003253	NP_003244	Q13009	TIAM1_HUMAN	T-cell lymphoma invasion and metastasis 1	1042	DH.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cell-cell junction|cytosol	receptor signaling protein activity|Rho guanyl-nucleotide exchange factor activity			lung(3)|breast(3)|ovary(2)|large_intestine(2)	10						ATCACCTTGCGCAGCTTATCT	0.567													11	132	---	---	---	---	PASS
C21orf45	54069	broad.mit.edu	37	21	33642731	33642731	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:33642731C>T	uc002ypi.2	-	3	562	c.511G>A	c.(511-513)GAA>AAA	p.E171K	C21orf45_uc011adn.1_Missense_Mutation_p.E171K	NM_018944	NP_061817	Q9NYP9	MS18A_HUMAN	chromosome 21 open reading frame 45	171					cell division|CenH3-containing nucleosome assembly at centromere|mitosis	chromosome, centromeric region|nucleoplasm					0						TCAATGGCTTCAACACTGAGG	0.413													18	95	---	---	---	---	PASS
DOPEY2	9980	broad.mit.edu	37	21	37610966	37610966	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:37610966G>T	uc002yvg.2	+	17	2922	c.2843G>T	c.(2842-2844)AGT>ATT	p.S948I	DOPEY2_uc011aeb.1_Missense_Mutation_p.S897I	NM_005128	NP_005119	Q9Y3R5	DOP2_HUMAN	pad-1-like	948					endoplasmic reticulum organization|Golgi to endosome transport|multicellular organismal development|protein transport	Golgi membrane				ovary(1)|central_nervous_system(1)	2						ATCCAAGGCAGTCGAGTAACA	0.493													21	53	---	---	---	---	PASS
DYRK1A	1859	broad.mit.edu	37	21	38878617	38878617	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:38878617C>T	uc002ywk.2	+						DYRK1A_uc002ywi.2_3'UTR|DYRK1A_uc002ywj.2_Intron|DYRK1A_uc002ywl.2_Missense_Mutation_p.S530L|DYRK1A_uc002ywm.2_Intron|DYRK1A_uc011aei.1_Intron	NM_001396	NP_001387	Q13627	DYR1A_HUMAN	dual-specificity tyrosine-(Y)-phosphorylation						nervous system development|peptidyl-tyrosine phosphorylation|protein autophosphorylation	nuclear speck	ATP binding|non-membrane spanning protein tyrosine kinase activity|protein binding|protein self-association|protein serine/threonine kinase activity			ovary(2)|lung(1)|breast(1)	4						ATGACCGTATCATTTACCCTA	0.473													8	18	---	---	---	---	PASS
KCNJ15	3772	broad.mit.edu	37	21	39671705	39671705	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:39671705G>C	uc002ywv.2	+	4	824	c.522G>C	c.(520-522)CGG>CGC	p.R174R	KCNJ15_uc002yww.2_Silent_p.R174R|KCNJ15_uc002ywx.2_Silent_p.R174R	NM_002243	NP_002234	Q99712	IRK15_HUMAN	potassium inwardly-rectifying channel J15	174	Cytoplasmic (By similarity).				synaptic transmission	integral to plasma membrane	inward rectifier potassium channel activity			ovary(2)|skin(2)|breast(1)|central_nervous_system(1)	6						CCAAAAAGCGGGCTGAGACCA	0.502													30	75	---	---	---	---	PASS
BRWD1	54014	broad.mit.edu	37	21	40559097	40559097	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:40559097G>C	uc002yxk.1	-	42	6957	c.6818C>G	c.(6817-6819)TCT>TGT	p.S2273C	BRWD1_uc010goc.1_Missense_Mutation_p.S916C	NM_018963	NP_061836	Q9NSI6	BRWD1_HUMAN	bromodomain and WD repeat domain containing 1	2273					regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus				skin(3)|ovary(1)	4		Prostate(19;8.44e-08)|all_epithelial(19;0.223)				AGCCGCAGCAGAAGCATTTCG	0.323													37	147	---	---	---	---	PASS
IGSF5	150084	broad.mit.edu	37	21	41142978	41142978	+	Nonsense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:41142978C>G	uc002yyo.2	+	4	657	c.554C>G	c.(553-555)TCA>TGA	p.S185*		NM_001080444	NP_001073913	Q9NSI5	IGSF5_HUMAN	immunoglobulin superfamily 5 like	185	Ig-like V-type 2.|Extracellular (Potential).					integral to membrane|tight junction					0		Prostate(19;5.35e-06)				GTCAGCCATTCAAGCTATTAT	0.537													16	95	---	---	---	---	PASS
DSCAM	1826	broad.mit.edu	37	21	41385099	41385099	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:41385099G>T	uc002yyq.1	-	33	6353	c.5901C>A	c.(5899-5901)GCC>GCA	p.A1967A	DSCAM_uc002yyr.1_RNA	NM_001389	NP_001380	O60469	DSCAM_HUMAN	Down syndrome cell adhesion molecule isoform	1967	Cytoplasmic (Potential).			HRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQK SRTLKRPTVLEPIPMEAASSASSTREGQSWQPGAVATLPQR EGAELGQAAKMSSSQESLLDSRGHLKGNNPYAKSYTLV -> IGQVTSYICLHTLEWTFC (in Ref. 1; AAC17966).	cell adhesion|dendrite self-avoidance|negative regulation of cell adhesion|positive regulation of axon extension involved in axon guidance|positive regulation of phosphorylation	axon|extracellular region|growth cone|integral to plasma membrane|membrane fraction	protein binding			ovary(6)|skin(4)|upper_aerodigestive_tract(1)	11		all_cancers(19;0.186)|Prostate(19;1.15e-05)|all_epithelial(19;0.0103)				ATGTGGCCACGGCCCCCGGCT	0.652													3	23	---	---	---	---	PASS
PRDM15	63977	broad.mit.edu	37	21	43287398	43287398	+	Intron	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:43287398C>G	uc002yzq.1	-						PRDM15_uc002yzo.2_Intron|PRDM15_uc002yzp.2_Intron|PRDM15_uc002yzr.1_Intron	NM_022115	NP_071398	P57071	PRD15_HUMAN	PR domain containing 15 isoform 1						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						CCTTTCTACTCTAGCCCTGAC	0.547													45	182	---	---	---	---	PASS
PDE9A	5152	broad.mit.edu	37	21	44179162	44179162	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44179162C>T	uc002zbm.2	+	11	927	c.864C>T	c.(862-864)TTC>TTT	p.F288F	PDE9A_uc002zbn.2_Silent_p.F161F|PDE9A_uc002zbo.2_Silent_p.F235F|PDE9A_uc002zbp.2_Silent_p.F81F|PDE9A_uc002zbq.2_Silent_p.F186F|PDE9A_uc002zbs.2_Silent_p.F81F|PDE9A_uc002zbr.2_Silent_p.F81F|PDE9A_uc002zbt.2_Silent_p.F160F|PDE9A_uc002zbu.2_Silent_p.F154F|PDE9A_uc002zbv.2_Silent_p.F128F|PDE9A_uc002zbw.2_Silent_p.F71F|PDE9A_uc002zbx.2_Silent_p.F228F|PDE9A_uc002zby.2_Silent_p.F71F|PDE9A_uc002zbz.2_Silent_p.F180F|PDE9A_uc002zca.2_Silent_p.F247F|PDE9A_uc002zcb.2_Silent_p.F262F|PDE9A_uc002zcc.2_Silent_p.F187F|PDE9A_uc002zcd.2_Silent_p.F202F|PDE9A_uc002zce.2_Silent_p.F221F|PDE9A_uc002zcf.2_Silent_p.F81F|PDE9A_uc002zcg.2_Silent_p.F81F|PDE9A_uc002zch.2_Silent_p.F71F|PDE9A_uc010gpf.1_Silent_p.F81F	NM_002606	NP_002597	O76083	PDE9A_HUMAN	phosphodiesterase 9A isoform a	288	Catalytic (By similarity).				platelet activation|signal transduction	cytosol|endoplasmic reticulum|Golgi apparatus|perinuclear region of cytoplasm|ruffle membrane	3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding|protein binding			ovary(1)|skin(1)	2						TCAGGGACTTCAGCATCAACC	0.602													4	56	---	---	---	---	PASS
PKNOX1	5316	broad.mit.edu	37	21	44448912	44448912	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44448912C>G	uc002zcq.1	+	10	1215	c.1027C>G	c.(1027-1029)CAG>GAG	p.Q343E	PKNOX1_uc002zcp.1_Missense_Mutation_p.Q343E|PKNOX1_uc011aex.1_Missense_Mutation_p.Q226E	NM_004571	NP_004562	P55347	PKNX1_HUMAN	PBX/knotted 1 homeobox 1	343							sequence-specific DNA binding			large_intestine(2)	2						CCGGCCAGTTCAGAGGTTTTG	0.512													67	221	---	---	---	---	PASS
PKNOX1	5316	broad.mit.edu	37	21	44450169	44450169	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44450169C>G	uc002zcq.1	+	11	1457	c.1269C>G	c.(1267-1269)CAC>CAG	p.H423Q	PKNOX1_uc011aex.1_Missense_Mutation_p.H306Q	NM_004571	NP_004562	P55347	PKNX1_HUMAN	PBX/knotted 1 homeobox 1	423							sequence-specific DNA binding			large_intestine(2)	2						CCCCTGCCCACATCAGCGGGC	0.607													18	53	---	---	---	---	PASS
CBS	875	broad.mit.edu	37	21	44483055	44483055	+	Intron	SNP	C	T	T	rs76292057	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44483055C>T	uc002zcu.2	-						CBS_uc002zcs.1_Intron|CBS_uc002zct.2_Intron|CBS_uc002zcw.3_Intron|CBS_uc002zcv.2_Intron|CBS_uc002zcx.2_5'Flank	NM_000071	NP_000062	P35520	CBS_HUMAN	cystathionine-beta-synthase						cysteine biosynthetic process from serine|cysteine biosynthetic process via cystathionine|homocysteine catabolic process|hydrogen sulfide biosynthetic process|L-cysteine catabolic process|L-serine catabolic process	cytosol|nucleolus	cystathionine beta-synthase activity|heme binding|protein homodimerization activity|pyridoxal phosphate binding|ubiquitin protein ligase binding				0					L-Cysteine(DB00151)|L-Serine(DB00133)|Pyridoxal Phosphate(DB00114)|Pyridoxine(DB00165)|S-Adenosylmethionine(DB00118)	GCTCTGGACTCGACCTACCGT	0.632													18	54	---	---	---	---	PASS
CBS	875	broad.mit.edu	37	21	44483143	44483143	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44483143C>T	uc002zcu.2	-	10	1119	c.874G>A	c.(874-876)GAG>AAG	p.E292K	CBS_uc002zcs.1_Missense_Mutation_p.E187K|CBS_uc002zct.2_Missense_Mutation_p.E292K|CBS_uc002zcw.3_Missense_Mutation_p.E292K|CBS_uc002zcv.2_Missense_Mutation_p.E292K|CBS_uc002zcx.2_5'Flank	NM_000071	NP_000062	P35520	CBS_HUMAN	cystathionine-beta-synthase	292					cysteine biosynthetic process from serine|cysteine biosynthetic process via cystathionine|homocysteine catabolic process|hydrogen sulfide biosynthetic process|L-cysteine catabolic process|L-serine catabolic process	cytosol|nucleolus	cystathionine beta-synthase activity|heme binding|protein homodimerization activity|pyridoxal phosphate binding|ubiquitin protein ligase binding				0					L-Cysteine(DB00151)|L-Serine(DB00133)|Pyridoxal Phosphate(DB00114)|Pyridoxine(DB00165)|S-Adenosylmethionine(DB00118)	TGGTTCAGCTCCTCCGGCTCT	0.632													34	123	---	---	---	---	PASS
CBS	875	broad.mit.edu	37	21	44483170	44483170	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44483170C>T	uc002zcu.2	-	10	1092	c.847G>A	c.(847-849)GAA>AAA	p.E283K	CBS_uc002zcs.1_Missense_Mutation_p.E178K|CBS_uc002zct.2_Missense_Mutation_p.E283K|CBS_uc002zcw.3_Missense_Mutation_p.E283K|CBS_uc002zcv.2_Missense_Mutation_p.E283K|CBS_uc002zcx.2_5'Flank	NM_000071	NP_000062	P35520	CBS_HUMAN	cystathionine-beta-synthase	283					cysteine biosynthetic process from serine|cysteine biosynthetic process via cystathionine|homocysteine catabolic process|hydrogen sulfide biosynthetic process|L-cysteine catabolic process|L-serine catabolic process	cytosol|nucleolus	cystathionine beta-synthase activity|heme binding|protein homodimerization activity|pyridoxal phosphate binding|ubiquitin protein ligase binding				0					L-Cysteine(DB00151)|L-Serine(DB00133)|Pyridoxal Phosphate(DB00114)|Pyridoxine(DB00165)|S-Adenosylmethionine(DB00118)	ATGGACCCTTCGGGATCCACC	0.607													33	106	---	---	---	---	PASS
TRPM2	7226	broad.mit.edu	37	21	45811239	45811239	+	Nonsense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45811239C>T	uc002zet.1	+	12	1738	c.1525C>T	c.(1525-1527)CAG>TAG	p.Q509*	TRPM2_uc002zeu.1_Nonsense_Mutation_p.Q509*|TRPM2_uc002zew.1_Nonsense_Mutation_p.Q509*|TRPM2_uc010gpt.1_Nonsense_Mutation_p.Q509*|TRPM2_uc002zex.1_Nonsense_Mutation_p.Q295*|TRPM2_uc002zey.1_Nonsense_Mutation_p.Q22*	NM_003307	NP_003298	O94759	TRPM2_HUMAN	transient receptor potential cation channel,	509	Cytoplasmic (Potential).					integral to plasma membrane	ADP-ribose diphosphatase activity|calcium channel activity|sodium channel activity			ovary(1)|central_nervous_system(1)|pancreas(1)	3						GAACGGGGTGCAGCTGAAGGA	0.557													39	153	---	---	---	---	PASS
KRTAP10-5	386680	broad.mit.edu	37	21	45999863	45999863	+	Nonsense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45999863G>T	uc002zfl.1	-	1	619	c.593C>A	c.(592-594)TCA>TAA	p.S198*	C21orf29_uc002zfe.1_Intron|C21orf29_uc010gpv.1_Intron	NM_198694	NP_941967	P60370	KR105_HUMAN	keratin associated protein 10-5	198	22 X 5 AA repeats of C-C-X(3).					keratin filament					0						CTGGCAGCATGAAGTGGAAGC	0.632													64	236	---	---	---	---	PASS
