Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	i_ACHILLES_Top_Genes	i_CCLE_ONCOMAP_overlapping_mutations	i_CCLE_ONCOMAP_total_mutations_in_gene	i_CCLE_SEQ_overlapping_mutations	i_CCLE_SEQ_total_mutations_in_gene	MUTSIG_Significant_Genes	OREGANNO_ID	OREGANNO_Values	i_tumor_f	i_init_t_lod	i_t_lod_fstar	i_t_alt_count	i_t_ref_count	i_judgement	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	dataset	Oncotatorv0393GAF20hg19Feb2011dbSNPbuild132UniProtRelease2011_6	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	newbase	context_orig	context65	gene_name	categ	categ_ignoring_null_categ
CHUK	1147	broad.mit.edu	37	10	101978830	101978830	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:101978830C>A	uc001kqp.2	-	c.624G>T	c.(622-624)GGG>GGT	p.G208G		NM_001278	NP_001269	O15111	IKKA_HUMAN	conserved helix-loop-helix ubiquitous kinase	208	Protein kinase.				I-kappaB phosphorylation|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	CD40 receptor complex|cytosol|internal side of plasma membrane|nucleus	ATP binding|identical protein binding|IkappaB kinase activity			ovary(2)|central_nervous_system(2)|large_intestine(1)|lung(1)|breast(1)	7		Colorectal(252;0.117)		Epithelial(162;2.05e-10)|all cancers(201;1.91e-08)		Ovarian(159;52 1904 10536 35305 37148)				415				0.367347	98.483428	99.995444	36	62	KEEP	---	---	---	---	capture		Silent	SNP	101978830	101978830	3550	10	C	A	A	A	379	30	CHUK	2	2
TLX1	3195	broad.mit.edu	37	10	102894055	102894055	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:102894055G>T	uc001ksw.2	+	c.692G>T	c.(691-693)CGC>CTC	p.R231L		NM_005521	NP_005512	P31314	TLX1_HUMAN	T-cell leukemia homeobox 1	231	Homeobox.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulator activity				0				Epithelial(162;6.35e-09)|all cancers(201;3.21e-07)						274				0.4	19.149051	19.279568	6	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	102894055	102894055	16489	10	G	T	T	T	494	38	TLX1	1	1
EIF3A	8661	broad.mit.edu	37	10	120802195	120802195	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:120802195C>G	uc001ldu.2	-	c.2837G>C	c.(2836-2838)AGA>ACA	p.R946T	EIF3A_uc010qsu.1_Missense_Mutation_p.R912T|EIF3A_uc009xzg.1_5'UTR	NM_003750	NP_003741	Q14152	EIF3A_HUMAN	eukaryotic translation initiation factor 3,	946	3.|Asp-rich.|25 X 10 AA approximate tandem repeats of [DE]-[DE]-[DE]-R-[SEVGFPILV]-[HPSN]- [RSW]-[RL]-[DRGTIHN]-[EPMANLGDT].				formation of translation initiation complex	cytosol|eukaryotic translation initiation factor 3 complex	protein binding|structural molecule activity|translation initiation factor activity				0		Lung NSC(174;0.094)|all_lung(145;0.123)		all cancers(201;0.0236)						1050				0.407407	247.955047	249.366249	77	112	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	120802195	120802195	5201	10	C	G	G	G	416	32	EIF3A	3	3
C10orf137	26098	broad.mit.edu	37	10	127441455	127441455	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:127441455A>G	uc001liq.1	+	c.3365A>G	c.(3364-3366)CAG>CGG	p.Q1122R	C10orf137_uc001lio.1_Missense_Mutation_p.Q1088R|C10orf137_uc001lip.1_Missense_Mutation_p.Q826R|C10orf137_uc001lis.1_Missense_Mutation_p.Q448R|C10orf137_uc001lit.1_Missense_Mutation_p.Q32R	NM_015608	NP_056423	Q3B7T1	EDRF1_HUMAN	erythroid differentiation-related factor 1	1122					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	binding			ovary(5)|large_intestine(3)	8		all_lung(145;0.0096)|Lung NSC(174;0.0145)|Colorectal(57;0.0846)|all_neural(114;0.0936)												0.309091	49.655108	51.441006	17	38	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	127441455	127441455	1631	10	A	G	G	G	91	7	C10orf137	4	4
EBF3	253738	broad.mit.edu	37	10	131666055	131666055	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:131666055C>T	uc001lki.1	-	c.876G>A	c.(874-876)GTG>GTA	p.V292V		NM_001005463	NP_001005463	Q9H4W6	COE3_HUMAN	early B-cell factor 3	301	IPT/TIG.				multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|metal ion binding|protein binding|transcription regulator activity			central_nervous_system(1)|pancreas(1)	2		all_cancers(35;1.8e-08)|all_epithelial(44;8.26e-08)|Lung NSC(174;0.0091)|all_lung(145;0.0123)|Breast(234;0.039)|all_neural(114;0.0722)|Colorectal(57;0.0764)		OV - Ovarian serous cystadenocarcinoma(35;0.00513)										0.470588	44.997769	45.023129	16	18	KEEP	---	---	---	---	capture		Silent	SNP	131666055	131666055	5068	10	C	T	T	T	210	17	EBF3	2	2
CYP2E1	1571	broad.mit.edu	37	10	135352302	135352302	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:135352302G>T	uc001lnj.1	+	c.1316G>T	c.(1315-1317)GGA>GTA	p.G439V	CYP2E1_uc001lnk.1_Missense_Mutation_p.G302V|CYP2E1_uc009ybl.1_Missense_Mutation_p.G240V|CYP2E1_uc009ybm.1_Missense_Mutation_p.G93V|CYP2E1_uc001lnl.1_Intron	NM_000773	NP_000764	P05181	CP2E1_HUMAN	cytochrome P450, family 2, subfamily E,	439					drug metabolic process|heterocycle metabolic process|monoterpenoid metabolic process|oxidation-reduction process|steroid metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	electron carrier activity|enzyme binding|heme binding|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen|oxygen binding			central_nervous_system(3)	3		all_cancers(35;1.14e-09)|all_epithelial(44;5.79e-08)|Lung NSC(174;0.00263)|all_lung(145;0.0039)|all_neural(114;0.0299)|Melanoma(40;0.123)|Colorectal(31;0.172)|Glioma(114;0.203)		OV - Ovarian serous cystadenocarcinoma(35;1.12e-06)|all cancers(32;1.43e-06)|Epithelial(32;1.71e-06)	Acetaminophen(DB00316)|Chlorzoxazone(DB00356)|Cinnarizine(DB00568)|Clofibrate(DB00636)|Dacarbazine(DB00851)|Dapsone(DB00250)|Enflurane(DB00228)|Eszopiclone(DB00402)|Ethanol(DB00898)|Ethosuximide(DB00593)|Fomepizole(DB01213)|Glutathione(DB00143)|Halothane(DB01159)|Hexobarbital(DB01355)|Isoflurane(DB00753)|Isoniazid(DB00951)|Menadione(DB00170)|Mephenytoin(DB00532)|Methoxyflurane(DB01028)|Midazolam(DB00683)|Mitoxantrone(DB01204)|Nicotine(DB00184)|Nifedipine(DB01115)|Nitrofurantoin(DB00698)|Orphenadrine(DB01173)|Phenelzine(DB00780)|Quinidine(DB00908)|S-Adenosylmethionine(DB00118)|Sevoflurane(DB01236)|Theophylline(DB00277)|Tolbutamide(DB01124)									0.389313	142.207035	143.608251	51	80	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	135352302	135352302	4335	10	G	T	T	T	533	41	CYP2E1	2	2
MYO3A	53904	broad.mit.edu	37	10	26436361	26436361	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:26436361C>T	uc001isn.2	+	c.2508C>T	c.(2506-2508)GTC>GTT	p.V836V	MYO3A_uc009xko.1_Silent_p.V836V|MYO3A_uc009xkp.1_Non-coding_Transcript|MYO3A_uc009xkq.1_Intron	NM_017433	NP_059129	Q8NEV4	MYO3A_HUMAN	myosin IIIA	836	Myosin head-like.				protein autophosphorylation|response to stimulus|sensory perception of sound|visual perception	cytoplasm|filamentous actin|filopodium|myosin complex	actin binding|actin-dependent ATPase activity|ADP binding|ATP binding|calmodulin binding|plus-end directed microfilament motor activity|protein serine/threonine kinase activity			ovary(6)|lung(3)|central_nervous_system(2)|breast(1)|kidney(1)|pancreas(1)	14										781				0.585366	77.707816	77.969547	24	17	KEEP	---	---	---	---	capture		Silent	SNP	26436361	26436361	10471	10	C	T	T	T	379	30	MYO3A	2	2
ANKRD30A	91074	broad.mit.edu	37	10	37451731	37451731	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:37451731C>A	uc001iza.1	+	c.1789C>A	c.(1789-1791)CCA>ACA	p.P597T		NM_052997	NP_443723	Q9BXX3	AN30A_HUMAN	ankyrin repeat domain 30A	653					regulation of transcription, DNA-dependent	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(7)|breast(1)	8														0.711864	132.337463	134.700919	42	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	37451731	37451731	663	10	C	A	A	A	286	22	ANKRD30A	2	2
ANKRD30A	91074	broad.mit.edu	37	10	37454033	37454033	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:37454033C>A	uc001iza.1	+	c.1846C>A	c.(1846-1848)CCA>ACA	p.P616T		NM_052997	NP_443723	Q9BXX3	AN30A_HUMAN	ankyrin repeat domain 30A	672					regulation of transcription, DNA-dependent	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(7)|breast(1)	8														0.681818	98.16279	99.455529	30	14	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	37454033	37454033	663	10	C	A	A	A	286	22	ANKRD30A	2	2
ZNF485	220992	broad.mit.edu	37	10	44112653	44112653	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:44112653G>T	uc010qfc.1	+	c.1162G>T	c.(1162-1164)GGG>TGG	p.G388W	ZNF485_uc010qfd.1_Missense_Mutation_p.G297W	NM_145312	NP_660355	Q8NCK3	ZN485_HUMAN	zinc finger protein 485	388	C2H2-type 10.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0														0.431818	59.521346	59.699025	19	25	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	44112653	44112653	18532	10	G	T	T	T	611	47	ZNF485	2	2
OR13A1	79290	broad.mit.edu	37	10	45799823	45799823	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:45799823G>A	uc001jcc.1	-	c.48C>T	c.(46-48)CCC>CCT	p.P16P	OR13A1_uc001jcd.1_Silent_p.P12P	NM_001004297	NP_001004297	Q8NGR1	O13A1_HUMAN	olfactory receptor, family 13, subfamily A,	16	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0														0.482353	122.329411	122.3533	41	44	KEEP	---	---	---	---	capture		Silent	SNP	45799823	45799823	11339	10	G	A	A	A	600	47	OR13A1	2	2
PCDH15	65217	broad.mit.edu	37	10	56106127	56106127	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:56106127G>T	uc010qhy.1	-	c.607C>A	c.(607-609)CCG>ACG	p.P203T	PCDH15_uc010qhq.1_Missense_Mutation_p.P203T|PCDH15_uc010qhr.1_Missense_Mutation_p.P198T|PCDH15_uc010qhs.1_Missense_Mutation_p.P203T|PCDH15_uc010qht.1_Missense_Mutation_p.P198T|PCDH15_uc010qhu.1_Missense_Mutation_p.P198T|PCDH15_uc001jjv.1_Missense_Mutation_p.P176T|PCDH15_uc010qhv.1_Missense_Mutation_p.P198T|PCDH15_uc010qhw.1_Missense_Mutation_p.P198T|PCDH15_uc010qhx.1_Missense_Mutation_p.P198T|PCDH15_uc010qhz.1_Missense_Mutation_p.P198T|PCDH15_uc010qia.1_Missense_Mutation_p.P176T|PCDH15_uc001jju.1_Missense_Mutation_p.P198T|PCDH15_uc010qib.1_Missense_Mutation_p.P176T|PCDH15_uc001jjw.2_Missense_Mutation_p.P198T	NM_001142763	NP_001136235	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-1 precursor	198	Extracellular (Potential).|Cadherin 2.				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)	9		Melanoma(3;0.117)|Lung SC(717;0.238)								1612				0.425926	62.590977	62.853921	23	31	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	56106127	56106127	11931	10	G	T	T	T	533	41	PCDH15	2	2
CDH23	64072	broad.mit.edu	37	10	73572631	73572631	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:73572631G>A	uc001jrx.3	+	c.9617G>A	c.(9616-9618)CGT>CAT	p.R3206H	CDH23_uc001jsg.3_Missense_Mutation_p.R966H|CDH23_uc001jsh.3_Missense_Mutation_p.R966H|CDH23_uc001jsi.3_Missense_Mutation_p.R966H|CDH23_uc001jsj.3_Missense_Mutation_p.R103H|CDH23_uc010qjr.1_Missense_Mutation_p.R103H	NM_022124	NP_071407	Q9H251	CAD23_HUMAN	cadherin-like 23 isoform 1 precursor	3206	Cytoplasmic (Potential).				calcium ion transport|calcium-dependent cell-cell adhesion|cytosolic calcium ion homeostasis|equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	integral to membrane|plasma membrane|stereocilium	calcium ion binding|protein binding			central_nervous_system(5)|large_intestine(4)|ovary(2)	11														0.608696	46.356876	46.596144	14	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	73572631	73572631	3237	10	G	A	A	A	520	40	CDH23	1	1
SFTPA2	729238	broad.mit.edu	37	10	81317230	81317230	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:81317230C>A	uc001kal.3	-	c.482G>T	c.(481-483)CGC>CTC	p.R161L	SFTPA2_uc001kan.3_Missense_Mutation_p.R161L	NM_006926	NP_008857	Q8IWL1	SFPA2_HUMAN	RecName: Full=Pulmonary surfactant-associated protein A2;          Short=SP-A2;          Short=SP-A;          Short=PSP-A;          Short=PSPA; AltName: Full=Alveolar proteinosis protein; AltName: Full=35 kDa pulmonary surfactant-associated protein; Flags: Precursor;	161	C-type lectin.				cell junction assembly|respiratory gaseous exchange	collagen|extracellular space	sugar binding				0	all_cancers(46;0.197)|Breast(12;0.000326)|Prostate(51;0.00985)|all_epithelial(25;0.0149)		Epithelial(14;0.00957)|all cancers(16;0.0179)|Colorectal(32;0.229)											0.266234	111.44755	118.961839	41	113	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	81317230	81317230	14681	10	C	A	A	A	351	27	SFTPA2	1	1
MMRN2	79812	broad.mit.edu	37	10	88702973	88702973	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:88702973T>C	uc001kea.2	-	c.1568A>G	c.(1567-1569)GAC>GGC	p.D523G	MMRN2_uc010qmn.1_Missense_Mutation_p.D166G|MMRN2_uc009xtb.2_Missense_Mutation_p.D480G	NM_024756	NP_079032	Q9H8L6	MMRN2_HUMAN	multimerin 2 precursor	523						extracellular space				large_intestine(1)	1														0.325581	34.830196	35.993711	14	29	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	88702973	88702973	10062	10	T	C	C	C	754	58	MMRN2	4	4
STAMBPL1	57559	broad.mit.edu	37	10	90670738	90670738	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:90670738C>T	uc010qmx.1	+	c.390C>T	c.(388-390)AAC>AAT	p.N130N	STAMBPL1_uc001kfk.2_Silent_p.N130N|STAMBPL1_uc009xto.2_Non-coding_Transcript|STAMBPL1_uc001kfl.2_Silent_p.N130N|STAMBPL1_uc001kfn.2_5'Flank	NM_020799	NP_065850	Q96FJ0	STALP_HUMAN	STAM binding protein-like 1	130							metal ion binding|metallopeptidase activity|protein binding			ovary(1)	1		Colorectal(252;0.0381)		Colorectal(12;6.38e-05)|COAD - Colon adenocarcinoma(12;7.75e-05)										0.19697	28.958041	34.58877	13	53	KEEP	---	---	---	---	capture		Silent	SNP	90670738	90670738	15770	10	C	T	T	T	246	19	STAMBPL1	1	1
ANKRD1	27063	broad.mit.edu	37	10	92678728	92678728	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:92678728G>T	uc001khe.1	-	c.347C>A	c.(346-348)ACG>AAG	p.T116K		NM_014391	NP_055206	Q15327	ANKR1_HUMAN	cardiac ankyrin repeat protein	116			T -> M (in TAPVR).		cellular lipid metabolic process|defense response|signal transduction		DNA binding				0		Colorectal(252;0.0475)												0.482759	93.599698	93.614545	28	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	92678728	92678728	640	10	G	T	T	T	520	40	ANKRD1	1	1
LGI1	9211	broad.mit.edu	37	10	95557473	95557473	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:95557473C>T	uc001kjc.3	+	c.1587C>T	c.(1585-1587)TCC>TCT	p.S529S	LGI1_uc010qnv.1_Silent_p.S481S|LGI1_uc001kjd.3_Intron|LGI1_uc009xui.2_Non-coding_Transcript|LGI1_uc001kje.2_Intron	NM_005097	NP_005088	O95970	LGI1_HUMAN	leucine-rich, glioma inactivated 1 precursor	529	EAR 7.				axon guidance|cell proliferation|positive regulation of cell growth|positive regulation of synaptic transmission	cell junction|extracellular space|synapse	receptor binding			ovary(2)|central_nervous_system(1)	3		Colorectal(252;0.124)												0.35	102.184918	104.174414	35	65	KEEP	---	---	---	---	capture		Silent	SNP	95557473	95557473	9077	10	C	T	T	T	262	21	LGI1	2	2
ATM	472	broad.mit.edu	37	11	108137952	108137952	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:108137952G>T	uc001pkb.1	+	c.2521G>T	c.(2521-2523)GAT>TAT	p.D841Y	ATM_uc009yxr.1_Missense_Mutation_p.D841Y|ATM_uc009yxs.1_5'Flank	NM_000051	NP_000042	Q13315	ATM_HUMAN	ataxia telangiectasia mutated isoform 1	841					cell cycle arrest|cellular response to gamma radiation|DNA damage induced protein phosphorylation|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|double-strand break repair via homologous recombination|G2/M transition DNA damage checkpoint|histone mRNA catabolic process|mitotic cell cycle spindle assembly checkpoint|negative regulation of B cell proliferation|peptidyl-serine phosphorylation|positive regulation of DNA damage response, signal transduction by p53 class mediator|pre-B cell allelic exclusion|protein autophosphorylation|reciprocal meiotic recombination|replicative senescence	cytoplasmic membrane-bounded vesicle|nucleoplasm	1-phosphatidylinositol-3-kinase activity|ATP binding|DNA binding|DNA-dependent protein kinase activity|identical protein binding|protein complex binding|protein dimerization activity|protein N-terminus binding			haematopoietic_and_lymphoid_tissue(174)|lung(24)|breast(14)|large_intestine(9)|ovary(5)|kidney(5)|central_nervous_system(4)|upper_aerodigestive_tract(1)|stomach(1)|NS(1)	238		all_cancers(61;9.64e-12)|all_epithelial(67;9.97e-08)|Melanoma(852;2.55e-06)|Acute lymphoblastic leukemia(157;3.95e-05)|all_hematologic(158;0.00014)|Breast(348;0.0258)|all_neural(303;0.072)		Epithelial(105;9.05e-06)|BRCA - Breast invasive adenocarcinoma(274;1.06e-05)|all cancers(92;0.000208)|Colorectal(284;0.116)|OV - Ovarian serous cystadenocarcinoma(223;0.147)						1073	TSP Lung(14;0.12)			0.536585	64.885341	64.928185	22	19	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	108137952	108137952	1128	11	G	T	T	T	585	45	ATM	2	2
C11orf52	91894	broad.mit.edu	37	11	111796798	111796798	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:111796798G>A	uc001pmh.2	+	c.247G>A	c.(247-249)GTG>ATG	p.V83M	C11orf52_uc001pmi.2_Missense_Mutation_p.V83M	NM_080659	NP_542390	Q96A22	CK052_HUMAN	hypothetical protein LOC91894	83										ovary(1)	1		all_cancers(61;8.8e-15)|all_epithelial(67;6.27e-09)|Melanoma(852;1.91e-06)|all_hematologic(158;0.000405)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0112)|all_neural(223;0.0281)|Medulloblastoma(222;0.0425)		Epithelial(105;3.63e-07)|BRCA - Breast invasive adenocarcinoma(274;1.1e-06)|all cancers(92;6.7e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.0512)										0.612903	61.729556	62.075545	19	12	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	111796798	111796798	1686	11	G	A	A	A	468	36	C11orf52	2	2
HTR3A	3359	broad.mit.edu	37	11	113853842	113853842	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:113853842C>A	uc010rxb.1	+	c.393C>A	c.(391-393)TTC>TTA	p.F131L	HTR3A_uc010rxa.1_Missense_Mutation_p.F131L|HTR3A_uc009yyx.2_Non-coding_Transcript|HTR3A_uc010rxc.1_Missense_Mutation_p.F110L	NM_213621	NP_998786	P46098	5HT3A_HUMAN	5-hydroxytryptamine (serotonin) receptor 3A	125	Extracellular (Potential).			F -> L (in Ref. 2; AAB37533).	digestion|synaptic transmission	cell junction|integral to plasma membrane|postsynaptic membrane	serotonin binding|serotonin receptor activity|serotonin-activated cation-selective channel activity				0		all_cancers(61;2.31e-17)|all_epithelial(67;2.1e-10)|all_hematologic(158;4.64e-05)|Melanoma(852;0.000312)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0101)|all_neural(223;0.0281)|Prostate(24;0.0294)|Medulloblastoma(222;0.0425)		BRCA - Breast invasive adenocarcinoma(274;2.71e-06)|Epithelial(105;2.58e-05)|all cancers(92;0.000238)|OV - Ovarian serous cystadenocarcinoma(223;0.191)	Alosetron(DB00969)|Chloroprocaine(DB01161)|Cisapride(DB00604)|Dolasetron(DB00757)|Granisetron(DB00889)|Mirtazapine(DB00370)|Ondansetron(DB00904)|Palonosetron(DB00377)|Procaine(DB00721)|Tubocurarine(DB01199)									0.533333	149.410673	149.50213	48	42	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	113853842	113853842	7744	11	C	A	A	A	350	27	HTR3A	1	1
MLL	4297	broad.mit.edu	37	11	118390412	118390412	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:118390412C>G	uc001ptb.2	+	c.11226C>G	c.(11224-11226)CAC>CAG	p.H3742Q	MLL_uc001pta.2_Missense_Mutation_p.H3739Q	NM_005933	NP_005924	Q03164	MLL1_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	3739	FY-rich C-terminal.				apoptosis|embryonic hemopoiesis|histone H4-K16 acetylation|positive regulation of transcription, DNA-dependent|protein complex assembly|transcription from RNA polymerase II promoter	MLL1 complex	AT DNA binding|histone acetyl-lysine binding|histone methyltransferase activity (H3-K4 specific)|protein homodimerization activity|RNA polymerase II transcription factor activity|sequence-specific DNA binding transcription factor activity|unmethylated CpG binding|zinc ion binding			ovary(5)|kidney(5)|lung(3)|pancreas(2)|central_nervous_system(1)|urinary_tract(1)|skin(1)	18	all_hematologic(175;0.046)	all_hematologic(192;1.13e-50)|all_neural(223;3.18e-06)|Breast(348;1.07e-05)|Medulloblastoma(222;0.0425)|Hepatocellular(160;0.244)		OV - Ovarian serous cystadenocarcinoma(223;2.77e-44)|BRCA - Breast invasive adenocarcinoma(274;1.2e-11)|Lung(307;3.48e-06)|LUSC - Lung squamous cell carcinoma(976;7.92e-05)|Colorectal(284;0.144)						723				0.598291	229.804277	230.783827	70	47	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	118390412	118390412	10010	11	C	G	G	G	259	20	MLL	3	3
HINFP	25988	broad.mit.edu	37	11	119005060	119005060	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:119005060A>T	uc001pvp.2	+	c.1406A>T	c.(1405-1407)CAG>CTG	p.Q469L	HINFP_uc001pvq.2_Missense_Mutation_p.Q469L|HINFP_uc001pvr.2_Missense_Mutation_p.Q222L	NM_015517	NP_056332	Q9BQA5	HINFP_HUMAN	MBD2 (methyl-CpG-binding protein)-interacting	469	Interaction with NPAT.				DNA damage checkpoint|DNA repair|establishment of protein localization|in utero embryonic development|myoblast differentiation|negative regulation of transcription, DNA-dependent|regulation of transcription involved in G1/S phase of mitotic cell cycle	Cajal body	enzyme binding|histone binding|promoter binding|sequence-specific DNA binding transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription coactivator activity|zinc ion binding			pancreas(2)|ovary(1)	3												OREG0021397	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	0.533333	77.500328	77.54439	24	21	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	119005060	119005060	7395	11	A	T	T	T	91	7	HINFP	3	3
BRSK2	9024	broad.mit.edu	37	11	1464734	1464734	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:1464734G>T	uc001ltm.2	+	c.787G>T	c.(787-789)GAC>TAC	p.D263Y	BRSK2_uc009ycv.1_Missense_Mutation_p.D217Y|BRSK2_uc001lth.1_Missense_Mutation_p.D217Y|BRSK2_uc001lti.2_Missense_Mutation_p.D217Y|BRSK2_uc001ltj.2_Missense_Mutation_p.D217Y|BRSK2_uc001ltk.2_Non-coding_Transcript|BRSK2_uc001ltl.2_Missense_Mutation_p.D217Y|BRSK2_uc001ltn.2_Non-coding_Transcript|BRSK2_uc010qwx.1_Non-coding_Transcript	NM_003957	NP_003948	Q8IWQ3	BRSK2_HUMAN	BR serine/threonine kinase 2	217	Protein kinase.				establishment of cell polarity|neuron differentiation|protein phosphorylation		ATP binding|magnesium ion binding|protein serine/threonine kinase activity				0		all_epithelial(84;4.17e-05)|Breast(177;0.000307)|Ovarian(85;0.0014)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		BRCA - Breast invasive adenocarcinoma(625;0.00144)|Lung(200;0.0713)|LUSC - Lung squamous cell carcinoma(625;0.0842)						1394				0.727273	26.505075	27.019145	8	3	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	1464734	1464734	1555	11	G	T	T	T	481	37	BRSK2	1	1
KRTAP5-5	439915	broad.mit.edu	37	11	1651688	1651688	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:1651688A>T	uc001lty.2	+	c.618A>T	c.(616-618)TCA>TCT	p.S206S		NM_001001480	NP_001001480	Q701N2	KRA55_HUMAN	keratin associated protein 5-5	206	8 X 4 AA repeats of C-C-X-P.					keratin filament				lung(1)	1		all_epithelial(84;0.00018)|Ovarian(85;0.0014)|Breast(177;0.00147)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		BRCA - Breast invasive adenocarcinoma(625;0.000614)|Lung(200;0.0681)|LUSC - Lung squamous cell carcinoma(625;0.082)										0.627329	335.093413	337.386828	101	60	KEEP	---	---	---	---	capture		Silent	SNP	1651688	1651688	8886	11	A	T	T	T	80	7	KRTAP5-5	3	3
KCNC1	3746	broad.mit.edu	37	11	17794029	17794029	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:17794029C>A	uc009yhc.1	+	c.1388C>A	c.(1387-1389)CCA>CAA	p.P463Q	KCNC1_uc001mnk.3_Missense_Mutation_p.P463Q	NM_001112741	NP_001106212	P48547	KCNC1_HUMAN	Shaw-related voltage-gated potassium channel	463	Cytoplasmic (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity				0														0.2	32.146342	37.978496	14	56	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	17794029	17794029	8319	11	C	A	A	A	273	21	KCNC1	2	2
KCNC1	3746	broad.mit.edu	37	11	17794031	17794031	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:17794031C>T	uc009yhc.1	+	c.1390C>T	c.(1390-1392)CCG>TCG	p.P464S	KCNC1_uc001mnk.3_Missense_Mutation_p.P464S	NM_001112741	NP_001106212	P48547	KCNC1_HUMAN	Shaw-related voltage-gated potassium channel	464	Cytoplasmic (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity				0														0.202899	28.018496	33.683043	14	55	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	17794031	17794031	8319	11	C	T	T	T	234	18	KCNC1	2	2
WT1	7490	broad.mit.edu	37	11	32414272	32414272	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:32414272C>A	uc001mtn.1	-	c.1279G>T	c.(1279-1281)GAC>TAC	p.D427Y	WT1_uc001mtl.1_Missense_Mutation_p.D215Y|WT1_uc001mtm.1_Missense_Mutation_p.D198Y|WT1_uc001mto.1_Missense_Mutation_p.D427Y|WT1_uc001mtp.1_Missense_Mutation_p.D410Y|WT1_uc001mtq.1_Missense_Mutation_p.D410Y|WT1_uc009yjs.1_Non-coding_Transcript	NM_024426	NP_077744	P19544	WT1_HUMAN	Wilms tumor 1 isoform D	359	C2H2-type 2.				adrenal gland development|branching involved in ureteric bud morphogenesis|glomerular basement membrane development|glomerular visceral epithelial cell differentiation|induction of apoptosis|male gonad development|metanephric S-shaped body morphogenesis|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of gene-specific transcription|negative regulation of transcription from RNA polymerase II promoter|negative regulation of translation|positive regulation of gene-specific transcription|sex determination|visceral serous pericardium development	cytoplasm|nuclear speck|nucleoplasm	C2H2 zinc finger domain binding|promoter binding|RNA binding|sequence-specific DNA binding transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription repressor activity|zinc ion binding		EWSR1/WT1(231)	haematopoietic_and_lymphoid_tissue(302)|soft_tissue(231)|kidney(132)|pleura(2)|peritoneum(1)|lung(1)	669	Breast(20;0.247)		OV - Ovarian serous cystadenocarcinoma(30;0.128)							684				0.148148	8.849027	15.299831	8	46	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	32414272	32414272	17982	11	C	A	A	A	390	30	WT1	2	2
CAPRIN1	4076	broad.mit.edu	37	11	34097814	34097814	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:34097814G>C	uc001mvh.1	+	c.398G>C	c.(397-399)CGG>CCG	p.R133P	CAPRIN1_uc001mvg.2_Missense_Mutation_p.R133P|CAPRIN1_uc001mvi.2_Missense_Mutation_p.R133P|CAPRIN1_uc001mvj.1_Missense_Mutation_p.R52P	NM_005898	NP_005889	Q14444	CAPR1_HUMAN	membrane component chromosome 11 surface marker	133	Potential.				negative regulation of translation|positive regulation of dendrite morphogenesis|positive regulation of dendritic spine morphogenesis	cytoplasmic mRNA processing body|cytosol|dendrite|integral to plasma membrane|stress granule	protein binding|RNA binding			ovary(1)	1		Acute lymphoblastic leukemia(5;0.00045)|all_hematologic(20;0.0016)												0.150943	14.869748	21.053272	8	45	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	34097814	34097814	2754	11	G	C	C	C	507	39	CAPRIN1	3	3
API5	8539	broad.mit.edu	37	11	43348161	43348161	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:43348161G>T	uc010rfh.1	+	c.855G>T	c.(853-855)GAG>GAT	p.E285D	API5_uc010rfg.1_Missense_Mutation_p.E274D|API5_uc001mxf.2_Missense_Mutation_p.E285D|API5_uc010rfi.1_Missense_Mutation_p.E231D|API5_uc001mxg.2_Missense_Mutation_p.E159D	NM_001142930	NP_001136402	Q9BZZ5	API5_HUMAN	apoptosis inhibitor 5 isoform a	285					anti-apoptosis|apoptosis	cytoplasm|spliceosomal complex	fibroblast growth factor binding			large_intestine(1)|ovary(1)|central_nervous_system(1)	3						Pancreas(1;98 122 5625 20895 49453)								0.240741	61.909228	68.52546	26	82	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	43348161	43348161	783	11	G	T	T	T	451	35	API5	2	2
OR51E1	143503	broad.mit.edu	37	11	4674333	4674333	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:4674333G>T	uc001lzi.3	+	c.577G>T	c.(577-579)GAT>TAT	p.D193Y		NM_152430	NP_689643	Q8TCB6	O51E1_HUMAN	olfactory receptor, family 51, subfamily E,	192	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(3)|pancreas(1)	4		Medulloblastoma(188;0.0025)|Breast(177;0.0101)|all_neural(188;0.0227)		Epithelial(150;7.37e-14)|GBM - Glioblastoma multiforme(2;2.85e-05)|BRCA - Breast invasive adenocarcinoma(625;0.00222)|LUSC - Lung squamous cell carcinoma(625;0.19)										0.178295	44.470705	57.039149	23	106	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	4674333	4674333	11504	11	G	T	T	T	585	45	OR51E1	2	2
OR4A15	81328	broad.mit.edu	37	11	55135976	55135976	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:55135976T>A	uc010rif.1	+	c.617T>A	c.(616-618)CTG>CAG	p.L206Q		NM_001005275	NP_001005275	Q8NGL6	O4A15_HUMAN	olfactory receptor, family 4, subfamily A,	206	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1														0.176	47.157492	59.558585	22	103	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	55135976	55135976	11446	11	T	A	A	A	715	55	OR4A15	3	3
OR9I1	219954	broad.mit.edu	37	11	57886584	57886584	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:57886584C>T	uc001nml.1	-	c.333G>A	c.(331-333)GAG>GAA	p.E111E	OR9Q1_uc001nmj.2_Intron	NM_001005211	NP_001005211	Q8NGQ6	OR9I1_HUMAN	olfactory receptor, family 9, subfamily I,	111	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			pancreas(1)	1		Breast(21;0.0589)												0.166667	11.328997	15.120436	6	30	KEEP	---	---	---	---	capture		Silent	SNP	57886584	57886584	11664	11	C	T	T	T	259	20	OR9I1	2	2
MS4A2	2206	broad.mit.edu	37	11	59857214	59857214	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:59857214G>A	uc001nop.2	+	c.106G>A	c.(106-108)GGC>AGC	p.G36S	MS4A2_uc009ymu.2_Missense_Mutation_p.G36S	NM_000139	NP_000130	Q01362	FCERB_HUMAN	membrane-spanning 4-domains, subfamily A, member	36	Cytoplasmic (Potential).				cell proliferation|humoral immune response	integral to plasma membrane	calcium channel activity			ovary(1)	1		all_epithelial(135;0.245)			Omalizumab(DB00043)									0.60241	172.568156	173.330707	50	33	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	59857214	59857214	10253	11	G	A	A	A	455	35	MS4A2	2	2
CD6	923	broad.mit.edu	37	11	60776153	60776153	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:60776153G>T	uc001nqq.2	+	c.617G>T	c.(616-618)TGG>TTG	p.W206L	CD6_uc009yni.2_Missense_Mutation_p.W206L|CD6_uc009ynj.2_Missense_Mutation_p.W206L|CD6_uc001nqp.2_Missense_Mutation_p.W206L|CD6_uc001nqr.2_Missense_Mutation_p.W206L|CD6_uc001nqs.2_Non-coding_Transcript|CD6_uc001nqt.2_Missense_Mutation_p.W206L	NM_006725	NP_006716	P30203	CD6_HUMAN	CD6 molecule precursor	206	SRCR 2.|Extracellular (Potential).				cell adhesion	cell surface|integral to plasma membrane	scavenger receptor activity			pancreas(1)	1						Pancreas(169;904 2017 4767 38890 42505)								0.545455	19.451046	19.470844	6	5	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	60776153	60776153	3156	11	G	T	T	T	611	47	CD6	2	2
VWCE	220001	broad.mit.edu	37	11	61040724	61040724	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:61040724C>A	uc001nra.2	-	c.1646G>T	c.(1645-1647)CGG>CTG	p.R549L	VWCE_uc001nrb.2_Non-coding_Transcript	NM_152718	NP_689931	Q96DN2	VWCE_HUMAN	von Willebrand factor C and EGF domains	549	VWFC 3.					extracellular region	calcium ion binding			ovary(1)	1														0.2	13.348609	16.364092	7	28	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	61040724	61040724	17816	11	C	A	A	A	299	23	VWCE	1	1
DDB1	1642	broad.mit.edu	37	11	61077401	61077401	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:61077401T>C	uc001nrc.3	-	c.2433A>G	c.(2431-2433)GAA>GAG	p.E811E	DDB1_uc010rle.1_Silent_p.E122E|DDB1_uc010rlf.1_Silent_p.E811E	NM_001923	NP_001914	Q16531	DDB1_HUMAN	damage-specific DNA binding protein 1	811	Interaction with CDT1 and CUL4A.				cell cycle checkpoint|interspecies interaction between organisms|nucleotide-excision repair, DNA damage removal|proteasomal ubiquitin-dependent protein catabolic process|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	Cul4A-RING ubiquitin ligase complex|Cul4B-RING ubiquitin ligase complex|cytoplasm|nucleoplasm	damaged DNA binding|protein binding			ovary(2)|central_nervous_system(1)	3														0.182692	38.915611	48.847754	19	85	KEEP	---	---	---	---	capture		Silent	SNP	61077401	61077401	4494	11	T	C	C	C	673	52	DDB1	4	4
AHNAK	79026	broad.mit.edu	37	11	62293785	62293785	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:62293785T>A	uc001ntl.2	-	c.8104A>T	c.(8104-8106)ATC>TTC	p.I2702F	AHNAK_uc001ntk.1_Intron	NM_001620	NP_001611	Q09666	AHNK_HUMAN	AHNAK nucleoprotein isoform 1	2702					nervous system development	nucleus	protein binding			ovary(10)|pancreas(4)	14		Melanoma(852;0.155)												0.2	94.193171	110.455206	39	156	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	62293785	62293785	417	11	T	A	A	A	637	49	AHNAK	3	3
FAM160A2	84067	broad.mit.edu	37	11	6244992	6244992	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:6244992G>A	uc001mck.3	-	c.625C>T	c.(625-627)CGT>TGT	p.R209C	FAM160A2_uc001mcl.3_Missense_Mutation_p.R209C|FAM160A2_uc001mcm.2_Missense_Mutation_p.R209C	NM_032127	NP_115503	Q8N612	F16A2_HUMAN	hypothetical protein LOC84067 isoform 1	209					early endosome to late endosome transport|endosome organization|endosome to lysosome transport|lysosome organization|protein transport	FHF complex	protein binding				0														0.661017	265.803882	268.54693	78	40	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	6244992	6244992	5673	11	G	A	A	A	507	39	FAM160A2	1	1
CCDC87	55231	broad.mit.edu	37	11	66359007	66359007	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:66359007C>A	uc001oiq.3	-	c.1480G>T	c.(1480-1482)GTC>TTC	p.V494F	CCS_uc001oir.2_5'Flank	NM_018219	NP_060689	Q9NVE4	CCD87_HUMAN	coiled-coil domain containing 87	494										ovary(1)	1														0.525	270.007366	270.094938	84	76	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	66359007	66359007	2987	11	C	A	A	A	234	18	CCDC87	2	2
RBM14	10432	broad.mit.edu	37	11	66392833	66392833	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:66392833G>T	uc001oit.2	+	c.1486G>T	c.(1486-1488)GGC>TGC	p.G496C	RBM14_uc009yrh.2_Intron|RBM14_uc009yri.2_Intron|RBM4_uc009yrj.2_Intron|RBM4_uc009yrk.2_Intron	NM_006328	NP_006319	Q96PK6	RBM14_HUMAN	RNA binding motif protein 14	496	Ala-rich.				DNA recombination|DNA repair|DNA replication|estrogen receptor signaling pathway|glucocorticoid receptor signaling pathway|histone deacetylation|positive regulation of transcription from RNA polymerase II promoter|response to hormone stimulus|transcription, DNA-dependent	mediator complex|ribonucleoprotein complex|transcription factor complex	ligand-dependent nuclear receptor transcription coactivator activity|nucleotide binding|protein binding, bridging|RNA binding|RNA polymerase II transcription mediator activity			ovary(2)|central_nervous_system(1)	3														0.674419	275.250017	278.727624	87	42	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	66392833	66392833	13576	11	G	T	T	T	611	47	RBM14	2	2
MRGPRF	116535	broad.mit.edu	37	11	68773568	68773568	+	Silent	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:68773568G>C	uc001ooo.3	-	c.210C>G	c.(208-210)GGC>GGG	p.G70G	MRGPRF_uc001oop.3_Silent_p.G70G	NM_001098515	NP_001091985	Q96AM1	MRGRF_HUMAN	MAS-related GPR, member F	70	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity				0			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)											0.225806	17.277818	19.369749	7	24	KEEP	---	---	---	---	capture		Silent	SNP	68773568	68773568	10157	11	G	C	C	C	431	34	MRGPRF	3	3
FOLR3	2352	broad.mit.edu	37	11	71850763	71850763	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:71850763G>A	uc001orx.1	+	c.626G>A	c.(625-627)TGC>TAC	p.C209Y	FOLR3_uc001ory.1_Missense_Mutation_p.C251Y	NM_000804	NP_000795	P41439	FOLR3_HUMAN	folate receptor 3 precursor	207					folic acid transport	extracellular region|extrinsic to membrane|membrane fraction	folic acid binding|receptor activity				0					Folic Acid(DB00158)									0.681818	88.453663	89.743017	30	14	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	71850763	71850763	6225	11	G	A	A	A	598	46	FOLR3	2	2
CCDC83	220047	broad.mit.edu	37	11	85593700	85593700	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:85593700C>A	uc001pbg.1	+	c.325C>A	c.(325-327)CAG>AAG	p.Q109K	CCDC83_uc001pbh.1_Missense_Mutation_p.Q109K|CCDC83_uc001pbi.1_Non-coding_Transcript|CCDC83_uc001pbj.1_Missense_Mutation_p.Q66K	NM_173556	NP_775827	Q8IWF9	CCD83_HUMAN	coiled-coil domain containing 83	109	Potential.										0		Acute lymphoblastic leukemia(157;4.88e-06)|all_hematologic(158;0.00572)												0.150943	15.965534	22.151271	8	45	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	85593700	85593700	2981	11	C	A	A	A	273	21	CCDC83	2	2
CHORDC1	26973	broad.mit.edu	37	11	89944475	89944475	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:89944475G>C	uc001pdg.2	-	c.341C>G	c.(340-342)CCA>CGA	p.P114R	CHORDC1_uc009yvz.2_Missense_Mutation_p.P95R	NM_012124	NP_036256	Q9UHD1	CHRD1_HUMAN	cysteine and histidine-rich domain-containing	114	Interaction with HSP90AA1 and HSP90AB1 (By similarity).				chaperone-mediated protein folding|regulation of response to stress|response to stress		Hsp90 protein binding|identical protein binding				0		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.00915)												0.627451	192.68086	194.10312	64	38	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	89944475	89944475	3499	11	G	C	C	C	611	47	CHORDC1	3	3
ACACB	32	broad.mit.edu	37	12	109609686	109609686	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:109609686G>T	uc001tob.2	+	c.1002G>T	c.(1000-1002)CTG>CTT	p.L334L	ACACB_uc001toc.2_Silent_p.L334L	NM_001093	NP_001084	O00763	ACACB_HUMAN	acetyl-Coenzyme A carboxylase beta	334	Biotin carboxylation.				acetyl-CoA metabolic process|carnitine shuttle|energy reserve metabolic process|fatty acid biosynthetic process|positive regulation of cellular metabolic process|protein homotetramerization|regulation of fatty acid oxidation	cytosol|endomembrane system|Golgi apparatus|membrane	acetyl-CoA carboxylase activity|ATP binding|biotin carboxylase activity|metal ion binding|protein binding			ovary(5)|pancreas(1)	6					Biotin(DB00121)					1843				0.806452	82.387841	85.102127	25	6	KEEP	---	---	---	---	capture		Silent	SNP	109609686	109609686	108	12	G	T	T	T	574	45	ACACB	2	2
ACACB	32	broad.mit.edu	37	12	109680382	109680382	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:109680382G>T	uc001tob.2	+	c.5163G>T	c.(5161-5163)CCG>CCT	p.P1721P	ACACB_uc001toc.2_Silent_p.P1721P|ACACB_uc010sxl.1_Non-coding_Transcript|ACACB_uc001tod.2_Non-coding_Transcript|ACACB_uc010sxm.1_Silent_p.P387P	NM_001093	NP_001084	O00763	ACACB_HUMAN	acetyl-Coenzyme A carboxylase beta	1721					acetyl-CoA metabolic process|carnitine shuttle|energy reserve metabolic process|fatty acid biosynthetic process|positive regulation of cellular metabolic process|protein homotetramerization|regulation of fatty acid oxidation	cytosol|endomembrane system|Golgi apparatus|membrane	acetyl-CoA carboxylase activity|ATP binding|biotin carboxylase activity|metal ion binding|protein binding			ovary(5)|pancreas(1)	6					Biotin(DB00121)					1843				0.73913	109.974324	112.382637	34	12	KEEP	---	---	---	---	capture		Silent	SNP	109680382	109680382	108	12	G	T	T	T	496	39	ACACB	1	1
C12orf51	283450	broad.mit.edu	37	12	112622286	112622286	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:112622286C>A	uc009zwc.2	-	c.9218G>T	c.(9217-9219)TGC>TTC	p.C3073F		NM_001109662	NP_001103132			chromosome 12 open reading frame 51											ovary(1)	1														0.4375	21.622828	21.677294	7	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	112622286	112622286	1740	12	C	A	A	A	325	25	C12orf51	2	2
TMEM132B	114795	broad.mit.edu	37	12	126138981	126138981	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:126138981A>G	uc001uhe.1	+	c.2962A>G	c.(2962-2964)AGT>GGT	p.S988G	TMEM132B_uc001uhf.1_Missense_Mutation_p.S500G	NM_052907	NP_443139	Q14DG7	T132B_HUMAN	transmembrane protein 132B	988	Cytoplasmic (Potential).					integral to membrane				ovary(5)|large_intestine(1)|breast(1)|pancreas(1)	8	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000423)|Epithelial(86;0.00394)|all cancers(50;0.0362)										0.818182	58.957222	61.047288	18	4	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	126138981	126138981	16577	12	A	G	G	G	91	7	TMEM132B	4	4
GPR133	283383	broad.mit.edu	37	12	131487810	131487810	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:131487810G>A	uc010tbm.1	+	c.1203G>A	c.(1201-1203)ACG>ACA	p.T401T	GPR133_uc001uit.3_Silent_p.T369T	NM_198827	NP_942122	Q6QNK2	GP133_HUMAN	G protein-coupled receptor 133 precursor	369	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			pancreas(5)|ovary(3)	8	all_neural(191;0.0982)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;1.68e-06)|all cancers(50;2.71e-06)|Epithelial(86;6.75e-06)										0.753425	160.081836	164.363159	55	18	KEEP	---	---	---	---	capture		Silent	SNP	131487810	131487810	6917	12	G	A	A	A	483	38	GPR133	1	1
GRIN2B	2904	broad.mit.edu	37	12	13906583	13906583	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:13906583G>T	uc001rbt.2	-	c.678C>A	c.(676-678)CCC>CCA	p.P226P		NM_000834	NP_000825	Q13224	NMDE2_HUMAN	N-methyl-D-aspartate receptor subunit 2B	226	Extracellular (Potential).				response to ethanol	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|outer membrane-bounded periplasmic space|postsynaptic membrane	glycine binding|N-methyl-D-aspartate selective glutamate receptor activity|zinc ion binding			central_nervous_system(4)|ovary(3)|lung(2)|skin(1)	10					Felbamate(DB00949)|Haloperidol(DB00502)|L-Glutamic Acid(DB00142)|Loperamide(DB00836)|Memantine(DB01043)					371				0.70303	389.553783	395.632176	116	49	KEEP	---	---	---	---	capture		Silent	SNP	13906583	13906583	7059	12	G	T	T	T	600	47	GRIN2B	2	2
ERC1	23085	broad.mit.edu	37	12	1399138	1399138	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:1399138G>C	uc001qjb.2	+	c.2740G>C	c.(2740-2742)GCA>CCA	p.A914P	ERC1_uc001qiz.2_Non-coding_Transcript|ERC1_uc001qjc.2_Missense_Mutation_p.A886P|ERC1_uc001qja.2_Non-coding_Transcript|ERC1_uc001qjd.2_Non-coding_Transcript|ERC1_uc001qjf.2_Missense_Mutation_p.A914P|ERC1_uc010sdv.1_Missense_Mutation_p.A622P|ERC1_uc001qje.2_Non-coding_Transcript	NM_178040	NP_829884	Q8IUD2	RB6I2_HUMAN	RAB6-interacting protein 2 isoform epsilon	914	Potential.				I-kappaB phosphorylation|multicellular organismal development|positive regulation of anti-apoptosis|positive regulation of NF-kappaB transcription factor activity|protein transport	Golgi membrane|IkappaB kinase complex|presynaptic membrane	leucine zipper domain binding			ovary(2)|lung(1)	3	all_epithelial(11;0.0698)|Ovarian(42;0.107)		OV - Ovarian serous cystadenocarcinoma(31;0.00239)|BRCA - Breast invasive adenocarcinoma(9;0.0567)							378				0.12844	22.816907	37.45907	14	95	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	1399138	1399138	5403	12	G	C	C	C	546	42	ERC1	3	3
GUCY2C	2984	broad.mit.edu	37	12	14804340	14804340	+	Splice_Site_SNP	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:14804340C>A	uc001rcd.2	-	c.1710_splice	c.e15+1	p.R570_splice		NM_004963	NP_004954			guanylate cyclase 2C precursor						intracellular signal transduction|protein phosphorylation|receptor guanylyl cyclase signaling pathway	integral to membrane	ATP binding|GTP binding|guanylate cyclase activity|protein binding|protein kinase activity|receptor activity			ovary(4)|skin(1)	5										889				0.125	18.825043	33.094074	13	91	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	14804340	14804340	7176	12	C	A	A	A	234	18	GUCY2C	5	2
CACNA2D4	93589	broad.mit.edu	37	12	1994018	1994018	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:1994018G>T	uc001qjp.2	-	c.1188C>A	c.(1186-1188)TGC>TGA	p.C396*	CACNA2D4_uc009zds.1_Non-coding_Transcript|CACNA2D4_uc009zdt.1_Nonsense_Mutation_p.C315*	NM_172364	NP_758952	Q7Z3S7	CA2D4_HUMAN	voltage-gated calcium channel alpha(2)delta-4	396	VWFA.|Extracellular (Potential).				response to stimulus|visual perception	integral to membrane	calcium channel activity|metal ion binding|voltage-gated ion channel activity			ovary(1)	1	Ovarian(42;0.107)	Myeloproliferative disorder(1001;0.206)	OV - Ovarian serous cystadenocarcinoma(31;0.00113)	Kidney(2;0.0205)|KIRC - Kidney renal clear cell carcinoma(2;0.0451)		Colon(2;101 179 21030 23310 28141)								0.783784	96.692771	99.441266	29	8	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	1994018	1994018	2667	12	G	T	T	T	594	46	CACNA2D4	5	2
KRAS	3845	broad.mit.edu	37	12	25380276	25380276	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:25380276T>A	uc001rgp.1	-	c.182A>T	c.(181-183)CAA>CTA	p.Q61L	KRAS_uc001rgq.1_Missense_Mutation_p.Q61L	NM_033360	NP_203524	P01116	RASK_HUMAN	c-K-ras2 protein isoform a precursor	61	GTP.		Q -> R (in a colorectal cancer sample; somatic mutation).		activation of MAPKK activity|axon guidance|blood coagulation|epidermal growth factor receptor signaling pathway|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|Ras protein signal transduction	plasma membrane	GTP binding|GTPase activity|protein binding	p.Q61L(47)|p.Q61R(40)|p.Q61H(23)|p.Q61P(11)|p.Q61D(1)		large_intestine(11742)|pancreas(3256)|lung(2694)|biliary_tract(514)|ovary(437)|endometrium(339)|haematopoietic_and_lymphoid_tissue(303)|stomach(179)|thyroid(145)|prostate(85)|soft_tissue(75)|small_intestine(62)|upper_aerodigestive_tract(59)|cervix(49)|urinary_tract(48)|skin(38)|breast(27)|liver(21)|testis(17)|oesophagus(15)|central_nervous_system(8)|peritoneum(5)|kidney(5)|salivary_gland(5)|thymus(5)|eye(4)|gastrointestinal_tract_(site_indeterminate)(4)|autonomic_ganglia(2)|bone(2)|genital_tract(1)|penis(1)|adrenal_gland(1)	20148	all_cancers(2;1e-35)|all_epithelial(2;1.97e-38)|all_lung(3;2.1e-23)|Lung NSC(3;1.16e-22)|Acute lymphoblastic leukemia(6;0.00231)|all_hematologic(7;0.00259)|Melanoma(3;0.0301)|Colorectal(261;0.11)|Ovarian(17;0.12)		OV - Ovarian serous cystadenocarcinoma(3;1.23e-21)|Epithelial(3;1.31e-20)|all cancers(3;5.45e-18)|STAD - Stomach adenocarcinoma(2;2.68e-05)			Pancreas(8;6 143 191 305 2070 2426 4376 10944 11745 26467 38091 50869)	Q61R(PANC0213_PANCREAS)|Q61L(NCIH650_LUNG)|Q61L(SW948_LARGE_INTESTINE)	119		262	TSP Lung(1;<1E-8)|Multiple Myeloma(2;<1E-6)			0.785047	288.632617	296.652702	84	23	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	25380276	25380276	8753	12	T	A	A	A	819	63	KRAS	3	3
CACNA1C	775	broad.mit.edu	37	12	2794913	2794913	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:2794913A>T	uc009zdu.1	+	c.5834A>T	c.(5833-5835)CAG>CTG	p.Q1945L	CACNA1C_uc009zdv.1_Missense_Mutation_p.Q1859L|CACNA1C_uc001qkb.2_Missense_Mutation_p.Q1862L|CACNA1C_uc001qkc.2_Missense_Mutation_p.Q1881L|CACNA1C_uc001qke.2_Missense_Mutation_p.Q1851L|CACNA1C_uc001qkf.2_Missense_Mutation_p.Q1870L|CACNA1C_uc001qjz.2_Missense_Mutation_p.Q1862L|CACNA1C_uc001qkd.2_Missense_Mutation_p.Q1881L|CACNA1C_uc001qkg.2_Missense_Mutation_p.Q1868L|CACNA1C_uc009zdw.1_Missense_Mutation_p.Q1903L|CACNA1C_uc001qkh.2_Missense_Mutation_p.Q1870L|CACNA1C_uc001qkl.2_Missense_Mutation_p.Q1910L|CACNA1C_uc001qkn.2_Missense_Mutation_p.Q1862L|CACNA1C_uc001qko.2_Missense_Mutation_p.Q1882L|CACNA1C_uc001qkp.2_Missense_Mutation_p.Q1862L|CACNA1C_uc001qkr.2_Missense_Mutation_p.Q1879L|CACNA1C_uc001qku.2_Missense_Mutation_p.Q1897L|CACNA1C_uc001qkq.2_Missense_Mutation_p.Q1890L|CACNA1C_uc001qks.2_Missense_Mutation_p.Q1862L|CACNA1C_uc001qkt.2_Missense_Mutation_p.Q1881L|CACNA1C_uc001qki.1_Missense_Mutation_p.Q1669L|CACNA1C_uc001qkj.1_Missense_Mutation_p.Q1633L|CACNA1C_uc001qkk.1_Missense_Mutation_p.Q1598L|CACNA1C_uc001qkm.1_Missense_Mutation_p.Q1658L|CACNA1C_uc010sea.1_Missense_Mutation_p.Q553L|CACNA1C_uc001qky.1_Missense_Mutation_p.Q180L	NM_199460	NP_955630	Q13936	CAC1C_HUMAN	calcium channel, voltage-dependent, L type,	1945	Cytoplasmic (Potential).				axon guidance|calcium ion transport into cytosol|energy reserve metabolic process|regulation of insulin secretion	cytoplasm|postsynaptic density|voltage-gated calcium channel complex	calmodulin binding|voltage-gated calcium channel activity			ovary(10)|central_nervous_system(1)	11			OV - Ovarian serous cystadenocarcinoma(31;0.00256)	LUAD - Lung adenocarcinoma(1;0.134)	Ibutilide(DB00308)|Isradipine(DB00270)|Magnesium Sulfate(DB00653)|Mibefradil(DB01388)|Nicardipine(DB00622)|Verapamil(DB00661)									0.632653	105.230513	105.987197	31	18	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	2794913	2794913	2656	12	A	T	T	T	91	7	CACNA1C	3	3
OVCH1	341350	broad.mit.edu	37	12	29617627	29617627	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:29617627C>T	uc001rix.1	-	c.1938G>A	c.(1936-1938)AGG>AGA	p.R646R		NM_183378	NP_899234	Q7RTY7	OVCH1_HUMAN	ovochymase 1 precursor	646	Peptidase S1 2.				proteolysis	extracellular region	metal ion binding|serine-type endopeptidase activity			ovary(3)|central_nervous_system(3)|pancreas(3)|large_intestine(1)	10	Lung NSC(12;1.84e-09)|Acute lymphoblastic leukemia(23;0.00885)|all_hematologic(23;0.0155)													0.75	236.163058	241.600134	72	24	KEEP	---	---	---	---	capture		Silent	SNP	29617627	29617627	11736	12	C	T	T	T	285	22	OVCH1	2	2
AKAP3	10566	broad.mit.edu	37	12	4736526	4736526	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:4736526C>A	uc001qnb.3	-	c.1542G>T	c.(1540-1542)GAG>GAT	p.E514D		NM_006422	NP_006413	O75969	AKAP3_HUMAN	A-kinase anchor protein 3	514					acrosome reaction|cellular component movement	acrosomal vesicle	protein kinase A binding			skin(2)|large_intestine(1)|ovary(1)|kidney(1)	5														0.333333	40.762594	41.954228	16	32	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	4736526	4736526	455	12	C	A	A	A	415	32	AKAP3	2	2
RAPGEF3	10411	broad.mit.edu	37	12	48134736	48134736	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:48134736T>A	uc001rpz.3	-	c.2011A>T	c.(2011-2013)ACG>TCG	p.T671S	RAPGEF3_uc001rpw.2_5'UTR|RAPGEF3_uc001rpx.2_Missense_Mutation_p.T86S|RAPGEF3_uc010sln.1_Missense_Mutation_p.T144S|RAPGEF3_uc001rpy.2_Non-coding_Transcript|RAPGEF3_uc009zkp.2_Missense_Mutation_p.T629S|RAPGEF3_uc009zkq.2_Missense_Mutation_p.T629S	NM_001098531	NP_001092001	A8K2G5	A8K2G5_HUMAN	Rap guanine nucleotide exchange factor 3 isoform	629					regulation of protein phosphorylation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cAMP-dependent protein kinase complex	cAMP-dependent protein kinase regulator activity|guanyl-nucleotide exchange factor activity				0	Lung SC(27;0.192)			GBM - Glioblastoma multiforme(48;0.0375)										0.473684	24.139652	24.152864	9	10	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	48134736	48134736	13505	12	T	A	A	A	754	58	RAPGEF3	3	3
KCNA5	3741	broad.mit.edu	37	12	5154280	5154280	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:5154280C>A	uc001qni.2	+	c.967C>A	c.(967-969)CCC>ACC	p.P323T		NM_002234	NP_002225	P22460	KCNA5_HUMAN	potassium voltage-gated channel, shaker-related	323						Golgi apparatus|voltage-gated potassium channel complex	delayed rectifier potassium channel activity			ovary(2)|breast(2)	4														0.179687	40.351036	52.71495	23	105	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	5154280	5154280	8311	12	C	A	A	A	286	22	KCNA5	2	2
KRT1	3848	broad.mit.edu	37	12	53071971	53071971	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:53071971C>T	uc001sau.1	-	c.843G>A	c.(841-843)GAG>GAA	p.E281E	KRT1_uc001sav.1_Silent_p.E281E	NM_006121	NP_006112	P04264	K2C1_HUMAN	keratin 1	281	Coil 1B.|Rod.				complement activation, lectin pathway|epidermis development|fibrinolysis|regulation of angiogenesis|response to oxidative stress	plasma membrane	protein binding|receptor activity|structural constituent of cytoskeleton|sugar binding			ovary(1)	1														0.710526	96.641081	98.150604	27	11	KEEP	---	---	---	---	capture		Silent	SNP	53071971	53071971	8762	12	C	T	T	T	415	32	KRT1	2	2
OR6C75	390323	broad.mit.edu	37	12	55759343	55759343	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:55759343G>T	uc010spk.1	+	c.449G>T	c.(448-450)GGG>GTG	p.G150V		NM_001005497	NP_001005497	A6NL08	O6C75_HUMAN	olfactory receptor, family 6, subfamily C,	150	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(1)|ovary(1)	2														0.857143	92.556158	96.860488	30	5	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	55759343	55759343	11609	12	G	T	T	T	559	43	OR6C75	2	2
OR6C2	341416	broad.mit.edu	37	12	55846340	55846340	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:55846340G>T	uc001sgz.1	+	c.343G>T	c.(343-345)GCC>TCC	p.A115S		NM_054105	NP_473446	Q9NZP2	OR6C2_HUMAN	olfactory receptor, family 6, subfamily C,	115	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0														0.717557	305.745761	311.300597	94	37	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	55846340	55846340	11601	12	G	T	T	T	442	34	OR6C2	2	2
FGF14	2259	broad.mit.edu	37	13	102527578	102527578	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:102527578C>A	uc001vpf.2	-	c.277G>T	c.(277-279)GAT>TAT	p.D93Y	FGF14_uc001vpe.2_Missense_Mutation_p.D88Y	NM_175929	NP_787125	Q92915	FGF14_HUMAN	fibroblast growth factor 14 isoform 1B	88					cell death|cell-cell signaling|JNK cascade|nervous system development|signal transduction	nucleus	growth factor activity|heparin binding			large_intestine(1)|ovary(1)	2	all_neural(89;0.0239)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)													0.37037	29.649694	30.045625	10	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	102527578	102527578	6080	13	C	A	A	A	403	31	FGF14	1	1
F7	2155	broad.mit.edu	37	13	113773184	113773184	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:113773184C>A	uc001vsv.2	+	c.1263C>A	c.(1261-1263)ATC>ATA	p.I421I	F7_uc001vsw.2_Silent_p.I399I|F7_uc010tjt.1_Silent_p.I352I	NM_000131	NP_000122	P08709	FA7_HUMAN	coagulation factor VII isoform a precursor	421	Peptidase S1.				anti-apoptosis|blood coagulation, extrinsic pathway|peptidyl-glutamic acid carboxylation|positive regulation of leukocyte chemotaxis|positive regulation of platelet-derived growth factor receptor signaling pathway|positive regulation of positive chemotaxis|positive regulation of protein kinase B signaling cascade|post-translational protein modification|proteolysis	endoplasmic reticulum lumen|Golgi lumen|plasma membrane	calcium ion binding|glycoprotein binding|serine-type endopeptidase activity				0	all_lung(23;0.000374)|Lung NSC(43;0.0107)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)	all_cancers(25;0.118)|all_lung(25;0.0364)|all_epithelial(44;0.0393)|Lung NSC(25;0.128)|Breast(118;0.188)	all cancers(43;0.0737)|Epithelial(84;0.213)|BRCA - Breast invasive adenocarcinoma(86;0.218)		Coagulation Factor IX(DB00100)|Coagulation factor VIIa(DB00036)|Menadione(DB00170)									0.266667	8.494838	9.232659	4	11	KEEP	---	---	---	---	capture		Silent	SNP	113773184	113773184	5543	13	C	A	A	A	395	31	F7	1	1
LATS2	26524	broad.mit.edu	37	13	21549289	21549289	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:21549289G>A	uc009zzs.2	-	c.2987C>T	c.(2986-2988)CCC>CTC	p.P996L	LATS2_uc001unr.3_Missense_Mutation_p.P996L	NM_014572	NP_055387	Q9NRM7	LATS2_HUMAN	LATS, large tumor suppressor, homolog 2	996	AGC-kinase C-terminal.				cell division|G1/S transition of mitotic cell cycle|hippo signaling cascade|hormone-mediated signaling pathway|intracellular protein kinase cascade|mitosis|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cyclin-dependent protein kinase activity|protein phosphorylation	microtubule organizing center|nucleus|spindle pole	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			lung(3)|central_nervous_system(3)|ovary(2)|pancreas(1)	9		all_cancers(29;4.74e-22)|all_epithelial(30;1.45e-18)|all_lung(29;4.69e-16)|Lung SC(185;0.0262)|Hepatocellular(188;0.244)		all cancers(112;0.000781)|Epithelial(112;0.00144)|OV - Ovarian serous cystadenocarcinoma(117;0.0183)|Lung(94;0.0375)|LUSC - Lung squamous cell carcinoma(192;0.104)						174				0.225352	41.864113	46.78236	16	55	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	21549289	21549289	8970	13	G	A	A	A	559	43	LATS2	2	2
MTMR6	9107	broad.mit.edu	37	13	25840081	25840081	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:25840081C>A	uc001uqf.3	-	c.467G>T	c.(466-468)TGT>TTT	p.C156F	MTMR6_uc001uqe.1_Missense_Mutation_p.C156F	NM_004685	NP_004676	Q9Y217	MTMR6_HUMAN	myotubularin related protein 6	156	Myotubularin phosphatase.					cytoplasm|nuclear envelope	calcium-activated potassium channel activity|protein serine/threonine phosphatase activity|protein tyrosine phosphatase activity			ovary(2)	2		Lung SC(185;0.0225)|Breast(139;0.0351)		all cancers(112;0.00927)|Epithelial(112;0.0474)|OV - Ovarian serous cystadenocarcinoma(117;0.164)										0.210526	37.061219	42.950974	16	60	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	25840081	25840081	10340	13	C	A	A	A	221	17	MTMR6	2	2