COL6A2	1292	broad.mit.edu	37	21	47546006	47546006	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:47546006C>T	uc002zia.1	+	26	2359	c.2277C>T	c.(2275-2277)ATC>ATT	p.I759I	COL6A2_uc002zhy.1_Silent_p.I759I|COL6A2_uc002zhz.1_Silent_p.I759I|COL6A2_uc002zib.1_Silent_p.I165I|COL6A2_uc002zic.1_5'Flank	NM_001849	NP_001840	P12110	CO6A2_HUMAN	alpha 2 type VI collagen isoform 2C2 precursor	759	VWFA 2.|Nonhelical region.				axon guidance|cell-cell adhesion|extracellular matrix organization|protein heterotrimerization	collagen|extracellular space|protein complex	extracellular matrix structural constituent|protein binding, bridging			central_nervous_system(7)|ovary(1)	8	Breast(49;0.245)			Colorectal(79;0.0303)|READ - Rectum adenocarcinoma(84;0.0649)		CCATCGGCATCGGGGACATGT	0.627													16	260	---	---	---	---	PASS
PCNT	5116	broad.mit.edu	37	21	47864606	47864606	+	Splice_Site	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:47864606G>C	uc002zji.3	+	46	9947	c.9840_splice	c.e46-1	p.R3280_splice	PCNT_uc002zjj.2_Splice_Site_p.R3083_splice	NM_006031	NP_006022	O95613	PCNT_HUMAN	pericentrin						cilium assembly|G2/M transition of mitotic cell cycle	cytosol|microtubule	calmodulin binding			ovary(4)|breast(2)|pancreas(2)	8	Breast(49;0.112)					TTTGTTTGAAGAGCCACTCCA	0.403													13	110	---	---	---	---	PASS
OR11H1	81061	broad.mit.edu	37	22	16449122	16449122	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:16449122A>T	uc011agd.1	-	1	683	c.683T>A	c.(682-684)TTT>TAT	p.F228Y		NM_001005239	NP_001005239	Q8NG94	O11H1_HUMAN	olfactory receptor, family 11, subfamily H,	228	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_hematologic(4;0.00567)|Acute lymphoblastic leukemia(84;0.0977)	all_epithelial(15;0.208)		Kidney(3;0.00216)|KIRC - Kidney renal clear cell carcinoma(3;0.00244)|Lung(27;0.0724)|COAD - Colon adenocarcinoma(3;0.211)		TCCAATAATAAAGAGGAAGTT	0.438													31	220	---	---	---	---	PASS
CECR5	27440	broad.mit.edu	37	22	17619130	17619130	+	Silent	SNP	T	A	A	rs138657583	byFrequency	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:17619130T>A	uc002zmf.2	-	8	1081	c.1053A>T	c.(1051-1053)TCA>TCT	p.S351S	CECR5_uc002zmd.2_Silent_p.S162S|CECR5_uc002zme.2_Silent_p.S143S|CECR5_uc002zmg.2_Silent_p.S151S|CECR5_uc002zmh.2_Silent_p.S321S	NM_033070	NP_149061	Q9BXW7	CECR5_HUMAN	cat eye syndrome chromosome region, candidate 5	351							hydrolase activity				0		all_epithelial(15;0.0181)|Lung NSC(13;0.109)|all_lung(157;0.132)				TCTGGCTTGCTGAGGGCTGTT	0.617													24	41	---	---	---	---	PASS
HIRA	7290	broad.mit.edu	37	22	19371184	19371184	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19371184C>T	uc002zpf.1	-	13	1594	c.1374G>A	c.(1372-1374)CGG>CGA	p.R458R	HIRA_uc011agx.1_Silent_p.R324R|HIRA_uc010grn.1_Silent_p.R458R|HIRA_uc010gro.1_Silent_p.R414R|HIRA_uc010grp.2_RNA	NM_003325	NP_003316	P54198	HIRA_HUMAN	HIR histone cell cycle regulation defective	458	Interaction with CCNA1.|Interaction with ASF1A.|Required for repression of histone gene transcription.			RRR->KKK: Impairs binding to ASF1A.|RR->AK: Impairs binding to ASF1A.|Missing: Impairs binding to ASF1A.|R->A: Impairs binding to ASF1A.|RRR->AKK: Abrogates binding to ASF1A.|R->K: Impairs binding to ASF1A; when associated with K-460.	chromatin modification|regulation of transcription from RNA polymerase II promoter	PML body	chromatin binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(1)	1	Colorectal(54;0.0993)					TGATTCTTCTCCGGCCATCTG	0.448													6	224	---	---	---	---	PASS
HIRA	7290	broad.mit.edu	37	22	19384325	19384325	+	Silent	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19384325G>C	uc002zpf.1	-	7	859	c.639C>G	c.(637-639)ACC>ACG	p.T213T	HIRA_uc011agx.1_Silent_p.T79T|HIRA_uc010grn.1_Silent_p.T213T|HIRA_uc010gro.1_Silent_p.T169T|HIRA_uc010grp.2_RNA	NM_003325	NP_003316	P54198	HIRA_HUMAN	HIR histone cell cycle regulation defective	213					chromatin modification|regulation of transcription from RNA polymerase II promoter	PML body	chromatin binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(1)	1	Colorectal(54;0.0993)					CAAAAGGCTTGGTGATGCTGG	0.567													36	81	---	---	---	---	PASS
TRMT2A	27037	broad.mit.edu	37	22	20103652	20103652	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:20103652C>A	uc002zrk.1	-	3	723	c.508G>T	c.(508-510)GAC>TAC	p.D170Y	TRMT2A_uc002zrl.1_Missense_Mutation_p.D170Y|TRMT2A_uc002zrm.1_5'UTR|TRMT2A_uc002zrn.1_Missense_Mutation_p.D170Y|TRMT2A_uc011ahk.1_Missense_Mutation_p.D170Y|RANBP1_uc011ahl.1_5'Flank|RANBP1_uc002zro.1_5'Flank|RANBP1_uc002zrp.2_5'Flank	NM_182984	NP_892029	Q8IZ69	TRM2A_HUMAN	HpaII tiny fragments locus 9C	170					RNA processing		nucleotide binding|RNA binding|RNA methyltransferase activity			breast(1)	1						GTCACCACGTCGGCCACTCGT	0.642													15	65	---	---	---	---	PASS
HIC2	23119	broad.mit.edu	37	22	21799210	21799210	+	Splice_Site	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21799210G>A	uc002zur.3	+	3	257	c.27_splice	c.e3-1	p.R9_splice	HIC2_uc002zus.3_Splice_Site_p.R9_splice	NM_015094	NP_055909	Q96JB3	HIC2_HUMAN	hypermethylated in cancer 2						negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	focal adhesion|nucleus	DNA binding|protein C-terminus binding|zinc ion binding			skin(1)	1	Melanoma(16;0.000465)|Ovarian(15;0.00438)|Colorectal(54;0.0968)	Lung SC(17;0.0262)|all_lung(157;0.205)				CTTGCCCACAGGTGGTGCGCG	0.667													12	59	---	---	---	---	PASS
LOC96610	96610	broad.mit.edu	37	22	22724275	22724275	+	RNA	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:22724275C>T	uc011aim.1	+	43		c.4548C>T								Parts of antibodies, mostly variable regions.												0						CCTACTGGTTCCAGCAGAAGC	0.582													13	32	---	---	---	---	PASS
SGSM1	129049	broad.mit.edu	37	22	25243621	25243621	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:25243621C>G	uc003abg.2	+	4	317	c.160C>G	c.(160-162)CTG>GTG	p.L54V	SGSM1_uc003abh.2_Missense_Mutation_p.L54V|SGSM1_uc010guu.1_Missense_Mutation_p.L54V|SGSM1_uc003abj.2_Missense_Mutation_p.L54V|SGSM1_uc003abi.1_Missense_Mutation_p.L29V|SGSM1_uc003abf.2_Missense_Mutation_p.L54V	NM_001039948	NP_001035037	Q2NKQ1	SGSM1_HUMAN	RUN and TBC1 domain containing 2 isoform 1	54	RUN.					Golgi apparatus	Rab GTPase activator activity			ovary(2)|central_nervous_system(2)|pancreas(1)	5						GGCCTGCGTTCTGCACGGGCT	0.622													4	24	---	---	---	---	PASS
TFIP11	24144	broad.mit.edu	37	22	26888319	26888319	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26888319G>T	uc003acr.2	-	14	2548	c.2174C>A	c.(2173-2175)CCA>CAA	p.P725Q	TFIP11_uc003acq.2_Missense_Mutation_p.P84Q|TFIP11_uc003acs.2_Missense_Mutation_p.P725Q|TFIP11_uc003act.2_Missense_Mutation_p.P725Q|uc003acu.1_RNA	NM_012143	NP_036275	Q9UBB9	TFP11_HUMAN	tuftelin interacting protein 11	725					biomineral tissue development	catalytic step 2 spliceosome|cytoplasm|nuclear speck	DNA binding|sequence-specific DNA binding transcription factor activity				0						CCGTGCTCCTGGCTGCATGTA	0.582													10	176	---	---	---	---	PASS
DEPDC5	9681	broad.mit.edu	37	22	32206504	32206504	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:32206504C>T	uc003als.2	+						DEPDC5_uc011als.1_Intron|DEPDC5_uc011alu.1_Intron|DEPDC5_uc011alv.1_Intron|DEPDC5_uc003alt.2_Intron|DEPDC5_uc003alr.1_Intron|DEPDC5_uc011alt.1_Intron	NM_014662	NP_055477	O75140	DEPD5_HUMAN	DEP domain containing 5 isoform 1						intracellular signal transduction					ovary(4)|central_nervous_system(3)|pancreas(1)	8						TTGTGTATTTCAGCTCTCGGG	0.408													11	134	---	---	---	---	PASS
SYN3	8224	broad.mit.edu	37	22	33402434	33402434	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:33402434G>C	uc003amx.2	-	1	373	c.214C>G	c.(214-216)CAG>GAG	p.Q72E	SYN3_uc003amy.2_Missense_Mutation_p.Q72E|SYN3_uc003amz.2_Missense_Mutation_p.Q72E	NM_003490	NP_003481	O14994	SYN3_HUMAN	synapsin III isoform IIIa	72	B; linker.				neurotransmitter secretion	cell junction|synaptic vesicle membrane	ATP binding|ligase activity			skin(1)	1						GAGGTGGCCTGAGGGGCCTGC	0.602													27	162	---	---	---	---	PASS
LARGE	9215	broad.mit.edu	37	22	33712171	33712171	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:33712171A>G	uc003and.3	-	12	1930	c.1351T>C	c.(1351-1353)TTC>CTC	p.F451L	LARGE_uc011amd.1_Missense_Mutation_p.F250L|LARGE_uc003ane.3_Missense_Mutation_p.F451L|LARGE_uc010gwp.2_Missense_Mutation_p.F399L|LARGE_uc011ame.1_Missense_Mutation_p.F383L|LARGE_uc011amf.1_Missense_Mutation_p.F451L|LARGE_uc010gwq.1_RNA	NM_004737	NP_004728	O95461	LARGE_HUMAN	like-glycosyltransferase	451	Lumenal (Potential).				glycosphingolipid biosynthetic process|muscle cell homeostasis|N-acetylglucosamine metabolic process|protein glycosylation	integral to Golgi membrane	acetylglucosaminyltransferase activity			ovary(1)|central_nervous_system(1)|skin(1)	3		Lung NSC(1;0.219)				TGGACAGTGAAGCGCTCTCGC	0.602													8	69	---	---	---	---	PASS
APOL6	80830	broad.mit.edu	37	22	36055367	36055367	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:36055367C>G	uc003aoe.2	+	3	1050	c.756C>G	c.(754-756)CTC>CTG	p.L252L	APOL6_uc003aod.2_RNA	NM_030641	NP_085144	Q9BWW8	APOL6_HUMAN	apolipoprotein L6	252					lipoprotein metabolic process	cytoplasm|extracellular region	lipid binding|lipid transporter activity				0						TGGCCACTCTCTCAAAGGAAT	0.527													5	101	---	---	---	---	PASS
TMPRSS6	164656	broad.mit.edu	37	22	37462230	37462230	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:37462230A>G	uc003aqs.1	-	18	2440	c.2326T>C	c.(2326-2328)TTC>CTC	p.F776L	TMPRSS6_uc003aqt.1_Missense_Mutation_p.F789L	NM_153609	NP_705837	Q8IU80	TMPS6_HUMAN	transmembrane protease, serine 6	776	Peptidase S1.|Extracellular (Potential).				angiogenesis|extracellular matrix organization|fibrinolysis|intracellular signal transduction|proteolysis	integral to membrane|intracellular|plasma membrane	serine-type endopeptidase activity			breast(4)|ovary(1)|skin(1)	6						CCCGCCAGGAACCAGCGGCCA	0.617													7	22	---	---	---	---	PASS
CYTH4	27128	broad.mit.edu	37	22	37693655	37693655	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:37693655C>T	uc003arf.2	+	5	401	c.285C>T	c.(283-285)GAC>GAT	p.D95D	CYTH4_uc003ard.3_Silent_p.D95D|CYTH4_uc003are.2_Silent_p.D95D|CYTH4_uc011amw.1_Silent_p.D38D|CYTH4_uc010gxe.2_Intron	NM_013385	NP_037517	Q9UIA0	CYH4_HUMAN	cytohesin 4	95	SEC7.				regulation of ARF protein signal transduction|regulation of cell adhesion	cytoplasm|plasma membrane	ARF guanyl-nucleotide exchange factor activity			ovary(2)	2						ACGTCCAGGACATTGCACGGT	0.567													20	140	---	---	---	---	PASS
SUN2	25777	broad.mit.edu	37	22	39138319	39138319	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:39138319G>T	uc003awh.1	-	10	1339	c.1055C>A	c.(1054-1056)GCT>GAT	p.A352D	SUN2_uc011anz.1_Missense_Mutation_p.A387D|SUN2_uc011aoa.1_Missense_Mutation_p.A341D|SUN2_uc003awi.1_Missense_Mutation_p.A352D|SUN2_uc010gxq.1_Missense_Mutation_p.A373D|SUN2_uc010gxr.1_Missense_Mutation_p.A352D|SUN2_uc010gxs.1_Missense_Mutation_p.A352D	NM_015374	NP_056189	Q9UH99	SUN2_HUMAN	unc-84 homolog B	352	Potential.|Perinuclear space.				centrosome localization|cytoskeletal anchoring at nuclear membrane|mitotic spindle organization|nuclear envelope organization|nuclear matrix anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	endosome membrane|integral to membrane|nuclear inner membrane|SUN-KASH complex	lamin binding|microtubule binding			large_intestine(1)|skin(1)	2						GATGCGAGCAGCAGTTTCCCT	0.617													16	102	---	---	---	---	PASS