FREM2	341640	broad.mit.edu	37	13	39430390	39430390	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:39430390G>T	uc001uwv.2	+	c.7053G>T	c.(7051-7053)ATG>ATT	p.M2351I	FREM2_uc001uww.2_Missense_Mutation_p.M437I	NM_207361	NP_997244	Q5SZK8	FREM2_HUMAN	FRAS1-related extracellular matrix protein 2	2351	Extracellular (Potential).				cell communication|homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(7)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|pancreas(1)	10		Lung NSC(96;1.04e-07)|Prostate(109;0.00384)|Breast(139;0.00396)|Lung SC(185;0.0565)|Hepatocellular(188;0.114)		all cancers(112;3.32e-07)|Epithelial(112;1.66e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.00154)|BRCA - Breast invasive adenocarcinoma(63;0.00631)|GBM - Glioblastoma multiforme(144;0.0312)										0.195122	16.393081	19.936281	8	33	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	39430390	39430390	6292	13	G	T	T	T	598	46	FREM2	2	2
NHLRC3	387921	broad.mit.edu	37	13	39621177	39621177	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:39621177G>T	uc001uxc.2	+	c.679G>T	c.(679-681)GTG>TTG	p.V227L	NHLRC3_uc001uxd.2_Missense_Mutation_p.V160L|NHLRC3_uc001uxe.2_Missense_Mutation_p.V30L	NM_001012754	NP_001012772	Q5JS37	NHLC3_HUMAN	NHL repeat containing 3 isoform a	227	NHL 3.					extracellular region					0		Lung NSC(96;6.01e-07)|Breast(139;0.00394)|Prostate(109;0.00676)|Lung SC(185;0.0548)|Hepatocellular(188;0.114)		all cancers(112;2.37e-08)|Epithelial(112;3.14e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.00101)|BRCA - Breast invasive adenocarcinoma(63;0.00335)|GBM - Glioblastoma multiforme(144;0.0128)										0.636364	62.961485	63.496351	21	12	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	39621177	39621177	10807	13	G	T	T	T	572	44	NHLRC3	2	2
MRPS31	10240	broad.mit.edu	37	13	41345263	41345263	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:41345263T>C	uc001uxm.3	-	c.10A>G	c.(10-12)AGA>GGA	p.R4G		NM_005830	NP_005821	Q92665	RT31_HUMAN	mitochondrial ribosomal protein S31 precursor	4						mitochondrion|ribosome	protein domain specific binding				0		Lung NSC(96;3.55e-06)|Breast(139;0.00394)|Prostate(109;0.0181)|Lung SC(185;0.0262)|Hepatocellular(188;0.194)		all cancers(112;1.52e-08)|Epithelial(112;7.63e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.000192)|GBM - Glioblastoma multiforme(144;0.00233)|BRCA - Breast invasive adenocarcinoma(63;0.0706)										0.390244	51.894017	52.325551	16	25	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	41345263	41345263	10234	13	T	C	C	C	687	53	MRPS31	4	4
KIAA0564	23078	broad.mit.edu	37	13	42142415	42142415	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:42142415C>A	uc001uyj.2	-	c.5636G>T	c.(5635-5637)CGG>CTG	p.R1879L		NM_015058	NP_055873	A3KMH1	K0564_HUMAN	hypothetical protein LOC23078 isoform a	1879	VWFA.					extracellular region	ATP binding|ATPase activity			ovary(3)|upper_aerodigestive_tract(1)|kidney(1)	5		Lung NSC(96;4.61e-06)|Prostate(109;0.0167)|Lung SC(185;0.0262)|Breast(139;0.0854)|Hepatocellular(98;0.114)		OV - Ovarian serous cystadenocarcinoma(117;0.000368)|GBM - Glioblastoma multiforme(144;0.0033)|BRCA - Breast invasive adenocarcinoma(63;0.0969)										0.25641	28.048778	30.135687	10	29	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	42142415	42142415	8492	13	C	A	A	A	299	23	KIAA0564	1	1
LPAR6	10161	broad.mit.edu	37	13	48986493	48986494	+	Nonsense_Mutation	DNP	TG	AT	AT			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:48986493_48986494TG>AT	uc010acu.2	-	c.66_67CA>AT	c.(64-69)TGCATG>TGATTG	p.22_23CM>*L	RB1_uc001vcb.2_Intron|LPAR6_uc001vcc.1_Intron|LPAR6_uc001vce.2_Nonsense_Mutation_p.22_23CM>*L|LPAR6_uc001vcf.2_Nonsense_Mutation_p.22_23CM>*L	NM_001162498	NP_001155970	P43657	LPAR6_HUMAN	G-protein coupled purinergic receptor P2Y5	22_23	Helical; Name=1; (Potential).					integral to membrane|plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			ovary(4)	4														0.52	82.249236	82.266551	26	24	KEEP	---	---	---	---	capture		Nonsense_Mutation	DNP	48986493	48986494	9282	13	TG	AT	AT	AT	663	51	LPAR6	5	3
PCDH17	27253	broad.mit.edu	37	13	58207410	58207410	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:58207410G>T	uc001vhq.1	+	c.730G>T	c.(730-732)GAG>TAG	p.E244*	PCDH17_uc010aec.1_Nonsense_Mutation_p.E244*	NM_001040429	NP_001035519	O14917	PCD17_HUMAN	protocadherin 17 precursor	244	Extracellular (Potential).|Cadherin 3.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding|protein binding			ovary(2)|pancreas(2)	4		Lung NSC(96;0.027)|Prostate(109;0.0453)|Breast(118;0.128)|Hepatocellular(98;0.132)		GBM - Glioblastoma multiforme(99;1.06e-05)		Melanoma(72;952 1291 1619 12849 33676)								0.5625	78.59669	78.757255	27	21	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	58207410	58207410	11932	13	G	T	T	T	481	37	PCDH17	5	1
SLITRK5	26050	broad.mit.edu	37	13	88329901	88329901	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr13:88329901C>A	uc001vln.2	+	c.2258C>A	c.(2257-2259)CCC>CAC	p.P753H	SLITRK5_uc010tic.1_Missense_Mutation_p.P512H	NM_015567	NP_056382	O94991	SLIK5_HUMAN	SLIT and NTRK-like family, member 5 precursor	753	Cytoplasmic (Potential).					integral to membrane				ovary(2)|pancreas(2)|central_nervous_system(1)	5	all_neural(89;0.101)|Medulloblastoma(90;0.163)													0.226415	25.260968	28.91673	12	41	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	88329901	88329901	15244	13	C	A	A	A	286	22	SLITRK5	2	2
LRFN5	145581	broad.mit.edu	37	14	42356124	42356124	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr14:42356124G>T	uc001wvm.2	+	c.296G>T	c.(295-297)CGA>CTA	p.R99L	LRFN5_uc010ana.2_Missense_Mutation_p.R99L	NM_152447	NP_689660	Q96NI6	LRFN5_HUMAN	leucine rich repeat and fibronectin type III	99	Extracellular (Potential).					integral to membrane				ovary(5)|pancreas(2)|central_nervous_system(1)	8			LUAD - Lung adenocarcinoma(50;0.0223)|Lung(238;0.0728)	GBM - Glioblastoma multiforme(112;0.00847)										0.247191	57.922313	63.088408	22	67	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	42356124	42356124	9314	14	G	T	T	T	481	37	LRFN5	1	1
SIX1	6495	broad.mit.edu	37	14	61113223	61113223	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr14:61113223C>A	uc001xfb.3	-	c.633G>T	c.(631-633)CCG>CCT	p.P211P		NM_005982	NP_005973	Q15475	SIX1_HUMAN	SIX homeobox 1	211					branching involved in ureteric bud morphogenesis|embryonic cranial skeleton morphogenesis|epithelial cell differentiation|inner ear morphogenesis|mesonephric tubule formation|metanephric mesenchyme development|myoblast migration|negative regulation of neuron apoptosis|organ induction|pattern specification process|positive regulation of branching involved in ureteric bud morphogenesis|positive regulation of gene-specific transcription|positive regulation of transcription from RNA polymerase II promoter|positive regulation of ureteric bud formation|protein localization to nucleus|regulation of branch elongation involved in ureteric bud branching|regulation of neuron differentiation|skeletal muscle tissue development|thymus development|thyroid gland development	nucleolus|transcription factor complex	promoter binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription activator activity				0				OV - Ovarian serous cystadenocarcinoma(108;0.0201)										0.853659	252.107613	261.978104	70	12	KEEP	---	---	---	---	capture		Silent	SNP	61113223	61113223	14841	14	C	A	A	A	340	27	SIX1	1	1
PCNX	22990	broad.mit.edu	37	14	71500153	71500153	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr14:71500153G>T	uc001xmo.2	+	c.3566G>T	c.(3565-3567)TGG>TTG	p.W1189L	PCNX_uc010are.1_Missense_Mutation_p.W1078L|PCNX_uc010arf.1_Missense_Mutation_p.W49L	NM_014982	NP_055797	Q96RV3	PCX1_HUMAN	pecanex-like 1	1189						integral to membrane				ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(12;0.206)	all cancers(60;0.00835)|BRCA - Breast invasive adenocarcinoma(234;0.00951)|OV - Ovarian serous cystadenocarcinoma(108;0.0417)										0.876289	293.694404	307.103102	85	12	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	71500153	71500153	12011	14	G	T	T	T	611	47	PCNX	2	2
TMEM63C	57156	broad.mit.edu	37	14	77715175	77715175	+	Silent	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr14:77715175G>C	uc001xtf.2	+	c.1830G>C	c.(1828-1830)GTG>GTC	p.V610V	TMEM63C_uc010asq.1_Silent_p.V610V	NM_020431	NP_065164	Q9P1W3	TM63C_HUMAN	transmembrane protein 63C	610	Helical; (Potential).					integral to membrane					0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0342)										0.165714	60.271971	78.840669	29	146	KEEP	---	---	---	---	capture		Silent	SNP	77715175	77715175	16731	14	G	C	C	C	574	45	TMEM63C	3	3
GOLGA5	9950	broad.mit.edu	37	14	93275695	93275695	+	Missense_Mutation	SNP	A	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr14:93275695A>C	uc001yaz.1	+	c.823A>C	c.(823-825)AAG>CAG	p.K275Q		NM_005113	NP_005104	Q8TBA6	GOGA5_HUMAN	Golgi autoantigen, golgin subfamily a, 5	275	Cytoplasmic (Potential).|Potential.				Golgi organization|protein phosphorylation	cis-Golgi network|integral to membrane	ATP binding|protein homodimerization activity|protein tyrosine kinase activity|Rab GTPase binding			ovary(2)|lung(1)	3		all_cancers(154;0.0934)		COAD - Colon adenocarcinoma(157;0.222)						351				0.857143	174.907486	181.778029	48	8	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	93275695	93275695	6825	14	A	C	C	C	13	1	GOLGA5	4	4
SERPINA3	12	broad.mit.edu	37	14	95088785	95088785	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr14:95088785A>G	uc001ydo.3	+	c.1100A>G	c.(1099-1101)GAC>GGC	p.D367G	SERPINA3_uc001ydr.2_Non-coding_Transcript|SERPINA3_uc001ydq.2_Missense_Mutation_p.D342G|SERPINA3_uc001ydp.2_Missense_Mutation_p.D342G|SERPINA3_uc001yds.2_Missense_Mutation_p.D342G|SERPINA3_uc010avg.2_Missense_Mutation_p.D342G	NM_001085	NP_001076	P01011	AACT_HUMAN	serpin peptidase inhibitor, clade A, member 3	342					acute-phase response|maintenance of gastrointestinal epithelium|regulation of lipid metabolic process|regulation of proteolysis	extracellular region|nucleus	DNA binding|protein binding|serine-type endopeptidase inhibitor activity			ovary(2)|central_nervous_system(2)|large_intestine(1)	5		all_cancers(154;0.0525)|all_epithelial(191;0.179)		COAD - Colon adenocarcinoma(157;0.212)|Epithelial(152;0.228)										0.923077	259.027597	270.921558	72	6	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	95088785	95088785	14578	14	A	G	G	G	130	10	SERPINA3	4	4
TARSL2	123283	broad.mit.edu	37	15	102197239	102197240	+	Splice_Site_DNP	DNP	CC	TA	TA			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:102197239_102197240CC>TA	uc002bxm.2	-	c.2146_splice	c.e18-1	p.V716_splice	TARSL2_uc002bxl.2_Splice_Site_DNP_p.W236_splice|TARSL2_uc010usi.1_Splice_Site_DNP	NM_152334	NP_689547			threonyl-tRNA synthetase-like 2						threonyl-tRNA aminoacylation	cytoplasm	ATP binding|threonine-tRNA ligase activity			ovary(2)	2	Lung NSC(78;0.000991)|all_lung(78;0.00128)|Melanoma(26;0.00505)		OV - Ovarian serous cystadenocarcinoma(32;0.000268)|LUSC - Lung squamous cell carcinoma(107;0.187)|Lung(145;0.23)											0.5	49.483894	49.483894	17	17	KEEP	---	---	---	---	capture		Splice_Site_DNP	DNP	102197239	102197240	16083	15	CC	TA	TA	TA	234	18	TARSL2	5	2
OR4M2	390538	broad.mit.edu	37	15	22369185	22369185	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:22369185G>T	uc010tzu.1	+	c.610G>T	c.(610-612)GGT>TGT	p.G204C	LOC727924_uc001yua.2_Intron|LOC727924_uc001yub.1_Intron|OR4N4_uc001yuc.1_Intron	NM_001004719	NP_001004719	Q8NGB6	OR4M2_HUMAN	olfactory receptor, family 4, subfamily M,	204	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		all_cancers(20;1.94e-20)|all_epithelial(15;3.94e-18)|Lung NSC(15;8.53e-15)|all_lung(15;2.87e-14)|Breast(32;0.00519)|Colorectal(260;0.101)	GBM - Glioblastoma multiforme(6;0.124)	all cancers(64;1.64e-11)|Epithelial(43;5.81e-10)|BRCA - Breast invasive adenocarcinoma(123;0.000255)|Kidney(6;0.00736)|KIRC - Kidney renal clear cell carcinoma(6;0.0135)|GBM - Glioblastoma multiforme(186;0.0963)										0.222707	119.496052	135.644527	51	178	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	22369185	22369185	11486	15	G	T	T	T	611	47	OR4M2	2	2
MKRN3	7681	broad.mit.edu	37	15	23812161	23812161	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:23812161C>A	uc001ywh.3	+	c.1232C>A	c.(1231-1233)CCA>CAA	p.P411Q	MKRN3_uc001ywi.2_Intron|MKRN3_uc010ayi.1_Intron	NM_005664	NP_005655	Q13064	MKRN3_HUMAN	makorin ring finger protein 3	411	C3H1-type 3.					ribonucleoprotein complex	ligase activity|nucleic acid binding|zinc ion binding			large_intestine(2)|ovary(2)	4		all_cancers(20;8.44e-25)|all_epithelial(15;3.69e-22)|Lung NSC(15;2.96e-18)|all_lung(15;2.8e-17)|Breast(32;0.000353)|Colorectal(260;0.14)		all cancers(64;3.02e-06)|Epithelial(43;1.94e-05)|BRCA - Breast invasive adenocarcinoma(123;0.0012)						79				0.173077	18.885126	24.1002	9	43	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	23812161	23812161	9998	15	C	A	A	A	273	21	MKRN3	2	2
MAGEL2	54551	broad.mit.edu	37	15	23889461	23889461	+	Silent	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:23889461G>C	uc001ywj.3	-	c.1620C>G	c.(1618-1620)GTC>GTG	p.V540V		NM_019066	NP_061939			MAGE-like protein 2												0		all_cancers(20;1.78e-24)|all_epithelial(15;7.75e-22)|Lung NSC(15;2.96e-18)|all_lung(15;2.8e-17)|Breast(32;0.000625)|Colorectal(260;0.14)		all cancers(64;1.84e-06)|Epithelial(43;1.2e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00177)										0.586207	56.380104	56.570334	17	12	KEEP	---	---	---	---	capture		Silent	SNP	23889461	23889461	9572	15	G	C	C	C	522	41	MAGEL2	3	3
RYR3	6263	broad.mit.edu	37	15	33842464	33842464	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:33842464G>T	uc001zhi.2	+	c.919G>T	c.(919-921)GAC>TAC	p.D307Y	RYR3_uc010bar.2_Missense_Mutation_p.D307Y	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	307	Cytoplasmic (By similarity).|MIR 4.				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)										0.315789	15.740867	16.315662	6	13	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	33842464	33842464	14250	15	G	T	T	T	429	33	RYR3	2	2
RYR3	6263	broad.mit.edu	37	15	33991938	33991938	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:33991938C>T	uc001zhi.2	+	c.6283C>T	c.(6283-6285)CGT>TGT	p.R2095C	RYR3_uc010bar.2_Missense_Mutation_p.R2095C	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	2095	4 X approximate repeats.|Cytoplasmic (By similarity).				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)										0.681818	50.533903	51.182146	15	7	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	33991938	33991938	14250	15	C	T	T	T	299	23	RYR3	1	1
TGM7	116179	broad.mit.edu	37	15	43572139	43572139	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:43572139C>T	uc001zrf.1	-	c.1362G>A	c.(1360-1362)GAG>GAA	p.E454E		NM_052955	NP_443187	Q96PF1	TGM7_HUMAN	transglutaminase 7	454					peptide cross-linking		acyltransferase activity|metal ion binding|protein-glutamine gamma-glutamyltransferase activity			ovary(2)	2		all_cancers(109;2.12e-14)|all_epithelial(112;1.99e-12)|Lung NSC(122;2.46e-08)|all_lung(180;2.75e-07)|Melanoma(134;0.0476)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;9.14e-07)	L-Glutamine(DB00130)									0.295455	36.073694	37.711471	13	31	KEEP	---	---	---	---	capture		Silent	SNP	43572139	43572139	16363	15	C	T	T	T	311	24	TGM7	2	2
CASC4	113201	broad.mit.edu	37	15	44630106	44630106	+	Splice_Site_SNP	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:44630106G>T	uc001ztp.2	+	c.721_splice	c.e5+1	p.E241_splice	CASC4_uc001ztq.2_Splice_Site_SNP_p.E241_splice|CASC4_uc010bdu.1_Splice_Site_SNP|CASC4_uc001zto.1_Splice_Site_SNP_p.E241_splice	NM_138423	NP_612432			cancer susceptibility candidate 4 isoform a							integral to membrane				ovary(1)	1		all_cancers(109;1.69e-13)|all_epithelial(112;3.94e-11)|Lung NSC(122;1.66e-07)|all_lung(180;1.47e-06)|Melanoma(134;0.027)		all cancers(107;2.91e-20)|GBM - Glioblastoma multiforme(94;1.57e-06)|COAD - Colon adenocarcinoma(120;0.217)|Colorectal(105;0.237)										0.4	47.411969	47.783266	16	24	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	44630106	44630106	2781	15	G	T	T	T	572	44	CASC4	5	2
ATP8B4	79895	broad.mit.edu	37	15	50226373	50226373	+	Nonsense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:50226373C>A	uc001zxu.2	-	c.1294G>T	c.(1294-1296)GAG>TAG	p.E432*	ATP8B4_uc010ber.2_Nonsense_Mutation_p.E305*|ATP8B4_uc010ufd.1_Nonsense_Mutation_p.E305*|ATP8B4_uc010ufe.1_Non-coding_Transcript	NM_024837	NP_079113	Q8TF62	AT8B4_HUMAN	ATPase class I type 8B member 4	432	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(2)|breast(2)|large_intestine(1)	5		all_lung(180;0.00183)		all cancers(107;2.41e-07)|GBM - Glioblastoma multiforme(94;8.28e-05)										0.26	31.583939	34.172164	13	37	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	50226373	50226373	1216	15	C	A	A	A	416	32	ATP8B4	5	2
HDC	3067	broad.mit.edu	37	15	50555433	50555433	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:50555433C>A	uc001zxz.2	-	c.203G>T	c.(202-204)GGG>GTG	p.G68V	HDC_uc010uff.1_Missense_Mutation_p.G68V|HDC_uc010bet.1_Missense_Mutation_p.G68V|HDC_uc010beu.1_Missense_Mutation_p.G68V	NM_002112	NP_002103	P19113	DCHS_HUMAN	histidine decarboxylase	68					catecholamine biosynthetic process|histidine metabolic process		histidine decarboxylase activity			large_intestine(2)|central_nervous_system(1)	3		all_lung(180;0.0138)		all cancers(107;1.12e-06)|GBM - Glioblastoma multiforme(94;9.95e-05)	L-Histidine(DB00117)|Pyridoxal Phosphate(DB00114)	GBM(95;1627 1936 6910 9570)								0.186992	45.806434	57.070358	23	100	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	50555433	50555433	7298	15	C	A	A	A	286	22	HDC	2	2
AP4E1	23431	broad.mit.edu	37	15	51201079	51201079	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:51201079G>T	uc001zyx.1	+	c.104G>T	c.(103-105)AGG>ATG	p.R35M	AP4E1_uc010ufi.1_Missense_Mutation_p.R35M|AP4E1_uc010ufj.1_Non-coding_Transcript|AP4E1_uc010ufk.1_Non-coding_Transcript	NM_007347	NP_031373	Q9UPM8	AP4E1_HUMAN	adaptor-related protein complex 4, epsilon 1	35					intracellular protein transport|vesicle-mediated transport	COPI vesicle coat	binding|structural molecule activity				0				all cancers(107;0.000893)|GBM - Glioblastoma multiforme(94;0.00364)										0.733333	35.030039	35.76716	11	4	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	51201079	51201079	762	15	G	T	T	T	455	35	AP4E1	2	2
LBXCOR1	390598	broad.mit.edu	37	15	68119376	68119376	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:68119376G>T	uc002aqy.1	+	c.1078G>T	c.(1078-1080)GGC>TGC	p.G360C		NM_001031807	NP_001026977	P84550	SKOR1_HUMAN	transcriptional corepressor Corl1	404					negative regulation of BMP signaling pathway|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transforming growth factor beta receptor signaling pathway|transcription, DNA-dependent	cytoplasm|dendrite|neuronal cell body|nucleus	nucleotide binding|SMAD binding|transcription repressor activity				0														0.28	18.319557	19.404709	7	18	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	68119376	68119376	8978	15	G	T	T	T	507	39	LBXCOR1	1	1
NOX5	79400	broad.mit.edu	37	15	69327796	69327796	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:69327796G>T	uc002ars.1	+	c.958G>T	c.(958-960)GTG>TTG	p.V320L	NOX5_uc002arp.1_Missense_Mutation_p.V302L|NOX5_uc002arq.1_Missense_Mutation_p.V274L|NOX5_uc010bid.1_Missense_Mutation_p.V285L|NOX5_uc002arr.1_Missense_Mutation_p.V292L|NOX5_uc010bie.1_Missense_Mutation_p.V120L|NOX5_uc010bif.1_Non-coding_Transcript	NM_024505	NP_078781	Q96PH1	NOX5_HUMAN	NADPH oxidase, EF-hand calcium binding domain 5	320	Ferric oxidoreductase.|Helical; (Potential).				angiogenesis|angiogenesis|cytokine secretion|cytokinesis|electron transport chain|endothelial cell proliferation|induction of apoptosis|positive regulation of reactive oxygen species metabolic process|regulation of fusion of sperm to egg plasma membrane|regulation of proton transport|superoxide anion generation	endoplasmic reticulum|endoplasmic reticulum|integral to membrane	calcium ion binding|electron carrier activity|flavin adenine dinucleotide binding|heme binding|hydrogen ion channel activity|NADP binding|superoxide-generating NADPH oxidase activity			breast(1)|pancreas(1)	2														0.512821	69.714867	69.721134	20	19	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	69327796	69327796	10963	15	G	T	T	T	520	40	NOX5	1	1
MYO9A	4649	broad.mit.edu	37	15	72208825	72208825	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:72208825T>C	uc002atl.3	-	c.2571A>G	c.(2569-2571)CTA>CTG	p.L857L	MYO9A_uc010biq.2_Silent_p.L477L|MYO9A_uc002atn.1_Silent_p.L838L	NM_006901	NP_008832	B2RTY4	MYO9A_HUMAN	myosin IXA	857					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction|visual perception	cytosol|integral to membrane|unconventional myosin complex	actin binding|ATP binding|GTPase activator activity|metal ion binding|motor activity			ovary(1)|pancreas(1)|skin(1)	3														0.459016	95.70945	95.796199	28	33	KEEP	---	---	---	---	capture		Silent	SNP	72208825	72208825	10479	15	T	C	C	C	678	53	MYO9A	4	4
NEO1	4756	broad.mit.edu	37	15	73409019	73409019	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:73409019G>A	uc002avm.3	+	c.269G>A	c.(268-270)GGA>GAA	p.G90E	NEO1_uc010ukx.1_Missense_Mutation_p.G90E|NEO1_uc010uky.1_Missense_Mutation_p.G90E|NEO1_uc010ukz.1_5'UTR	NM_002499	NP_002490	Q92859	NEO1_HUMAN	neogenin homolog 1 precursor	90	Extracellular (Potential).|Ig-like C2-type 1.				axon guidance|cell adhesion|positive regulation of muscle cell differentiation	Golgi apparatus|integral to plasma membrane|nucleus				pancreas(1)	1														0.25	82.346179	89.613539	32	96	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	73409019	73409019	10735	15	G	A	A	A	533	41	NEO1	2	2
KIAA1199	57214	broad.mit.edu	37	15	81188358	81188358	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:81188358G>T	uc002bfw.1	+	c.1368G>T	c.(1366-1368)GTG>GTT	p.V456V	KIAA1199_uc010unn.1_Silent_p.V456V	NM_018689	NP_061159	Q8WUJ3	K1199_HUMAN	KIAA1199 precursor	456										ovary(1)	1														0.333333	67.194471	68.956628	24	48	KEEP	---	---	---	---	capture		Silent	SNP	81188358	81188358	8521	15	G	T	T	T	587	46	KIAA1199	2	2
ADAMTSL3	57188	broad.mit.edu	37	15	84373230	84373230	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:84373230G>T	uc002bjz.3	+	c.159G>T	c.(157-159)GAG>GAT	p.E53D	ADAMTSL3_uc002bjy.1_Missense_Mutation_p.E53D|ADAMTSL3_uc010bmt.1_Missense_Mutation_p.E53D|ADAMTSL3_uc010bmu.1_Missense_Mutation_p.E53D	NM_207517	NP_997400	P82987	ATL3_HUMAN	ADAMTS-like 3 precursor	53						proteinaceous extracellular matrix	metallopeptidase activity|zinc ion binding			central_nervous_system(5)|ovary(5)|large_intestine(4)|lung(1)|breast(1)|kidney(1)|pancreas(1)	18			BRCA - Breast invasive adenocarcinoma(143;0.211)							580				0.545455	258.360186	258.623655	84	70	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	84373230	84373230	277	15	G	T	T	T	438	34	ADAMTSL3	2	2
AKAP13	11214	broad.mit.edu	37	15	86236676	86236676	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:86236676T>A	uc002blu.1	+	c.5470T>A	c.(5470-5472)TGT>AGT	p.C1824S	AKAP13_uc002blv.1_Missense_Mutation_p.C1820S|AKAP13_uc010bnf.1_Missense_Mutation_p.C442S|AKAP13_uc002blw.1_Missense_Mutation_p.C287S|AKAP13_uc002blx.1_Missense_Mutation_p.C65S	NM_006738	NP_006729	Q12802	AKP13_HUMAN	A-kinase anchor protein 13 isoform 1	1820	Phorbol-ester/DAG-type.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|membrane|membrane fraction|nucleus	cAMP-dependent protein kinase activity|metal ion binding|protein binding|Rho guanyl-nucleotide exchange factor activity|signal transducer activity			central_nervous_system(3)|kidney(2)|urinary_tract(1)|ovary(1)|liver(1)	8						Melanoma(94;603 1453 3280 32295 32951)								0.325301	84.298445	86.544996	27	56	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	86236676	86236676	452	15	T	A	A	A	819	63	AKAP13	3	3
NTRK3	4916	broad.mit.edu	37	15	88679745	88679745	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:88679745C>G	uc002bme.1	-	c.718G>C	c.(718-720)GAT>CAT	p.D240H	NTRK3_uc002bmh.2_Missense_Mutation_p.D240H|NTRK3_uc002bmf.1_Missense_Mutation_p.D240H|NTRK3_uc010upl.1_Missense_Mutation_p.D142H|NTRK3_uc010bnh.1_Missense_Mutation_p.D240H|NTRK3_uc002bmg.2_Missense_Mutation_p.D240H	NM_001012338	NP_001012338	Q16288	NTRK3_HUMAN	neurotrophic tyrosine kinase, receptor, type 3	240	Ig-like C2-type 1.|Extracellular (Potential).				transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|transmembrane receptor protein tyrosine kinase activity		ETV6/NTRK3(234)	soft_tissue(85)|kidney(66)|breast(56)|salivary_gland(26)|lung(13)|ovary(5)|central_nervous_system(3)|haematopoietic_and_lymphoid_tissue(2)|stomach(1)|skin(1)|pancreas(1)	259			BRCA - Breast invasive adenocarcinoma(143;0.211)							506	TSP Lung(13;0.10)			0.535714	53.427226	53.458274	15	13	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	88679745	88679745	11113	15	C	G	G	G	377	29	NTRK3	3	3
POLG	5428	broad.mit.edu	37	15	89867077	89867077	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:89867077C>A	uc002bns.3	-	c.2126G>T	c.(2125-2127)CGA>CTA	p.R709L	POLG_uc002bnr.3_Missense_Mutation_p.R709L	NM_002693	NP_002684	P54098	DPOG1_HUMAN	DNA-directed DNA polymerase gamma	709					base-excision repair, gap-filling|DNA-dependent DNA replication	mitochondrial nucleoid	DNA binding|DNA-directed DNA polymerase activity|protease binding			ovary(1)|lung(1)	2	Lung NSC(78;0.0472)|all_lung(78;0.089)		STAD - Stomach adenocarcinoma(125;0.165)			Colon(73;648 1203 11348 18386 27782)								0.15	12.52693	17.221165	6	34	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	89867077	89867077	12628	15	C	A	A	A	403	31	POLG	1	1
SV2B	9899	broad.mit.edu	37	15	91769503	91769503	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:91769503T>C	uc002bqv.2	+	c.10T>C	c.(10-12)TAC>CAC	p.Y4H	SV2B_uc002bqt.2_Missense_Mutation_p.Y4H|SV2B_uc010uqv.1_Intron|SV2B_uc002bqu.3_Non-coding_Transcript	NM_014848	NP_055663	Q7L1I2	SV2B_HUMAN	synaptic vesicle protein 2B homolog	4	Cytoplasmic (Potential).				neurotransmitter transport|transmembrane transport	acrosomal vesicle|cell junction|integral to membrane|synaptic vesicle membrane	transporter activity			ovary(3)|central_nervous_system(2)	5	Lung NSC(78;0.0987)|all_lung(78;0.172)		BRCA - Breast invasive adenocarcinoma(143;0.0895)											0.47619	31.348801	31.359089	10	11	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	91769503	91769503	15938	15	T	C	C	C	689	53	SV2B	4	4
GTF3C1	2975	broad.mit.edu	37	16	27499558	27499558	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:27499558T>A	uc002dov.1	-	c.3690A>T	c.(3688-3690)AGA>AGT	p.R1230S	GTF3C1_uc002dou.2_Missense_Mutation_p.R1230S	NM_001520	NP_001511	Q12789	TF3C1_HUMAN	general transcription factor IIIC, polypeptide	1230	Arg/Lys-rich (basic).				5S class rRNA transcription from RNA polymerase III type 1 promoter|tRNA transcription from RNA polymerase III promoter	transcription factor TFIIIC complex	DNA binding|protein binding			ovary(2)|breast(1)|pancreas(1)	4														0.282258	84.063482	89.353032	35	89	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	27499558	27499558	7152	16	T	A	A	A	803	62	GTF3C1	3	3
PRSS36	146547	broad.mit.edu	37	16	31157191	31157191	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:31157191G>A	uc002ebd.2	-	c.639C>T	c.(637-639)CCC>CCT	p.P213P	PRSS36_uc010vff.1_5'UTR|PRSS36_uc010vfg.1_Silent_p.P213P|PRSS36_uc010vfh.1_Silent_p.P213P	NM_173502	NP_775773	Q5K4E3	POLS2_HUMAN	protease, serine, 36 precursor	213	Peptidase S1 1.				proteolysis	cytoplasm|proteinaceous extracellular matrix	serine-type endopeptidase activity			ovary(1)	1														0.5	83.835831	83.835831	26	26	KEEP	---	---	---	---	capture		Silent	SNP	31157191	31157191	13075	16	G	A	A	A	496	39	PRSS36	1	1
ITGAD	3681	broad.mit.edu	37	16	31414948	31414948	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:31414948C>A	uc010cap.1	+	c.686C>A	c.(685-687)ACG>AAG	p.T229K	ITGAD_uc010vfl.1_Missense_Mutation_p.T229K|ITGAD_uc002ebv.1_Missense_Mutation_p.T229K|ITGAD_uc002ebw.1_Missense_Mutation_p.T40K	NM_005353	NP_005344	Q13349	ITAD_HUMAN	integrin, alpha D precursor	229	Extracellular (Potential).|VWFA.				cell-cell adhesion|cell-matrix adhesion|immune response|integrin-mediated signaling pathway	integrin complex	receptor activity			skin(1)	1														0.55102	86.422552	86.534452	27	22	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	31414948	31414948	8188	16	C	A	A	A	247	19	ITGAD	1	1
VASN	114990	broad.mit.edu	37	16	4431769	4431769	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:4431769C>T	uc002cwj.1	+	c.891C>T	c.(889-891)CGC>CGT	p.R297R	CORO7_uc002cwe.2_Intron|CORO7_uc002cwf.2_Intron|CORO7_uc002cwg.3_Intron|CORO7_uc002cwh.3_Intron|CORO7_uc010uxh.1_Intron|CORO7_uc010uxi.1_Intron|CORO7_uc002cwi.1_Intron|CORO7_uc010uxj.1_Intron|CORO7_uc010btp.1_Intron	NM_138440	NP_612449	Q6EMK4	VASN_HUMAN	slit-like 2 precursor	297	Extracellular (Potential).					extracellular region|integral to membrane					0														0.225	15.311398	18.058709	9	31	KEEP	---	---	---	---	capture		Silent	SNP	4431769	4431769	17692	16	C	T	T	T	314	25	VASN	2	2
ABCC12	94160	broad.mit.edu	37	16	48145573	48145573	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:48145573C>A	uc002efc.1	-	c.2125G>T	c.(2125-2127)GAT>TAT	p.D709Y	ABCC12_uc002eey.1_Non-coding_Transcript|ABCC12_uc002eez.1_Non-coding_Transcript|ABCC12_uc002efa.1_Non-coding_Transcript|ABCC12_uc002efb.1_Non-coding_Transcript|ABCC12_uc002efd.1_Non-coding_Transcript	NM_033226	NP_150229	Q96J65	MRP9_HUMAN	ATP-binding cassette protein C12	709						integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(2)	2		all_cancers(37;0.0474)|all_lung(18;0.047)												0.265537	107.93702	116.7437	47	130	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	48145573	48145573	53	16	C	A	A	A	390	30	ABCC12	2	2
NFATC3	4775	broad.mit.edu	37	16	68156481	68156481	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:68156481G>T	uc002evo.1	+	c.695G>T	c.(694-696)GGA>GTA	p.G232V	NFATC3_uc010vkl.1_5'UTR|NFATC3_uc010vkm.1_5'UTR|NFATC3_uc010vkn.1_5'UTR|NFATC3_uc010vko.1_5'UTR|NFATC3_uc010vkp.1_5'UTR|NFATC3_uc010vkq.1_5'UTR|NFATC3_uc002evl.2_Intron|NFATC3_uc002evk.2_Missense_Mutation_p.G232V|NFATC3_uc002evm.1_Missense_Mutation_p.G232V|NFATC3_uc002evn.1_Missense_Mutation_p.G232V|NFATC3_uc010vkr.1_5'UTR|NFATC3_uc010vks.1_5'UTR|NFATC3_uc010vkt.1_5'UTR|NFATC3_uc010vku.1_5'UTR|NFATC3_uc010vkv.1_5'UTR|NFATC3_uc010vkw.1_5'UTR|NFATC3_uc010vkx.1_5'UTR|NFATC3_uc010vky.1_5'UTR|NFATC3_uc010vkz.1_5'UTR|NFATC3_uc010vla.1_5'UTR|NFATC3_uc010vlb.1_5'UTR|NFATC3_uc010vlc.1_5'UTR	NM_173165	NP_775188	Q12968	NFAC3_HUMAN	nuclear factor of activated T-cells,	232	3 X SP repeats.				inflammatory response|transcription from RNA polymerase II promoter	nucleolus|plasma membrane	DNA binding			central_nervous_system(1)|pancreas(1)	2		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0119)|Epithelial(162;0.0452)|all cancers(182;0.24)										0.210526	26.073953	30.489358	12	45	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	68156481	68156481	10764	16	G	T	T	T	533	41	NFATC3	2	2
HYDIN	54768	broad.mit.edu	37	16	70908242	70908242	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:70908242G>T	uc002ezr.2	-	c.10911C>A	c.(10909-10911)ATC>ATA	p.I3637I		NM_032821	NP_116210	Q4G0P3	HYDIN_HUMAN	hydrocephalus inducing isoform a	3638										ovary(1)	1		Ovarian(137;0.0654)												0.138889	22.194166	35.771954	15	93	KEEP	---	---	---	---	capture		Silent	SNP	70908242	70908242	7767	16	G	T	T	T	577	45	HYDIN	2	2
ZNF19	7567	broad.mit.edu	37	16	71512219	71512219	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:71512219C>A	uc010cgc.1	-	c.186G>T	c.(184-186)CTG>CTT	p.L62L	ZNF23_uc002fai.2_5'UTR|ZNF19_uc002fak.1_Silent_p.L50L|ZNF19_uc002fal.1_Silent_p.L50L|ZNF19_uc002fam.1_Silent_p.L62L	NM_006961	NP_008892	P17023	ZNF19_HUMAN	zinc finger protein 19	62	KRAB.				regulation of transcription, DNA-dependent	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Ovarian(137;0.00965)		BRCA - Breast invasive adenocarcinoma(221;0.0161)|Kidney(780;0.0598)										0.347826	22.292207	22.762678	8	15	KEEP	---	---	---	---	capture		Silent	SNP	71512219	71512219	18346	16	C	A	A	A	366	29	ZNF19	2	2
RFWD3	55159	broad.mit.edu	37	16	74685929	74685929	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:74685929C>A	uc002fda.2	-	c.610G>T	c.(610-612)GTA>TTA	p.V204L	RFWD3_uc010cgq.2_Missense_Mutation_p.V204L	NM_018124	NP_060594	Q6PCD5	RFWD3_HUMAN	ring finger and WD repeat domain 3	204					DNA repair|mitotic cell cycle G1/S transition DNA damage checkpoint|response to ionizing radiation	nucleus	MDM2 binding|p53 binding|ubiquitin-protein ligase activity|zinc ion binding				0														0.192982	24.624121	29.615432	11	46	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	74685929	74685929	13733	16	C	A	A	A	221	17	RFWD3	2	2
PLCG2	5336	broad.mit.edu	37	16	81888159	81888159	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:81888159A>T	uc002fgt.2	+	c.304A>T	c.(304-306)ACT>TCT	p.T102S	PLCG2_uc010chg.1_Missense_Mutation_p.T102S	NM_002661	NP_002652	P16885	PLCG2_HUMAN	phospholipase C, gamma 2	102	PH.				intracellular signal transduction|phospholipid catabolic process|platelet activation	plasma membrane	phosphatidylinositol phospholipase C activity|protein binding|signal transducer activity			large_intestine(4)|lung(2)|ovary(1)|skin(1)	8										1880				0.586957	181.956159	182.564978	54	38	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	81888159	81888159	12462	16	A	T	T	T	78	6	PLCG2	3	3
PLCG2	5336	broad.mit.edu	37	16	81925085	81925085	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:81925085G>A	uc002fgt.2	+	c.876G>A	c.(874-876)ACG>ACA	p.T292T	PLCG2_uc010chg.1_Silent_p.T292T	NM_002661	NP_002652	P16885	PLCG2_HUMAN	phospholipase C, gamma 2	292					intracellular signal transduction|phospholipid catabolic process|platelet activation	plasma membrane	phosphatidylinositol phospholipase C activity|protein binding|signal transducer activity			large_intestine(4)|lung(2)|ovary(1)|skin(1)	8										1880				0.214286	14.536732	16.645763	6	22	KEEP	---	---	---	---	capture		Silent	SNP	81925085	81925085	12462	16	G	A	A	A	509	40	PLCG2	1	1
SLC38A8	146167	broad.mit.edu	37	16	84067060	84067060	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:84067060G>T	uc002fhg.1	-	c.403C>A	c.(403-405)CTG>ATG	p.L135M		NM_001080442	NP_001073911	A6NNN8	S38A8_HUMAN	solute carrier family 38, member 8	135					amino acid transport|sodium ion transport	integral to membrane					0														0.48	73.298762	73.316001	24	26	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	84067060	84067060	15107	16	G	T	T	T	451	35	SLC38A8	2	2
ADAD2	161931	broad.mit.edu	37	16	84230345	84230345	+	Missense_Mutation	SNP	T	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:84230345T>G	uc002fhq.2	+	c.1865T>G	c.(1864-1866)CTG>CGG	p.L622R	ADAD2_uc002fhr.2_Missense_Mutation_p.L540R	NM_139174	NP_631913	Q8NCV1	ADAD2_HUMAN	adenosine deaminase domain containing 2 isoform	540	A to I editase.				RNA processing	intracellular	adenosine deaminase activity|double-stranded RNA binding				0														0.145161	15.346412	22.846811	9	53	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	84230345	84230345	233	16	T	G	G	G	715	55	ADAD2	4	4
FOXC2	2303	broad.mit.edu	37	16	86601557	86601557	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:86601557G>C	uc002fjq.2	+	c.616G>C	c.(616-618)GAG>CAG	p.E206Q		NM_005251	NP_005242	Q99958	FOXC2_HUMAN	forkhead box C2	206					anti-apoptosis|artery morphogenesis|blood vessel remodeling|camera-type eye development|cardiac muscle cell proliferation|collagen fibril organization|embryonic heart tube development|embryonic viscerocranium morphogenesis|insulin receptor signaling pathway|lymphangiogenesis|metanephros development|negative regulation of gene-specific transcription from RNA polymerase II promoter|neural crest cell fate commitment|Notch signaling pathway|ossification|paraxial mesodermal cell fate commitment|patterning of blood vessels|positive regulation of cell adhesion mediated by integrin|positive regulation of cell migration involved in sprouting angiogenesis|positive regulation of gene-specific transcription from RNA polymerase II promoter|positive regulation of vascular wound healing|regulation of blood vessel size|regulation of organ growth|regulation of sequence-specific DNA binding transcription factor activity|somitogenesis|ureteric bud development|vascular endothelial growth factor receptor signaling pathway|vasculogenesis|ventricular cardiac muscle tissue morphogenesis	transcription factor complex	chromatin DNA binding|DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding				0														0.26087	17.445326	18.631896	6	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	86601557	86601557	6237	16	G	C	C	C	533	41	FOXC2	3	3
DEF8	54849	broad.mit.edu	37	16	90032312	90032312	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:90032312C>T	uc002fpn.1	+	c.1480C>T	c.(1480-1482)CGG>TGG	p.R494W	DEF8_uc002fpo.1_Missense_Mutation_p.R433W|DEF8_uc002fpp.1_Missense_Mutation_p.R423W|DEF8_uc010vpq.1_Missense_Mutation_p.R373W|DEF8_uc010vpr.1_Missense_Mutation_p.R416W|DEF8_uc002fpq.1_Missense_Mutation_p.R191W	NM_207514	NP_997397	Q6ZN54	DEFI8_HUMAN	differentially expressed in FDCP 8 isoform 1	494					intracellular signal transduction		zinc ion binding			central_nervous_system(1)	1		all_cancers(9;7.59e-13)|Lung NSC(15;1.56e-06)|all_lung(18;2.18e-06)|all_neural(9;0.0019)|all_hematologic(23;0.0194)		BRCA - Breast invasive adenocarcinoma(80;0.0274)										0.227273	12.56403	14.065446	5	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	90032312	90032312	4558	16	C	T	T	T	295	23	DEF8	1	1
AKAP10	11216	broad.mit.edu	37	17	19861631	19861631	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:19861631C>A	uc002gwo.2	-	c.573G>T	c.(571-573)AAG>AAT	p.K191N	AKAP10_uc002gwp.1_Missense_Mutation_p.K191N|AKAP10_uc010cqw.1_Missense_Mutation_p.K191N|AKAP10_uc010vze.1_Missense_Mutation_p.K112N	NM_007202	NP_009133	O43572	AKA10_HUMAN	A-kinase anchor protein 10 precursor	191	RGS 1.				blood coagulation|protein localization	cytosol|mitochondrion|plasma membrane	signal transducer activity			skin(1)	1	all_cancers(12;2.08e-05)|all_epithelial(12;0.00158)|Breast(13;0.165)													0.771429	90.039702	92.403116	27	8	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	19861631	19861631	449	17	C	A	A	A	363	28	AKAP10	2	2
UNC45B	146862	broad.mit.edu	37	17	33491042	33491042	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:33491042G>T	uc002hja.2	+	c.1008G>T	c.(1006-1008)GGG>GGT	p.G336G	UNC45B_uc002hjb.2_Silent_p.G336G|UNC45B_uc002hjc.2_Silent_p.G336G|UNC45B_uc010cto.2_Silent_p.G336G	NM_173167	NP_775259	Q8IWX7	UN45B_HUMAN	cardiomyopathy associated 4 isoform 1	336					cell differentiation|muscle organ development		binding			ovary(3)|central_nervous_system(2)|breast(1)	6		Ovarian(249;0.17)												0.705357	232.807745	237.058326	79	33	KEEP	---	---	---	---	capture		Silent	SNP	33491042	33491042	17547	17	G	T	T	T	535	42	UNC45B	2	2
ERBB2	2064	broad.mit.edu	37	17	37865605	37865605	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:37865605C>T	uc002hso.2	+	c.474C>T	c.(472-474)AAC>AAT	p.N158N	ERBB2_uc002hsm.2_Silent_p.N128N|ERBB2_uc010cwa.2_Silent_p.N143N|ERBB2_uc002hsp.2_5'UTR|ERBB2_uc010cwb.2_Silent_p.N158N|ERBB2_uc010wek.1_Intron|ERBB2_uc002hsl.2_Silent_p.N128N|ERBB2_uc002hsn.1_Silent_p.N158N	NM_004448	NP_004439	P04626	ERBB2_HUMAN	erbB-2 isoform a	158	Extracellular (Potential).				cell proliferation|heart development|phosphatidylinositol 3-kinase cascade|phosphatidylinositol-mediated signaling|positive regulation of cell adhesion|positive regulation of epithelial cell proliferation|positive regulation of MAP kinase activity|protein autophosphorylation|regulation of angiogenesis|regulation of transcription, DNA-dependent|transcription, DNA-dependent|wound healing	integral to membrane|nucleus|perinuclear region of cytoplasm|receptor complex	ATP binding|DNA binding|epidermal growth factor receptor activity|ErbB-3 class receptor binding|identical protein binding|protein C-terminus binding|protein heterodimerization activity|protein phosphatase binding|receptor signaling protein tyrosine kinase activity			lung(71)|central_nervous_system(16)|ovary(13)|stomach(12)|breast(5)|upper_aerodigestive_tract(4)|large_intestine(3)|liver(3)|endometrium(2)|pancreas(1)	130	all_cancers(6;1.06e-93)|all_epithelial(6;2.33e-113)|Breast(7;9.37e-100)|Lung NSC(9;9.76e-10)|all_lung(9;5.34e-09)|Colorectal(19;0.000442)|Esophageal squamous(10;0.052)	Ovarian(249;0.0547)|Colorectal(1115;0.234)	UCEC - Uterine corpus endometrioid carcinoma (11;0.000126)|Epithelial(3;9.42e-64)|all cancers(3;5.61e-57)|BRCA - Breast invasive adenocarcinoma(8;2.5e-45)|STAD - Stomach adenocarcinoma(3;9.03e-13)|Colorectal(5;6.23e-08)|COAD - Colon adenocarcinoma(5;8.58e-06)|Lung(15;0.00193)|LUAD - Lung adenocarcinoma(14;0.0664)|OV - Ovarian serous cystadenocarcinoma(8;0.0917)|LUSC - Lung squamous cell carcinoma(15;0.171)	UCEC - Uterine corpus endometrioid carcinoma (308;0.0767)	Lapatinib(DB01259)|Letrozole(DB01006)|Trastuzumab(DB00072)			1		271	TCGA GBM(5;<1E-8)			0.428571	60.444309	60.664467	21	28	KEEP	---	---	---	---	capture		Silent	SNP	37865605	37865605	5399	17	C	T	T	T	233	18	ERBB2	2	2
KRT23	25984	broad.mit.edu	37	17	39092632	39092632	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:39092632G>T	uc002hvm.1	-	c.224C>A	c.(223-225)ACC>AAC	p.T75N	KRT23_uc010wfl.1_Intron|KRT23_uc010cxf.1_Intron|KRT23_uc010cxg.2_Missense_Mutation_p.T75N|KRT23_uc002hvn.1_Missense_Mutation_p.T75N	NM_015515	NP_056330	Q9C075	K1C23_HUMAN	keratin 23	75	Rod.|Coil 1A.					intermediate filament	structural molecule activity			ovary(1)	1		Breast(137;0.000301)|Ovarian(249;0.15)												0.762376	256.055821	262.388634	77	24	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	39092632	39092632	8775	17	G	T	T	T	572	44	KRT23	2	2
KAT2A	2648	broad.mit.edu	37	17	40271406	40271406	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:40271406G>A	uc002hyx.2	-	c.930C>T	c.(928-930)CGC>CGT	p.R310R		NM_021078	NP_066564	Q92830	KAT2A_HUMAN	general control of amino acid synthesis 5-like	310					chromatin remodeling|histone deubiquitination|interspecies interaction between organisms|regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	Ada2/Gcn5/Ada3 transcription activator complex|STAGA complex|transcription factor TFTC complex	H3 histone acetyltransferase activity|histone deacetylase binding|protein binding|transcription coactivator activity				0														0.717949	179.543949	182.906196	56	22	KEEP	---	---	---	---	capture		Silent	SNP	40271406	40271406	8285	17	G	A	A	A	431	34	KAT2A	2	2
MPP3	4356	broad.mit.edu	37	17	41909256	41909256	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:41909256C>G	uc002ieh.2	-	c.94G>C	c.(94-96)GAC>CAC	p.D32H	MPP3_uc002iei.3_Missense_Mutation_p.D7H|MPP3_uc002iej.2_Non-coding_Transcript|MPP3_uc010czi.1_Missense_Mutation_p.D7H|MPP3_uc010wik.1_Missense_Mutation_p.D32H|MPP3_uc010czj.1_Missense_Mutation_p.D7H	NM_001932	NP_001923	Q13368	MPP3_HUMAN	palmitoylated membrane protein 3	7	L27 1.				signal transduction	cell surface|integral to plasma membrane	guanylate kinase activity			large_intestine(1)	1		Breast(137;0.00394)		BRCA - Breast invasive adenocarcinoma(366;0.119)										0.666667	32.749563	33.117298	10	5	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	41909256	41909256	10127	17	C	G	G	G	390	30	MPP3	3	3
OSBPL7	114881	broad.mit.edu	37	17	45893993	45893993	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:45893993G>A	uc002ilx.1	-	c.864C>T	c.(862-864)ACC>ACT	p.T288T	OSBPL7_uc002ilw.1_5'UTR	NM_145798	NP_665741	Q9BZF2	OSBL7_HUMAN	oxysterol-binding protein-like protein 7	288					lipid transport		lipid binding				0														0.84	71.78993	74.541684	21	4	KEEP	---	---	---	---	capture		Silent	SNP	45893993	45893993	11693	17	G	A	A	A	548	43	OSBPL7	2	2
KIF2B	84643	broad.mit.edu	37	17	51900573	51900573	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:51900573G>T	uc002iua.2	+	c.179G>T	c.(178-180)TGG>TTG	p.W60L		NM_032559	NP_115948	Q8N4N8	KIF2B_HUMAN	kinesin family member 2B	60					blood coagulation|cell division|microtubule depolymerization|microtubule-based movement|mitotic prometaphase|regulation of chromosome segregation	condensed chromosome kinetochore|cytosol|microtubule|microtubule organizing center|nucleolus|spindle	ATP binding|microtubule motor activity			ovary(5)	5														0.784615	155.622415	160.426526	51	14	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	51900573	51900573	8609	17	G	T	T	T	611	47	KIF2B	2	2
MMD	23531	broad.mit.edu	37	17	53471758	53471758	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:53471758C>A	uc002iui.2	-	c.654G>T	c.(652-654)GTG>GTT	p.V218V		NM_012329	NP_036461	Q15546	PAQRB_HUMAN	monocyte to macrophage	218	Helical; (Potential).				cytolysis	integral to plasma membrane|late endosome membrane|lysosomal membrane|membrane fraction	receptor activity				0														0.775	200.179586	205.748875	62	18	KEEP	---	---	---	---	capture		Silent	SNP	53471758	53471758	10033	17	C	A	A	A	314	25	MMD	2	2
LPO	4025	broad.mit.edu	37	17	56343529	56343529	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:56343529T>A	uc002ivt.2	+	c.1535T>A	c.(1534-1536)CTG>CAG	p.L512Q	LPO_uc010wns.1_Missense_Mutation_p.L453Q|LPO_uc010dcp.2_Missense_Mutation_p.L429Q|LPO_uc010dcq.2_Missense_Mutation_p.L183Q|LPO_uc010dcr.2_Missense_Mutation_p.L75Q	NM_006151	NP_006142	P22079	PERL_HUMAN	lactoperoxidase isoform 1 preproprotein	512					hydrogen peroxide catabolic process|oxidation-reduction process	extracellular space	heme binding|peroxidase activity			ovary(1)|breast(1)	2														0.714286	33.355454	33.932317	10	4	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	56343529	56343529	9295	17	T	A	A	A	715	55	LPO	3	3
SCN4A	6329	broad.mit.edu	37	17	62018356	62018356	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:62018356C>A	uc002jds.1	-	c.5286G>T	c.(5284-5286)GGG>GGT	p.G1762G		NM_000334	NP_000325	P35499	SCN4A_HUMAN	voltage-gated sodium channel type 4 alpha	1762					muscle contraction	voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(1)|pancreas(1)|skin(1)	3					Lamotrigine(DB00555)									0.6875	96.965718	98.46047	33	15	KEEP	---	---	---	---	capture		Silent	SNP	62018356	62018356	14402	17	C	A	A	A	275	22	SCN4A	2	2
TP53	7157	broad.mit.edu	37	17	7577100	7577100	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:7577100T>C	uc002gim.2	-	c.838A>G	c.(838-840)AGA>GGA	p.R280G	TP53_uc002gig.1_Intron|TP53_uc002gih.2_Missense_Mutation_p.R280G|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Missense_Mutation_p.R148G|TP53_uc010cng.1_Missense_Mutation_p.R148G|TP53_uc002gii.1_Missense_Mutation_p.R148G|TP53_uc010cnh.1_Missense_Mutation_p.R280G|TP53_uc010cni.1_Missense_Mutation_p.R280G|TP53_uc002gij.2_Missense_Mutation_p.R280G	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	280	Interaction with DNA.||Interaction with E4F1.|Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).		R -> T (in sporadic cancers; somatic mutation).|R -> G (in sporadic cancers; somatic mutation).|R -> K (in a familial cancer not matching LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> P (in a sporadic cancer; somatic mutation).|R -> I (in sporadic cancers; somatic mutation).|R -> S (in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of gene-specific transcription from RNA polymerase II promoter|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of gene-specific transcription from RNA polymerase II promoter|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	chromatin|cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|promoter binding|promoter binding|protease binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|sequence-specific DNA binding transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding|ubiquitin protein ligase binding|zinc ion binding	p.R280G(15)|p.R280*(8)|p.0?(6)|p.?(2)|p.G279fs*65(2)|p.R280_D281delRD(2)|p.A276_R283delACPGRDRR(1)|p.C275fs*20(1)|p.A276fs*64(1)|p.L265_K305del41(1)|p.G279_R280delGR(1)|p.F270_D281del12(1)|p.G279fs*59(1)|p.R280fs*65(1)|p.R280fs*62(1)|p.S269fs*21(1)|p.V272_K292del21(1)|p.C275_R283delCACPGRDRR(1)		large_intestine(4614)|breast(2344)|upper_aerodigestive_tract(2150)|lung(1958)|ovary(1559)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1212)|stomach(1127)|urinary_tract(1113)|central_nervous_system(1072)|liver(805)|skin(693)|pancreas(370)|biliary_tract(247)|soft_tissue(209)|prostate(192)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(41)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	21904		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)		Pancreas(47;798 1329 9957 10801)		111	p.V274fs(SCC9-Tumor)|p.R280G(CJM-Tumor)	690	TCGA GBM(1;<1E-8)|TSP Lung(2;<1E-8)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			0.76	67.127487	68.668853	19	6	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	7577100	7577100	16923	17	T	C	C	C	700	54	TP53	4	4
AFMID	125061	broad.mit.edu	37	17	76198623	76198623	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:76198623C>T	uc002juz.3	+	c.198C>T	c.(196-198)GTC>GTT	p.V66V	AFMID_uc010dhj.2_Silent_p.V66V|AFMID_uc002jvb.3_Intron|AFMID_uc002jva.3_Silent_p.V66V	NM_001145526	NP_001138998	Q63HM1	AFMID_HUMAN	arylformamidase isoform 2	66						cytosol|nucleus	arylformamidase activity			large_intestine(1)|pancreas(1)	2			BRCA - Breast invasive adenocarcinoma(99;0.00269)|OV - Ovarian serous cystadenocarcinoma(97;0.134)											0.190476	25.884132	31.510723	12	51	KEEP	---	---	---	---	capture		Silent	SNP	76198623	76198623	363	17	C	T	T	T	379	30	AFMID	2	2
USP43	124739	broad.mit.edu	37	17	9613391	9613391	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr17:9613391G>T	uc010cod.2	+	c.2130G>T	c.(2128-2130)CGG>CGT	p.R710R	USP43_uc002gma.3_Silent_p.R399R|USP43_uc010vva.1_Silent_p.R705R|USP43_uc010coe.2_Silent_p.R507R|USP43_uc002gmc.3_Silent_p.R222R	NM_153210	NP_694942	Q70EL4	UBP43_HUMAN	ubiquitin specific protease 43	710					ubiquitin-dependent protein catabolic process		cysteine-type peptidase activity|ubiquitin thiolesterase activity			ovary(1)|central_nervous_system(1)	2														0.705882	72.284942	73.572332	24	10	KEEP	---	---	---	---	capture		Silent	SNP	9613391	9613391	17638	17	G	T	T	T	522	41	USP43	2	2
C18orf34	374864	broad.mit.edu	37	18	30903460	30903461	+	Missense_Mutation	DNP	GG	TT	TT			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:30903460_30903461GG>TT	uc010xbr.1	-	c.1016_1017CC>AA	c.(1015-1017)GCC>GAA	p.A339E	C18orf34_uc002kxn.2_Missense_Mutation_p.A339E|C18orf34_uc010dmf.1_Intron|C18orf34_uc002kxo.2_Missense_Mutation_p.A339E|C18orf34_uc002kxp.2_Missense_Mutation_p.A339E	NM_001105528	NP_001098998	Q5BJE1	CR034_HUMAN	hypothetical protein LOC374864 isoform 1	339	Potential.									ovary(1)	1														0.227273	12.765945	14.265985	5	17	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	30903460	30903461	1963	18	GG	TT	TT	TT	444	35	C18orf34	2	2
ASXL3	80816	broad.mit.edu	37	18	31324221	31324221	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:31324221C>A	uc010dmg.1	+	c.4409C>A	c.(4408-4410)CCG>CAG	p.P1470Q	ASXL3_uc002kxq.2_Missense_Mutation_p.P1177Q	NM_030632	NP_085135	Q9C0F0	ASXL3_HUMAN	additional sex combs like 3	1470					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	metal ion binding			ovary(2)|pancreas(1)	3												OREG0024911	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	0.428571	68.88147	69.096088	21	28	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	31324221	31324221	1087	18	C	A	A	A	299	23	ASXL3	1	1
FHOD3	80206	broad.mit.edu	37	18	34191968	34191968	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:34191968G>T	uc002kzs.1	+	c.867G>T	c.(865-867)CTG>CTT	p.L289L	FHOD3_uc002kzr.1_Silent_p.L289L|FHOD3_uc002kzt.1_Silent_p.L289L|FHOD3_uc002kzu.1_Silent_p.L114L|FHOD3_uc010dmz.1_Silent_p.L42L	NM_025135	NP_079411	Q2V2M9	FHOD3_HUMAN	formin homology 2 domain containing 3	289	GBD/FH3.				actin cytoskeleton organization	cytoplasm|cytoskeleton	actin binding			large_intestine(2)|breast(2)|ovary(1)	5		all_epithelial(2;0.0181)|Colorectal(2;0.0195)												0.387097	35.092738	35.43903	12	19	KEEP	---	---	---	---	capture		Silent	SNP	34191968	34191968	6121	18	G	T	T	T	600	47	FHOD3	2	2
PIK3C3	5289	broad.mit.edu	37	18	39537583	39537583	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:39537583G>T	uc002lap.2	+	c.117G>T	c.(115-117)CTG>CTT	p.L39L	PIK3C3_uc010xcl.1_Intron|PIK3C3_uc002lao.2_Silent_p.L39L	NM_002647	NP_002638	Q8NEB9	PK3C3_HUMAN	catalytic phosphatidylinositol 3-kinase 3	39					cell cycle|cytokinesis|fibroblast growth factor receptor signaling pathway|innate immune response|insulin receptor signaling pathway	midbody|phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|protein binding			lung(7)|ovary(1)	8						NSCLC(37;552 1060 2683 16430 37914)				441	TSP Lung(28;0.18)			0.366667	32.817909	33.286488	11	19	KEEP	---	---	---	---	capture		Silent	SNP	39537583	39537583	12336	18	G	T	T	T	600	47	PIK3C3	2	2
ALPK2	115701	broad.mit.edu	37	18	56247074	56247074	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:56247074G>T	uc002lhj.3	-	c.934C>A	c.(934-936)CCA>ACA	p.P312T		NM_052947	NP_443179	Q86TB3	ALPK2_HUMAN	heart alpha-kinase	312					protein phosphorylation		ATP binding|protein serine/threonine kinase activity			ovary(7)|skin(2)|lung(1)|central_nervous_system(1)	11										343		OREG0025011	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	0.215385	33.21594	38.074497	14	51	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	56247074	56247074	548	18	G	T	T	T	559	43	ALPK2	2	2
ZNF532	55205	broad.mit.edu	37	18	56586014	56586014	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:56586014G>T	uc002lho.2	+	c.495G>T	c.(493-495)ACG>ACT	p.T165T	ZNF532_uc002lhp.2_Silent_p.T163T|ZNF532_uc010xeg.1_Silent_p.T163T|ZNF532_uc002lhr.2_Silent_p.T163T|ZNF532_uc002lhs.2_Silent_p.T163T	NM_018181	NP_060651	Q9HCE3	ZN532_HUMAN	zinc finger protein 532	165					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			breast(1)	1														0.253165	52.456105	56.834493	20	59	KEEP	---	---	---	---	capture		Silent	SNP	56586014	56586014	18566	18	G	T	T	T	496	39	ZNF532	1	1
CDH7	1005	broad.mit.edu	37	18	63530152	63530152	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:63530152G>C	uc002ljz.2	+	c.1863G>C	c.(1861-1863)TTG>TTC	p.L621F	CDH7_uc002lka.2_Missense_Mutation_p.L621F|CDH7_uc002lkb.2_Missense_Mutation_p.L621F	NM_033646	NP_387450	Q9ULB5	CADH7_HUMAN	cadherin 7, type 2 preproprotein	621	Helical; (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)|pancreas(1)	3		Esophageal squamous(42;0.129)												0.333333	28.338969	29.077503	10	20	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	63530152	63530152	3244	18	G	C	C	C	607	47	CDH7	3	3
RTTN	25914	broad.mit.edu	37	18	67684766	67684766	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:67684766C>A	uc002lkp.2	-	c.6298G>T	c.(6298-6300)GGC>TGC	p.G2100C	RTTN_uc002lko.2_Non-coding_Transcript|RTTN_uc010xfb.1_Missense_Mutation_p.G1188C|RTTN_uc002lkn.2_Missense_Mutation_p.G90C|RTTN_uc010dqp.2_Missense_Mutation_p.G352C	NM_173630	NP_775901	Q86VV8	RTTN_HUMAN	rotatin	2100							binding			ovary(3)|pancreas(2)|breast(1)|central_nervous_system(1)	7		Esophageal squamous(42;0.129)												0.346939	47.563172	48.529249	17	32	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	67684766	67684766	14217	18	C	A	A	A	273	21	RTTN	2	2
LAMA1	284217	broad.mit.edu	37	18	6961967	6961967	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:6961967C>A	uc002knm.2	-	c.7429G>T	c.(7429-7431)GTG>TTG	p.V2477L	LAMA1_uc002knl.2_5'UTR|LAMA1_uc010wzj.1_Missense_Mutation_p.V1953L	NM_005559	NP_005550	P25391	LAMA1_HUMAN	laminin, alpha 1 precursor	2477	Laminin G-like 2.				axon guidance|cell adhesion|cell surface receptor linked signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	extracellular space|laminin-1 complex|laminin-3 complex	extracellular matrix structural constituent|receptor binding			ovary(8)|large_intestine(4)|breast(2)|pancreas(2)|central_nervous_system(1)	17		Colorectal(10;0.172)			Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)					1597				0.150442	62.593073	89.119858	34	192	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	6961967	6961967	8928	18	C	A	A	A	260	20	LAMA1	2	2
ZNF236	7776	broad.mit.edu	37	18	74607043	74607043	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:74607043G>T	uc002lmi.2	+	c.1486G>T	c.(1486-1488)GAC>TAC	p.D496Y	ZNF236_uc002lmj.2_Non-coding_Transcript	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	496	C2H2-type 10.				cellular response to glucose stimulus|regulation of transcription, DNA-dependent	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)										0.403509	64.817807	65.27948	23	34	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	74607043	74607043	18380	18	G	T	T	T	481	37	ZNF236	1	1