TNRC6B	23112	broad.mit.edu	37	22	40718922	40718922	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:40718922C>G	uc011aor.1	+	23	5390	c.5179C>G	c.(5179-5181)CTG>GTG	p.L1727V	TNRC6B_uc003aym.2_Missense_Mutation_p.L923V|TNRC6B_uc003ayn.3_Missense_Mutation_p.L1617V	NM_001162501	NP_001155973	Q9UPQ9	TNR6B_HUMAN	trinucleotide repeat containing 6B isoform 1	1727					gene silencing by RNA|regulation of translation	cytoplasmic mRNA processing body	nucleotide binding|RNA binding				0						CAGCCGCTTTCTGGCACAAGC	0.582													20	38	---	---	---	---	PASS
SGSM3	27352	broad.mit.edu	37	22	40803811	40803811	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:40803811G>A	uc003ayu.1	+	14	1752	c.1543G>A	c.(1543-1545)GAG>AAG	p.E515K	SGSM3_uc011aos.1_Missense_Mutation_p.E448K|SGSM3_uc011aot.1_Missense_Mutation_p.E452K|SGSM3_uc010gyd.1_Missense_Mutation_p.E586K	NM_015705	NP_056520	Q96HU1	SGSM3_HUMAN	small G protein signaling modulator 3	515	SH3.				cell cycle arrest|Rap protein signal transduction	cytoplasm	Rab GTPase activator activity|Rab GTPase binding			ovary(2)	2						TCAGAAGGACGAGCACTGCTG	0.632													27	70	---	---	---	---	PASS
XPNPEP3	63929	broad.mit.edu	37	22	41278163	41278163	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41278163C>G	uc003azh.2	+	3	663	c.571C>G	c.(571-573)CTT>GTT	p.L191V	XPNPEP3_uc011aox.1_Missense_Mutation_p.L191V|XPNPEP3_uc003azi.2_Missense_Mutation_p.L112V|XPNPEP3_uc011aoy.1_RNA|XPNPEP3_uc010gyh.1_RNA	NM_022098	NP_071381	Q9NQH7	XPP3_HUMAN	X-prolyl aminopeptidase (aminopeptidase P) 3,	191					cellular process	mitochondrion	aminopeptidase activity|manganese ion binding|metallopeptidase activity				0						ATTTCAACATCTTCTACCAAA	0.418													51	107	---	---	---	---	PASS
ZC3H7B	23264	broad.mit.edu	37	22	41751776	41751776	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41751776G>A	uc003azw.2	+	19	2400	c.2184G>A	c.(2182-2184)CGG>CGA	p.R728R	ZC3H7B_uc010gyl.1_Intron	NM_017590	NP_060060	Q9UGR2	Z3H7B_HUMAN	zinc finger CCCH-type containing 7B	744					interspecies interaction between organisms	nucleus	nucleic acid binding|protein binding|zinc ion binding			central_nervous_system(1)	1						CCAAGGAGCGGCGGGTCCTTC	0.597													17	21	---	---	---	---	PASS
XRCC6	2547	broad.mit.edu	37	22	42018102	42018102	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:42018102C>T	uc003bao.1	+						PPPDE2_uc003ban.1_5'Flank|PPPDE2_uc011apb.1_5'Flank|XRCC6_uc003bap.1_Intron|XRCC6_uc011apc.1_Intron|XRCC6_uc003baq.1_Intron|XRCC6_uc003bar.1_Intron|XRCC6_uc003bas.1_Intron	NM_001469	NP_001460	P12956	XRCC6_HUMAN	ATP-dependent DNA helicase II, 70 kDa subunit						DNA ligation|double-strand break repair via nonhomologous end joining|initiation of viral infection|negative regulation of transcription, DNA-dependent|positive regulation of transcription from RNA polymerase II promoter|provirus integration|telomere maintenance|transcription, DNA-dependent	DNA-dependent protein kinase-DNA ligase 4 complex|Ku70:Ku80 complex|membrane fraction|nuclear telomere cap complex|transcription factor complex	5'-deoxyribose-5-phosphate lyase activity|ATP binding|ATP-dependent DNA helicase activity|double-stranded DNA binding|protein C-terminus binding|transcription regulatory region DNA binding			skin(2)|ovary(1)|lung(1)|kidney(1)	5						TAAGTGACTTCAGCATGTAGT	0.493								Direct_reversal_of_damage|NHEJ					15	50	---	---	---	---	PASS
XRCC6	2547	broad.mit.edu	37	22	42042909	42042909	+	Silent	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:42042909G>A	uc003bao.1	+	7	853	c.783G>A	c.(781-783)CTG>CTA	p.L261L	XRCC6_uc003bap.1_Silent_p.L220L|XRCC6_uc011apc.1_Silent_p.L211L|XRCC6_uc003baq.1_Silent_p.L261L|XRCC6_uc003bar.1_Silent_p.L261L|XRCC6_uc003bas.1_Silent_p.L211L	NM_001469	NP_001460	P12956	XRCC6_HUMAN	ATP-dependent DNA helicase II, 70 kDa subunit	261	Ku.				DNA ligation|double-strand break repair via nonhomologous end joining|initiation of viral infection|negative regulation of transcription, DNA-dependent|positive regulation of transcription from RNA polymerase II promoter|provirus integration|telomere maintenance|transcription, DNA-dependent	DNA-dependent protein kinase-DNA ligase 4 complex|Ku70:Ku80 complex|membrane fraction|nuclear telomere cap complex|transcription factor complex	5'-deoxyribose-5-phosphate lyase activity|ATP binding|ATP-dependent DNA helicase activity|double-stranded DNA binding|protein C-terminus binding|transcription regulatory region DNA binding	p.L261L(1)		skin(2)|ovary(1)|lung(1)|kidney(1)	5						GGTTAAAGCTGAAGCTCAACA	0.383								Direct_reversal_of_damage|NHEJ					17	349	---	---	---	---	PASS
NAGA	4668	broad.mit.edu	37	22	42456917	42456917	+	Intron	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:42456917C>T	uc003bbx.2	-						NAGA_uc003bby.2_Intron|NAGA_uc003bbw.3_Intron	NM_000262	NP_000253	P17050	NAGAB_HUMAN	alpha-N-acetylgalactosaminidase precursor						glycoside catabolic process|glycosylceramide catabolic process|oligosaccharide metabolic process	lysosome	alpha-galactosidase activity|alpha-N-acetylgalactosaminidase activity|cation binding|protein homodimerization activity			central_nervous_system(1)	1						TGCAGGCAGCCGGGTGCTCAC	0.577													21	117	---	---	---	---	PASS
C22orf9	23313	broad.mit.edu	37	22	45595791	45595791	+	Silent	SNP	G	A	A	rs150877720		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:45595791G>A	uc003bfx.1	-	8	1044	c.978C>T	c.(976-978)AAC>AAT	p.N326N	C22orf9_uc010gzw.1_Silent_p.N178N|C22orf9_uc003bfv.1_Silent_p.N335N|C22orf9_uc003bfw.1_Silent_p.N331N|C22orf9_uc010gzx.2_Silent_p.N308N	NM_001009880	NP_001009880	Q6ICG6	K0930_HUMAN	hypothetical protein LOC23313 isoform b	326							protein binding				0		Ovarian(80;0.00965)|all_neural(38;0.0244)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0178)|READ - Rectum adenocarcinoma(1;0.000617)|Colorectal(1;0.0024)		CCTCGCTGTCGTTGGCCGAGT	0.627													29	146	---	---	---	---	PASS
PKDREJ	10343	broad.mit.edu	37	22	46654413	46654413	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:46654413C>T	uc003bhh.2	-	1	4807	c.4807G>A	c.(4807-4809)GGC>AGC	p.G1603S		NM_006071	NP_006062	Q9NTG1	PKDRE_HUMAN	receptor for egg jelly-like protein precursor	1603	Extracellular (Potential).				acrosome reaction|neuropeptide signaling pathway	integral to membrane	calcium ion binding|ion channel activity			breast(3)|ovary(2)	5		Ovarian(80;0.00965)|all_neural(38;0.0416)		UCEC - Uterine corpus endometrioid carcinoma (28;0.00459)		TTGTCATAGCCGTAAGTCAGT	0.393													29	93	---	---	---	---	PASS
PLXNB2	23654	broad.mit.edu	37	22	50720748	50720748	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50720748G>A	uc003bkv.3	-						PLXNB2_uc003bkt.1_5'Flank|PLXNB2_uc003bku.1_5'UTR	NM_012401	NP_036533	O15031	PLXB2_HUMAN	plexin B2 precursor						regulation of small GTPase mediated signal transduction	integral to membrane|intracellular	GTPase activator activity|protein binding|receptor activity			ovary(4)|central_nervous_system(1)|skin(1)	6		all_cancers(38;5.78e-13)|all_epithelial(38;1.71e-11)|all_lung(38;3.89e-05)|Breast(42;0.000523)|Lung NSC(38;0.000992)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		BRCA - Breast invasive adenocarcinoma(115;0.205)|LUAD - Lung adenocarcinoma(64;0.247)		CACCACTGCGGAGGGCAGTGC	0.701													7	44	---	---	---	---	PASS
NLGN4X	57502	broad.mit.edu	37	X	5821118	5821118	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:5821118C>T	uc010ndh.2	-	5	2102	c.1601G>A	c.(1600-1602)GGT>GAT	p.G534D	NLGN4X_uc004crp.2_Missense_Mutation_p.G554D|NLGN4X_uc004crq.2_Missense_Mutation_p.G534D|NLGN4X_uc010ndi.2_Missense_Mutation_p.G571D|NLGN4X_uc004crr.2_Missense_Mutation_p.G534D|NLGN4X_uc010ndj.2_Missense_Mutation_p.G534D	NM_181332	NP_851849	Q8N0W4	NLGNX_HUMAN	X-linked neuroligin 4 precursor	534	Extracellular (Potential).				brainstem development|cell adhesion|cell-cell junction organization|cerebellum development|male courtship behavior|positive regulation of organ growth|regulation of excitatory postsynaptic membrane potential|social behavior|synapse assembly|territorial aggressive behavior|vocalization behavior	cell surface|dendrite|integral to plasma membrane|synapse	chloride ion binding|neurexin binding|protein homodimerization activity|receptor activity			skin(2)|large_intestine(1)|ovary(1)	4						ATGAACGTACCCAGTTTTGGC	0.478													8	82	---	---	---	---	PASS
ASB11	140456	broad.mit.edu	37	X	15311360	15311360	+	Missense_Mutation	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:15311360A>T	uc004cwp.1	-	4	452	c.452T>A	c.(451-453)CTG>CAG	p.L151Q	ASB11_uc004cwo.1_Missense_Mutation_p.L130Q|ASB11_uc010nes.1_RNA|ASB11_uc010net.1_Missense_Mutation_p.L134Q	NM_080873	NP_543149	Q8WXH4	ASB11_HUMAN	ankyrin repeat and SOCS box-containing protein	151	ANK 3.				intracellular signal transduction					breast(2)|skin(1)	3	Hepatocellular(33;0.183)					TCCGAACTCCAGCAGCACATT	0.547													51	190	---	---	---	---	PASS
CNKSR2	22866	broad.mit.edu	37	X	21534642	21534642	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:21534642G>C	uc004czx.1	+	9	886	c.850G>C	c.(850-852)GAG>CAG	p.E284Q	CNKSR2_uc004czw.2_Missense_Mutation_p.E284Q|CNKSR2_uc011mjn.1_Intron|CNKSR2_uc011mjo.1_Missense_Mutation_p.E284Q	NM_014927	NP_055742	Q8WXI2	CNKR2_HUMAN	connector enhancer of kinase suppressor of Ras	284	PDZ.				regulation of signal transduction	cytoplasm|membrane	protein binding			large_intestine(1)|lung(1)	2						TGCACTACGAGAGGACCCGAG	0.413													34	129	---	---	---	---	PASS
DDX53	168400	broad.mit.edu	37	X	23018538	23018538	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:23018538G>C	uc004daj.2	+	1	452	c.364G>C	c.(364-366)GAA>CAA	p.E122Q		NM_182699	NP_874358	Q86TM3	DDX53_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 53	122						nucleus	ATP binding|ATP-dependent helicase activity|RNA binding			large_intestine(1)|ovary(1)|kidney(1)	3						CTACAACTCAGAATCCAGTGT	0.403													10	122	---	---	---	---	PASS
DMD	1756	broad.mit.edu	37	X	31747740	31747740	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:31747740A>T	uc004dda.1	-						DMD_uc004dcr.1_Intron|DMD_uc004dcs.1_Intron|DMD_uc004dct.1_Intron|DMD_uc004dcu.1_Intron|DMD_uc004dcv.1_Intron|DMD_uc004dcw.2_Intron|DMD_uc004dcx.2_Intron|DMD_uc004dcz.2_Intron|DMD_uc004dcy.1_Intron|DMD_uc004ddb.1_Intron	NM_004006	NP_003997	P11532	DMD_HUMAN	dystrophin Dp427m isoform						muscle filament sliding|peptide biosynthetic process	cell surface|costamere|cytoskeleton|cytosol|dystrophin-associated glycoprotein complex|sarcolemma	actin binding|dystroglycan binding|nitric-oxide synthase binding|protein binding|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(3)|pancreas(2)|large_intestine(1)	6		all_cancers(2;1.22e-16)|Acute lymphoblastic leukemia(2;4.65e-06)|all_hematologic(2;0.00108)|all_epithelial(3;0.00626)|all_neural(2;0.0189)|all_lung(315;0.182)|Glioma(3;0.203)				GCTTGTTAAAAAACTTACTTC	0.368													103	120	---	---	---	---	PASS
LANCL3	347404	broad.mit.edu	37	X	37526617	37526617	+	Silent	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:37526617C>G	uc011mkd.1	+	4	1280	c.978C>G	c.(976-978)CTC>CTG	p.L326L	LANCL3_uc004ddp.1_Silent_p.L326L	NM_198511	NP_940913	Q6ZV70	LANC3_HUMAN	LanC lantibiotic synthetase component C-like 3	326							catalytic activity				0						GTGGGGAACTCACATGGCAGA	0.507													14	63	---	---	---	---	PASS
RPGR	6103	broad.mit.edu	37	X	38144829	38144829	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:38144829C>A	uc004ded.1	-	15	3591	c.3423G>T	c.(3421-3423)TGG>TGT	p.W1141C	RPGR_uc004deb.2_Intron|RPGR_uc004dea.2_Intron|RPGR_uc004dec.2_Intron	NM_001034853	NP_001030025	Q92834	RPGR_HUMAN	retinitis pigmentosa GTPase regulator isoform C	Error:Variant_position_missing_in_Q92834_after_alignment					intracellular protein transport|response to stimulus|visual perception	Golgi apparatus|photoreceptor outer segment	guanyl-nucleotide exchange factor activity|protein binding			ovary(1)	1						ATACATTATTCCAGAACTTTT	0.398													87	76	---	---	---	---	PASS
USP9X	8239	broad.mit.edu	37	X	41073965	41073965	+	Intron	SNP	A	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:41073965A>T	uc004dfb.2	+						USP9X_uc004dfc.2_Intron	NM_001039590	NP_001034679	Q93008	USP9X_HUMAN	ubiquitin specific protease 9, X-linked isoform						BMP signaling pathway|cell division|chromosome segregation|female gamete generation|mitosis|protein deubiquitination|transforming growth factor beta receptor signaling pathway|ubiquitin-dependent protein catabolic process	cytoplasm	co-SMAD binding|cysteine-type endopeptidase activity|ubiquitin thiolesterase activity			lung(3)|breast(2)|ovary(1)	6						ATAAAAAGGTACGGGCTGTCC	0.313													47	51	---	---	---	---	PASS
EFHC2	80258	broad.mit.edu	37	X	44171804	44171804	+	Intron	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:44171804T>A	uc004dgb.3	-							NM_025184	NP_079460	Q5JST6	EFHC2_HUMAN	EF-hand domain (C-terminal) containing 2								calcium ion binding			breast(3)|ovary(2)|central_nervous_system(1)	6						CCCAGTGTCATGTGACTTACC	0.373													24	22	---	---	---	---	PASS
ARAF	369	broad.mit.edu	37	X	47426294	47426294	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:47426294G>C	uc011mlq.1	+	8	844	c.711G>C	c.(709-711)CAG>CAC	p.Q237H	ARAF_uc011mln.1_Intron|ARAF_uc011mlo.1_Missense_Mutation_p.Q103H|ARAF_uc011mlp.1_Missense_Mutation_p.Q237H|ARAF_uc004dic.1_Missense_Mutation_p.Q18H	NM_001654	NP_001645	P10398	ARAF_HUMAN	v-raf murine sarcoma 3611 viral oncogene	237					intracellular signal transduction|negative regulation of apoptosis|positive regulation of peptidyl-serine phosphorylation		ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|receptor signaling protein activity			large_intestine(3)|lung(2)|ovary(1)|skin(1)	7					Adenosine triphosphate(DB00171)	TCACTGGCCAGAGTTTCAGCA	0.602													19	71	---	---	---	---	PASS
PORCN	64840	broad.mit.edu	37	X	48370271	48370271	+	Intron	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:48370271T>A	uc010nie.1	+						PORCN_uc004djq.1_Intron|PORCN_uc004djr.1_Intron|PORCN_uc004djs.1_Intron|PORCN_uc004djt.1_Intron|PORCN_uc011mlx.1_Intron|PORCN_uc004dju.1_Intron|PORCN_uc004djv.1_Intron|PORCN_uc004djw.1_Intron	NM_203475	NP_982301	Q9H237	PORCN_HUMAN	porcupine isoform D						Wnt receptor signaling pathway	endoplasmic reticulum membrane|integral to membrane	acyltransferase activity			ovary(2)|central_nervous_system(1)	3						CCAGCACCTTTTTCCTCAGTG	0.607											OREG0019764	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	42	45	---	---	---	---	PASS
PORCN	64840	broad.mit.edu	37	X	48370272	48370272	+	Intron	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:48370272T>C	uc010nie.1	+						PORCN_uc004djq.1_Intron|PORCN_uc004djr.1_Intron|PORCN_uc004djs.1_Intron|PORCN_uc004djt.1_Intron|PORCN_uc011mlx.1_Intron|PORCN_uc004dju.1_Intron|PORCN_uc004djv.1_Intron|PORCN_uc004djw.1_Intron	NM_203475	NP_982301	Q9H237	PORCN_HUMAN	porcupine isoform D						Wnt receptor signaling pathway	endoplasmic reticulum membrane|integral to membrane	acyltransferase activity			ovary(2)|central_nervous_system(1)	3						CAGCACCTTTTTCCTCAGTGA	0.602											OREG0019764	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	41	46	---	---	---	---	PASS
MAGED1	9500	broad.mit.edu	37	X	51644851	51644851	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:51644851G>C	uc004dpm.2	+	12	2257	c.2162G>C	c.(2161-2163)GGA>GCA	p.G721A	MAGED1_uc004dpn.2_Missense_Mutation_p.G777A|MAGED1_uc004dpo.2_Missense_Mutation_p.G721A	NM_001005332	NP_001005332	Q9Y5V3	MAGD1_HUMAN	melanoma antigen family D, 1 isoform b	721					apoptosis|induction of apoptosis by extracellular signals|negative regulation of epithelial cell proliferation|nerve growth factor receptor signaling pathway|regulation of transcription, DNA-dependent	cytoplasm|plasma membrane|protein complex	protein binding			ovary(3)	3	Ovarian(276;0.236)					GATGAGGAAGGAGATTTTGGA	0.542										Multiple Myeloma(10;0.10)			12	43	---	---	---	---	PASS
HUWE1	10075	broad.mit.edu	37	X	53584372	53584372	+	Nonsense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53584372G>C	uc004dsp.2	-	60	8579	c.8177C>G	c.(8176-8178)TCA>TGA	p.S2726*	HUWE1_uc004dsn.2_Nonsense_Mutation_p.S1550*|MIR98_hsa-mir-98|MI0000100_5'Flank|uc004dsr.1_5'Flank|uc004dss.2_5'Flank|MIRLET7F2_hsa-let-7f-2|MI0000068_5'Flank	NM_031407	NP_113584	Q7Z6Z7	HUWE1_HUMAN	HECT, UBA and WWE domain containing 1	2726					base-excision repair|cell differentiation|histone ubiquitination|protein monoubiquitination|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	DNA binding|protein binding|ubiquitin-protein ligase activity			ovary(8)|large_intestine(4)|breast(4)|kidney(1)	17						GGAGTCATTTGACTTAGATGC	0.433													9	82	---	---	---	---	PASS
TRO	7216	broad.mit.edu	37	X	54952896	54952896	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54952896T>A	uc004dtq.2	+	8	1738	c.1631T>A	c.(1630-1632)TTT>TAT	p.F544Y	TRO_uc004dts.2_Missense_Mutation_p.F544Y|TRO_uc004dtr.2_Missense_Mutation_p.F544Y|TRO_uc004dtt.2_RNA|TRO_uc004dtu.2_RNA|TRO_uc004dtv.2_Missense_Mutation_p.F147Y|TRO_uc011mok.1_Missense_Mutation_p.F75Y|TRO_uc004dtw.2_Missense_Mutation_p.F147Y|TRO_uc004dtx.2_5'UTR	NM_001039705	NP_001034794	Q12816	TROP_HUMAN	trophinin isoform 5	544	MAGE.				embryo implantation|homophilic cell adhesion	integral to plasma membrane				ovary(1)	1						AGTGTCATTTTTATGAATGGC	0.493													13	68	---	---	---	---	PASS
USP51	158880	broad.mit.edu	37	X	55514731	55514731	+	Silent	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:55514731G>T	uc004dun.1	-	2	721	c.642C>A	c.(640-642)ATC>ATA	p.I214I	USP51_uc011moo.1_Intron	NM_201286	NP_958443	Q70EK9	UBP51_HUMAN	ubiquitin specific protease 51	214					ubiquitin-dependent protein catabolic process		cysteine-type peptidase activity|ubiquitin thiolesterase activity|zinc ion binding			ovary(1)|lung(1)|breast(1)	3						AACGCTGGTAGATCAACCTCA	0.493													40	18	---	---	---	---	PASS
ZC4H2	55906	broad.mit.edu	37	X	64137706	64137706	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:64137706C>A	uc004dvu.2	-	5	720	c.632G>T	c.(631-633)CGG>CTG	p.R211L	ZC4H2_uc004dvv.2_Missense_Mutation_p.R188L|ZC4H2_uc011mov.1_Missense_Mutation_p.R188L|ZC4H2_uc011mow.1_Missense_Mutation_p.G157C|ZC4H2_uc004dvw.1_3'UTR	NM_018684	NP_061154	Q9NQZ6	ZC4H2_HUMAN	zinc finger, C4H2 domain containing	211							metal ion binding|protein binding			ovary(1)	1						GTTCCGGGACCGACTCTTGGC	0.488													20	15	---	---	---	---	PASS
P2RY4	5030	broad.mit.edu	37	X	69478906	69478906	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:69478906C>G	uc004dxz.1	-	1	749	c.569G>C	c.(568-570)CGG>CCG	p.R190P		NM_002565	NP_002556	P51582	P2RY4_HUMAN	pyrimidinergic receptor P2Y4	190	Extracellular (Potential).				activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|elevation of cytosolic calcium ion concentration	integral to plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			lung(1)	1						CTCTTCAGGCCGAGTGGTGTC	0.572													40	14	---	---	---	---	PASS
P2RY4	5030	broad.mit.edu	37	X	69478907	69478907	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:69478907G>A	uc004dxz.1	-	1	748	c.568C>T	c.(568-570)CGG>TGG	p.R190W		NM_002565	NP_002556	P51582	P2RY4_HUMAN	pyrimidinergic receptor P2Y4	190	Extracellular (Potential).				activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|elevation of cytosolic calcium ion concentration	integral to plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			lung(1)	1						TCTTCAGGCCGAGTGGTGTCA	0.572													40	12	---	---	---	---	PASS
MED12	9968	broad.mit.edu	37	X	70341403	70341403	+	Intron	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70341403T>C	uc004dyy.2	+						MED12_uc011mpq.1_Intron|MED12_uc004dyz.2_Intron|MED12_uc004dza.2_Intron	NM_005120	NP_005111	Q93074	MED12_HUMAN	mediator complex subunit 12						androgen receptor signaling pathway|negative regulation of Wnt receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	ligand-dependent nuclear receptor transcription coactivator activity|protein C-terminus binding|protein domain specific binding|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			ovary(1)|breast(1)|central_nervous_system(1)|skin(1)	4	Renal(35;0.156)					GATGGTCGTGTCTTCACAGTA	0.532													21	24	---	---	---	---	PASS
ZMYM3	9203	broad.mit.edu	37	X	70472742	70472742	+	Missense_Mutation	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70472742C>T	uc004dzh.1	-	2	451	c.364G>A	c.(364-366)GAG>AAG	p.E122K	BCYRN1_uc011mpt.1_Intron|ZMYM3_uc004dzi.1_Missense_Mutation_p.E122K|ZMYM3_uc004dzj.1_Missense_Mutation_p.E122K|ZMYM3_uc011mpu.1_5'Flank|ZMYM3_uc004dzk.3_Missense_Mutation_p.E122K|ZMYM3_uc004dzl.3_Missense_Mutation_p.E122K|ZMYM3_uc004dzm.3_Missense_Mutation_p.E122K	NM_201599	NP_963893	Q14202	ZMYM3_HUMAN	zinc finger protein 261	122					multicellular organismal development	nucleus	DNA binding|zinc ion binding			ovary(1)	1	Renal(35;0.156)					GGTACCACCTCAGGGGTCTGG	0.622													9	27	---	---	---	---	PASS
RGAG4	340526	broad.mit.edu	37	X	71351267	71351267	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:71351267C>A	uc010nlh.1	-	1	485	c.124G>T	c.(124-126)GAG>TAG	p.E42*	NHSL2_uc011mqa.1_Intron|RGAG4_uc004eaj.1_RNA|NHSL2_uc004eak.1_5'Flank|NHSL2_uc010nli.2_5'Flank	NM_001024455	NP_001019626	Q5HYW3	RGAG4_HUMAN	retrotransposon gag domain containing 4	42										ovary(2)|skin(1)	3	Renal(35;0.156)					GAATTAACCTCGGCCAGGGCT	0.597													41	49	---	---	---	---	PASS
PHKA1	5255	broad.mit.edu	37	X	71813135	71813135	+	Intron	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:71813135G>A	uc004eax.3	-						PHKA1_uc004eay.3_Intron|PHKA1_uc011mqi.1_Intron|PHKA1_uc010nll.2_Missense_Mutation_p.S53F	NM_002637	NP_002628	P46020	KPB1_HUMAN	phosphorylase kinase, alpha 1 (muscle) isoform						glucose metabolic process|glycogen catabolic process	cytosol|plasma membrane	calmodulin binding|glucan 1,4-alpha-glucosidase activity|phosphorylase kinase activity			ovary(3)|skin(1)	4	Renal(35;0.156)					CTTGGAAGAGGAGAGGAAAGA	0.318													20	41	---	---	---	---	PASS
TBX22	50945	broad.mit.edu	37	X	79282234	79282234	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:79282234C>A	uc010nmg.1	+	6	799	c.665C>A	c.(664-666)CCC>CAC	p.P222H	TBX22_uc004edi.1_Missense_Mutation_p.P102H|TBX22_uc004edj.1_Missense_Mutation_p.P222H	NM_001109878	NP_001103348	Q9Y458	TBX22_HUMAN	T-box 22 isoform 1	222	T-box.				multicellular organismal development|negative regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			lung(7)|large_intestine(3)|central_nervous_system(2)|breast(1)|skin(1)|ovary(1)	15						AAGTACAAACCCCGAGTGCAC	0.458													42	50	---	---	---	---	PASS