RALBP1	10928	broad.mit.edu	37	18	9533746	9533746	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr18:9533746G>T	uc002kob.2	+	c.1623G>T	c.(1621-1623)GAG>GAT	p.E541D	RALBP1_uc002koc.2_Missense_Mutation_p.E541D	NM_006788	NP_006779	Q15311	RBP1_HUMAN	ralA binding protein 1	541					chemotaxis|positive regulation of Cdc42 GTPase activity|small GTPase mediated signal transduction|transport	cytosol|membrane	ATPase activity, coupled to movement of substances|Rac GTPase activator activity|Rac GTPase binding|Ral GTPase binding			central_nervous_system(1)	1										246				0.777778	218.38389	224.765932	70	20	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	9533746	9533746	13472	18	G	T	T	T	425	33	RALBP1	2	2
ATG4D	84971	broad.mit.edu	37	19	10657598	10657598	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:10657598C>T	uc002mov.2	+	c.577C>T	c.(577-579)CGC>TGC	p.R193C	ATG4D_uc010xlg.1_Missense_Mutation_p.R216C|ATG4D_uc010xlh.1_Missense_Mutation_p.R130C|ATG4D_uc010dxh.2_Non-coding_Transcript|ATG4D_uc010dxi.2_Intron|ATG4D_uc010dxj.2_Intron	NM_032885	NP_116274	Q86TL0	ATG4D_HUMAN	APG4 autophagy 4 homolog D	193					autophagy|protein transport	cytoplasm	cysteine-type endopeptidase activity				0			Epithelial(33;9.2e-06)|all cancers(31;3.9e-05)											0.869565	66.102726	69.153678	20	3	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	10657598	10657598	1118	19	C	T	T	T	299	23	ATG4D	1	1
ZNF98	148198	broad.mit.edu	37	19	22575523	22575523	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:22575523G>T	uc002nqt.2	-	c.514C>A	c.(514-516)CAT>AAT	p.H172N		NM_001098626	NP_001092096	A6NK75	ZNF98_HUMAN	zinc finger protein 98	172					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		all_cancers(12;0.0536)|all_lung(12;0.00187)|Lung NSC(12;0.0019)|all_epithelial(12;0.00542)|Hepatocellular(1079;0.244)												0.727273	28.505468	29.018382	8	3	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	22575523	22575523	18807	19	G	T	T	T	624	48	ZNF98	2	2
ZNF536	9745	broad.mit.edu	37	19	31040278	31040278	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:31040278C>A	uc002nsu.1	+	c.3752C>A	c.(3751-3753)CCG>CAG	p.P1251Q	ZNF536_uc010edd.1_Missense_Mutation_p.P1251Q	NM_014717	NP_055532	O15090	ZN536_HUMAN	zinc finger protein 536	1251					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(7)|large_intestine(2)	9	Esophageal squamous(110;0.0834)													0.85	54.686373	57.040884	17	3	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	31040278	31040278	18568	19	C	A	A	A	299	23	ZNF536	1	1
C19orf28	126321	broad.mit.edu	37	19	3551130	3551130	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:3551130C>A	uc002lxw.2	-	c.361G>T	c.(361-363)GCC>TCC	p.A121S	C19orf28_uc002lxx.2_Missense_Mutation_p.A121S|C19orf28_uc002lxy.2_Missense_Mutation_p.A112S|C19orf28_uc002lxz.2_Missense_Mutation_p.A121S	NM_021731	NP_068377	Q6NUT3	CS028_HUMAN	hypothetical protein LOC126321 isoform a	121					transmembrane transport	integral to membrane				breast(1)|pancreas(1)	2		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.00251)|STAD - Stomach adenocarcinoma(1328;0.18)										0.75	42.908582	44.036208	15	5	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	3551130	3551130	1980	19	C	A	A	A	338	26	C19orf28	2	2
CYP2A7	1549	broad.mit.edu	37	19	41386406	41386406	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:41386406G>A	uc002opm.2	-	c.471C>T	c.(469-471)ATC>ATT	p.I157I	CYP2A7_uc002opo.2_Silent_p.I157I|CYP2A7_uc002opn.2_Silent_p.I106I	NM_000764	NP_000755	P20853	CP2A7_HUMAN	cytochrome P450, family 2, subfamily A,	157					oxidation-reduction process	endoplasmic reticulum membrane|microsome	aromatase activity|electron carrier activity|heme binding|oxygen binding			ovary(1)	1			LUSC - Lung squamous cell carcinoma(20;0.000219)|Lung(22;0.000959)							177				0.5	54.240412	54.240412	18	18	KEEP	---	---	---	---	capture		Silent	SNP	41386406	41386406	4328	19	G	A	A	A	473	37	CYP2A7	1	1
PSG7	5676	broad.mit.edu	37	19	43433838	43433838	+	Silent	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:43433838A>G	uc002ovl.3	-	c.465T>C	c.(463-465)AAT>AAC	p.N155N	PSG3_uc002ouf.2_Intron|PSG11_uc002ouw.2_Intron|PSG7_uc002ous.1_5'Flank|PSG7_uc002out.1_5'UTR|PSG10_uc002ouv.1_Intron|PSG6_uc002ovh.1_Intron|PSG6_uc002ovi.2_Intron|PSG6_uc010xwk.1_Intron|PSG11_uc002ovk.1_Intron|PSG7_uc010xwl.1_Silent_p.N33N	NM_002783	NP_002774	Q13046	PSG7_HUMAN	pregnancy specific beta-1-glycoprotein 7	155	Ig-like C2-type 1.				female pregnancy	extracellular region					0		Prostate(69;0.00682)												0.803797	454.314978	467.958573	127	31	KEEP	---	---	---	---	capture		Silent	SNP	43433838	43433838	13113	19	A	G	G	G	50	4	PSG7	4	4
ZNF229	7772	broad.mit.edu	37	19	44934092	44934092	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:44934092C>A	uc002oze.1	-	c.864G>T	c.(862-864)TTG>TTT	p.L288F	ZNF229_uc010ejk.1_5'UTR|ZNF229_uc010ejl.1_Missense_Mutation_p.L282F	NM_014518	NP_055333	Q9UJW7	ZN229_HUMAN	zinc finger protein 229	288					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|pancreas(1)	2		Prostate(69;0.0352)												0.888889	153.628166	161.697638	48	6	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	44934092	44934092	18373	19	C	A	A	A	376	29	ZNF229	2	2
DKKL1	27120	broad.mit.edu	37	19	49877992	49877992	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:49877992A>G	uc002pnk.2	+	c.436A>G	c.(436-438)AAG>GAG	p.K146E		NM_014419	NP_055234	Q9UK85	DKKL1_HUMAN	dickkopf-like 1 precursor	146					anatomical structure morphogenesis	extracellular space	protein binding|signal transducer activity				0		all_lung(116;1.66e-06)|Lung NSC(112;5.89e-06)|all_neural(266;0.0189)|Ovarian(192;0.0392)		OV - Ovarian serous cystadenocarcinoma(262;0.00156)|GBM - Glioblastoma multiforme(486;0.0456)										0.637931	132.490516	133.461773	37	21	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	49877992	49877992	4728	19	A	G	G	G	117	9	DKKL1	4	4
GPR32	2854	broad.mit.edu	37	19	51274608	51274608	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:51274608G>T	uc010ycf.1	+	c.751G>T	c.(751-753)GCC>TCC	p.A251S		NM_001506	NP_001497	O75388	GPR32_HUMAN	G protein-coupled receptor 32	251	Cytoplasmic (Potential).					integral to plasma membrane	N-formyl peptide receptor activity				0		all_neural(266;0.131)		OV - Ovarian serous cystadenocarcinoma(262;0.00641)|GBM - Glioblastoma multiforme(134;0.028)		Esophageal Squamous(113;152 1581 5732 15840 44398)								0.707317	92.682034	94.256808	29	12	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	51274608	51274608	6963	19	G	T	T	T	598	46	GPR32	2	2
HAS1	3036	broad.mit.edu	37	19	52222568	52222568	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:52222568G>T	uc002pxn.1	-	c.614C>A	c.(613-615)GCG>GAG	p.A205E	HAS1_uc010epc.1_5'Flank|HAS1_uc010epd.1_Missense_Mutation_p.A163E|HAS1_uc002pxo.1_Missense_Mutation_p.A198E|HAS1_uc002pxp.1_Missense_Mutation_p.A197E	NM_001523	NP_001514	Q92839	HAS1_HUMAN	hyaluronan synthase 1	198	Cytoplasmic (Potential).				cell adhesion	integral to plasma membrane	hyaluronan synthase activity|protein binding			ovary(1)|pancreas(1)	2		all_neural(266;0.0189)|Medulloblastoma(540;0.146)		GBM - Glioblastoma multiforme(134;0.00102)|OV - Ovarian serous cystadenocarcinoma(262;0.0177)		NSCLC(132;636 2450 45807 47979)								0.714286	29.651272	30.227205	10	4	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	52222568	52222568	7243	19	G	T	T	T	494	38	HAS1	1	1
ZNF665	79788	broad.mit.edu	37	19	53669454	53669454	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:53669454C>G	uc010eqm.1	-	c.289G>C	c.(289-291)GAC>CAC	p.D97H		NM_024733	NP_079009	Q9H7R5	ZN665_HUMAN	zinc finger protein 665	32					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2				GBM - Glioblastoma multiforme(134;0.0196)										0.782313	405.674184	416.477596	115	32	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	53669454	53669454	18668	19	C	G	G	G	403	31	ZNF665	3	3
CACNG8	59283	broad.mit.edu	37	19	54485474	54485474	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:54485474G>C	uc002qcs.1	+	c.646G>C	c.(646-648)GAG>CAG	p.E216Q	MIR935_hsa-mir-935|MI0005757_5'Flank	NM_031895	NP_114101	Q8WXS5	CCG8_HUMAN	voltage-dependent calcium channel gamma-8	217	Helical; (Potential).				regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|synaptic transmission	alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex|endocytic vesicle membrane|postsynaptic density|voltage-gated calcium channel complex	voltage-gated calcium channel activity				0	all_cancers(19;0.0385)|all_epithelial(19;0.0207)|all_lung(19;0.145)|Lung NSC(19;0.168)|Ovarian(34;0.19)			GBM - Glioblastoma multiforme(134;0.162)										0.944444	62.838223	65.529662	17	1	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	54485474	54485474	2679	19	G	C	C	C	481	37	CACNG8	3	3
LILRB5	10990	broad.mit.edu	37	19	54760174	54760174	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:54760174C>A	uc002qey.2	-	c.387G>T	c.(385-387)CTG>CTT	p.L129L	LILRA6_uc002qew.1_Intron|LILRB5_uc010yer.1_Silent_p.L120L|LILRB5_uc002qex.2_Silent_p.L129L|LILRB5_uc002qez.2_Intron|LILRB5_uc002qfa.1_Intron|LILRB5_uc010yes.1_Intron	NM_001081442	NP_001074911	O75023	LIRB5_HUMAN	leukocyte immunoglobulin-like receptor,	129	Extracellular (Potential).|Ig-like C2-type 2.				cell surface receptor linked signaling pathway|defense response	integral to membrane	transmembrane receptor activity			ovary(1)|pancreas(1)	2	all_cancers(19;0.00681)|all_epithelial(19;0.00368)|all_lung(19;0.016)|Lung NSC(19;0.0296)|Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.105)										0.818182	151.802505	157.031269	45	10	KEEP	---	---	---	---	capture		Silent	SNP	54760174	54760174	9120	19	C	A	A	A	314	25	LILRB5	2	2
KIR2DL3	3804	broad.mit.edu	37	19	55263202	55263202	+	Nonsense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:55263202A>T	uc010erw.1	+	c.817A>T	c.(817-819)AAA>TAA	p.K273*	KIR2DL3_uc002qgv.2_Nonsense_Mutation_p.K273*|KIR2DL3_uc002qgx.2_Nonsense_Mutation_p.K273*|KIR2DL3_uc002qgy.2_Nonsense_Mutation_p.K175*|KIR2DL1_uc002qgz.1_Intron|KIR2DL3_uc002qha.1_Intron	NM_015868	NP_056952	P43628	KI2L3_HUMAN	killer cell immunoglobulin-like receptor, two	273	Cytoplasmic (Potential).				immune response|regulation of immune response	integral to plasma membrane	antigen binding|protein binding|receptor activity			ovary(2)	2				GBM - Glioblastoma multiforme(193;0.0192)										0.717949	85.609121	87.271289	28	11	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	55263202	55263202	8629	19	A	T	T	T	13	1	KIR2DL3	5	3
C19orf51	352909	broad.mit.edu	37	19	55671298	55671298	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:55671298C>A	uc002qjl.1	-	c.1333G>T	c.(1333-1335)GGC>TGC	p.G445C	TNNI3_uc002qjg.3_5'Flank|TNNI3_uc010yft.1_5'Flank|C19orf51_uc002qjh.1_Missense_Mutation_p.G193C|C19orf51_uc002qji.1_Missense_Mutation_p.G378C|C19orf51_uc002qjj.1_Missense_Mutation_p.G425C|C19orf51_uc002qjk.1_Missense_Mutation_p.G324C	NM_178837	NP_849159	Q8N9W5	CS051_HUMAN	hypothetical protein LOC352909	378											0			BRCA - Breast invasive adenocarcinoma(297;0.209)	GBM - Glioblastoma multiforme(193;0.044)										0.702703	86.557574	87.916384	26	11	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	55671298	55671298	1997	19	C	A	A	A	299	23	C19orf51	1	1
ZIM2	23619	broad.mit.edu	37	19	57286128	57286128	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:57286128G>A	uc002qnr.2	-	c.1512C>T	c.(1510-1512)GGC>GGT	p.G504G	ZIM2_uc010ygq.1_Silent_p.G300G|ZIM2_uc010ygr.1_Silent_p.G300G|ZIM2_uc002qnq.2_Silent_p.G504G|ZIM2_uc010etp.2_Silent_p.G504G|ZIM2_uc010ygs.1_Silent_p.G504G	NM_015363	NP_056178	Q9NZV7	ZIM2_HUMAN	zinc finger, imprinted 2	504	C2H2-type 5.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(3)	3		Colorectal(82;0.000256)|all_neural(62;0.103)|Ovarian(87;0.243)		GBM - Glioblastoma multiforme(193;0.0314)										0.74	109.56801	112.210839	37	13	KEEP	---	---	---	---	capture		Silent	SNP	57286128	57286128	18275	19	G	A	A	A	535	42	ZIM2	2	2
DUS3L	56931	broad.mit.edu	37	19	5788169	5788169	+	Nonsense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:5788169G>A	uc002mdc.2	-	c.961C>T	c.(961-963)CGA>TGA	p.R321*	DUS3L_uc002mdd.2_Nonsense_Mutation_p.R79*|DUS3L_uc010duk.2_5'UTR|DUS3L_uc010xiw.1_Non-coding_Transcript	NM_020175	NP_064560	Q96G46	DUS3L_HUMAN	dihydrouridine synthase 3-like isoform 1	321					oxidation-reduction process|tRNA processing		flavin adenine dinucleotide binding|nucleic acid binding|tRNA dihydrouridine synthase activity|zinc ion binding				0														0.763158	104.296828	106.705987	29	9	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	5788169	5788169	4992	19	G	A	A	A	506	39	DUS3L	5	1
ZNF416	55659	broad.mit.edu	37	19	58084849	58084849	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:58084849C>T	uc002qpf.2	-	c.423G>A	c.(421-423)AAG>AAA	p.K141K	ZNF547_uc002qpm.3_Intron	NM_017879	NP_060349	Q9BWM5	ZN416_HUMAN	zinc finger protein 416	141					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0259)										0.8	81.308303	83.815749	24	6	KEEP	---	---	---	---	capture		Silent	SNP	58084849	58084849	18486	19	C	T	T	T	363	28	ZNF416	2	2
ZNF671	79891	broad.mit.edu	37	19	58238788	58238788	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:58238788G>C	uc002qpz.3	-	c.109C>G	c.(109-111)CCT>GCT	p.P37A	ZNF776_uc002qpx.2_Intron|ZNF671_uc010eug.2_5'UTR|ZNF671_uc010yhf.1_5'UTR	NM_024833	NP_079109	Q8TAW3	ZN671_HUMAN	zinc finger protein 671	37					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0257)										0.833333	51.927023	53.819193	15	3	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	58238788	58238788	18673	19	G	C	C	C	533	41	ZNF671	3	3
ZNF497	162968	broad.mit.edu	37	19	58867550	58867550	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:58867550G>A	uc002qsh.1	-	c.1452C>T	c.(1450-1452)AAC>AAT	p.N484N	A1BG_uc002qsd.3_5'Flank|A1BG_uc002qsf.1_Intron|ZNF497_uc002qsi.1_Silent_p.N484N	NM_198458	NP_940860	Q6ZNH5	ZN497_HUMAN	zinc finger protein 497	484	C2H2-type 14.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			central_nervous_system(2)	2		all_cancers(17;3.11e-12)|all_epithelial(17;9.43e-09)|Colorectal(82;0.000256)|Lung NSC(17;0.000607)|all_lung(17;0.0024)|all_neural(62;0.0412)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0278)						25				0.625	30.952885	31.172298	10	6	KEEP	---	---	---	---	capture		Silent	SNP	58867550	58867550	18540	19	G	A	A	A	568	44	ZNF497	2	2
ACTL9	284382	broad.mit.edu	37	19	8808576	8808576	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:8808576C>T	uc002mkl.2	-	c.476G>A	c.(475-477)CGC>CAC	p.R159H		NM_178525	NP_848620	Q8TC94	ACTL9_HUMAN	actin-like 9	159						cytoplasm|cytoskeleton				large_intestine(2)|pancreas(1)	3														0.25	23.845171	26.108512	10	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	8808576	8808576	204	19	C	T	T	T	351	27	ACTL9	1	1
MUC16	94025	broad.mit.edu	37	19	9011493	9011493	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:9011493G>T	uc002mkp.2	-	c.38740C>A	c.(38740-38742)CCT>ACT	p.P12914T	MUC16_uc010xki.1_Intron	NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	12916	SEA 6.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			ovary(15)|large_intestine(1)|pancreas(1)|breast(1)|skin(1)	19														0.701299	166.953442	169.720728	54	23	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	9011493	9011493	10367	19	G	T	T	T	546	42	MUC16	2	2
MUC16	94025	broad.mit.edu	37	19	9049248	9049248	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:9049248A>T	uc002mkp.2	-	c.32383T>A	c.(32383-32385)TCA>ACA	p.S10795T		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	10797	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			ovary(15)|large_intestine(1)|pancreas(1)|breast(1)|skin(1)	19														0.752475	239.680314	245.538372	76	25	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	9049248	9049248	10367	19	A	T	T	T	143	11	MUC16	3	3
MUC16	94025	broad.mit.edu	37	19	9062525	9062525	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr19:9062525G>A	uc002mkp.2	-	c.24921C>T	c.(24919-24921)ACC>ACT	p.T8307T		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	8309	Ser-rich.|Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			ovary(15)|large_intestine(1)|pancreas(1)|breast(1)|skin(1)	19														0.222222	25.228402	28.42097	10	35	KEEP	---	---	---	---	capture		Silent	SNP	9062525	9062525	10367	19	G	A	A	A	600	47	MUC16	2	2
COL11A1	1301	broad.mit.edu	37	1	103440391	103440391	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:103440391G>T	uc001dum.2	-	c.2839C>A	c.(2839-2841)CCT>ACT	p.P947T	COL11A1_uc001duk.2_Missense_Mutation_p.P131T|COL11A1_uc001dul.2_Missense_Mutation_p.P935T|COL11A1_uc001dun.2_Missense_Mutation_p.P896T|COL11A1_uc009weh.2_Missense_Mutation_p.P819T	NM_080629	NP_542196	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform B	935	Triple-helical region.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|central_nervous_system(1)|pancreas(1)	11		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)										0.366667	30.813361	31.283701	11	19	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	103440391	103440391	3805	1	G	T	T	T	559	43	COL11A1	2	2
COL11A1	1301	broad.mit.edu	37	1	103548452	103548452	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:103548452G>T	uc001dum.2	-	c.183C>A	c.(181-183)TGC>TGA	p.C61*	COL11A1_uc001dul.2_Nonsense_Mutation_p.C61*|COL11A1_uc001dun.2_Nonsense_Mutation_p.C61*|COL11A1_uc009weh.2_Nonsense_Mutation_p.C61*	NM_080629	NP_542196	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform B	61	TSP N-terminal.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|central_nervous_system(1)|pancreas(1)	11		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)										0.346154	81.000357	82.63087	27	51	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	103548452	103548452	3805	1	G	T	T	T	594	46	COL11A1	5	2
PRMT6	55170	broad.mit.edu	37	1	107600389	107600389	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:107600389G>C	uc010ous.1	+	c.1052G>C	c.(1051-1053)CGT>CCT	p.R351P		NM_018137	NP_060607	Q96LA8	ANM6_HUMAN	protein arginine methyltransferase 6	351					base-excision repair|interspecies interaction between organisms|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	histone binding|histone methyltransferase activity (H2A-R3 specific)|histone methyltransferase activity (H3-R2 specific)|histone methyltransferase activity (H4-R3 specific)|protein-arginine omega-N asymmetric methyltransferase activity|protein-arginine omega-N monomethyltransferase activity				0		all_epithelial(167;0.000429)|all_lung(203;0.00122)|Lung NSC(277;0.00185)		Lung(183;0.0305)|Epithelial(280;0.0765)|Colorectal(144;0.0998)|all cancers(265;0.14)|LUSC - Lung squamous cell carcinoma(189;0.173)|BRCA - Breast invasive adenocarcinoma(282;0.242)										0.333333	16.94267	17.386149	6	12	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	107600389	107600389	12983	1	G	C	C	C	520	40	PRMT6	3	3
CELSR2	1952	broad.mit.edu	37	1	109813107	109813107	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:109813107G>T	uc001dxa.3	+	c.7368G>T	c.(7366-7368)TGG>TGT	p.W2456C		NM_001408	NP_001399	Q9HCU4	CELR2_HUMAN	cadherin EGF LAG seven-pass G-type receptor 2	2456	Helical; Name=3; (Potential).				dendrite morphogenesis|homophilic cell adhesion|neural plate anterior/posterior regionalization|neuropeptide signaling pathway|regulation of cell-cell adhesion|regulation of gene-specific transcription|Wnt receptor signaling pathway	cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(3)	3		all_epithelial(167;0.000114)|all_lung(203;0.000321)|Lung NSC(277;0.000626)|Breast(1374;0.244)		Colorectal(144;0.0296)|Lung(183;0.067)|COAD - Colon adenocarcinoma(174;0.114)|Epithelial(280;0.193)|all cancers(265;0.219)		NSCLC(158;1285 2011 34800 34852 42084)								0.277778	37.161798	39.527226	15	39	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	109813107	109813107	3355	1	G	T	T	T	559	43	CELSR2	2	2
SLC6A17	388662	broad.mit.edu	37	1	110717483	110717484	+	Nonsense_Mutation	DNP	GG	CT	CT			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:110717483_110717484GG>CT	uc009wfq.2	+	c.654_655GG>CT	c.(652-657)TCGGAG>TCCTAG	p.E219*		NM_001010898	NP_001010898	Q9H1V8	S6A17_HUMAN	solute carrier family 6, member 17	219	Extracellular (Potential).				alanine transport|glycine transport|leucine transport|proline transport	cell junction|integral to plasma membrane|synaptic vesicle membrane	neurotransmitter:sodium symporter activity			ovary(1)|pancreas(1)	2		all_cancers(81;9.9e-06)|all_epithelial(167;3.24e-06)|all_lung(203;0.000116)|Lung NSC(277;0.000233)		Lung(183;0.0282)|Epithelial(280;0.0372)|all cancers(265;0.0378)|Colorectal(144;0.0438)|LUSC - Lung squamous cell carcinoma(189;0.151)|COAD - Colon adenocarcinoma(174;0.151)										0.333333	28.667023	29.330729	9	18	KEEP	---	---	---	---	capture		Nonsense_Mutation	DNP	110717483	110717484	15177	1	GG	CT	CT	CT	496	39	SLC6A17	5	3
C1orf103	55791	broad.mit.edu	37	1	111495357	111495357	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:111495357T>A	uc001eaa.2	-	c.149A>T	c.(148-150)AAG>ATG	p.K50M	C1orf103_uc001dzz.2_De_novo_Start_OutOfFrame|C1orf103_uc001eab.2_Intron|C1orf103_uc001eac.1_Intron	NM_018372	NP_060842	Q5T3J3	CA103_HUMAN	receptor-interacting factor 1 isoform 1	50							protein binding				0		all_cancers(81;1.02e-05)|all_epithelial(167;1.87e-05)|all_lung(203;0.000234)|Lung NSC(277;0.000451)		Lung(183;0.0155)|Colorectal(144;0.0314)|all cancers(265;0.082)|LUSC - Lung squamous cell carcinoma(189;0.0826)|Epithelial(280;0.0891)|COAD - Colon adenocarcinoma(174;0.134)										0.324324	33.813296	34.813372	12	25	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	111495357	111495357	2044	1	T	A	A	A	728	56	C1orf103	3	3
C1orf161	126868	broad.mit.edu	37	1	116670876	116670876	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:116670876G>A	uc001egc.1	+	c.771G>A	c.(769-771)AGG>AGA	p.R257R		NM_152367	NP_689580	Q8N8X9	MB213_HUMAN	hypothetical protein LOC126868	257											0	Lung SC(450;0.184)	all_cancers(81;0.00142)|all_lung(203;0.000139)|all_epithelial(167;0.000401)|Lung NSC(69;0.000705)		Lung(183;0.0171)|Colorectal(144;0.0686)|LUSC - Lung squamous cell carcinoma(189;0.0903)|all cancers(265;0.108)|COAD - Colon adenocarcinoma(174;0.111)|Epithelial(280;0.12)										0.28	19.6141	20.702091	7	18	KEEP	---	---	---	---	capture		Silent	SNP	116670876	116670876	2076	1	G	A	A	A	529	41	C1orf161	2	2
HSD3B2	3284	broad.mit.edu	37	1	119962122	119962122	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:119962122T>A	uc001ehs.2	+	c.224T>A	c.(223-225)GTC>GAC	p.V75D	HSD3B2_uc001eht.2_Missense_Mutation_p.V75D|HSD3B2_uc001ehu.2_Missense_Mutation_p.V75D	NM_000198	NP_000189	P26439	3BHS2_HUMAN	3 beta-hydroxysteroid dehydrogenase 2	75					androgen biosynthetic process|glucocorticoid biosynthetic process|mineralocorticoid biosynthetic process|oxidation-reduction process	integral to membrane|microsome|mitochondrial inner membrane|mitochondrial intermembrane space|smooth endoplasmic reticulum membrane	3-beta-hydroxy-delta5-steroid dehydrogenase activity|binding|steroid delta-isomerase activity			ovary(2)	2	all_neural(166;0.187)	all_lung(203;1.06e-06)|Lung NSC(69;7.5e-06)|all_epithelial(167;0.000284)		Lung(183;0.015)|LUSC - Lung squamous cell carcinoma(189;0.0836)	NADH(DB00157)|Trilostane(DB01108)									0.384615	27.443549	27.747033	10	16	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	119962122	119962122	7686	1	T	A	A	A	754	58	HSD3B2	3	3
MIIP	60672	broad.mit.edu	37	1	12089915	12089915	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:12089915A>G	uc001ato.1	+	c.809A>G	c.(808-810)CAG>CGG	p.Q270R		NM_021933	NP_068752	Q5JXC2	MIIP_HUMAN	invasion inhibitory protein 45	270	Interaction with IGFBP2.									ovary(1)	1														0.52381	35.825801	35.836172	11	10	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	12089915	12089915	9975	1	A	G	G	G	91	7	MIIP	4	4
TNFRSF1B	7133	broad.mit.edu	37	1	12248921	12248921	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:12248921A>T	uc001att.2	+	c.147A>T	c.(145-147)ACA>ACT	p.T49T	TNFRSF1B_uc001atu.2_Intron|TNFRSF1B_uc009vnk.2_Non-coding_Transcript	NM_001066	NP_001057	P20333	TNR1B_HUMAN	tumor necrosis factor receptor 2 precursor	49	Extracellular (Potential).|TNFR-Cys 1.				apoptosis	extracellular region|integral to membrane|membrane raft|plasma membrane	tumor necrosis factor receptor activity			liver(1)|central_nervous_system(1)	2	Ovarian(185;0.249)	Lung NSC(185;8.72e-05)|all_lung(284;9.92e-05)|Renal(390;0.000147)|Colorectal(325;0.000584)|Breast(348;0.00093)|Ovarian(437;0.00965)|Hepatocellular(190;0.0202)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0234)|Colorectal(212;5.52e-07)|COAD - Colon adenocarcinoma(227;0.000345)|BRCA - Breast invasive adenocarcinoma(304;0.000353)|Kidney(185;0.00102)|KIRC - Kidney renal clear cell carcinoma(229;0.00302)|STAD - Stomach adenocarcinoma(313;0.00815)|READ - Rectum adenocarcinoma(331;0.0284)	Etanercept(DB00005)|Infliximab(DB00065)					222				0.285714	33.382529	35.11319	12	30	KEEP	---	---	---	---	capture		Silent	SNP	12248921	12248921	16835	1	A	T	T	T	80	7	TNFRSF1B	3	3
FLG	2312	broad.mit.edu	37	1	152279988	152279988	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:152279988A>T	uc001ezu.1	-	c.7374T>A	c.(7372-7374)GGT>GGA	p.G2458G		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	2458	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)	9	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)											0.471519	436.031487	436.259865	149	167	KEEP	---	---	---	---	capture		Silent	SNP	152279988	152279988	6160	1	A	T	T	T	119	10	FLG	3	3
LELP1	149018	broad.mit.edu	37	1	153177371	153177371	+	Nonsense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:153177371C>A	uc001fbl.2	+	c.188C>A	c.(187-189)TCG>TAG	p.S63*		NM_001010857	NP_001010857	Q5T871	LELP1_HUMAN	late cornified envelope-like proline-rich 1	63	Cys/Pro-rich.									ovary(1)	1	all_lung(78;3.51e-31)|Lung NSC(65;1.34e-29)|Hepatocellular(266;0.0877)|all_hematologic(923;0.127)|Melanoma(130;0.242)		LUSC - Lung squamous cell carcinoma(543;0.171)											0.508772	96.078214	96.082122	29	28	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	153177371	153177371	9042	1	C	A	A	A	403	31	LELP1	5	1
IQGAP3	128239	broad.mit.edu	37	1	156532439	156532439	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:156532439C>A	uc001fpf.2	-	c.817G>T	c.(817-819)GAC>TAC	p.D273Y	IQGAP3_uc009wsb.1_Missense_Mutation_p.D230Y	NM_178229	NP_839943	Q86VI3	IQGA3_HUMAN	IQ motif containing GTPase activating protein 3	273					small GTPase mediated signal transduction	intracellular	calmodulin binding|Ras GTPase activator activity			ovary(5)	5	all_hematologic(923;0.088)|Hepatocellular(266;0.158)													0.416667	83.025045	83.463704	30	42	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	156532439	156532439	8119	1	C	A	A	A	390	30	IQGAP3	2	2
PEAR1	375033	broad.mit.edu	37	1	156883536	156883536	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:156883536C>A	uc001fqj.1	+	c.2697C>A	c.(2695-2697)GGC>GGA	p.G899G	PEAR1_uc001fqk.1_Silent_p.G524G	NM_001080471	NP_001073940	Q5VY43	PEAR1_HUMAN	platelet endothelial aggregation receptor 1	899	Pro-rich.					integral to membrane				ovary(2)|central_nervous_system(1)	3	all_hematologic(923;0.0839)|Hepatocellular(266;0.158)													0.648649	73.87771	74.591478	24	13	KEEP	---	---	---	---	capture		Silent	SNP	156883536	156883536	12133	1	C	A	A	A	327	26	PEAR1	2	2
CD1D	912	broad.mit.edu	37	1	158152741	158152741	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:158152741A>T	uc001frr.2	+	c.681A>T	c.(679-681)TCA>TCT	p.S227S	CD1D_uc009wss.2_Intron	NM_001766	NP_001757	P15813	CD1D_HUMAN	CD1D antigen precursor	227	Ig-like.|Extracellular (Potential).				antigen processing and presentation, endogenous lipid antigen via MHC class Ib|detection of bacterium|innate immune response|interspecies interaction between organisms|positive regulation of innate immune response|T cell selection	endosome membrane|integral to plasma membrane|lysosomal membrane	beta-2-microglobulin binding|exogenous lipid antigen binding|histone binding|receptor activity			ovary(1)	1	all_hematologic(112;0.0378)													0.452632	129.852624	130.044702	43	52	KEEP	---	---	---	---	capture		Silent	SNP	158152741	158152741	3104	1	A	T	T	T	80	7	CD1D	3	3
CD1E	913	broad.mit.edu	37	1	158325743	158325743	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:158325743A>T	uc001fse.2	+	c.752A>T	c.(751-753)CAG>CTG	p.Q251L	CD1E_uc010pid.1_Missense_Mutation_p.Q249L|CD1E_uc010pie.1_Missense_Mutation_p.Q152L|CD1E_uc010pif.1_Missense_Mutation_p.Q62L|CD1E_uc001fsd.2_Missense_Mutation_p.Q251L|CD1E_uc001fsk.2_Missense_Mutation_p.Q161L|CD1E_uc001fsj.2_Intron|CD1E_uc001fsc.2_Missense_Mutation_p.Q62L|CD1E_uc010pig.1_Intron|CD1E_uc001fsa.2_Intron|CD1E_uc001fsf.2_Missense_Mutation_p.Q251L|CD1E_uc001fry.2_Intron|CD1E_uc001fsg.2_Missense_Mutation_p.Q62L|CD1E_uc001fsh.2_Missense_Mutation_p.Q62L|CD1E_uc001fsi.2_Missense_Mutation_p.Q251L|CD1E_uc009wsv.2_Missense_Mutation_p.Q152L|CD1E_uc001frz.2_Missense_Mutation_p.Q161L|CD1E_uc009wsw.2_Missense_Mutation_p.Q9L	NM_030893	NP_112155	P15812	CD1E_HUMAN	CD1E antigen isoform a precursor	251	Ig-like.				antigen processing and presentation|immune response	early endosome|Golgi membrane|integral to plasma membrane|late endosome|lysosomal lumen					0	all_hematologic(112;0.0378)													0.375	69.679806	70.559104	24	40	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	158325743	158325743	3105	1	A	T	T	T	91	7	CD1E	3	3
SPTA1	6708	broad.mit.edu	37	1	158615096	158615096	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:158615096C>A	uc001fst.1	-	c.4076G>T	c.(4075-4077)GGG>GTG	p.G1359V		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	1359	Spectrin 13.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|breast(1)	5	all_hematologic(112;0.0378)													0.333333	66.36681	68.203527	25	50	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	158615096	158615096	15630	1	C	A	A	A	286	22	SPTA1	2	2
TMEM82	388595	broad.mit.edu	37	1	16070900	16070900	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:16070900G>T	uc001axc.2	+	c.582G>T	c.(580-582)CTG>CTT	p.L194L		NM_001013641	NP_001013663	A0PJX8	TMM82_HUMAN	transmembrane protein 82	194	Leu-rich.					integral to membrane				breast(1)|central_nervous_system(1)	2		Colorectal(325;0.00108)|Renal(390;0.00145)|Breast(348;0.00224)|Lung NSC(340;0.00566)|all_lung(284;0.00831)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0798)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;5.73e-07)|COAD - Colon adenocarcinoma(227;3.49e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000114)|KIRC - Kidney renal clear cell carcinoma(229;0.00244)|STAD - Stomach adenocarcinoma(313;0.0072)|READ - Rectum adenocarcinoma(331;0.0649)										0.571429	12.70111	12.732344	4	3	KEEP	---	---	---	---	capture		Silent	SNP	16070900	16070900	16745	1	G	T	T	T	600	47	TMEM82	2	2
GORAB	92344	broad.mit.edu	37	1	170521423	170521423	+	Silent	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:170521423A>G	uc001gha.2	+	c.1005A>G	c.(1003-1005)CCA>CCG	p.P335P	GORAB_uc009wvx.2_Silent_p.P155P|GORAB_uc001ghb.2_Silent_p.P155P|GORAB_uc001ghc.2_Silent_p.P155P|GORAB_uc001ghd.2_Silent_p.P128P	NM_152281	NP_689494	Q5T7V8	GORAB_HUMAN	golgin, RAB6-interacting isoform a	335	Necessary for interaction with RCHY1.					Golgi apparatus|nucleus					0														0.395349	43.210675	43.637721	17	26	KEEP	---	---	---	---	capture		Silent	SNP	170521423	170521423	6847	1	A	G	G	G	93	8	GORAB	4	4
C1orf105	92346	broad.mit.edu	37	1	172425554	172425555	+	Splice_Site_DNP	DNP	GG	TT	TT			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:172425554_172425555GG>TT	uc001gik.2	+	c.199_splice	c.e4-1	p.A67_splice		NM_139240	NP_640333			hypothetical protein LOC92346												0														0.197802	40.494859	48.235747	18	73	KEEP	---	---	---	---	capture		Splice_Site_DNP	DNP	172425554	172425555	2046	1	GG	TT	TT	TT	455	35	C1orf105	5	2
SLC9A11	284525	broad.mit.edu	37	1	173476059	173476059	+	Missense_Mutation	SNP	A	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:173476059A>C	uc001giz.2	-	c.3161T>G	c.(3160-3162)GTA>GGA	p.V1054G	SLC9A11_uc009wwe.2_Missense_Mutation_p.V612G	NM_178527	NP_848622	Q5TAH2	S9A11_HUMAN	solute carrier family 9, member 11	1054					sodium ion transport	integral to membrane	solute:hydrogen antiporter activity			ovary(2)	2														0.303797	74.07297	76.78511	24	55	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	173476059	173476059	15208	1	A	C	C	C	182	14	SLC9A11	4	4
PADI1	29943	broad.mit.edu	37	1	17548814	17548815	+	Missense_Mutation	DNP	GG	TT	TT			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:17548814_17548815GG>TT	uc001bah.1	+	c.122_123GG>TT	c.(121-123)AGG>ATT	p.R41I		NM_013358	NP_037490	Q9ULC6	PADI1_HUMAN	peptidylarginine deiminase type I	41					peptidyl-citrulline biosynthetic process from peptidyl-arginine	cytoplasm	calcium ion binding|protein-arginine deiminase activity				0		Colorectal(325;3.46e-05)|Breast(348;0.000162)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.00054)|Ovarian(437;0.00409)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00522)|BRCA - Breast invasive adenocarcinoma(304;1.3e-05)|COAD - Colon adenocarcinoma(227;1.31e-05)|Kidney(64;0.000212)|KIRC - Kidney renal clear cell carcinoma(64;0.003)|STAD - Stomach adenocarcinoma(196;0.0069)|READ - Rectum adenocarcinoma(331;0.0681)|Lung(427;0.197)	L-Citrulline(DB00155)	Esophageal Squamous(80;414 1257 4580 27746 50832)								0.204082	21.320173	25.304721	10	39	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	17548814	17548815	11793	1	GG	TT	TT	TT	455	35	PADI1	2	2
TDRD5	163589	broad.mit.edu	37	1	179561783	179561783	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:179561783G>T	uc010pnp.1	+	c.33G>T	c.(31-33)CTG>CTT	p.L11L	TDRD5_uc001gnf.1_Silent_p.L11L	NM_173533	NP_775804	Q8NAT2	TDRD5_HUMAN	tudor domain containing 5	11	Lotus/OST-HTH 1.				DNA methylation involved in gamete generation|P granule organization|spermatid development	chromatoid body|pi-body	nucleic acid binding			ovary(2)|central_nervous_system(1)|skin(1)	4														0.390244	94.760467	95.630765	32	50	KEEP	---	---	---	---	capture		Silent	SNP	179561783	179561783	16260	1	G	T	T	T	587	46	TDRD5	2	2
CACNA1E	777	broad.mit.edu	37	1	181765960	181765960	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:181765960C>A	uc001gow.2	+	c.6236C>A	c.(6235-6237)CCC>CAC	p.P2079H	CACNA1E_uc009wxs.2_Missense_Mutation_p.P1967H|CACNA1E_uc009wxt.2_Missense_Mutation_p.P1348H	NM_000721	NP_000712	Q15878	CAC1E_HUMAN	calcium channel, voltage-dependent, R type,	2122	Cytoplasmic (Potential).				energy reserve metabolic process|membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	voltage-gated calcium channel activity			ovary(3)|central_nervous_system(2)|pancreas(1)	6														0.6	18.050511	18.137704	6	4	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	181765960	181765960	2658	1	C	A	A	A	286	22	CACNA1E	2	2
ZNF648	127665	broad.mit.edu	37	1	182027050	182027050	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:182027050G>T	uc001goz.2	-	c.96C>A	c.(94-96)AAC>AAA	p.N32K		NM_001009992	NP_001009992	Q5T619	ZN648_HUMAN	zinc finger protein 648	32					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1						NSCLC(71;908 1374 5429 20458 35642)								0.474227	146.142486	146.198636	46	51	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	182027050	182027050	18658	1	G	T	T	T	464	36	ZNF648	2	2
CDC73	79577	broad.mit.edu	37	1	193218922	193218922	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:193218922G>T	uc001gtb.2	+	c.1480G>T	c.(1480-1482)GTA>TTA	p.V494L		NM_024529	NP_078805	Q6P1J9	CDC73_HUMAN	parafibromin	494					cell cycle|histone H2B ubiquitination|histone monoubiquitination|transcription, DNA-dependent	Cdc73/Paf1 complex	protein binding			parathyroid(44)|ovary(1)|pancreas(1)	46										312				0.301587	53.317845	55.522965	19	44	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	193218922	193218922	3214	1	G	T	T	T	624	48	CDC73	2	2
CFHR4	10877	broad.mit.edu	37	1	196887425	196887425	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:196887425A>T	uc001gtp.2	+	c.1626A>T	c.(1624-1626)ACA>ACT	p.T542T	CFHR4_uc001gto.2_Silent_p.T295T|CFHR4_uc009wyy.2_Silent_p.T541T	NM_006684	NM_006684	Q92496	FHR4_HUMAN	complement factor H-related 4 precursor	295	Sushi 5.					extracellular region	lipid transporter activity			ovary(1)|pancreas(1)	2														0.432836	91.365119	91.628547	29	38	KEEP	---	---	---	---	capture		Silent	SNP	196887425	196887425	3420	1	A	T	T	T	80	7	CFHR4	3	3
ASPM	259266	broad.mit.edu	37	1	197065223	197065223	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:197065223C>A	uc001gtu.2	-	c.8892G>T	c.(8890-8892)TGG>TGT	p.W2964C	ASPM_uc001gtv.2_Missense_Mutation_p.W1379C|ASPM_uc001gtw.3_Missense_Mutation_p.W812C	NM_018136	NP_060606	Q8IZT6	ASPM_HUMAN	asp (abnormal spindle)-like, microcephaly	2964	IQ 35.				mitosis	cytoplasm|nucleus	calmodulin binding			ovary(4)|central_nervous_system(2)	6														0.52809	307.648574	307.770611	94	84	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	197065223	197065223	1075	1	C	A	A	A	234	18	ASPM	2	2
CRB1	23418	broad.mit.edu	37	1	197390204	197390204	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:197390204C>A	uc001gtz.2	+	c.1246C>A	c.(1246-1248)CCT>ACT	p.P416T	CRB1_uc010poz.1_Missense_Mutation_p.P347T|CRB1_uc010ppa.1_Non-coding_Transcript|CRB1_uc009wza.2_Missense_Mutation_p.P304T|CRB1_uc010ppb.1_Missense_Mutation_p.P416T|CRB1_uc010ppc.1_Non-coding_Transcript|CRB1_uc010ppd.1_5'UTR|CRB1_uc001gub.1_Missense_Mutation_p.P65T	NM_201253	NP_957705	P82279	CRUM1_HUMAN	crumbs homolog 1 precursor	416	Extracellular (Potential).|EGF-like 10; calcium-binding (Potential).				cell-cell signaling|establishment or maintenance of cell polarity|response to stimulus|visual perception	apical plasma membrane|extracellular region|integral to membrane	calcium ion binding|protein binding			ovary(5)|large_intestine(1)	6														0.277228	69.87213	74.376139	28	73	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	197390204	197390204	3987	1	C	A	A	A	338	26	CRB1	2	2
TMCO4	255104	broad.mit.edu	37	1	20009803	20009804	+	Missense_Mutation	DNP	CT	AA	AA			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:20009803_20009804CT>AA	uc001bcn.2	-	c.1634_1635AG>TT	c.(1633-1635)CAG>CTT	p.Q545L	TMCO4_uc001bcm.2_Missense_Mutation_p.Q376L|TMCO4_uc001bco.1_Missense_Mutation_p.Q545L|TMCO4_uc001bcp.1_Missense_Mutation_p.Q505L	NM_181719	NP_859070	Q5TGY1	TMCO4_HUMAN	transmembrane and coiled-coil domains 4	545						integral to membrane					0		Colorectal(325;0.000147)|Renal(390;0.000469)|all_lung(284;0.00519)|Breast(348;0.00526)|Lung NSC(340;0.00544)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0439)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00708)|COAD - Colon adenocarcinoma(152;2.28e-05)|BRCA - Breast invasive adenocarcinoma(304;5.8e-05)|Kidney(64;0.000367)|GBM - Glioblastoma multiforme(114;0.000377)|KIRC - Kidney renal clear cell carcinoma(64;0.00459)|STAD - Stomach adenocarcinoma(196;0.0072)|READ - Rectum adenocarcinoma(331;0.0862)|Lung(427;0.223)										0.509434	80.520428	80.524708	27	26	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	20009803	20009804	16528	1	CT	AA	AA	AA	311	24	TMCO4	2	2
FAM58B	339521	broad.mit.edu	37	1	200183036	200183036	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:200183036C>T	uc009wzi.1	+	c.345C>T	c.(343-345)GAC>GAT	p.D115D		NM_001105517	NP_001098987	P0C7Q3	FA58B_HUMAN	family with sequence similarity 58 member B	115											0	Prostate(682;0.19)													0.25	37.594981	41.214749	16	48	KEEP	---	---	---	---	capture		Silent	SNP	200183036	200183036	5813	1	C	T	T	T	259	20	FAM58B	2	2
RNPEP	6051	broad.mit.edu	37	1	201973564	201973564	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:201973564C>G	uc001gxd.2	+	c.1734C>G	c.(1732-1734)ATC>ATG	p.I578M	RNPEP_uc001gxe.2_Missense_Mutation_p.I279M|RNPEP_uc001gxf.2_Missense_Mutation_p.I447M	NM_020216	NP_064601	Q9H4A4	AMPB_HUMAN	arginyl aminopeptidase	578					leukotriene biosynthetic process|proteolysis		epoxide hydrolase activity|zinc ion binding				0				KIRC - Kidney renal clear cell carcinoma(1967;3.23e-08)|Colorectal(1306;0.005)		GBM(19;39 479 7473 13131 19462)								0.279661	96.184722	101.369017	33	85	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	201973564	201973564	13988	1	C	G	G	G	395	31	RNPEP	3	3
CTSE	1510	broad.mit.edu	37	1	206331183	206331183	+	Nonstop_Mutation	SNP	T	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:206331183T>G	uc001hdu.2	+	c.1189T>G	c.(1189-1191)TAA>GAA	p.*397E	CTSE_uc001hdv.2_Silent_p.P349P|CTSE_uc010prs.1_Silent_p.P274P	NM_001910	NP_001901	P14091	CATE_HUMAN	cathepsin E isoform a preproprotein	397					antigen processing and presentation of exogenous peptide antigen via MHC class II|digestion|proteolysis	endosome	aspartic-type endopeptidase activity			ovary(1)	1			BRCA - Breast invasive adenocarcinoma(75;0.0754)											0.246377	42.843107	46.883562	17	52	KEEP	---	---	---	---	capture		Nonstop_Mutation	SNP	206331183	206331183	4192	1	T	G	G	G	689	53	CTSE	5	4
CR1	1378	broad.mit.edu	37	1	207741314	207741314	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:207741314C>A	uc001hfx.2	+	c.4098C>A	c.(4096-4098)AGC>AGA	p.S1366R	CR1_uc009xcl.1_Missense_Mutation_p.S466R|CR1_uc001hfy.2_Missense_Mutation_p.S916R|CR1_uc009xck.1_Missense_Mutation_p.S466R	NM_000651	NP_000642	P17927	CR1_HUMAN	complement receptor 1 isoform S precursor	916	Extracellular (Potential).|Sushi 14.				complement activation, classical pathway|innate immune response	integral to plasma membrane	complement receptor activity			ovary(3)	3														0.342857	66.545076	68.041531	24	46	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	207741314	207741314	3979	1	C	A	A	A	324	25	CR1	2	2
PLXNA2	5362	broad.mit.edu	37	1	208206713	208206713	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:208206713C>A	uc001hgz.2	-	c.5006G>T	c.(5005-5007)GGC>GTC	p.G1669V		NM_025179	NP_079455	O75051	PLXA2_HUMAN	plexin A2 precursor	1669	Cytoplasmic (Potential).				axon guidance	integral to membrane|intracellular|plasma membrane				ovary(2)	2				OV - Ovarian serous cystadenocarcinoma(81;0.199)										0.482143	72.275259	72.292542	27	29	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	208206713	208206713	12546	1	C	A	A	A	338	26	PLXNA2	2	2
PLXNA2	5362	broad.mit.edu	37	1	208390847	208390847	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:208390847G>A	uc001hgz.2	-	c.421C>T	c.(421-423)CGG>TGG	p.R141W	PLXNA2_uc001hha.3_Missense_Mutation_p.R195W	NM_025179	NP_079455	O75051	PLXA2_HUMAN	plexin A2 precursor	141	Extracellular (Potential).|Sema.				axon guidance	integral to membrane|intracellular|plasma membrane				ovary(2)	2				OV - Ovarian serous cystadenocarcinoma(81;0.199)										0.292683	90.761589	95.490207	36	87	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	208390847	208390847	12546	1	G	A	A	A	493	38	PLXNA2	1	1
SIPA1L2	57568	broad.mit.edu	37	1	232579372	232579372	+	Nonsense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:232579372C>T	uc001hvg.2	-	c.3413G>A	c.(3412-3414)TGG>TAG	p.W1138*	SIPA1L2_uc001hvf.2_Nonsense_Mutation_p.W212*	NM_020808	NP_065859	Q9P2F8	SI1L2_HUMAN	signal-induced proliferation-associated 1 like	1138					regulation of small GTPase mediated signal transduction	intracellular	GTPase activator activity			ovary(2)|central_nervous_system(2)|pancreas(1)	5		all_cancers(173;0.00605)|Prostate(94;0.128)|all_epithelial(177;0.186)												0.4	48.993515	49.342774	16	24	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	232579372	232579372	14825	1	C	T	T	T	273	21	SIPA1L2	5	2
LUZP1	7798	broad.mit.edu	37	1	23418280	23418280	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:23418280C>A	uc001bgk.2	-	c.2475G>T	c.(2473-2475)CAG>CAT	p.Q825H	LUZP1_uc010odv.1_Missense_Mutation_p.Q825H|LUZP1_uc001bgl.2_Missense_Mutation_p.Q825H|LUZP1_uc001bgm.1_Missense_Mutation_p.Q825H	NM_033631	NP_361013	Q86V48	LUZP1_HUMAN	leucine zipper protein 1	825						nucleus					0		Colorectal(325;3.46e-05)|Lung NSC(340;4.15e-05)|all_lung(284;6.64e-05)|Renal(390;0.000219)|Ovarian(437;0.00373)|Breast(348;0.00815)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;4.88e-27)|Colorectal(126;8.36e-08)|COAD - Colon adenocarcinoma(152;4.31e-06)|GBM - Glioblastoma multiforme(114;8.64e-05)|BRCA - Breast invasive adenocarcinoma(304;0.00112)|KIRC - Kidney renal clear cell carcinoma(1967;0.00176)|STAD - Stomach adenocarcinoma(196;0.0146)|READ - Rectum adenocarcinoma(331;0.0686)|Lung(427;0.0967)|LUSC - Lung squamous cell carcinoma(448;0.199)										0.413793	66.349628	66.734497	24	34	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	23418280	23418280	9462	1	C	A	A	A	311	24	LUZP1	2	2
RYR2	6262	broad.mit.edu	37	1	237670064	237670064	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:237670064C>A	uc001hyl.1	+	c.2668C>A	c.(2668-2670)CAT>AAT	p.H890N		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	890	Cytoplasmic (By similarity).|1.|4 X approximate repeats.				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)											0.565217	42.677266	42.762351	13	10	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	237670064	237670064	14249	1	C	A	A	A	273	21	RYR2	2	2
RYR2	6262	broad.mit.edu	37	1	237789102	237789102	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:237789102C>A	uc001hyl.1	+	c.6164C>A	c.(6163-6165)TCC>TAC	p.S2055Y		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	2055	Cytoplasmic (By similarity).|4 X approximate repeats.				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)											0.272727	14.774664	15.777887	6	16	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	237789102	237789102	14249	1	C	A	A	A	390	30	RYR2	2	2
RYR2	6262	broad.mit.edu	37	1	237870278	237870278	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:237870278G>A	uc001hyl.1	+	c.9610G>A	c.(9610-9612)GTT>ATT	p.V3204I	RYR2_uc010pxz.1_Missense_Mutation_p.V159I	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	3204					cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)											0.271318	81.96244	88.139867	35	94	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	237870278	237870278	14249	1	G	A	A	A	624	48	RYR2	2	2
RYR2	6262	broad.mit.edu	37	1	237948103	237948103	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:237948103C>A	uc001hyl.1	+	c.13091C>A	c.(13090-13092)ACC>AAC	p.T4364N	RYR2_uc010pya.1_Missense_Mutation_p.T779N	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	4364					cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)											0.2	15.509572	18.435957	7	28	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	237948103	237948103	14249	1	C	A	A	A	234	18	RYR2	2	2
NLRP3	114548	broad.mit.edu	37	1	247586625	247586625	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:247586625G>T	uc001icr.2	+	c.377G>T	c.(376-378)AGA>ATA	p.R126I	NLRP3_uc001ics.2_Missense_Mutation_p.R126I|NLRP3_uc001icu.2_Missense_Mutation_p.R126I|NLRP3_uc001icw.2_Missense_Mutation_p.R126I|NLRP3_uc001icv.2_Missense_Mutation_p.R126I|NLRP3_uc010pyw.1_Missense_Mutation_p.R124I|NLRP3_uc001ict.1_Missense_Mutation_p.R124I	NM_001079821	NP_001073289	Q96P20	NALP3_HUMAN	NLR family, pyrin domain containing 3 isoform a	126					detection of biotic stimulus|induction of apoptosis|inflammatory response|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|positive regulation of interleukin-1 beta secretion|protein oligomerization|signal transduction	cytoplasm	ATP binding|peptidoglycan binding|protein binding			ovary(5)|lung(2)|skin(2)|upper_aerodigestive_tract(1)|pancreas(1)	11	all_cancers(71;9.66e-05)|all_epithelial(71;1.85e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)	all_cancers(173;0.0172)	OV - Ovarian serous cystadenocarcinoma(106;0.0141)							412				0.243902	47.667	52.563467	20	62	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	247586625	247586625	10881	1	G	T	T	T	429	33	NLRP3	2	2
NLRP3	114548	broad.mit.edu	37	1	247588117	247588117	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:247588117C>A	uc001icr.2	+	c.1372C>A	c.(1372-1374)CAG>AAG	p.Q458K	NLRP3_uc001ics.2_Missense_Mutation_p.Q458K|NLRP3_uc001icu.2_Missense_Mutation_p.Q458K|NLRP3_uc001icw.2_Missense_Mutation_p.Q458K|NLRP3_uc001icv.2_Missense_Mutation_p.Q458K|NLRP3_uc010pyw.1_Missense_Mutation_p.Q456K|NLRP3_uc001ict.1_Missense_Mutation_p.Q456K	NM_001079821	NP_001073289	Q96P20	NALP3_HUMAN	NLR family, pyrin domain containing 3 isoform a	458	NACHT.				detection of biotic stimulus|induction of apoptosis|inflammatory response|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|positive regulation of interleukin-1 beta secretion|protein oligomerization|signal transduction	cytoplasm	ATP binding|peptidoglycan binding|protein binding			ovary(5)|lung(2)|skin(2)|upper_aerodigestive_tract(1)|pancreas(1)	11	all_cancers(71;9.66e-05)|all_epithelial(71;1.85e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)	all_cancers(173;0.0172)	OV - Ovarian serous cystadenocarcinoma(106;0.0141)							412				0.214286	14.134975	16.245586	6	22	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	247588117	247588117	10881	1	C	A	A	A	273	21	NLRP3	2	2
PAFAH2	5051	broad.mit.edu	37	1	26310565	26310565	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:26310565C>A	uc001bld.3	-	c.424G>T	c.(424-426)GCA>TCA	p.A142S	PAFAH2_uc001ble.3_Missense_Mutation_p.A142S	NM_000437	NP_000428	Q99487	PAFA2_HUMAN	platelet-activating factor acetylhydrolase 2	142					lipid catabolic process	cytoplasm	1-alkyl-2-acetylglycerophosphocholine esterase activity|phospholipid binding			ovary(2)	2		Colorectal(325;3.47e-05)|Lung NSC(340;6.23e-05)|all_lung(284;9.48e-05)|Renal(390;0.0007)|Ovarian(437;0.00473)|Breast(348;0.0155)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0298)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|OV - Ovarian serous cystadenocarcinoma(117;3.84e-25)|Colorectal(126;3.57e-08)|COAD - Colon adenocarcinoma(152;1.84e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.000794)|BRCA - Breast invasive adenocarcinoma(304;0.00105)|STAD - Stomach adenocarcinoma(196;0.00155)|GBM - Glioblastoma multiforme(114;0.00717)|READ - Rectum adenocarcinoma(331;0.0649)										0.202614	66.788376	79.248265	31	122	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	26310565	26310565	11803	1	C	A	A	A	338	26	PAFAH2	2	2
FGR	2268	broad.mit.edu	37	1	27949654	27949654	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:27949654C>T	uc001boj.2	-	c.228G>A	c.(226-228)GGG>GGA	p.G76G	FGR_uc001bok.2_Silent_p.G76G|FGR_uc001bol.2_Silent_p.G76G|FGR_uc001bom.2_Silent_p.G76G	NM_005248	NP_005239	P09769	FGR_HUMAN	proto-oncogene tyrosine-protein kinase FGR	76					platelet activation|protein phosphorylation|response to virus	cytosol	ATP binding|non-membrane spanning protein tyrosine kinase activity			skin(1)	1		all_lung(284;2.05e-05)|Colorectal(325;3.46e-05)|Lung NSC(340;3.67e-05)|Renal(390;0.00121)|Breast(348;0.0021)|Ovarian(437;0.00503)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0381)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0416)|OV - Ovarian serous cystadenocarcinoma(117;1.25e-24)|Colorectal(126;1.24e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|BRCA - Breast invasive adenocarcinoma(304;0.00244)|KIRC - Kidney renal clear cell carcinoma(1967;0.0027)|STAD - Stomach adenocarcinoma(196;0.00303)|READ - Rectum adenocarcinoma(331;0.0419)						129				0.318182	17.111835	17.761685	7	15	KEEP	---	---	---	---	capture		Silent	SNP	27949654	27949654	6111	1	C	T	T	T	379	30	FGR	2	2
BAI2	576	broad.mit.edu	37	1	32222212	32222212	+	Nonsense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:32222212T>A	uc001btn.2	-	c.226A>T	c.(226-228)AAG>TAG	p.K76*	BAI2_uc010ogp.1_Nonsense_Mutation_p.K64*|BAI2_uc010ogq.1_Nonsense_Mutation_p.K76*|BAI2_uc001bto.2_Nonsense_Mutation_p.K76*|BAI2_uc001btq.1_Nonsense_Mutation_p.K64*|BAI2_uc010ogr.1_Nonsense_Mutation_p.K64*	NM_001703	NP_001694	O60241	BAI2_HUMAN	brain-specific angiogenesis inhibitor 2	76	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(2)|central_nervous_system(1)	3		Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0606)|all_neural(195;0.0837)|Breast(348;0.174)		STAD - Stomach adenocarcinoma(196;0.0557)										0.352941	17.172188	17.48419	6	11	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	32222212	32222212	1320	1	T	A	A	A	819	63	BAI2	5	3
CSMD2	114784	broad.mit.edu	37	1	34038154	34038154	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:34038154G>T	uc001bxm.1	-	c.7714C>A	c.(7714-7716)CTG>ATG	p.L2572M	CSMD2_uc001bxn.1_Missense_Mutation_p.L2574M	NM_052896	NP_443128	Q7Z408	CSMD2_HUMAN	CUB and Sushi multiple domains 2	2574	Extracellular (Potential).|Sushi 15.					integral to membrane|plasma membrane	protein binding			ovary(5)|pancreas(1)	6		Myeloproliferative disorder(586;0.0294)|all_neural(195;0.249)												0.55914	145.932126	146.206709	52	41	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	34038154	34038154	4086	1	G	T	T	T	425	33	CSMD2	2	2
GJA4	2701	broad.mit.edu	37	1	35260672	35260672	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:35260672C>A	uc009vul.2	+	c.1086C>A	c.(1084-1086)TCC>TCA	p.S362S	GJA4_uc001bya.2_Silent_p.S286S|GJA4_uc009vum.1_Silent_p.S286S	NM_002060	NP_002051	P35212	CXA4_HUMAN	connexin 37	286	Cytoplasmic (Potential).				cell-cell junction assembly	integral to plasma membrane				central_nervous_system(1)	1		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.234)												0.266667	10.393819	11.131177	4	11	KEEP	---	---	---	---	capture		Silent	SNP	35260672	35260672	6671	1	C	A	A	A	262	21	GJA4	2	2
DLGAP3	58512	broad.mit.edu	37	1	35334650	35334650	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:35334650C>T	uc001byc.2	-	c.2041G>A	c.(2041-2043)GTG>ATG	p.V681M		NM_001080418	NP_001073887	O95886	DLGP3_HUMAN	discs, large (Drosophila) homolog-associated	681					cell-cell signaling	cell junction|postsynaptic density|postsynaptic membrane		p.V681M(1)		ovary(3)	3		Myeloproliferative disorder(586;0.0393)												0.357143	14.477734	14.726452	5	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	35334650	35334650	4741	1	C	T	T	T	247	19	DLGAP3	1	1
GPBP1L1	60313	broad.mit.edu	37	1	46120390	46120390	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:46120390C>A	uc001coq.2	-	c.302G>T	c.(301-303)CGA>CTA	p.R101L		NM_021639	NP_067652	Q9HC44	GPBL1_HUMAN	GC-rich promoter binding protein 1-like 1	101					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)													0.321429	27.977082	28.763808	9	19	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	46120390	46120390	6870	1	C	A	A	A	403	31	GPBP1L1	1	1
TAL1	6886	broad.mit.edu	37	1	47685773	47685773	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:47685773C>A	uc001cqx.2	-	c.615G>T	c.(613-615)GGG>GGT	p.G205G	TAL1_uc009vyq.2_5'UTR|TAL1_uc001cqy.2_Silent_p.G205G	NM_003189	NP_003180	P17542	TAL1_HUMAN	T-cell acute lymphocytic leukemia 1	205	Helix-loop-helix motif.				cell fate commitment|cell proliferation|embryonic hemopoiesis|erythrocyte differentiation|positive regulation of cell division|positive regulation of chromatin assembly or disassembly|positive regulation of erythrocyte differentiation|positive regulation of gene-specific transcription from RNA polymerase II promoter|positive regulation of mitotic cell cycle|positive regulation of protein complex assembly	nuclear chromatin	E-box binding|histone deacetylase binding|sequence-specific DNA binding transcription factor activity|transcription activator activity				0										17				0.285714	15.70823	16.852699	8	20	KEEP	---	---	---	---	capture		Silent	SNP	47685773	47685773	16062	1	C	A	A	A	275	22	TAL1	2	2
DMRTB1	63948	broad.mit.edu	37	1	53930518	53930518	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:53930518C>A	uc001cvq.1	+	c.959C>A	c.(958-960)ACT>AAT	p.T320N		NM_033067	NP_149056	Q96MA1	DMRTB_HUMAN	DMRT-like family B with proline-rich C-terminal,	320					regulation of transcription, DNA-dependent|sex differentiation	nucleus	DNA binding|metal ion binding|sequence-specific DNA binding transcription factor activity				0														0.46875	94.839458	94.893433	30	34	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	53930518	53930518	4770	1	C	A	A	A	260	20	DMRTB1	2	2
C1orf87	127795	broad.mit.edu	37	1	60538214	60538214	+	Silent	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:60538214T>A	uc001czs.1	-	c.102A>T	c.(100-102)CCA>CCT	p.P34P		NM_152377	NP_689590	Q8N0U7	CA087_HUMAN	hypothetical protein LOC127795	34							calcium ion binding			ovary(1)|breast(1)	2						NSCLC(75;811 1386 4923 13371 51772)								0.102041	12.002087	42.921903	20	176	KEEP	---	---	---	---	capture		Silent	SNP	60538214	60538214	2140	1	T	A	A	A	808	63	C1orf87	3	3