BRWD3	254065	broad.mit.edu	37	X	79937529	79937529	+	Missense_Mutation	SNP	G	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:79937529G>A	uc004edt.2	-	39	4725	c.4462C>T	c.(4462-4464)CAT>TAT	p.H1488Y	BRWD3_uc010nmi.1_RNA|BRWD3_uc004edo.2_Missense_Mutation_p.H1084Y|BRWD3_uc004edp.2_Missense_Mutation_p.H1317Y|BRWD3_uc004edq.2_Missense_Mutation_p.H1084Y|BRWD3_uc010nmj.1_Missense_Mutation_p.H1084Y|BRWD3_uc004edr.2_Missense_Mutation_p.H1158Y|BRWD3_uc004eds.2_Missense_Mutation_p.H1084Y|BRWD3_uc004edu.2_Missense_Mutation_p.H1158Y|BRWD3_uc004edv.2_Missense_Mutation_p.H1084Y|BRWD3_uc004edw.2_Missense_Mutation_p.H1084Y|BRWD3_uc004edx.2_Missense_Mutation_p.H1084Y|BRWD3_uc004edy.2_Missense_Mutation_p.H1084Y|BRWD3_uc004edz.2_Missense_Mutation_p.H1158Y|BRWD3_uc004eea.2_Missense_Mutation_p.H1158Y|BRWD3_uc004eeb.2_Missense_Mutation_p.H1084Y	NM_153252	NP_694984	Q6RI45	BRWD3_HUMAN	bromodomain and WD repeat domain containing 3	1488										ovary(4)	4						GTCCTGGCATGAGATACTGAG	0.353													24	114	---	---	---	---	PASS
CYLC1	1538	broad.mit.edu	37	X	83128683	83128683	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:83128683A>G	uc004eei.1	+	4	988	c.967A>G	c.(967-969)AAA>GAA	p.K323E	CYLC1_uc004eeh.1_Missense_Mutation_p.K322E	NM_021118	NP_066941	P35663	CYLC1_HUMAN	cylicin, basic protein of sperm head	323	2.				cell differentiation|multicellular organismal development|spermatogenesis	acrosomal matrix|cytoskeletal calyx	structural molecule activity			ovary(4)|skin(1)	5						AGATGACAAGAAAAAGGATGT	0.274													12	33	---	---	---	---	PASS
KLHL4	56062	broad.mit.edu	37	X	86887307	86887307	+	Missense_Mutation	SNP	T	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:86887307T>G	uc004efb.2	+	7	1604	c.1422T>G	c.(1420-1422)ATT>ATG	p.I474M	KLHL4_uc004efa.2_Missense_Mutation_p.I474M	NM_019117	NP_061990	Q9C0H6	KLHL4_HUMAN	kelch-like 4 isoform 1	474	Kelch 1.					cytoplasm|microtubule cytoskeleton|nucleolus	actin binding			ovary(2)|lung(1)|breast(1)|central_nervous_system(1)	5						TCGCAGTTATTGATAATAAGC	0.413													46	26	---	---	---	---	PASS
CPXCR1	53336	broad.mit.edu	37	X	88009209	88009209	+	Missense_Mutation	SNP	T	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:88009209T>C	uc004efd.3	+	3	1053	c.794T>C	c.(793-795)GTT>GCT	p.V265A	CPXCR1_uc004efc.3_Missense_Mutation_p.V265A	NM_033048	NP_149037	Q8N123	CPXCR_HUMAN	CPX chromosome region, candidate 1	265						intracellular	zinc ion binding			ovary(3)	3						ACCATGAATGTTATGATCACA	0.328													24	25	---	---	---	---	PASS
NAP1L3	4675	broad.mit.edu	37	X	92927281	92927281	+	Silent	SNP	C	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:92927281C>T	uc004efq.2	-	1	1328	c.1023G>A	c.(1021-1023)TCG>TCA	p.S341S	FAM133A_uc004efr.1_5'Flank	NM_004538	NP_004529	Q99457	NP1L3_HUMAN	nucleosome assembly protein 1-like 3	341					nucleosome assembly	chromatin assembly complex				ovary(1)|skin(1)	2						GGCTAACATCCGACAAGAACT	0.423													68	44	---	---	---	---	PASS
CENPI	2491	broad.mit.edu	37	X	100417910	100417910	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:100417910C>G	uc004egx.2	+	21	2495	c.2225C>G	c.(2224-2226)TCT>TGT	p.S742C	CENPI_uc011mrg.1_Missense_Mutation_p.S728C	NM_006733	NP_006724	Q92674	CENPI_HUMAN	centromere protein I	742					CenH3-containing nucleosome assembly at centromere|mitotic prometaphase	cytosol|kinetochore|nucleoplasm	protein binding			skin(1)	1						GTTCATCATTCTTCCATTCCC	0.388													111	63	---	---	---	---	PASS
BTK	695	broad.mit.edu	37	X	100617573	100617573	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:100617573G>T	uc004ehg.2	-	6	689	c.496C>A	c.(496-498)CAA>AAA	p.Q166K	BTK_uc010nnn.2_Missense_Mutation_p.Q166K|BTK_uc010nno.2_Missense_Mutation_p.Q200K|BTK_uc004ehi.2_Missense_Mutation_p.Q166K	NM_000061	NP_000052	Q06187	BTK_HUMAN	Bruton agammaglobulinemia tyrosine kinase	166	Btk-type.				calcium-mediated signaling|induction of apoptosis by extracellular signals|mesoderm development	cytosol|membrane raft|nucleus|plasma membrane	ATP binding|identical protein binding|metal ion binding|non-membrane spanning protein tyrosine kinase activity|phosphatidylinositol-3,4,5-trisphosphate binding			lung(3)|central_nervous_system(2)|ovary(1)	6						TCCAAAATTTGGCAGCCCATA	0.448									Agammaglobulinemia_X-linked				116	79	---	---	---	---	PASS
TCEAL5	340543	broad.mit.edu	37	X	102528982	102528982	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:102528982C>G	uc004ejz.1	-	3	805	c.510G>C	c.(508-510)TGG>TGC	p.W170C		NM_001012979	NP_001012997	Q5H9L2	TCAL5_HUMAN	transcription elongation factor A (SII)-like 5	170					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding			lung(1)|breast(1)	2						CTCTTTGCATCCAATGAAAAC	0.517													53	162	---	---	---	---	PASS
MUM1L1	139221	broad.mit.edu	37	X	105450803	105450803	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:105450803G>C	uc004emf.1	+	4	2027	c.1378G>C	c.(1378-1380)GAG>CAG	p.E460Q	MUM1L1_uc004emg.1_Missense_Mutation_p.E460Q	NM_152423	NP_689636	Q5H9M0	MUML1_HUMAN	melanoma associated antigen (mutated) 1-like 1	460										ovary(2)|pancreas(1)|skin(1)	4						CAAAGCCAGGGAGGATTATAG	0.363													54	50	---	---	---	---	PASS
TEX13B	56156	broad.mit.edu	37	X	107224904	107224904	+	Missense_Mutation	SNP	G	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107224904G>T	uc004enn.1	-	2	547	c.454C>A	c.(454-456)CAT>AAT	p.H152N		NM_031273	NP_112563	Q9BXU2	TX13B_HUMAN	testis expressed 13B	152										ovary(1)	1						CTTACGGCATGGAAGAGCTTC	0.597													15	80	---	---	---	---	PASS
DCX	1641	broad.mit.edu	37	X	110644549	110644549	+	Missense_Mutation	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:110644549T>A	uc004epd.2	-	3	789	c.617A>T	c.(616-618)TAT>TTT	p.Y206F	DCX_uc011msv.1_Missense_Mutation_p.Y206F|DCX_uc004epe.2_Missense_Mutation_p.Y125F|DCX_uc004epf.2_Missense_Mutation_p.Y125F|DCX_uc004epg.2_Missense_Mutation_p.Y125F	NM_000555	NP_000546	O43602	DCX_HUMAN	doublecortin isoform a	206	Doublecortin 1.		Y -> H (in LISX1 and SBHX).|Y -> D (in SBHX).		axon guidance|central nervous system development|intracellular signal transduction	cytosol|microtubule associated complex	microtubule binding			central_nervous_system(2)|lung(1)|skin(1)	4						GGAACAGACATAGCTTTCCCC	0.378													78	55	---	---	---	---	PASS
IL13RA1	3597	broad.mit.edu	37	X	117900499	117900499	+	Missense_Mutation	SNP	G	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:117900499G>C	uc004eqs.2	+	7	878	c.835G>C	c.(835-837)GAG>CAG	p.E279Q	IL13RA1_uc004eqt.1_Missense_Mutation_p.E279Q	NM_001560	NP_001551	P78552	I13R1_HUMAN	interleukin 13 receptor, alpha 1 precursor	279	Extracellular (Potential).					interleukin-13 receptor complex	cytokine receptor activity				0						CAAGGTCCAAGAGGCTAAATG	0.338													45	36	---	---	---	---	PASS
DCAF12L1	139170	broad.mit.edu	37	X	125685517	125685517	+	Missense_Mutation	SNP	A	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:125685517A>G	uc004eul.2	-	1	1326	c.1075T>C	c.(1075-1077)TAC>CAC	p.Y359H		NM_178470	NP_848565	Q5VU92	DC121_HUMAN	DDB1 and CUL4 associated factor 12-like 1	359	WD 4.									skin(3)|ovary(1)	4						ATGTGGCGGTAGAAGCTCAGC	0.622													4	38	---	---	---	---	PASS
ELF4	2000	broad.mit.edu	37	X	129205333	129205333	+	Missense_Mutation	SNP	C	G	G			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:129205333C>G	uc004evd.3	-	6	979	c.594G>C	c.(592-594)AGG>AGC	p.R198S	ELF4_uc004eve.3_Missense_Mutation_p.R198S	NM_001421	NP_001412	Q99607	ELF4_HUMAN	E74-like factor 4	198	RUNX1-binding.				natural killer cell proliferation|NK T cell proliferation|positive regulation of transcription from RNA polymerase II promoter	PML body	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1						TTGATTTCTTCCTAATGGGGA	0.592			T	ERG	AML								14	59	---	---	---	---	PASS
RAB33A	9363	broad.mit.edu	37	X	129318484	129318484	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:129318484C>A	uc004evl.2	+	2	748	c.484C>A	c.(484-486)CCC>ACC	p.P162T	RAB33A_uc010nre.2_RNA	NM_004794	NP_004785	Q14088	RB33A_HUMAN	Ras-related protein Rab-33A	162					protein transport|small GTPase mediated signal transduction	plasma membrane	GTP binding|GTPase activity|protein binding				0						GATCCAGGTGCCCTCCAACTT	0.512													12	106	---	---	---	---	PASS
SPANXN2	494119	broad.mit.edu	37	X	142803733	142803733	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:142803733C>A	uc004fbz.2	-	1	784	c.30G>T	c.(28-30)GGG>GGT	p.G10G		NM_001009615	NP_001009615	Q5MJ10	SPXN2_HUMAN	SPANX-N2 protein	10										ovary(1)	1	Acute lymphoblastic leukemia(192;6.56e-05)					TCCTCTTCTCCCCATTGGTGC	0.333													155	178	---	---	---	---	PASS
MIR510	574515	broad.mit.edu	37	X	146353923	146353923	+	RNA	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:146353923C>A	hsa-mir-510|MI0003197	-			c.4C>A																				0						GAGTAGGACACCACACACATA	0.398													5	76	---	---	---	---	PASS
AFF2	2334	broad.mit.edu	37	X	148049150	148049150	+	Intron	SNP	T	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:148049150T>A	uc004fcp.2	+						AFF2_uc004fcq.2_Intron|AFF2_uc004fcr.2_Intron|AFF2_uc011mxb.1_Intron|AFF2_uc004fcs.2_Intron|AFF2_uc011mxc.1_Intron	NM_002025	NP_002016	P51816	AFF2_HUMAN	fragile X mental retardation 2						brain development|mRNA processing|regulation of RNA splicing|RNA splicing	nuclear speck	G-quadruplex RNA binding|protein binding			ovary(3)|pancreas(2)	5	Acute lymphoblastic leukemia(192;6.56e-05)					GCTTGTTTTGTTTATTTAGGG	0.343													10	111	---	---	---	---	PASS
CD99L2	83692	broad.mit.edu	37	X	149937524	149937524	+	Nonsense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:149937524C>A	uc004fel.2	-	11	890	c.772G>T	c.(772-774)GAA>TAA	p.E258*	CD99L2_uc004fek.2_RNA|CD99L2_uc004fem.2_Nonsense_Mutation_p.E209*|CD99L2_uc004fen.2_Nonsense_Mutation_p.E186*|CD99L2_uc004feo.2_RNA|CD99L2_uc011myb.1_Nonsense_Mutation_p.E185*	NM_031462	NP_113650	Q8TCZ2	C99L2_HUMAN	CD99 antigen-like 2 isoform E3'-E4'-E3-E4	258	Cytoplasmic (Potential).|Poly-Pro.				cell adhesion	cell junction|integral to membrane				large_intestine(2)|ovary(1)	3	Acute lymphoblastic leukemia(192;6.56e-05)					CGGGCTGGTTCGGGCGGCGGC	0.622													43	39	---	---	---	---	PASS
MAGEA6	4105	broad.mit.edu	37	X	151870215	151870215	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:151870215C>A	uc004ffq.1	+	3	1099	c.905C>A	c.(904-906)CCA>CAA	p.P302Q	MAGEA6_uc004ffr.1_Missense_Mutation_p.P302Q|MAGEA2_uc010nto.2_Intron	NM_005363	NP_005354	P43360	MAGA6_HUMAN	melanoma antigen family A, 6	302	MAGE.						protein binding				0	Acute lymphoblastic leukemia(192;6.56e-05)					ATTTCCTACCCACTCCTGCAT	0.562													90	67	---	---	---	---	PASS
MAGEA6	4105	broad.mit.edu	37	X	151870217	151870217	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:151870217C>A	uc004ffq.1	+	3	1101	c.907C>A	c.(907-909)CTC>ATC	p.L303I	MAGEA6_uc004ffr.1_Missense_Mutation_p.L303I|MAGEA2_uc010nto.2_Intron	NM_005363	NP_005354	P43360	MAGA6_HUMAN	melanoma antigen family A, 6	303	MAGE.						protein binding				0	Acute lymphoblastic leukemia(192;6.56e-05)					TTCCTACCCACTCCTGCATGA	0.572													92	69	---	---	---	---	PASS