HES3	390992	broad.mit.edu	37	1	6305549	6305549	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:6305549C>A	uc009vly.1	+	c.543C>A	c.(541-543)CCC>CCA	p.P181P		NM_001024598	NP_001019769	Q5TGS1	HES3_HUMAN	hairy and enhancer of split 3	181					transcription, DNA-dependent	nucleus	DNA binding|transcription regulator activity				0	Ovarian(185;0.0634)	all_cancers(23;2.48e-32)|all_epithelial(116;1.14e-17)|all_lung(118;2.85e-06)|all_neural(13;3.68e-06)|all_hematologic(16;2.39e-05)|Lung NSC(185;3.77e-05)|Acute lymphoblastic leukemia(12;0.000372)|Glioma(11;0.00127)|Renal(390;0.00188)|Colorectal(325;0.00342)|Breast(487;0.00475)|Hepatocellular(190;0.0218)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.15)		Epithelial(90;1.2e-37)|GBM - Glioblastoma multiforme(13;3.2e-29)|OV - Ovarian serous cystadenocarcinoma(86;2.52e-19)|Colorectal(212;1.19e-07)|COAD - Colon adenocarcinoma(227;1.3e-05)|Kidney(185;4.88e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000871)|BRCA - Breast invasive adenocarcinoma(365;0.00105)|STAD - Stomach adenocarcinoma(132;0.00308)|READ - Rectum adenocarcinoma(331;0.0642)|Lung(427;0.241)										0.5	16.875406	16.875406	5	5	KEEP	---	---	---	---	capture		Silent	SNP	6305549	6305549	7350	1	C	A	A	A	288	23	HES3	1	1
LEPR	3953	broad.mit.edu	37	1	66102113	66102113	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:66102113G>T	uc001dci.2	+	c.2913G>T	c.(2911-2913)GAG>GAT	p.E971D	LEPR_uc009waq.2_3'UTR	NM_002303	NP_002294	P48357	LEPR_HUMAN	leptin receptor isoform 1	971	Cytoplasmic (Potential).				energy reserve metabolic process|multicellular organismal development	extracellular region|integral to membrane|plasma membrane	cytokine receptor activity				0				OV - Ovarian serous cystadenocarcinoma(397;0.00722)|KIRC - Kidney renal clear cell carcinoma(1967;0.094)										0.114583	22.336937	50.43385	22	170	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	66102113	66102113	9052	1	G	T	T	T	451	35	LEPR	2	2
LEPR	3953	broad.mit.edu	37	1	66102442	66102442	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:66102442G>T	uc001dci.2	+	c.3242G>T	c.(3241-3243)GGG>GTG	p.G1081V	LEPR_uc009waq.2_3'UTR	NM_002303	NP_002294	P48357	LEPR_HUMAN	leptin receptor isoform 1	1081	Cytoplasmic (Potential).				energy reserve metabolic process|multicellular organismal development	extracellular region|integral to membrane|plasma membrane	cytokine receptor activity				0				OV - Ovarian serous cystadenocarcinoma(397;0.00722)|KIRC - Kidney renal clear cell carcinoma(1967;0.094)										0.838235	565.902965	588.079793	171	33	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	66102442	66102442	9052	1	G	T	T	T	559	43	LEPR	2	2
TCTEX1D1	200132	broad.mit.edu	37	1	67242971	67242971	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:67242971G>T	uc001dcv.2	+	c.374G>T	c.(373-375)CGG>CTG	p.R125L	TCTEX1D1_uc009wau.2_Non-coding_Transcript|TCTEX1D1_uc009wav.2_Non-coding_Transcript	NM_152665	NP_689878	Q8N7M0	TC1D1_HUMAN	Tctex1 domain containing 1	125											0														0.699387	396.393474	402.209133	114	49	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	67242971	67242971	16245	1	G	T	T	T	507	39	TCTEX1D1	1	1
FPGT	8790	broad.mit.edu	37	1	74670277	74670277	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:74670277G>A	uc001dgb.1	+	c.546G>A	c.(544-546)AGG>AGA	p.R182R	TNNI3K_uc001dgc.1_Intron|TNNI3K_uc001dgd.2_Intron|TNNI3K_uc001dge.1_Intron|FPGT_uc010oqt.1_Intron|FPGT_uc010oqu.1_Intron|FPGT_uc010oqv.1_Intron	NM_003838	NP_003829	O14772	FPGT_HUMAN	fucose-1-phosphate guanyltransferase	182					fucose metabolic process	cytoplasm	fucose-1-phosphate guanylyltransferase activity|GTP binding				0														0.09816	10.722791	37.027323	16	147	KEEP	---	---	---	---	capture		Silent	SNP	74670277	74670277	6283	1	G	A	A	A	568	44	FPGT	2	2
C1orf173	127254	broad.mit.edu	37	1	75055645	75055645	+	Nonsense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:75055645T>A	uc001dgg.2	-	c.1846A>T	c.(1846-1848)AGA>TGA	p.R616*	C1orf173_uc001dgi.3_Nonsense_Mutation_p.R410*	NM_001002912	NP_001002912	Q5RHP9	CA173_HUMAN	hypothetical protein LOC127254	616	Glu-rich.									ovary(3)|central_nervous_system(1)	4														0.778626	367.02153	376.382184	102	29	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	75055645	75055645	2081	1	T	A	A	A	713	55	C1orf173	5	3
AK5	26289	broad.mit.edu	37	1	77806104	77806104	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:77806104C>A	uc001dhn.2	+	c.742C>A	c.(742-744)CAG>AAG	p.Q248K	AK5_uc001dho.2_Missense_Mutation_p.Q222K	NM_174858	NP_777283	Q9Y6K8	KAD5_HUMAN	adenylate kinase 5 isoform 1	248					ADP biosynthetic process|ATP metabolic process|dADP biosynthetic process|nucleobase, nucleoside and nucleotide interconversion|pyrimidine ribonucleotide biosynthetic process|signal transduction	centrosome|cytosol	adenylate kinase activity|ATP binding|cAMP-dependent protein kinase regulator activity|nucleoside kinase activity			skin(1)	1														0.813253	440.92946	456.172743	135	31	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	77806104	77806104	446	1	C	A	A	A	377	29	AK5	2	2
SLC45A1	50651	broad.mit.edu	37	1	8384429	8384429	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:8384429C>A	uc001apb.2	+	c.40C>A	c.(40-42)CTC>ATC	p.L14I		NM_001080397	NP_001073866	Q9Y2W3	S45A1_HUMAN	DNB5	14					carbohydrate transport	integral to membrane	symporter activity			central_nervous_system(2)|pancreas(1)	3	Ovarian(185;0.0661)|all_lung(157;0.127)	all_epithelial(116;1.22e-15)|all_lung(118;0.000147)|Lung NSC(185;0.000251)|Renal(390;0.000469)|Colorectal(325;0.00578)|Breast(348;0.00686)|Hepatocellular(190;0.0228)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.11)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|all cancers(8;3.95e-66)|GBM - Glioblastoma multiforme(8;5.93e-33)|Colorectal(212;2.86e-07)|COAD - Colon adenocarcinoma(227;3.11e-05)|Kidney(185;5.33e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000513)|KIRC - Kidney renal clear cell carcinoma(229;0.000979)|STAD - Stomach adenocarcinoma(132;0.00199)|READ - Rectum adenocarcinoma(331;0.0649)										0.407895	83.765792	84.337794	31	45	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	8384429	8384429	15137	1	C	A	A	A	312	24	SLC45A1	2	2
KLHL17	339451	broad.mit.edu	37	1	898278	898278	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:898278G>A	uc001aca.1	+	c.1023G>A	c.(1021-1023)GGG>GGA	p.G341G	KLHL17_uc001acc.1_Non-coding_Transcript|KLHL17_uc010nyb.1_Silent_p.G64G	NM_198317	NP_938073	Q6TDP4	KLH17_HUMAN	kelch-like 17	341	Interaction with F-actin (By similarity).					cell junction|postsynaptic density|postsynaptic membrane					0	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;9.48e-15)|all_lung(118;9.67e-07)|Lung NSC(185;5.59e-05)|Renal(390;0.00571)|Breast(487;0.0183)|Hepatocellular(190;0.0268)|Myeloproliferative disorder(586;0.028)|Ovarian(437;0.127)|Lung SC(97;0.217)		UCEC - Uterine corpus endometrioid carcinoma (11;0.00459)|Epithelial(90;1.52e-38)|OV - Ovarian serous cystadenocarcinoma(86;5.59e-23)|Colorectal(212;0.000155)|COAD - Colon adenocarcinoma(227;0.000193)|BRCA - Breast invasive adenocarcinoma(365;0.000469)|Kidney(185;0.00227)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0339)|Lung(427;0.199)										0.3	15.34537	16.058362	6	14	KEEP	---	---	---	---	capture		Silent	SNP	898278	898278	8684	1	G	A	A	A	535	42	KLHL17	2	2
AGRN	375790	broad.mit.edu	37	1	981168	981168	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:981168G>A	uc001ack.1	+	c.2592G>A	c.(2590-2592)GGG>GGA	p.G864G		NM_198576	NP_940978	O00468	AGRIN_HUMAN	agrin precursor	864	Laminin EGF-like 2.				axon guidance|clustering of voltage-gated sodium channels|muscarinic acetylcholine receptor signaling pathway|receptor clustering	basal lamina	laminin binding|structural constituent of cytoskeleton			central_nervous_system(2)|breast(1)	3	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;8.75e-19)|all_lung(118;2.3e-08)|Lung NSC(185;2.38e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Lung SC(97;0.128)		UCEC - Uterine corpus endometrioid carcinoma (11;0.00462)|Epithelial(90;5.98e-38)|OV - Ovarian serous cystadenocarcinoma(86;5.43e-23)|Colorectal(212;5.97e-05)|COAD - Colon adenocarcinoma(227;0.000201)|Kidney(185;0.0024)|BRCA - Breast invasive adenocarcinoma(365;0.00246)|STAD - Stomach adenocarcinoma(132;0.00645)|KIRC - Kidney renal clear cell carcinoma(229;0.0354)|Lung(427;0.201)										0.350877	55.17955	56.299001	20	37	KEEP	---	---	---	---	capture		Silent	SNP	981168	981168	400	1	G	A	A	A	535	42	AGRN	2	2
AGRN	375790	broad.mit.edu	37	1	986125	986125	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr1:986125C>A	uc001ack.1	+	c.5161C>A	c.(5161-5163)CTG>ATG	p.L1721M		NM_198576	NP_940978	O00468	AGRIN_HUMAN	agrin precursor	1721	Laminin G-like 2.				axon guidance|clustering of voltage-gated sodium channels|muscarinic acetylcholine receptor signaling pathway|receptor clustering	basal lamina	laminin binding|structural constituent of cytoskeleton			central_nervous_system(2)|breast(1)	3	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;8.75e-19)|all_lung(118;2.3e-08)|Lung NSC(185;2.38e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Lung SC(97;0.128)		UCEC - Uterine corpus endometrioid carcinoma (11;0.00462)|Epithelial(90;5.98e-38)|OV - Ovarian serous cystadenocarcinoma(86;5.43e-23)|Colorectal(212;5.97e-05)|COAD - Colon adenocarcinoma(227;0.000201)|Kidney(185;0.0024)|BRCA - Breast invasive adenocarcinoma(365;0.00246)|STAD - Stomach adenocarcinoma(132;0.00645)|KIRC - Kidney renal clear cell carcinoma(229;0.0354)|Lung(427;0.201)										0.333333	8.021755	8.243283	3	6	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	986125	986125	400	1	C	A	A	A	311	24	AGRN	2	2
CSRP2BP	57325	broad.mit.edu	37	20	18143374	18143374	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:18143374C>T	uc002wqj.2	+	c.1456C>T	c.(1456-1458)CCG>TCG	p.P486S	CSRP2BP_uc002wqk.2_Missense_Mutation_p.P358S|CSRP2BP_uc010zru.1_Missense_Mutation_p.P357S	NM_020536	NP_065397	Q9H8E8	CSR2B_HUMAN	CSRP2 binding protein	486					histone H3 acetylation	Ada2/Gcn5/Ada3 transcription activator complex|cytoplasm	LIM domain binding|N-acetyltransferase activity			ovary(2)	2														0.256757	47.993672	51.961231	19	55	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	18143374	18143374	4109	20	C	T	T	T	390	30	CSRP2BP	2	2
DNMT3B	1789	broad.mit.edu	37	20	31388040	31388040	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:31388040G>T	uc002wyc.2	+	c.1841G>T	c.(1840-1842)GGA>GTA	p.G614V	DNMT3B_uc010zty.1_Non-coding_Transcript|DNMT3B_uc002wyd.2_Missense_Mutation_p.G594V|DNMT3B_uc002wye.2_Missense_Mutation_p.G594V|DNMT3B_uc010gee.2_Non-coding_Transcript|DNMT3B_uc010gef.2_Non-coding_Transcript|DNMT3B_uc010ztz.1_Missense_Mutation_p.G552V|DNMT3B_uc010zua.1_Missense_Mutation_p.G518V|DNMT3B_uc002wyf.2_Missense_Mutation_p.G606V|DNMT3B_uc002wyg.2_Missense_Mutation_p.G313V|DNMT3B_uc010geg.2_5'Flank|DNMT3B_uc010geh.2_5'Flank	NM_006892	NP_008823	Q9UBC3	DNM3B_HUMAN	DNA cytosine-5 methyltransferase 3 beta isoform	614					negative regulation of histone H3-K9 methylation|positive regulation of gene expression|positive regulation of histone H3-K4 methylation		protein binding|transcription corepressor activity|zinc ion binding			ovary(2)|lung(1)	3										1211				0.413333	87.708734	88.200966	31	44	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	31388040	31388040	4860	20	G	T	T	T	533	41	DNMT3B	2	2
AHCY	191	broad.mit.edu	37	20	32878141	32878141	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:32878141C>T	uc002xai.2	-	c.969G>A	c.(967-969)CCG>CCA	p.P323P	AHCY_uc002xaj.2_Silent_p.P295P	NM_000687	NP_000678	P23526	SAHH_HUMAN	adenosylhomocysteinase isoform 1	323					methylation|xenobiotic metabolic process	cytosol|melanosome	adenosylhomocysteinase activity|protein binding				0														0.397727	94.629043	95.453386	35	53	KEEP	---	---	---	---	capture		Silent	SNP	32878141	32878141	412	20	C	T	T	T	340	27	AHCY	1	1
C20orf152	140894	broad.mit.edu	37	20	34596256	34596256	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:34596256C>A	uc002xer.1	+	c.1008C>A	c.(1006-1008)ATC>ATA	p.I336I	C20orf152_uc002xes.1_Silent_p.I336I|C20orf152_uc010gfp.1_Non-coding_Transcript	NM_080834	NP_543024	Q96M20	CT152_HUMAN	hypothetical protein LOC140894	336											0	Breast(12;0.00631)													0.288889	103.874577	109.266698	39	96	KEEP	---	---	---	---	capture		Silent	SNP	34596256	34596256	2169	20	C	A	A	A	369	29	C20orf152	2	2
FAM83D	81610	broad.mit.edu	37	20	37576623	37576623	+	Silent	SNP	C	G	G	rs77993973	by1000genomes	TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:37576623C>G	uc002xjg.2	+	c.846C>G	c.(844-846)CGC>CGG	p.R282R		NM_030919	NP_112181	Q9H4H8	FA83D_HUMAN	hypothetical protein LOC81610	252					cell division|mitosis	cytoplasm|spindle pole				ovary(3)	3		Myeloproliferative disorder(115;0.00878)												0.15	18.965324	25.986333	9	51	KEEP	---	---	---	---	capture		Silent	SNP	37576623	37576623	5862	20	C	G	G	G	340	27	FAM83D	3	3
PABPC1L	80336	broad.mit.edu	37	20	43552898	43552898	+	Splice_Site_SNP	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:43552898G>T	uc010ggv.1	+	c.972_splice	c.e7+1	p.K324_splice	PABPC1L_uc010zwq.1_Splice_Site_SNP|PABPC1L_uc002xmv.2_Splice_Site_SNP	NM_001124756	NP_001118228			poly(A)-binding protein, cytoplasmic 1-like								nucleotide binding|RNA binding			ovary(1)	1														0.534884	75.047238	75.09573	23	20	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	43552898	43552898	11777	20	G	T	T	T	572	44	PABPC1L	5	2
ARFGEF2	10564	broad.mit.edu	37	20	47607618	47607618	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:47607618C>T	uc002xtx.3	+	c.2856C>T	c.(2854-2856)TCC>TCT	p.S952S	ARFGEF2_uc010zyf.1_Silent_p.S245S	NM_006420	NP_006411	Q9Y6D5	BIG2_HUMAN	ADP-ribosylation factor guanine	952					exocytosis|intracellular signal transduction|regulation of ARF protein signal transduction	cytosol|Golgi membrane	ARF guanyl-nucleotide exchange factor activity			breast(3)	3			BRCA - Breast invasive adenocarcinoma(12;0.00148)|Colorectal(8;0.198)			Esophageal Squamous(176;1738 1974 26285 33069 35354)								0.229167	27.303129	30.530745	11	37	KEEP	---	---	---	---	capture		Silent	SNP	47607618	47607618	864	20	C	T	T	T	275	22	ARFGEF2	2	2
ATP9A	10079	broad.mit.edu	37	20	50310572	50310572	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:50310572C>A	uc002xwg.1	-	c.617G>T	c.(616-618)TGC>TTC	p.C206F	ATP9A_uc010gih.1_Intron|ATP9A_uc002xwf.1_5'UTR	NM_006045	NP_006036	O75110	ATP9A_HUMAN	ATPase, class II, type 9A	206	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(4)	4														0.693878	113.068062	114.712712	34	15	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	50310572	50310572	1217	20	C	A	A	A	325	25	ATP9A	2	2
BMP7	655	broad.mit.edu	37	20	55758795	55758795	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:55758795C>T	uc010gip.1	-	c.941G>A	c.(940-942)CGG>CAG	p.R314Q	BMP7_uc010giq.1_Intron|BMP7_uc002xyc.2_Missense_Mutation_p.R314Q	NM_001719	NP_001710	P18075	BMP7_HUMAN	bone morphogenetic protein 7 precursor	314					BMP signaling pathway|cartilage development|cellular response to hypoxia|epithelial to mesenchymal transition|growth|mesonephros development|negative regulation of gene-specific transcription|negative regulation of glomerular mesangial cell proliferation|negative regulation of MAP kinase activity|negative regulation of mitosis|negative regulation of neuron differentiation|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|negative regulation of phosphorylation|negative regulation of striated muscle cell apoptosis|ossification|pathway-restricted SMAD protein phosphorylation|positive regulation of bone mineralization|positive regulation of osteoblast differentiation|positive regulation of pathway-restricted SMAD protein phosphorylation|protein localization to nucleus|regulation of removal of superoxide radicals|SMAD protein signal transduction|steroid hormone mediated signaling pathway|ureteric bud development	extracellular space	cytokine activity|growth factor activity				0	all_lung(29;0.0133)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(4;2.49e-13)|Epithelial(14;1.74e-08)|all cancers(14;2.05e-07)											0.245902	37.678664	41.284067	15	46	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	55758795	55758795	1490	20	C	T	T	T	299	23	BMP7	1	1
CTCFL	140690	broad.mit.edu	37	20	56094399	56094399	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:56094399C>T	uc010giw.1	-	c.789G>A	c.(787-789)ATG>ATA	p.M263I	CTCFL_uc010gix.1_Missense_Mutation_p.M263I|CTCFL_uc002xym.2_Missense_Mutation_p.M263I|CTCFL_uc010giz.1_5'UTR|CTCFL_uc010giy.1_5'UTR|CTCFL_uc010gja.1_Missense_Mutation_p.M263I|CTCFL_uc010gjb.1_Missense_Mutation_p.M263I|CTCFL_uc010gjc.1_Missense_Mutation_p.M263I|CTCFL_uc010gjd.1_Missense_Mutation_p.M263I|CTCFL_uc010gje.2_Missense_Mutation_p.M263I|CTCFL_uc010gjf.2_Missense_Mutation_p.M58I|CTCFL_uc010gjg.2_5'UTR|CTCFL_uc010gjh.1_Missense_Mutation_p.M263I|CTCFL_uc010gji.1_Missense_Mutation_p.M58I|CTCFL_uc010gjj.1_Missense_Mutation_p.M263I|CTCFL_uc010gjk.1_Missense_Mutation_p.M263I|CTCFL_uc010gjl.1_Missense_Mutation_p.M263I	NM_080618	NP_542185	Q8NI51	CTCFL_HUMAN	CCCTC-binding factor-like protein	263	C2H2-type 1.				cell cycle|DNA methylation involved in gamete generation|histone methylation|positive regulation of gene expression|regulation of gene expression by genetic imprinting|regulation of histone H3-K4 methylation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	histone binding|promoter binding|transcription activator activity|zinc ion binding			ovary(2)|large_intestine(1)	3	Lung NSC(12;0.00132)|all_lung(29;0.00433)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(13;3.95e-12)|Epithelial(14;3.41e-08)|all cancers(14;2.09e-07)											0.166667	27.876156	37.962464	16	80	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	56094399	56094399	4160	20	C	T	T	T	221	17	CTCFL	2	2
PCK1	5105	broad.mit.edu	37	20	56139537	56139537	+	Splice_Site_SNP	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:56139537G>T	uc002xyn.3	+	c.1187_splice	c.e8-1	p.G396_splice	PCK1_uc010zzm.1_Splice_Site_SNP_p.G79_splice	NM_002591	NP_002582			cytosolic phosphoenolpyruvate carboxykinase 1						gluconeogenesis|glucose homeostasis|glycerol biosynthetic process from pyruvate|response to insulin stimulus	cytosol|nucleus	carboxylic acid binding|GTP binding|magnesium ion binding|manganese ion binding|phosphoenolpyruvate carboxykinase (GTP) activity				0	Lung NSC(12;0.000764)|all_lung(29;0.00264)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(13;9.88e-12)|Epithelial(14;3.41e-08)|all cancers(14;2.13e-07)											0.242424	38.270798	42.261419	16	50	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	56139537	56139537	12001	20	G	T	T	T	455	35	PCK1	5	2
YTHDF1	54915	broad.mit.edu	37	20	61834033	61834033	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:61834033C>A	uc002yeh.2	-	c.1259G>T	c.(1258-1260)CGC>CTC	p.R420L	YTHDF1_uc011aaq.1_Missense_Mutation_p.R370L	NM_017798	NP_060268	Q9BYJ9	YTHD1_HUMAN	YTH domain family, member 1	420	YTH.									ovary(2)	2														0.452055	107.71442	107.852464	33	40	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	61834033	61834033	18081	20	C	A	A	A	351	27	YTHDF1	1	1
MYT1	4661	broad.mit.edu	37	20	62850370	62850370	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr20:62850370A>T	uc002yii.2	+	c.1953A>T	c.(1951-1953)CCA>CCT	p.P651P	MYT1_uc002yih.2_Silent_p.P353P|MYT1_uc002yij.2_Silent_p.P310P	NM_004535	NP_004526	Q01538	MYT1_HUMAN	myelin transcription factor 1	651					cell differentiation|nervous system development|regulation of transcription, DNA-dependent	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2	all_cancers(38;1.82e-11)|all_epithelial(29;3.3e-13)|Lung NSC(23;5.21e-10)|all_lung(23;1.92e-09)					GBM(59;481 1041 20555 21139 33705)				1819				0.357143	28.75368	29.251918	10	18	KEEP	---	---	---	---	capture		Silent	SNP	62850370	62850370	10501	20	A	T	T	T	67	6	MYT1	3	3
TPTE	7179	broad.mit.edu	37	21	10920104	10920104	+	Nonsense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr21:10920104C>A	uc002yip.1	-	c.1150G>T	c.(1150-1152)GGA>TGA	p.G384*	TPTE_uc002yis.1_Non-coding_Transcript|TPTE_uc002yiq.1_Nonsense_Mutation_p.G366*|TPTE_uc002yir.1_Nonsense_Mutation_p.G346*|TPTE_uc010gkv.1_Nonsense_Mutation_p.G246*	NM_199261	NP_954870	P56180	TPTE_HUMAN	transmembrane phosphatase with tensin homology	384	Phosphatase tensin-type.				signal transduction	integral to membrane	ion channel activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			ovary(2)|lung(1)|breast(1)|skin(1)	5			Colorectal(6;3.44e-05)|COAD - Colon adenocarcinoma(6;0.00727)|READ - Rectum adenocarcinoma(6;0.0723)	UCEC - Uterine corpus endometrioid carcinoma (6;0.0974)|all cancers(6;2.54e-22)|Epithelial(6;4.21e-19)|OV - Ovarian serous cystadenocarcinoma(6;1.16e-09)|BRCA - Breast invasive adenocarcinoma(6;7.72e-05)|Lung(8;0.000189)|LUSC - Lung squamous cell carcinoma(6;0.00379)|GBM - Glioblastoma multiforme(6;0.00391)|Kidney(17;0.0773)|LUAD - Lung adenocarcinoma(8;0.247)										0.193548	23.545731	29.0067	12	50	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	10920104	10920104	16974	21	C	A	A	A	286	22	TPTE	5	2
TMPRSS15	5651	broad.mit.edu	37	21	19756051	19756051	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr21:19756051C>A	uc002ykw.2	-	c.389G>T	c.(388-390)TGG>TTG	p.W130L		NM_002772	NP_002763	P98073	ENTK_HUMAN	enterokinase precursor	130	Extracellular (Potential).|SEA.				proteolysis	brush border|integral to membrane	scavenger receptor activity|serine-type endopeptidase activity			ovary(5)|breast(1)	6														0.461538	19.250638	19.267129	6	7	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	19756051	19756051	16787	21	C	A	A	A	273	21	TMPRSS15	2	2
KRTAP12-1	353332	broad.mit.edu	37	21	46102028	46102028	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr21:46102028G>A	uc002zfv.2	-	c.11C>T	c.(10-12)ACC>ATC	p.T4I	C21orf29_uc002zfe.1_Intron|C21orf29_uc010gpv.1_Intron	NM_181686	NP_859014	P59990	KR121_HUMAN	keratin associated protein 12-1	4						keratin filament					0														0.619048	41.778729	42.039443	13	8	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	46102028	46102028	8833	21	G	A	A	A	572	44	KRTAP12-1	2	2
PIWIL3	440822	broad.mit.edu	37	22	25123945	25123945	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr22:25123945C>T	uc003abd.1	-	c.2008G>A	c.(2008-2010)GTT>ATT	p.V670I	PIWIL3_uc011ajx.1_Missense_Mutation_p.V552I|PIWIL3_uc011ajy.1_Missense_Mutation_p.V552I|PIWIL3_uc010gut.1_Missense_Mutation_p.V661I	NM_001008496	NP_001008496	Q7Z3Z3	PIWL3_HUMAN	piwi-like 3	670	Piwi.				cell differentiation|gene silencing by RNA|meiosis|multicellular organismal development|regulation of translation|spermatogenesis	cytoplasm	RNA binding			ovary(3)|central_nervous_system(1)	4														0.4375	63.866517	64.030137	21	27	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	25123945	25123945	12383	22	C	T	T	T	221	17	PIWIL3	2	2
CHEK2	11200	broad.mit.edu	37	22	29121263	29121263	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr22:29121263T>C	uc003adt.1	-	c.541A>G	c.(541-543)ACA>GCA	p.T181A	CHEK2_uc003ads.1_5'UTR|CHEK2_uc010gvh.1_Intron|CHEK2_uc010gvi.1_Missense_Mutation_p.T138A|CHEK2_uc010gvj.1_Intron|CHEK2_uc003adr.1_Non-coding_Transcript|CHEK2_uc010gvk.1_Non-coding_Transcript|CHEK2_uc003adu.1_Missense_Mutation_p.T138A|CHEK2_uc003adv.1_Missense_Mutation_p.T138A|CHEK2_uc003adw.1_Missense_Mutation_p.T138A|CHEK2_uc003adx.1_5'UTR|CHEK2_uc003ady.1_Missense_Mutation_p.T138A|CHEK2_uc003adz.1_5'UTR	NM_001005735	NP_001005735	O96017	CHK2_HUMAN	protein kinase CHK2 isoform c	138	FHA.				cell cycle|DNA damage checkpoint|DNA damage response, signal transduction resulting in induction of apoptosis|protein phosphorylation|replicative senescence	PML body	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			central_nervous_system(17)|ovary(1)	18										268				0.284483	102.534263	107.367552	33	83	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	29121263	29121263	3469	22	T	C	C	C	780	60	CHEK2	4	4
LGALS2	3957	broad.mit.edu	37	22	37966684	37966684	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr22:37966684A>T	uc003ata.2	-	c.148T>A	c.(148-150)TTC>ATC	p.F50I		NM_006498	NP_006489	P05162	LEG2_HUMAN	lectin, galactoside-binding, soluble, 2	50	Galectin.									breast(1)	1	Melanoma(58;0.0574)					GBM(193;1840 2185 13711 20676 24505)								0.46875	136.385452	136.464806	45	51	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	37966684	37966684	9067	22	A	T	T	T	39	3	LGALS2	3	3
CACNA1I	8911	broad.mit.edu	37	22	40055719	40055719	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr22:40055719C>A	uc003ayc.2	+	c.2466C>A	c.(2464-2466)GAC>GAA	p.D822E	CACNA1I_uc003ayd.2_Missense_Mutation_p.D787E|CACNA1I_uc003aye.2_Missense_Mutation_p.D737E|CACNA1I_uc003ayf.2_Missense_Mutation_p.D702E	NM_021096	NP_066919	Q9P0X4	CAC1I_HUMAN	calcium channel, voltage-dependent, T type,	822	Extracellular (Potential).|II.				axon guidance|signal transduction	voltage-gated calcium channel complex	low voltage-gated calcium channel activity|protein binding			breast(1)|central_nervous_system(1)	2	Melanoma(58;0.0749)				Flunarizine(DB04841)|Paramethadione(DB00617)|Verapamil(DB00661)									0.568182	166.257509	166.613411	50	38	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	40055719	40055719	2662	22	C	A	A	A	259	20	CACNA1I	2	2
EFCAB6	64800	broad.mit.edu	37	22	44107437	44107437	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr22:44107437C>A	uc003bdy.1	-	c.949G>T	c.(949-951)GTG>TTG	p.V317L	EFCAB6_uc003bdz.1_Missense_Mutation_p.V165L|EFCAB6_uc010gzi.1_Missense_Mutation_p.V165L|EFCAB6_uc010gzk.1_Non-coding_Transcript|EFCAB6_uc011aqa.1_Missense_Mutation_p.V211L|EFCAB6_uc003bea.1_Missense_Mutation_p.V314L	NM_022785	NP_073622	Q5THR3	EFCB6_HUMAN	CAP-binding protein complex interacting protein	317	EF-hand 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	calcium ion binding			ovary(3)|pancreas(1)	4		Ovarian(80;0.0247)|all_neural(38;0.025)												0.625	68.337219	68.797582	20	12	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	44107437	44107437	5126	22	C	A	A	A	247	19	EFCAB6	1	1
BRD1	23774	broad.mit.edu	37	22	50192297	50192297	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr22:50192297G>A	uc003biu.3	-	c.1694C>T	c.(1693-1695)ACC>ATC	p.T565I	BRD1_uc011arf.1_Missense_Mutation_p.T160I|BRD1_uc011arg.1_Missense_Mutation_p.T619I|BRD1_uc003biv.2_Missense_Mutation_p.T565I|BRD1_uc011arh.1_Missense_Mutation_p.T565I	NM_014577	NP_055392	O95696	BRD1_HUMAN	bromodomain containing protein 1	565					histone H3 acetylation	MOZ/MORF histone acetyltransferase complex	zinc ion binding			pancreas(1)	1		all_cancers(38;6.11e-10)|all_epithelial(38;8.06e-09)|all_lung(38;6.64e-05)|Lung NSC(38;0.0011)|Breast(42;0.00235)|Ovarian(80;0.0139)|Lung SC(80;0.164)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0369)|BRCA - Breast invasive adenocarcinoma(115;0.21)										0.3125	12.880806	13.37529	5	11	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	50192297	50192297	1532	22	G	A	A	A	572	44	BRD1	2	2
POLR1B	84172	broad.mit.edu	37	2	113300233	113300233	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:113300233C>T	uc010yxn.1	+	c.276C>T	c.(274-276)CTC>CTT	p.L92L	POLR1B_uc002thw.2_Silent_p.L54L|POLR1B_uc010fkn.2_Silent_p.L54L|POLR1B_uc002thx.2_5'UTR|POLR1B_uc010fko.2_Silent_p.L54L|POLR1B_uc010fkp.2_5'UTR|POLR1B_uc002thy.2_5'UTR|POLR1B_uc010yxo.1_5'UTR	NM_019014	NP_061887	Q9H9Y6	RPA2_HUMAN	RNA polymerase I polypeptide B isoform 1	54					termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription initiation from RNA polymerase I promoter	nucleoplasm	DNA binding|DNA-directed RNA polymerase activity|metal ion binding|protein binding|ribonucleoside binding			ovary(1)	1						Ovarian(16;256 576 9537 23969 41147)								0.483871	42.499456	42.50704	15	16	KEEP	---	---	---	---	capture		Silent	SNP	113300233	113300233	12638	2	C	T	T	T	392	31	POLR1B	1	1
MARCO	8685	broad.mit.edu	37	2	119726804	119726804	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:119726804C>A	uc002tln.1	+	c.166C>A	c.(166-168)CTC>ATC	p.L56I	MARCO_uc010yyf.1_5'UTR	NM_006770	NP_006761	Q9UEW3	MARCO_HUMAN	macrophage receptor with collagenous structure	56	Helical; Signal-anchor for type II membrane protein; (Potential).				cell surface receptor linked signaling pathway|innate immune response	collagen|integral to plasma membrane	pattern recognition receptor activity|scavenger receptor activity			ovary(3)|central_nervous_system(1)	4						GBM(8;18 374 7467 11269 32796)								0.258065	39.88034	43.163215	16	46	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	119726804	119726804	9694	2	C	A	A	A	364	28	MARCO	2	2