PNCK	139728	broad.mit.edu	37	X	152936585	152936585	+	Silent	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:152936585C>A	uc011myu.1	-	8	1110	c.924G>T	c.(922-924)CTG>CTT	p.L308L	PNCK_uc011myt.1_Silent_p.L242L|PNCK_uc004fia.2_Silent_p.L260L|PNCK_uc004fhz.3_Silent_p.L123L|PNCK_uc010nuh.2_3'UTR|PNCK_uc011myv.1_3'UTR|PNCK_uc011myw.1_3'UTR	NM_001039582	NP_001034671	Q6P2M8	KCC1B_HUMAN	pregnancy upregulated non-ubiquitously expressed	225	Protein kinase.					cytoplasm|nucleus	ATP binding|calmodulin binding|calmodulin-dependent protein kinase activity			breast(1)	1	all_hematologic(71;4.25e-06)|Acute lymphoblastic leukemia(192;6.56e-05)					AGCTGGCCCTCAGGATCTGGC	0.587													10	100	---	---	---	---	PASS
UBL4A	8266	broad.mit.edu	37	X	153713988	153713988	+	Missense_Mutation	SNP	C	A	A			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153713988C>A	uc004flo.2	-	4	373	c.364G>T	c.(364-366)GAT>TAT	p.D122Y		NM_014235	NP_055050	P11441	UBL4A_HUMAN	ubiquitin-like 4	122					protein modification process|tail-anchored membrane protein insertion into ER membrane|transport	BAT3 complex	small conjugating protein ligase activity				0	all_cancers(53;5.05e-16)|all_epithelial(53;1.87e-10)|all_lung(58;1.84e-07)|Lung NSC(58;5.84e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)					CTCTCGTAATCCTGGGGAGAG	0.607													5	85	---	---	---	---	PASS
CDK11B	984	broad.mit.edu	37	1	1571659	1571660	+	Intron	INS	-	C	C			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1571659_1571660insC	uc001agv.1	-						CDK11B_uc009vkj.2_Intron|CDK11B_uc001ags.1_Intron|CDK11B_uc001agt.1_Intron|CDK11B_uc001aha.1_Intron|CDK11B_uc001agw.1_Intron|CDK11B_uc001agy.1_Intron|CDK11B_uc001agx.1_Intron|CDK11B_uc001agz.1_Intron	NM_033486	NP_277021	P21127	CD11B_HUMAN	cell division cycle 2-like 1 (PITSLRE proteins)						apoptosis|cell proliferation|mitosis|regulation of cell growth|regulation of mRNA processing|regulation of transcription, DNA-dependent	cytoplasm|nucleus	ATP binding|cyclin-dependent protein kinase activity|protein binding			skin(1)	1						CCGCTATGGCTCGGGACCTCCC	0.644													4	3	---	---	---	---	
POMGNT1	55624	broad.mit.edu	37	1	46655770	46655771	+	Intron	DEL	TT	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:46655770_46655771delTT	uc001cpe.2	-						POMGNT1_uc010olx.1_Intron|POMGNT1_uc010oly.1_Intron|POMGNT1_uc010olz.1_Intron|POMGNT1_uc001cpg.2_Intron|POMGNT1_uc001cpf.2_Intron	NM_017739	NP_060209	Q8WZA1	PMGT1_HUMAN	O-linked mannose						protein N-linked glycosylation|protein O-linked glycosylation	Golgi membrane|integral to membrane|microsome	alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity|beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity			ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)					cttgaagttctttttttttttt	0.149													5	3	---	---	---	---	
PAPOLG	64895	broad.mit.edu	37	2	60997770	60997771	+	Intron	INS	-	A	A	rs10187671	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:60997770_60997771insA	uc002sai.2	+						PAPOLG_uc002saj.2_Intron|PAPOLG_uc002sak.2_Intron	NM_022894	NP_075045	Q9BWT3	PAPOG_HUMAN	poly(A) polymerase gamma						mRNA processing|RNA polyadenylation|transcription, DNA-dependent	nucleus	ATP binding|metal ion binding|polynucleotide adenylyltransferase activity|RNA binding			ovary(1)|central_nervous_system(1)	2	all_hematologic(2;0.0797)		LUSC - Lung squamous cell carcinoma(5;1.19e-07)|Lung(5;2.86e-06)|Epithelial(17;0.0768)			tttttttttttaatgaagagat	0.109													5	3	---	---	---	---	
TANC1	85461	broad.mit.edu	37	2	159912830	159912831	+	Intron	INS	-	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:159912830_159912831insT	uc002uag.2	+						TANC1_uc010fol.1_Intron|TANC1_uc010zcm.1_Intron	NM_033394	NP_203752	Q9C0D5	TANC1_HUMAN	tetratricopeptide repeat, ankyrin repeat and							cell junction|postsynaptic density|postsynaptic membrane	binding			ovary(2)|central_nervous_system(1)	3						ttatttatttattttttttttt	0.173													4	2	---	---	---	---	
VPRBP	9730	broad.mit.edu	37	3	51505206	51505206	+	Intron	DEL	T	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51505206delT	uc003dbe.1	-						VPRBP_uc003dbg.1_Intron	NM_014703	NP_055518	Q9Y4B6	VPRBP_HUMAN	HIV-1 Vpr binding protein						interspecies interaction between organisms	cytoplasm|nucleus	protein binding			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.000272)|Kidney(197;0.000729)|KIRC - Kidney renal clear cell carcinoma(197;0.000875)		AAACTCAttcttttttttttt	0.139													4	2	---	---	---	---	
ALCAM	214	broad.mit.edu	37	3	105213324	105213324	+	Intron	DEL	T	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:105213324delT	uc003dvx.2	+						ALCAM_uc003dvv.2_Intron|ALCAM_uc003dvw.1_Intron|ALCAM_uc003dvy.2_Intron|ALCAM_uc011bhh.1_Intron	NM_001627	NP_001618	Q13740	CD166_HUMAN	activated leukocyte cell adhesion molecule						cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(2)|breast(1)	3						ctttcttctctttTTTCGGCC	0.224													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	115529092	115529093	+	IGR	INS	-	TCTC	TCTC	rs56145932		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:115529092_115529093insTCTC								LSAMP (5074 upstream) : LOC285194 (899542 downstream)																							ctctctctctgtctctctctct	0.262													2	4	---	---	---	---	
MUC13	56667	broad.mit.edu	37	3	124626850	124626851	+	Intron	DEL	TC	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124626850_124626851delTC	uc003ehq.1	-							NM_033049	NP_149038	Q9H3R2	MUC13_HUMAN	mucin 13, epithelial transmembrane							extracellular region|integral to membrane|plasma membrane					0						TCCTTTTTGATCTCTCTCTCTC	0.322													4	2	---	---	---	---	
PHC3	80012	broad.mit.edu	37	3	169846305	169846305	+	Intron	DEL	T	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169846305delT	uc010hws.1	-						PHC3_uc003fgl.2_Intron|PHC3_uc011bpq.1_Intron	NM_024947	NP_079223	Q8NDX5	PHC3_HUMAN	polyhomeotic like 3						multicellular organismal development	PcG protein complex	DNA binding|zinc ion binding			ovary(1)|central_nervous_system(1)	2	all_cancers(22;2.67e-22)|all_epithelial(15;4.73e-27)|all_lung(20;6.31e-17)|Lung NSC(18;2.61e-16)|Ovarian(172;0.000337)|Breast(254;0.169)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.0655)			AACAATGGCATTTTTTTTTTT	0.303													4	3	---	---	---	---	
TBL1XR1	79718	broad.mit.edu	37	3	176744032	176744032	+	Intron	DEL	A	-	-	rs112275760		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:176744032delA	uc003fiw.3	-						TBL1XR1_uc003fix.3_Intron|TBL1XR1_uc011bpz.1_Intron	NM_024665	NP_078941	Q9BZK7	TBL1R_HUMAN	transducin (beta)-like 1 X-linked receptor 1						canonical Wnt receptor signaling pathway|cellular lipid metabolic process|chromatin modification|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|proteasomal ubiquitin-dependent protein catabolic process|transcription, DNA-dependent	spindle microtubule|transcriptional repressor complex	beta-catenin binding|histone binding|protein N-terminus binding|transcription corepressor activity|transcription regulatory region DNA binding			ovary(1)	1	all_cancers(143;1.44e-17)|Ovarian(172;0.00163)|Breast(254;0.214)	Acute lymphoblastic leukemia(1;0.00599)|all_hematologic(1;0.0632)|Prostate(884;0.215)	OV - Ovarian serous cystadenocarcinoma(80;9.83e-31)			CAGCCTCAGGAAAAAAAAAAA	0.318													8	7	---	---	---	---	
GNB4	59345	broad.mit.edu	37	3	179119234	179119236	+	Intron	DEL	AAT	-	-	rs74384746		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179119234_179119236delAAT	uc003fjv.3	-						GNB4_uc003fju.3_Intron	NM_021629	NP_067642	Q9HAV0	GBB4_HUMAN	guanine nucleotide-binding protein, beta-4						cellular response to glucagon stimulus|energy reserve metabolic process	plasma membrane	signal transducer activity			skin(2)	2	all_cancers(143;2.01e-16)|Ovarian(172;0.0172)|Breast(254;0.191)		OV - Ovarian serous cystadenocarcinoma(80;5.78e-26)|GBM - Glioblastoma multiforme(14;0.0169)|BRCA - Breast invasive adenocarcinoma(182;0.237)			TCAGttaaaaaataataataatt	0.271													6	5	---	---	---	---	
YEATS2	55689	broad.mit.edu	37	3	183490546	183490547	+	Intron	INS	-	AC	AC	rs139500481	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183490546_183490547insAC	uc003fly.2	+							NM_018023	NP_060493	Q9ULM3	YETS2_HUMAN	YEATS domain containing 2						histone H3 acetylation|negative regulation of transcription from RNA polymerase II promoter	Ada2/Gcn5/Ada3 transcription activator complex	TBP-class protein binding			ovary(3)|large_intestine(1)	4	all_cancers(143;6.55e-10)|Ovarian(172;0.0303)		all cancers(12;2.38e-42)|Epithelial(37;1.9e-36)|OV - Ovarian serous cystadenocarcinoma(80;6.48e-22)			GCTTTAAATTTacacacacaca	0.158													3	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	4	4147283	4147283	+	IGR	DEL	G	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:4147283delG								LOC348926 (190135 upstream) : OTOP1 (43247 downstream)																							CACTGGGCATGGGGCCCCCAA	0.617													3	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	4	111323431	111323447	+	IGR	DEL	TTCCTTCCTTCCTCCCT	-	-	rs6817024		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:111323431_111323447delTTCCTTCCTTCCTCCCT								ELOVL6 (203611 upstream) : ENPEP (73782 downstream)																							ccttccttccttccttccttcctcccttcccttccct	0.097													1	5	---	---	---	---	
TRIM23	373	broad.mit.edu	37	5	64907242	64907243	+	Intron	INS	-	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:64907242_64907243insT	uc003jty.2	-						TRIM23_uc003jtw.2_Intron|TRIM23_uc003jtx.2_Intron	NM_001656	NP_001647	P36406	TRI23_HUMAN	ADP-ribosylation factor domain protein 1 isoform						interspecies interaction between organisms|small GTPase mediated signal transduction	Golgi membrane|lysosomal membrane	enzyme activator activity|GDP binding|GTP binding|GTPase activity|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(3)|lung(1)	4		Lung NSC(167;3.24e-06)|Prostate(74;0.0138)|Breast(144;0.0433)|Ovarian(174;0.0545)|Colorectal(97;0.234)		Lung(70;0.00473)		CCTCTTTGAAGTTTTTTTTTTT	0.317													4	3	---	---	---	---	
EDIL3	10085	broad.mit.edu	37	5	83433136	83433136	+	Frame_Shift_Del	DEL	C	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:83433136delC	uc003kio.1	-	5	811	c.392delG	c.(391-393)GGTfs	p.G131fs	EDIL3_uc003kip.1_Frame_Shift_Del_p.G121fs	NM_005711	NP_005702	O43854	EDIL3_HUMAN	EGF-like repeats and discoidin I-like	131	EGF-like 3.				cell adhesion|multicellular organismal development	extracellular region	calcium ion binding|integrin binding			skin(2)	2		Lung NSC(167;0.000121)|all_lung(232;0.000154)|Ovarian(174;0.0425)		OV - Ovarian serous cystadenocarcinoma(54;4.3e-40)|Epithelial(54;4.79e-32)|all cancers(79;1.54e-26)		ACATATTCCACCATTTTTGCA	0.333													195	87	---	---	---	---	
GPR98	84059	broad.mit.edu	37	5	90041205	90041205	+	Intron	DEL	G	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90041205delG	uc003kju.2	+						GPR98_uc003kjt.2_Intron|GPR98_uc003kjv.2_Intron	NM_032119	NP_115495	Q8WXG9	GPR98_HUMAN	G protein-coupled receptor 98 precursor						cell communication|cell-cell adhesion|maintenance of organ identity|neuropeptide signaling pathway|photoreceptor cell maintenance	cell surface|cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(11)|central_nervous_system(3)|pancreas(2)	16		all_cancers(142;1.05e-09)|all_epithelial(76;1.81e-12)|all_lung(232;5.41e-06)|Lung NSC(167;1.72e-05)|Ovarian(174;0.00948)|Colorectal(57;0.133)|Breast(839;0.192)		OV - Ovarian serous cystadenocarcinoma(54;7.01e-30)|Epithelial(54;6.79e-25)|all cancers(79;1.88e-20)		TTATCAGCCTGAAATTTGGTT	0.259													11	7	---	---	---	---	
Unknown	0	broad.mit.edu	37	6	77372658	77372658	+	IGR	DEL	G	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:77372658delG								IMPG1 (590323 upstream) : HTR1B (799290 downstream)																							AAACATACTTGAGGAACCCTT	0.338													19	14	---	---	---	---	
SYNJ2	8871	broad.mit.edu	37	6	158495956	158495965	+	Intron	DEL	TTTTTTTTTT	-	-	rs7765766		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:158495956_158495965delTTTTTTTTTT	uc003qqx.1	+						SYNJ2_uc003qqw.1_Intron|SYNJ2_uc003qqy.1_Intron|SYNJ2_uc003qqz.1_Intron|SYNJ2_uc003qra.1_Intron	NM_003898	NP_003889	O15056	SYNJ2_HUMAN	synaptojanin 2								nucleotide binding|phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity|RNA binding			skin(1)	1				OV - Ovarian serous cystadenocarcinoma(65;4.42e-18)|BRCA - Breast invasive adenocarcinoma(81;4.23e-05)		CTTCCTGTCCtttttttttttttttttttt	0.219													6	4	---	---	---	---	
SNX8	29886	broad.mit.edu	37	7	2297644	2297644	+	Intron	DEL	T	-	-	rs71984612		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2297644delT	uc003slw.2	-							NM_013321	NP_037453	Q9Y5X2	SNX8_HUMAN	sorting nexin 8						cell communication|early endosome to Golgi transport|intracellular protein transport	early endosome membrane	phosphatidylinositol binding|protein binding			large_intestine(1)|ovary(1)	2		Ovarian(82;0.11)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0853)|OV - Ovarian serous cystadenocarcinoma(56;3.79e-14)		CCCAGCAGtcttttttttttt	0.343													4	2	---	---	---	---	
HECW1	23072	broad.mit.edu	37	7	43375383	43375386	+	Intron	DEL	CTTC	-	-	rs78981700		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:43375383_43375386delCTTC	uc003tid.1	+						HECW1_uc011kbi.1_Intron|HECW1_uc003tie.1_Intron	NM_015052	NP_055867	Q76N89	HECW1_HUMAN	NEDD4-like ubiquitin-protein ligase 1						protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	ubiquitin-protein ligase activity			ovary(8)|lung(6)|breast(4)|skin(4)|pancreas(1)	23						ttcttcctttcttccttccttcct	0.010													5	4	---	---	---	---	
PTCD1	26024	broad.mit.edu	37	7	99043035	99043036	+	Intron	INS	-	A	A	rs35628302		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99043035_99043036insA	uc011kiw.1	-						CPSF4_uc003uqi.2_Intron|CPSF4_uc003uqj.2_Intron|CPSF4_uc003uqk.2_Intron|CPSF4_uc011kix.1_Intron	NM_015545	NP_056360	O75127	PTCD1_HUMAN	pentatricopeptide repeat domain 1											ovary(1)	1	all_cancers(62;2.54e-08)|all_epithelial(64;2.55e-09)|Lung NSC(181;0.0053)|all_lung(186;0.00895)|Esophageal squamous(72;0.0166)		STAD - Stomach adenocarcinoma(171;0.215)			gactctatctcaaaaaaaaaaa	0.183													4	2	---	---	---	---	
HBP1	26959	broad.mit.edu	37	7	106836195	106836196	+	Intron	INS	-	T	T			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:106836195_106836196insT	uc003vdy.2	+						HBP1_uc011klv.1_Intron|HBP1_uc003vdz.2_Intron|HBP1_uc003vea.2_Intron|HBP1_uc003veb.1_Intron	NM_012257	NP_036389	O60381	HBP1_HUMAN	HMG-box transcription factor 1						cell cycle arrest|regulation of transcription, DNA-dependent|transcription, DNA-dependent|Wnt receptor signaling pathway	nucleus	DNA binding			skin(1)	1						CAGATGTTTTCTTTTTTTTTTT	0.257													4	3	---	---	---	---	
ARF5	381	broad.mit.edu	37	7	127230390	127230390	+	Intron	DEL	T	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127230390delT	uc003vmb.1	+						FSCN3_uc003vmc.1_5'Flank	NM_001662	NP_001653	P84085	ARF5_HUMAN	ADP-ribosylation factor 5						protein transport|small GTPase mediated signal transduction|vesicle-mediated transport	Golgi apparatus|perinuclear region of cytoplasm	GTP binding|GTPase activity|protein binding			ovary(1)	1						ttgtcttgtcttttttttttt	0.174													4	2	---	---	---	---	
TTC26	79989	broad.mit.edu	37	7	138872336	138872336	+	Intron	DEL	G	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138872336delG	uc003vus.2	+						TTC26_uc011kqn.1_Intron|TTC26_uc011kqo.1_Intron|TTC26_uc011kqp.1_Intron|TTC26_uc003vut.2_Intron|TTC26_uc011kqq.1_Intron	NM_024926	NP_079202	A0AVF1	TTC26_HUMAN	tetratricopeptide repeat domain 26 isoform 1								binding			ovary(1)	1						TTGTTTGTGAGGGAAAATACT	0.353													87	42	---	---	---	---	
PRDM14	63978	broad.mit.edu	37	8	70967745	70967746	+	Intron	DEL	TT	-	-	rs72213521		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:70967745_70967746delTT	uc003xym.2	-							NM_024504	NP_078780	Q9GZV8	PRD14_HUMAN	PR domain containing 14						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)	3	Breast(64;0.193)		Epithelial(68;0.00508)|all cancers(69;0.0259)|OV - Ovarian serous cystadenocarcinoma(28;0.0405)			AAtttttttctttttttttttt	0.163													8	7	---	---	---	---	
CSMD3	114788	broad.mit.edu	37	8	113651071	113651071	+	Frame_Shift_Del	DEL	C	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113651071delC	uc003ynu.2	-	21	3539	c.3380delG	c.(3379-3381)GGCfs	p.G1127fs	CSMD3_uc003yns.2_Frame_Shift_Del_p.G399fs|CSMD3_uc003ynt.2_Frame_Shift_Del_p.G1087fs|CSMD3_uc011lhx.1_Frame_Shift_Del_p.G1023fs	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	1127	Extracellular (Potential).|CUB 6.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63						GGTAAAACTGCCATTCTCTGT	0.408										HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			92	59	---	---	---	---	
ANXA13	312	broad.mit.edu	37	8	124706232	124706232	+	Intron	DEL	T	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124706232delT	uc003yqu.2	-						ANXA13_uc003yqt.2_Intron	NM_004306	NP_004297	P27216	ANX13_HUMAN	annexin A13 isoform a						cell differentiation	plasma membrane	calcium ion binding|calcium-dependent phospholipid binding			ovary(1)|pancreas(1)|skin(1)	3	Lung NSC(37;2.06e-11)|Ovarian(258;0.00579)|all_neural(195;0.0741)		STAD - Stomach adenocarcinoma(47;0.00288)			TGGTTTTGCCTTTTTTTTTTT	0.483													6	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	138016485	138016486	+	IGR	INS	-	AAGA	AAGA	rs147997959	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:138016485_138016486insAAGA								OLFM1 (3454 upstream) : KIAA0649 (355162 downstream)																							agaaaagaaagaagaaagaaag	0.000													4	2	---	---	---	---	
ITIH5	80760	broad.mit.edu	37	10	7697413	7697413	+	Intron	DEL	A	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:7697413delA	uc001ijq.2	-						ITIH5_uc001ijr.1_Intron	NM_030569	NP_085046	Q86UX2	ITIH5_HUMAN	inter-alpha trypsin inhibitor heavy chain						hyaluronan metabolic process	extracellular region	serine-type endopeptidase inhibitor activity			ovary(2)|central_nervous_system(2)	4						CAGAAAAAAGAAAAAAAAAAT	0.284													4	2	---	---	---	---	
VIM	7431	broad.mit.edu	37	10	17272091	17272092	+	Intron	INS	-	G	G	rs148498270	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:17272091_17272092insG	uc001iou.2	+						uc001iot.1_5'Flank|VIM_uc001iov.1_Intron|VIM_uc001iow.1_Intron|VIM_uc001iox.1_Intron|VIM_uc001ioy.1_Intron|VIM_uc001ioz.1_Intron|VIM_uc001ipb.1_Intron|VIM_uc009xjv.1_Intron|VIM_uc001ipc.1_Intron	NM_003380	NP_003371	P08670	VIME_HUMAN	vimentin						cellular component disassembly involved in apoptosis|cellular component movement|interspecies interaction between organisms|muscle filament sliding	cytosol|intermediate filament	protein C-terminus binding|structural constituent of cytoskeleton			large_intestine(1)|lung(1)|ovary(1)|pancreas(1)	4						GGGATGTGGCCGGGGGGAGGCC	0.723													4	3	---	---	---	---	
PNLIP	5406	broad.mit.edu	37	10	118307590	118307591	+	Intron	DEL	CA	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118307590_118307591delCA	uc001lcm.2	+							NM_000936	NP_000927	P16233	LIPP_HUMAN	pancreatic lipase precursor						lipid catabolic process|retinoid metabolic process|steroid metabolic process	extracellular region	retinyl-palmitate esterase activity|triglyceride lipase activity			ovary(1)|central_nervous_system(1)|skin(1)	3				all cancers(201;0.0131)	Bentiromide(DB00522)|Orlistat(DB01083)	Tacacacacgcacacacacaca	0.144													4	3	---	---	---	---	
CUZD1	50624	broad.mit.edu	37	10	124596659	124596659	+	Intron	DEL	T	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124596659delT	uc001lgq.2	-						CUZD1_uc001lgp.2_Intron|CUZD1_uc009yad.2_Intron|CUZD1_uc009yaf.2_Intron|CUZD1_uc001lgr.2_Intron|CUZD1_uc010qty.1_Intron|CUZD1_uc009yae.2_Intron|CUZD1_uc001lgs.2_Intron|CUZD1_uc010qtz.1_Intron	NM_022034	NP_071317	Q86UP6	CUZD1_HUMAN	CUB and zona pellucida-like domains 1 precursor						cell cycle|cell division|cell proliferation|substrate-dependent cell migration, cell attachment to substrate|trypsinogen activation	integral to membrane|transport vesicle membrane|zymogen granule membrane				ovary(1)|skin(1)	2		all_neural(114;0.169)|Glioma(114;0.222)		Colorectal(40;0.126)|COAD - Colon adenocarcinoma(40;0.141)		TGATTATGGATTTTTTTTTTC	0.368													3	3	---	---	---	---	
DOCK1	1793	broad.mit.edu	37	10	128836112	128836112	+	Intron	DEL	C	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:128836112delC	uc001ljt.2	+						DOCK1_uc010qun.1_Intron	NM_001380	NP_001371	Q14185	DOCK1_HUMAN	dedicator of cytokinesis 1						apoptosis|axon guidance|blood coagulation|integrin-mediated signaling pathway|phagocytosis, engulfment|small GTPase mediated signal transduction	cytosol|membrane	GTP binding|GTPase activator activity|GTPase binding|guanyl-nucleotide exchange factor activity|SH3 domain binding			central_nervous_system(4)|ovary(2)|lung(1)|breast(1)|kidney(1)	9		all_epithelial(44;2.3e-07)|all_lung(145;0.00466)|Lung NSC(174;0.00685)|Colorectal(57;0.0107)|Renal(717;0.0113)|Breast(234;0.0492)|all_neural(114;0.108)|all_hematologic(284;0.14)		BRCA - Breast invasive adenocarcinoma(275;0.0221)|Colorectal(40;0.115)		CTTTTTGGGTCtttttttttt	0.393													6	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	11	30925317	30925317	+	Intron	DEL	A	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:30925317delA	uc001mss.1	-						uc009yjk.1_Intron|uc009yjj.1_Intron					Homo sapiens mRNA for KIAA1493 protein, partial cds.																		TAAAAATCTGAAAAAAAAAAT	0.318													4	2	---	---	---	---	
ROBO3	64221	broad.mit.edu	37	11	124743831	124743831	+	Intron	DEL	A	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124743831delA	uc001qbc.2	+						ROBO3_uc010saq.1_5'Flank|ROBO3_uc001qbd.2_5'Flank|ROBO3_uc010sar.1_5'Flank|ROBO3_uc001qbe.2_5'Flank	NM_022370	NP_071765	Q96MS0	ROBO3_HUMAN	roundabout, axon guidance receptor, homolog 3						axon midline choice point recognition	integral to membrane	receptor activity			breast(1)|central_nervous_system(1)	2	all_hematologic(175;0.215)	Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|Breast(109;0.0481)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.5e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0296)		GGTCTTTGCTATTGTGAGGTG	0.478													33	21	---	---	---	---	
CCND2	894	broad.mit.edu	37	12	4385331	4385331	+	Frame_Shift_Del	DEL	C	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:4385331delC	uc001qmo.2	+	2	661	c.356delC	c.(355-357)ACCfs	p.T119fs		NM_001759	NP_001750	P30279	CCND2_HUMAN	cyclin D2	119	Cyclin N-terminal.				cell division|positive regulation of cyclin-dependent protein kinase activity|positive regulation of protein phosphorylation	cyclin-dependent protein kinase holoenzyme complex|cytoplasm|membrane|nucleus	protein kinase binding			haematopoietic_and_lymphoid_tissue(1)|breast(1)|kidney(1)	3			all cancers(3;4.15e-10)|GBM - Glioblastoma multiforme(3;6.34e-05)|Colorectal(7;0.00245)|OV - Ovarian serous cystadenocarcinoma(31;0.00301)|COAD - Colon adenocarcinoma(12;0.0264)|STAD - Stomach adenocarcinoma(119;0.206)			AGCCCGCTGACCGCGGAGAAG	0.582			T	IGL@	NHL,CLL								70	77	---	---	---	---	
A2ML1	144568	broad.mit.edu	37	12	9008258	9008258	+	Intron	DEL	C	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9008258delC	uc001quz.3	+						A2ML1_uc001qva.1_Intron|A2ML1_uc010sgm.1_Intron	NM_144670	NP_653271	A8K2U0	A2ML1_HUMAN	alpha-2-macroglobulin-like 1 precursor							extracellular space	endopeptidase inhibitor activity			ovary(2)|skin(1)	3						TGGAGTGGGGCGGGACATACG	0.458													47	84	---	---	---	---	
DUSP16	80824	broad.mit.edu	37	12	12653397	12653397	+	Intron	DEL	G	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12653397delG	uc001rao.1	-						DUSP16_uc001ran.1_Intron	NM_030640	NP_085143	Q9BY84	DUS16_HUMAN	dual specificity phosphatase 16						inactivation of MAPK activity|MAPK export from nucleus|MAPK phosphatase export from nucleus, leptomycin B sensitive	cytoplasmic membrane-bounded vesicle|nucleus	MAP kinase tyrosine/serine/threonine phosphatase activity|protein tyrosine phosphatase activity				0		Prostate(47;0.0687)		BRCA - Breast invasive adenocarcinoma(232;0.0203)		GGTAACTGCTGTTTCTCCAGC	0.458													55	78	---	---	---	---	
SLCO1B3	28234	broad.mit.edu	37	12	21008139	21008139	+	Intron	DEL	G	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21008139delG	uc001rek.2	+						SLCO1B3_uc001rel.2_Intron|SLCO1B3_uc010sil.1_Intron|LST-3TM12_uc010sim.1_Intron	NM_019844	NP_062818	Q9NPD5	SO1B3_HUMAN	solute carrier organic anion transporter family,						bile acid metabolic process|sodium-independent organic anion transport	basolateral plasma membrane|cytoplasm|integral to plasma membrane	bile acid transmembrane transporter activity|organic anion transmembrane transporter activity			large_intestine(2)|ovary(1)|skin(1)	4	Esophageal squamous(101;0.149)					AACCATACTTGCATAAGTTGA	0.204													37	24	---	---	---	---	
Unknown	0	broad.mit.edu	37	12	34317681	34317681	+	IGR	DEL	C	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:34317681delC								ALG10 (136447 upstream) : None (None downstream)																							CACACTGCTTCCCCCCTTTAC	0.468													112	96	---	---	---	---	
ABCC4	10257	broad.mit.edu	37	13	95859281	95859282	+	Intron	DEL	AA	-	-	rs112178408		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:95859281_95859282delAA	uc001vmd.3	-						ABCC4_uc010afk.2_Intron|ABCC4_uc001vme.2_Intron|ABCC4_uc010tih.1_Intron|ABCC4_uc001vmf.2_Intron|ABCC4_uc010afl.1_Intron|ABCC4_uc010afm.1_Intron	NM_005845	NP_005836	O15439	MRP4_HUMAN	ATP-binding cassette, sub-family C, member 4						platelet activation|platelet degranulation	integral to membrane|membrane fraction|plasma membrane|platelet dense granule membrane	15-hydroxyprostaglandin dehydrogenase (NAD+) activity|ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|chloride channel activity			central_nervous_system(3)|skin(1)	4	all_neural(89;0.0878)|Medulloblastoma(90;0.163)				Cefazolin(DB01327)	TCCAAAAGCCAAAAAAAAAATA	0.198													3	4	---	---	---	---	
PROZ	8858	broad.mit.edu	37	13	113818761	113818770	+	Intron	DEL	TGTGCAAGGC	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:113818761_113818770delTGTGCAAGGC	uc001vta.1	+						PROZ_uc010agr.1_Intron	NM_003891	NP_003882	P22891	PROZ_HUMAN	protein Z, vitamin K-dependent plasma						blood coagulation|peptidyl-glutamic acid carboxylation|post-translational protein modification|proteolysis	endoplasmic reticulum lumen|extracellular region|Golgi lumen	calcium ion binding|serine-type endopeptidase activity				0	all_lung(23;0.000374)|Lung NSC(43;0.0107)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)	all_lung(25;0.216)	all cancers(43;0.104)		Menadione(DB00170)	CACAGAACTGTGTGCAAGGCTGTGATAAAA	0.419													26	15	---	---	---	---	
C14orf43	91748	broad.mit.edu	37	14	74206888	74206888	+	5'UTR	DEL	T	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:74206888delT	uc001xot.2	-	2					C14orf43_uc001xou.2_5'UTR|C14orf43_uc010tud.1_5'UTR|C14orf43_uc010arw.2_RNA	NM_194278	NP_919254	Q6PJG2	CN043_HUMAN	hypothetical protein LOC91748						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(4)|central_nervous_system(1)	5				BRCA - Breast invasive adenocarcinoma(234;0.00358)|KIRC - Kidney renal clear cell carcinoma(182;0.0878)|OV - Ovarian serous cystadenocarcinoma(108;0.115)		TGGCTCTTCCTTTCTCTTCCA	0.597													5	3	---	---	---	---	
TMEM62	80021	broad.mit.edu	37	15	43452742	43452744	+	Intron	DEL	AAC	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43452742_43452744delAAC	uc001zqr.2	+						TMEM62_uc010bda.2_Intron|TMEM62_uc001zqt.2_5'UTR	NM_024956	NP_079232	Q0P6H9	TMM62_HUMAN	transmembrane protein 62							integral to membrane				ovary(1)|breast(1)	2		all_cancers(109;1.16e-10)|all_epithelial(112;2.01e-09)|Lung NSC(122;8.91e-07)|all_lung(180;8.8e-06)|Melanoma(134;0.0728)		GBM - Glioblastoma multiforme(94;4.23e-07)		aaccttgAAAaacaacaacaaca	0.064													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	47119912	47119912	+	IGR	DEL	A	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:47119912delA								None (None upstream) : SEMA6D (356491 downstream)																							CTGCTGGAACAAGCTGGTGCA	0.463													5	6	---	---	---	---	
OSTBETA	123264	broad.mit.edu	37	15	65344105	65344106	+	Intron	INS	-	AAAC	AAAC	rs140336932	by1000genomes	TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65344105_65344106insAAAC	uc002aog.2	+						OSTBETA_uc002aoh.2_Intron	NM_178859	NP_849190	Q86UW2	OSTB_HUMAN	organic solute transporter beta							integral to membrane|plasma membrane					0						CAAGCTGTTaaaaacaaacaaa	0.465													4	2	---	---	---	---	
SLC28A1	9154	broad.mit.edu	37	15	85449794	85449795	+	Intron	DEL	TC	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:85449794_85449795delTC	uc002blg.2	+						SLC28A1_uc010upd.1_Intron|SLC28A1_uc010bnb.2_Intron|SLC28A1_uc010upe.1_Intron|SLC28A1_uc010upf.1_Intron|SLC28A1_uc010upg.1_Intron	NM_004213	NP_004204	O00337	S28A1_HUMAN	solute carrier family 28, member 1 isoform 1						nucleobase, nucleoside and nucleotide metabolic process	integral to plasma membrane|membrane fraction	nucleoside binding			skin(2)|ovary(1)	3			BRCA - Breast invasive adenocarcinoma(143;0.0587)			tttctttctttctctttctttc	0.000													4	2	---	---	---	---	
SEC14L5	9717	broad.mit.edu	37	16	5061152	5061152	+	Frame_Shift_Del	DEL	C	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:5061152delC	uc002cye.2	+	15	2037	c.1857delC	c.(1855-1857)AGCfs	p.S619fs		NM_014692	NP_055507	O43304	S14L5_HUMAN	SEC14-like 5	619	GOLD.					integral to membrane|intracellular	transporter activity				0						AAATGCACAGCCCCCCCAGCA	0.662													18	9	---	---	---	---	
GGA3	23163	broad.mit.edu	37	17	73243031	73243032	+	Intron	INS	-	A	A	rs75940499		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73243031_73243032insA	uc002jni.1	-						GGA3_uc002jnj.1_Intron|GGA3_uc010wrw.1_Intron|GGA3_uc002jnk.1_Intron|GGA3_uc010wrx.1_Intron|GGA3_uc010wry.1_Intron|GGA3_uc010wrz.1_Intron	NM_138619	NP_619525	Q9NZ52	GGA3_HUMAN	ADP-ribosylation factor binding protein 3						intracellular protein transport|vesicle-mediated transport	clathrin adaptor complex|endosome membrane|trans-Golgi network	ADP-ribosylation factor binding			ovary(1)|breast(1)	2			all cancers(21;2.39e-06)|Epithelial(20;2.38e-05)			CAAGGAGACAGAAAAAAAAAAA	0.347													5	3	---	---	---	---	
SBNO2	22904	broad.mit.edu	37	19	1109754	1109756	+	In_Frame_Del	DEL	CTC	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1109754_1109756delCTC	uc002lrk.3	-	27	3287_3289	c.3049_3051delGAG	c.(3049-3051)GAGdel	p.E1017del	SBNO2_uc002lri.3_5'Flank|SBNO2_uc002lrj.3_In_Frame_Del_p.E960del|SBNO2_uc010dse.2_In_Frame_Del_p.E1000del|SBNO2_uc010xgj.1_Intron	NM_014963	NP_055778	Q9Y2G9	SBNO2_HUMAN	strawberry notch homolog 2 isoform 1	1017					macrophage activation involved in immune response|negative regulation of transcription, DNA-dependent|regulation of inflammatory response|transcription, DNA-dependent						0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;7.93e-06)|all_lung(49;1.25e-05)|Breast(49;0.000172)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		CCTCGTAGATCTCCTCGATACCG	0.675													31	30	---	---	---	---	
KLC3	147700	broad.mit.edu	37	19	45844444	45844445	+	Intron	INS	-	TG	TG	rs369335		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45844444_45844445insTG	uc002pbf.1	+						KLC3_uc002pbe.2_Intron|KLC3_uc010ejy.1_Intron	NM_177417	NP_803136	Q6P597	KLC3_HUMAN	kinesin light chain 3							cytoplasm|kinesin complex|microtubule	microtubule motor activity			ovary(1)	1		Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0226)		CTGCCtgtgtttgtgtgtgtgt	0.490													4	2	---	---	---	---	
MIR525	574470	broad.mit.edu	37	19	54198733	54198733	+	5'Flank	DEL	C	-	-	rs79901517		TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54198733delC	hsa-mir-525|MI0003152	+						MIR523_hsa-mir-523|MI0003153_5'Flank																	0						aaacggtcctctttttttttt	0.010													4	2	---	---	---	---	
RANGAP1	5905	broad.mit.edu	37	22	41642673	41642673	+	Frame_Shift_Del	DEL	G	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41642673delG	uc003azs.2	-	15	3168	c.1698delC	c.(1696-1698)CCCfs	p.P566fs	RANGAP1_uc003azt.2_Frame_Shift_Del_p.P566fs|RANGAP1_uc003azu.2_Frame_Shift_Del_p.P566fs|RANGAP1_uc003azr.2_Frame_Shift_Del_p.P79fs|RANGAP1_uc010gyk.2_Frame_Shift_Del_p.P69fs|RANGAP1_uc011aoz.1_Frame_Shift_Del_p.P511fs	NM_002883	NP_002874	P46060	RAGP1_HUMAN	Ran GTPase activating protein 1	566					mitotic prometaphase|signal transduction	condensed chromosome kinetochore|cytosol|nuclear membrane|nuclear pore|soluble fraction|spindle pole	protein binding|Ran GTPase activator activity				0						GGGCGCTGTTGGGCCTGCGGG	0.562													5	7	---	---	---	---	
BMX	660	broad.mit.edu	37	X	15554697	15554697	+	Intron	DEL	A	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:15554697delA	uc004cww.2	+						BMX_uc004cwx.3_Intron|BMX_uc004cwy.3_Intron	NM_203281	NP_975010	P51813	BMX_HUMAN	BMX non-receptor tyrosine kinase						cellular component disassembly involved in apoptosis|intracellular signal transduction|mesoderm development	cytosol	ATP binding|metal ion binding|non-membrane spanning protein tyrosine kinase activity|protein binding|signal transducer activity			lung(3)|ovary(2)	5	Hepatocellular(33;0.183)					GATTTTCTTTAAAAAAAAAAA	0.313													5	3	---	---	---	---	
FAM47A	158724	broad.mit.edu	37	X	34148575	34148575	+	Frame_Shift_Del	DEL	T	-	-			TCGA-60-2698-01	TCGA-60-2698-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:34148575delT	uc004ddg.2	-	1	1854	c.1821delA	c.(1819-1821)AAAfs	p.K607fs		NM_203408	NP_981953	Q5JRC9	FA47A_HUMAN	hypothetical protein LOC158724	607										ovary(4)|central_nervous_system(1)	5						ATTCACGGAGTTTTTCCGATG	0.443													50	47	---	---	---	---	