POTEF	728378	broad.mit.edu	37	2	130832725	130832725	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:130832725C>A	uc010fmh.2	-	c.2320G>T	c.(2320-2322)GGC>TGC	p.G774C		NM_001099771	NP_001093241	A5A3E0	POTEF_HUMAN	prostate, ovary, testis expressed protein on	774	Actin-like.					cell cortex	ATP binding			ovary(2)|skin(1)	3														0.388235	100.575667	101.498623	33	52	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	130832725	130832725	12695	2	C	A	A	A	299	23	POTEF	1	1
THSD7B	80731	broad.mit.edu	37	2	137988681	137988681	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:137988681C>A	uc002tva.1	+	c.1698C>A	c.(1696-1698)CCC>CCA	p.P566P	THSD7B_uc010zbj.1_Intron|THSD7B_uc002tvb.2_Silent_p.P456P	NM_001080427	NP_001073896			thrombospondin, type I, domain containing 7B											ovary(4)|central_nervous_system(2)|pancreas(1)	7				BRCA - Breast invasive adenocarcinoma(221;0.19)										0.290323	22.677385	23.890074	9	22	KEEP	---	---	---	---	capture		Silent	SNP	137988681	137988681	16408	2	C	A	A	A	301	24	THSD7B	2	2
THSD7B	80731	broad.mit.edu	37	2	138376014	138376014	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:138376014G>C	uc002tva.1	+	c.3531G>C	c.(3529-3531)AGG>AGC	p.R1177S	THSD7B_uc010zbj.1_Intron	NM_001080427	NP_001073896			thrombospondin, type I, domain containing 7B											ovary(4)|central_nervous_system(2)|pancreas(1)	7				BRCA - Breast invasive adenocarcinoma(221;0.19)										0.466667	22.124214	22.138607	7	8	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	138376014	138376014	16408	2	G	C	C	C	529	41	THSD7B	3	3
LRP1B	53353	broad.mit.edu	37	2	140995809	140995809	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:140995809C>A	uc002tvj.1	-	c.13472G>T	c.(13471-13473)GGC>GTC	p.G4491V		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	4491	Cytoplasmic (Potential).				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|ovary(10)|pancreas(3)|central_nervous_system(2)|liver(1)|kidney(1)	34		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		Colon(99;50 2074 2507 20106)				2546	TSP Lung(27;0.18)			0.522727	67.310804	67.329846	23	21	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	140995809	140995809	9328	2	C	A	A	A	338	26	LRP1B	2	2
LRP1B	53353	broad.mit.edu	37	2	141458109	141458109	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:141458109C>A	uc002tvj.1	-	c.6509G>T	c.(6508-6510)TGT>TTT	p.C2170F		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	2170	Extracellular (Potential).|EGF-like 5.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|ovary(10)|pancreas(3)|central_nervous_system(2)|liver(1)|kidney(1)	34		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		Colon(99;50 2074 2507 20106)				2546	TSP Lung(27;0.18)			0.27551	74.373049	78.828875	27	71	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	141458109	141458109	9328	2	C	A	A	A	221	17	LRP1B	2	2
GTDC1	79712	broad.mit.edu	37	2	144966344	144966344	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:144966344C>A	uc002tvp.2	-	c.5G>T	c.(4-6)AGT>ATT	p.S2I	GTDC1_uc002tvo.2_Missense_Mutation_p.S2I|GTDC1_uc002tvq.2_Missense_Mutation_p.S2I|GTDC1_uc002tvr.2_Missense_Mutation_p.S2I|GTDC1_uc010fnn.2_Missense_Mutation_p.S2I|GTDC1_uc002tvs.2_5'UTR|GTDC1_uc010fno.2_Intron|GTDC1_uc002tvt.1_Missense_Mutation_p.S2I	NM_001006636	NP_001006637	Q4AE62	GTDC1_HUMAN	glycosyltransferase-like domain containing 1	2					biosynthetic process		transferase activity, transferring glycosyl groups			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.0914)										0.266667	30.179329	32.39312	12	33	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	144966344	144966344	7131	2	C	A	A	A	260	20	GTDC1	2	2
LYPD6B	130576	broad.mit.edu	37	2	150069541	150069541	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:150069541A>T	uc002twv.1	+	c.364A>T	c.(364-366)AGC>TGC	p.S122C	LYPD6B_uc002tww.1_Missense_Mutation_p.S84C|LYPD6B_uc002twx.1_Missense_Mutation_p.S84C	NM_177964	NP_808879	Q8NI32	LPD6B_HUMAN	LY6/PLAUR domain containing 6B	98	UPAR/Ly6.					anchored to membrane|plasma membrane					0														0.475	59.507294	59.529805	19	21	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	150069541	150069541	9492	2	A	T	T	T	91	7	LYPD6B	3	3
GALNT13	114805	broad.mit.edu	37	2	155252566	155252566	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:155252566G>T	uc002tyt.3	+	c.1220G>T	c.(1219-1221)TGT>TTT	p.C407F	GALNT13_uc002tyr.3_Missense_Mutation_p.C407F|GALNT13_uc010foc.1_Missense_Mutation_p.C226F|GALNT13_uc010fod.2_Missense_Mutation_p.C160F	NM_052917	NP_443149	Q8IUC8	GLT13_HUMAN	UDP-N-acetyl-alpha-D-galactosamine:polypeptide	407	Lumenal (Potential).					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			ovary(2)|pancreas(2)|central_nervous_system(1)	5														0.309524	38.465192	39.819675	13	29	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	155252566	155252566	6475	2	G	T	T	T	624	48	GALNT13	2	2
UPP2	151531	broad.mit.edu	37	2	158978086	158978086	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:158978086C>A	uc002tzo.2	+	c.791C>A	c.(790-792)CCA>CAA	p.P264Q	UPP2_uc002tzp.2_Missense_Mutation_p.P207Q	NM_001135098	NP_001128570	O95045	UPP2_HUMAN	uridine phosphorylase 2 isoform b	207					nucleotide catabolic process|pyrimidine base metabolic process|pyrimidine nucleoside catabolic process|pyrimidine nucleoside salvage|uridine metabolic process	cytosol|type III intermediate filament	uridine phosphorylase activity				0														0.1875	29.369223	36.698481	15	65	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	158978086	158978086	17574	2	C	A	A	A	273	21	UPP2	2	2
LY75	4065	broad.mit.edu	37	2	160697335	160697335	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:160697335G>T	uc002ubb.3	-	c.3412C>A	c.(3412-3414)CTG>ATG	p.L1138M	LY75_uc010fos.2_Missense_Mutation_p.L1138M|LY75_uc002ubc.3_Missense_Mutation_p.L1138M	NM_002349	NP_002340	O60449	LY75_HUMAN	lymphocyte antigen 75 precursor	1138	Extracellular (Potential).|C-type lectin 7.				endocytosis|immune response|inflammatory response	integral to plasma membrane	receptor activity|sugar binding				0				COAD - Colon adenocarcinoma(177;0.132)										0.459459	154.313742	154.472289	51	60	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	160697335	160697335	9476	2	G	T	T	T	438	34	LY75	2	2
TBR1	10716	broad.mit.edu	37	2	162274207	162274207	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:162274207G>C	uc002ubw.1	+	c.713G>C	c.(712-714)AGT>ACT	p.S238T	TBR1_uc010foy.2_5'Flank	NM_006593	NP_006584	Q16650	TBR1_HUMAN	T-box, brain, 1	238	T-box.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1														0.454545	201.94678	202.187876	60	72	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	162274207	162274207	16173	2	G	C	C	C	468	36	TBR1	3	3
PXDN	7837	broad.mit.edu	37	2	1667392	1667392	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:1667392T>A	uc002qxa.2	-	c.1552A>T	c.(1552-1554)ACT>TCT	p.T518S	PXDN_uc002qxb.1_Missense_Mutation_p.T518S	NM_012293	NP_036425	Q92626	PXDN_HUMAN	peroxidasin precursor	518	Ig-like C2-type 3.				extracellular matrix organization|hydrogen peroxide catabolic process|immune response|oxidation-reduction process	endoplasmic reticulum|extracellular space|proteinaceous extracellular matrix	extracellular matrix structural constituent|heme binding|interleukin-1 receptor antagonist activity|peroxidase activity			pancreas(6)|ovary(2)	8	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.0845)|Lung NSC(108;0.00641)|all_epithelial(98;0.00716)		all cancers(51;0.0492)|OV - Ovarian serous cystadenocarcinoma(76;0.0973)|Epithelial(75;0.17)|GBM - Glioblastoma multiforme(21;0.228)						2093				0.538462	128.473708	128.577699	42	36	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	1667392	1667392	13305	2	T	A	A	A	754	58	PXDN	3	3
DNAJC10	54431	broad.mit.edu	37	2	183584886	183584886	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:183584886T>C	uc002uow.1	+	c.357T>C	c.(355-357)CGT>CGC	p.R119R	DNAJC10_uc002uox.1_Non-coding_Transcript|DNAJC10_uc002uoy.1_Non-coding_Transcript|DNAJC10_uc002uoz.1_Silent_p.R119R|DNAJC10_uc010fro.1_Non-coding_Transcript	NM_018981	NP_061854	Q8IXB1	DJC10_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 10	119					apoptosis in response to endoplasmic reticulum stress|cell redox homeostasis|ER-associated protein catabolic process|glycerol ether metabolic process|negative regulation of protein phosphorylation|protein folding|response to endoplasmic reticulum stress	endoplasmic reticulum chaperone complex|endoplasmic reticulum lumen|extracellular region	ATPase activator activity|ATPase binding|chaperone binding|electron carrier activity|heat shock protein binding|misfolded protein binding|protein disulfide oxidoreductase activity|unfolded protein binding			ovary(1)|large_intestine(1)|breast(1)	3			OV - Ovarian serous cystadenocarcinoma(117;0.0942)|Epithelial(96;0.209)			Pancreas(56;860 1183 25669 35822 48585)								0.298701	73.197361	75.984399	23	54	KEEP	---	---	---	---	capture		Silent	SNP	183584886	183584886	4812	2	T	C	C	C	769	60	DNAJC10	4	4
PLCL1	5334	broad.mit.edu	37	2	198950857	198950857	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:198950857T>C	uc010fsp.2	+	c.2616T>C	c.(2614-2616)TAT>TAC	p.Y872Y	PLCL1_uc002uuv.3_Silent_p.Y793Y	NM_001114661	NP_001108133	Q15111	PLCL1_HUMAN	RecName: Full=Inactive phospholipase C-like protein 1;          Short=PLC-L1; AltName: Full=Phospholipase C-deleted in lung carcinoma; AltName: Full=Phospholipase C-related but catalytically inactive protein;          Short=PRIP;	872					intracellular signal transduction|lipid metabolic process	cytoplasm	calcium ion binding|phosphatidylinositol phospholipase C activity|signal transducer activity			ovary(1)	1					Quinacrine(DB01103)									0.69697	76.814356	77.950764	23	10	KEEP	---	---	---	---	capture		Silent	SNP	198950857	198950857	12465	2	T	C	C	C	634	49	PLCL1	4	4
AOX1	316	broad.mit.edu	37	2	201473757	201473757	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:201473757G>T	uc002uvx.2	+	c.958G>T	c.(958-960)GCT>TCT	p.A320S	AOX1_uc010zhf.1_5'Flank|AOX1_uc010fsu.2_5'Flank	NM_001159	NP_001150	Q06278	ADO_HUMAN	aldehyde oxidase 1	320	FAD-binding PCMH-type.				inflammatory response|oxidation-reduction process|reactive oxygen species metabolic process	cytoplasm	2 iron, 2 sulfur cluster binding|aldehyde oxidase activity|flavin adenine dinucleotide binding|iron ion binding|NAD binding|xanthine dehydrogenase activity			ovary(4)|pancreas(1)	5					Brimonidine(DB00484)|Chlorpromazine(DB00477)|Famciclovir(DB00426)|Menadione(DB00170)|Methotrexate(DB00563)|NADH(DB00157)|Palonosetron(DB00377)|Penciclovir(DB00299)|Raloxifene(DB00481)|Zaleplon(DB00962)|Zonisamide(DB00909)									0.64	51.905685	52.336776	16	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	201473757	201473757	739	2	G	T	T	T	546	42	AOX1	2	2
ALS2CR11	151254	broad.mit.edu	37	2	202352544	202352544	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:202352544A>T	uc002uyf.2	-	c.5254T>A	c.(5254-5256)TTA>ATA	p.L1752I	ALS2CR11_uc002uye.2_Missense_Mutation_p.L555I|ALS2CR11_uc010fti.2_3'UTR	NM_152525	NP_689738	Q53TS8	AL2SA_HUMAN	amyotrophic lateral sclerosis 2 (juvenile)	555										large_intestine(1)|ovary(1)	2														0.262032	112.882057	122.480414	49	138	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	202352544	202352544	555	2	A	T	T	T	11	1	ALS2CR11	3	3
CPS1	1373	broad.mit.edu	37	2	211465353	211465353	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:211465353A>T	uc010fur.2	+	c.1642A>T	c.(1642-1644)ATG>TTG	p.M548L	CPS1_uc002vee.3_Missense_Mutation_p.M542L|CPS1_uc010fus.2_Missense_Mutation_p.M91L	NM_001122633	NP_001116105	P31327	CPSM_HUMAN	carbamoyl-phosphate synthetase 1 isoform a	542					carbamoyl phosphate biosynthetic process|citrulline biosynthetic process|glutamine metabolic process|glycogen catabolic process|nitric oxide metabolic process|positive regulation of vasodilation|response to lipopolysaccharide|triglyceride catabolic process|urea cycle	mitochondrial nucleoid	ATP binding|carbamoyl-phosphate synthase (ammonia) activity			ovary(8)|central_nervous_system(3)|breast(1)	12				Epithelial(149;0.00697)|Lung(261;0.0521)|LUSC - Lung squamous cell carcinoma(261;0.0544)|all cancers(144;0.0843)										0.226415	58.64464	65.931783	24	82	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	211465353	211465353	3961	2	A	T	T	T	208	16	CPS1	3	3
APOB	338	broad.mit.edu	37	2	21229598	21229598	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:21229598A>G	uc002red.2	-	c.10142T>C	c.(10141-10143)TTA>TCA	p.L3381S		NM_000384	NP_000375	P04114	APOB_HUMAN	apolipoprotein B precursor	3381	LDL receptor binding.				cholesterol homeostasis|cholesterol metabolic process|leukocyte migration|low-density lipoprotein particle clearance|low-density lipoprotein particle remodeling|platelet activation|positive regulation of cholesterol storage|positive regulation of macrophage derived foam cell differentiation|receptor-mediated endocytosis|response to virus|very-low-density lipoprotein particle assembly	chylomicron remnant|clathrin-coated endocytic vesicle membrane|endoplasmic reticulum lumen|endoplasmic reticulum membrane|endosome lumen|endosome membrane|intermediate-density lipoprotein particle|low-density lipoprotein particle|mature chylomicron|microsome|plasma membrane|very-low-density lipoprotein particle	cholesterol transporter activity|enzyme binding|heparin binding|low-density lipoprotein particle receptor binding|phospholipid binding|protein heterodimerization activity			ovary(11)|central_nervous_system(3)|large_intestine(2)|pancreas(1)|skin(1)	18	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				Atorvastatin(DB01076)									0.487395	207.762346	207.77804	58	61	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	21229598	21229598	796	2	A	G	G	G	169	13	APOB	4	4
ATIC	471	broad.mit.edu	37	2	216213880	216213880	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:216213880G>T	uc002vex.3	+	c.1567G>T	c.(1567-1569)GAG>TAG	p.E523*	ATIC_uc010zjo.1_Nonsense_Mutation_p.E464*|ATIC_uc002vey.3_Nonsense_Mutation_p.E522*	NM_004044	NP_004035	P31939	PUR9_HUMAN	5-aminoimidazole-4-carboxamide ribonucleotide	523					IMP biosynthetic process|purine base metabolic process	cytosol	IMP cyclohydrolase activity|phosphoribosylaminoimidazolecarboxamide formyltransferase activity|protein homodimerization activity		ATIC/ALK(24)	haematopoietic_and_lymphoid_tissue(22)|ovary(2)|soft_tissue(2)	26		Renal(323;0.229)		Epithelial(149;2.02e-06)|all cancers(144;0.000316)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.0097)	Tetrahydrofolic acid(DB00116)					243				0.454545	69.812848	69.917613	25	30	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	216213880	216213880	1124	2	G	T	T	T	429	33	ATIC	5	2
WNT10A	80326	broad.mit.edu	37	2	219754782	219754782	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:219754782G>T	uc002vjd.1	+	c.453G>T	c.(451-453)CTG>CTT	p.L151L		NM_025216	NP_079492	Q9GZT5	WN10A_HUMAN	wingless-type MMTV integration site family,	151					anterior/posterior pattern formation|axis specification|canonical Wnt receptor signaling pathway|cellular response to transforming growth factor beta stimulus|female gonad development|hair follicle morphogenesis|negative regulation of gene-specific transcription from RNA polymerase II promoter|odontogenesis|positive regulation of gene-specific transcription from RNA polymerase II promoter|regulation of odontogenesis of dentine-containing tooth|sebaceous gland development|skin development|tongue development|Wnt receptor signaling pathway, calcium modulating pathway	extracellular space|plasma membrane|proteinaceous extracellular matrix	G-protein-coupled receptor binding|signal transducer activity				0		Renal(207;0.0474)		Epithelial(149;4.26e-07)|all cancers(144;8.8e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)										0.156863	14.401101	20.104202	8	43	KEEP	---	---	---	---	capture		Silent	SNP	219754782	219754782	17956	2	G	T	T	T	600	47	WNT10A	2	2
ANKZF1	55139	broad.mit.edu	37	2	220098104	220098104	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:220098104A>T	uc002vkg.2	+	c.768A>T	c.(766-768)TCA>TCT	p.S256S	ANKZF1_uc010zkv.1_Silent_p.S200S|ANKZF1_uc010zkw.1_Silent_p.S46S|ANKZF1_uc002vkh.2_Silent_p.S46S|ANKZF1_uc002vki.2_Silent_p.S256S|ANKZF1_uc002vkj.1_Silent_p.S244S	NM_018089	NP_060559	Q9H8Y5	ANKZ1_HUMAN	ankyrin repeat and zinc finger domain containing	256						intracellular	zinc ion binding			ovary(2)	2		Renal(207;0.0474)		Epithelial(149;1.2e-06)|all cancers(144;0.000197)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)										0.323529	28.424263	29.35858	11	23	KEEP	---	---	---	---	capture		Silent	SNP	220098104	220098104	701	2	A	T	T	T	67	6	ANKZF1	3	3
SPEG	10290	broad.mit.edu	37	2	220326615	220326615	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:220326615T>C	uc010fwg.2	+	c.2452T>C	c.(2452-2454)TCC>CCC	p.S818P	SPEG_uc002vlm.2_Non-coding_Transcript|SPEG_uc010fwh.1_Missense_Mutation_p.S26P|SPEG_uc002vln.1_Missense_Mutation_p.S26P|SPEG_uc002vlp.1_Missense_Mutation_p.S26P|SPEG_uc002vlq.2_5'UTR	NM_005876	NP_005867	Q15772	SPEG_HUMAN	SPEG complex locus	818					muscle organ development|negative regulation of cell proliferation|protein phosphorylation	nucleus	ATP binding|protein serine/threonine kinase activity			ovary(4)|stomach(2)|central_nervous_system(1)	7		Renal(207;0.0183)		Epithelial(149;4.5e-10)|all cancers(144;7.93e-08)|Lung(261;0.00639)|LUSC - Lung squamous cell carcinoma(224;0.00829)|READ - Rectum adenocarcinoma(5;0.163)						482				0.2	52.021014	60.805429	21	84	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	220326615	220326615	15548	2	T	C	C	C	650	50	SPEG	4	4
EPHA4	2043	broad.mit.edu	37	2	222298988	222298988	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:222298988C>A	uc002vmq.2	-	c.2370G>T	c.(2368-2370)TGG>TGT	p.W790C	EPHA4_uc002vmr.2_Missense_Mutation_p.W790C|EPHA4_uc010zlm.1_Missense_Mutation_p.W731C|EPHA4_uc010zln.1_Missense_Mutation_p.W790C	NM_004438	NP_004429	P54764	EPHA4_HUMAN	ephrin receptor EphA4 precursor	790	Protein kinase.|Cytoplasmic (Potential).				protein phosphorylation|transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|ephrin receptor activity			lung(3)|large_intestine(2)|central_nervous_system(2)|urinary_tract(1)|skin(1)	9		Renal(207;0.0183)		Epithelial(121;5.38e-09)|all cancers(144;2.47e-06)|LUSC - Lung squamous cell carcinoma(224;0.0115)|Lung(261;0.0154)					p.W790*(JHUEM7-Tumor)	395				0.239583	50.008372	55.934502	23	73	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	222298988	222298988	5362	2	C	A	A	A	390	30	EPHA4	2	2
KCNE4	23704	broad.mit.edu	37	2	223917913	223917913	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:223917913G>T	uc002vnl.3	+	c.365G>T	c.(364-366)GGG>GTG	p.G122V		NM_080671	NP_542402	Q8WWG9	KCNE4_HUMAN	potassium voltage-gated channel, Isk-related	122	Cytoplasmic (Potential).					integral to membrane	voltage-gated potassium channel activity			ovary(1)	1		Renal(207;0.0183)|Lung NSC(271;0.137)|all_lung(227;0.175)		Epithelial(121;4.48e-11)|all cancers(144;2.88e-08)|Lung(261;0.00688)|LUSC - Lung squamous cell carcinoma(224;0.008)										0.189189	14.50662	17.848129	7	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	223917913	223917913	8330	2	G	T	T	T	559	43	KCNE4	2	2
DOCK10	55619	broad.mit.edu	37	2	225761065	225761065	+	Silent	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:225761065A>G	uc010fwz.1	-	c.363T>C	c.(361-363)CAT>CAC	p.H121H	DOCK10_uc002vob.2_Silent_p.H115H|DOCK10_uc002vod.1_Silent_p.H121H	NM_014689	NP_055504	Q96BY6	DOC10_HUMAN	dedicator of cytokinesis 10	121							GTP binding			ovary(2)	2		Renal(207;0.0113)|all_lung(227;0.0486)|Lung NSC(271;0.0653)|all_hematologic(139;0.14)		Epithelial(121;2.37e-10)|all cancers(144;2.26e-07)|Lung(261;0.0143)|LUSC - Lung squamous cell carcinoma(224;0.0178)										0.538462	22.324838	22.341482	7	6	KEEP	---	---	---	---	capture		Silent	SNP	225761065	225761065	4869	2	A	G	G	G	102	8	DOCK10	4	4
SP140	11262	broad.mit.edu	37	2	231090583	231090583	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:231090583G>T	uc002vql.2	+	c.24G>T	c.(22-24)GGG>GGT	p.G8G	SP140_uc010zma.1_Non-coding_Transcript|SP140_uc002vqj.2_Silent_p.G8G|SP140_uc002vqk.2_Silent_p.G8G|SP140_uc002vqn.2_Silent_p.G8G|SP140_uc002vqm.2_Silent_p.G8G|SP140_uc010fxl.2_Silent_p.G8G	NM_007237	NP_009168	Q13342	LY10_HUMAN	SP140 nuclear body protein isoform 1	8					defense response	cytoplasm|nuclear envelope|nucleolus|nucleoplasm	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Renal(207;0.0112)|all_lung(227;0.0221)|Lung NSC(271;0.0977)|all_hematologic(139;0.103)|Acute lymphoblastic leukemia(138;0.167)		Epithelial(121;1.13e-12)|all cancers(144;2.71e-10)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(119;0.00942)						802				0.6	47.223235	47.440691	15	10	KEEP	---	---	---	---	capture		Silent	SNP	231090583	231090583	15462	2	G	T	T	T	535	42	SP140	2	2
COL6A3	1293	broad.mit.edu	37	2	238280799	238280799	+	Missense_Mutation	SNP	G	C	C	rs113247852		TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:238280799G>C	uc002vwl.2	-	c.3861C>G	c.(3859-3861)AAC>AAG	p.N1287K	COL6A3_uc002vwo.2_Missense_Mutation_p.N1081K|COL6A3_uc010znj.1_Missense_Mutation_p.N680K|COL6A3_uc002vwq.2_Missense_Mutation_p.N1081K|COL6A3_uc002vwr.2_Missense_Mutation_p.N880K	NM_004369	NP_004360	P12111	CO6A3_HUMAN	alpha 3 type VI collagen isoform 1 precursor	1287	VWFA 7.|Nonhelical region.				axon guidance|cell adhesion|muscle organ development	collagen type VI|extracellular space	serine-type endopeptidase inhibitor activity			ovary(8)|central_nervous_system(6)|pancreas(1)	15		Breast(86;0.000301)|Renal(207;0.000966)|all_hematologic(139;0.067)|Ovarian(221;0.0694)|all_lung(227;0.0943)|Melanoma(123;0.203)		Epithelial(121;1.23e-21)|OV - Ovarian serous cystadenocarcinoma(60;1.34e-10)|Kidney(56;5.71e-09)|KIRC - Kidney renal clear cell carcinoma(57;1.51e-07)|BRCA - Breast invasive adenocarcinoma(100;0.00025)|Lung(119;0.0142)|LUSC - Lung squamous cell carcinoma(224;0.034)										0.520833	81.18298	81.201861	25	23	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	238280799	238280799	3839	2	G	C	C	C	516	40	COL6A3	3	3
KIF1A	547	broad.mit.edu	37	2	241712631	241712631	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:241712631G>T	uc010fzk.2	-	c.1080C>A	c.(1078-1080)ATC>ATA	p.I360I	KIF1A_uc002vzy.2_Silent_p.I360I|KIF1A_uc002vzz.1_Silent_p.I360I	NM_004321	NP_004312	Q12756	KIF1A_HUMAN	axonal transport of synaptic vesicles	360	Kinesin-motor.				anterograde axon cargo transport	cytoplasm|microtubule|nucleus	ATP binding|microtubule motor activity			lung(1)	1		all_epithelial(40;1.35e-15)|Breast(86;2.14e-05)|Renal(207;0.00183)|Ovarian(221;0.0228)|all_lung(227;0.0295)|all_neural(83;0.0459)|Lung NSC(271;0.0942)|all_hematologic(139;0.158)|Melanoma(123;0.16)|Hepatocellular(293;0.244)		Epithelial(32;6.12e-30)|all cancers(36;3.46e-27)|OV - Ovarian serous cystadenocarcinoma(60;1.38e-14)|Kidney(56;5e-09)|KIRC - Kidney renal clear cell carcinoma(57;5e-08)|BRCA - Breast invasive adenocarcinoma(100;5.87e-06)|Lung(119;0.00209)|LUSC - Lung squamous cell carcinoma(224;0.00902)|Colorectal(34;0.0282)|COAD - Colon adenocarcinoma(134;0.176)										0.255319	30.900374	33.43806	12	35	KEEP	---	---	---	---	capture		Silent	SNP	241712631	241712631	8594	2	G	T	T	T	577	45	KIF1A	2	2
D2HGDH	728294	broad.mit.edu	37	2	242707130	242707130	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:242707130G>T	uc002wce.1	+	c.1312G>T	c.(1312-1314)GGT>TGT	p.G438C	D2HGDH_uc010fzq.1_Missense_Mutation_p.G304C|D2HGDH_uc002wcg.1_Non-coding_Transcript|D2HGDH_uc002wch.2_Non-coding_Transcript|D2HGDH_uc002wci.2_Missense_Mutation_p.G137C	NM_152783	NP_689996	Q8N465	D2HDH_HUMAN	D-2-hydroxyglutarate dehydrogenase precursor	438					2-oxoglutarate metabolic process|cellular protein metabolic process|oxidation-reduction process|response to cobalt ion|response to manganese ion|response to zinc ion	mitochondrial matrix	(R)-2-hydroxyglutarate dehydrogenase activity|flavin adenine dinucleotide binding|protein binding				0		all_cancers(19;1.09e-40)|all_epithelial(40;2.03e-18)|Breast(86;1.53e-05)|all_lung(227;0.00338)|Renal(207;0.00502)|Ovarian(221;0.00716)|Lung NSC(271;0.012)|Esophageal squamous(248;0.129)|Melanoma(123;0.144)|all_hematologic(139;0.158)|all_neural(83;0.243)|Hepatocellular(293;0.244)		Epithelial(32;4.59e-33)|all cancers(36;9.89e-31)|OV - Ovarian serous cystadenocarcinoma(60;7.89e-15)|Kidney(56;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;1.63e-06)|Lung(119;0.000152)|LUSC - Lung squamous cell carcinoma(224;0.00154)|Colorectal(34;0.0129)|COAD - Colon adenocarcinoma(134;0.0833)										0.211538	25.094998	29.097998	11	41	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	242707130	242707130	4379	2	G	T	T	T	611	47	D2HGDH	2	2
BRE	9577	broad.mit.edu	37	2	28521328	28521329	+	Missense_Mutation	DNP	GG	TT	TT			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:28521328_28521329GG>TT	uc002rls.2	+	c.1058_1059GG>TT	c.(1057-1059)TGG>TTT	p.W353F	BRE_uc002rlp.1_Missense_Mutation_p.W353F|BRE_uc002rlq.2_Missense_Mutation_p.W353F|BRE_uc002rlr.2_Missense_Mutation_p.W353F|BRE_uc002rlt.2_Missense_Mutation_p.W353F|BRE_uc002rlu.2_Missense_Mutation_p.W353F|BRE_uc002rlv.2_Missense_Mutation_p.W215F|BRE_uc002rlx.2_Non-coding_Transcript	NM_004899	NP_004890	Q9NXR7	BRE_HUMAN	brain and reproductive organ-expressed (TNFRSF1A	353	UEV-like 2.				apoptosis|chromatin modification|double-strand break repair|G2/M transition DNA damage checkpoint|positive regulation of anti-apoptosis|positive regulation of DNA repair|response to ionizing radiation|signal transduction	BRCA1-A complex|BRISC complex|cytoplasm|nuclear ubiquitin ligase complex	peroxisome targeting sequence binding|polyubiquitin binding|tumor necrosis factor receptor binding			lung(1)|kidney(1)	2	Acute lymphoblastic leukemia(172;0.155)													0.483146	139.489014	139.512095	43	46	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	28521328	28521329	1540	2	GG	TT	TT	TT	611	47	BRE	2	2
BIRC6	57448	broad.mit.edu	37	2	32836633	32836633	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:32836633A>G	uc010ezu.2	+	c.14378A>G	c.(14377-14379)CAT>CGT	p.H4793R		NM_016252	NP_057336	Q9NR09	BIRC6_HUMAN	baculoviral IAP repeat-containing 6	4793					anti-apoptosis|apoptosis|post-translational protein modification	intracellular	acid-amino acid ligase activity|cysteine-type endopeptidase inhibitor activity|protein binding			ovary(5)|skin(4)|lung(2)|central_nervous_system(1)|breast(1)|pancreas(1)	14	Acute lymphoblastic leukemia(172;0.155)					Pancreas(94;175 1509 16028 18060 45422)				1555				0.32	19.953344	20.694722	8	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	32836633	32836633	1463	2	A	G	G	G	104	8	BIRC6	4	4
PREPL	9581	broad.mit.edu	37	2	44553863	44553863	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:44553863C>A	uc002ruf.2	-	c.1734G>T	c.(1732-1734)GCG>GCT	p.A578A	PREPL_uc002rug.2_Silent_p.A512A|PREPL_uc002ruh.2_Silent_p.A516A|PREPL_uc010fax.2_Silent_p.A578A|PREPL_uc002rui.3_Silent_p.A489A|PREPL_uc002ruj.1_Silent_p.A489A|PREPL_uc002ruk.1_Silent_p.A578A	NM_006036	NP_006027	Q4J6C6	PPCEL_HUMAN	prolyl endopeptidase-like isoform C	578					proteolysis	cytosol	serine-type endopeptidase activity			ovary(1)	1		all_hematologic(82;0.151)|Acute lymphoblastic leukemia(82;0.175)												0.25	48.019837	52.107781	18	54	KEEP	---	---	---	---	capture		Silent	SNP	44553863	44553863	12918	2	C	A	A	A	288	23	PREPL	1	1
MCFD2	90411	broad.mit.edu	37	2	47136246	47136246	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:47136246G>A	uc002rvk.2	-	c.65C>T	c.(64-66)CCA>CTA	p.P22L	MCFD2_uc002rvl.2_Intron|MCFD2_uc010fba.2_Missense_Mutation_p.P20L|MCFD2_uc010yof.1_Intron	NM_139279	NP_644808	Q8NI22	MCFD2_HUMAN	multiple coagulation factor deficiency 2	22					post-translational protein modification|protein N-linked glycosylation via asparagine|protein transport|vesicle-mediated transport	endoplasmic reticulum|ER to Golgi transport vesicle membrane|ER-Golgi intermediate compartment|Golgi apparatus	calcium ion binding			central_nervous_system(1)	1		all_hematologic(82;0.151)|Acute lymphoblastic leukemia(82;0.175)	Lung(47;0.0792)|LUSC - Lung squamous cell carcinoma(58;0.114)		Antihemophilic Factor(DB00025)									0.268293	31.113867	33.096314	11	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	47136246	47136246	9770	2	G	A	A	A	611	47	MCFD2	2	2
KLRAQ1	129285	broad.mit.edu	37	2	48688331	48688331	+	Silent	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:48688331C>G	uc002rwm.2	+	c.654C>G	c.(652-654)TCC>TCG	p.S218S	KLRAQ1_uc002rwi.1_Silent_p.S218S|KLRAQ1_uc002rwj.2_Silent_p.S218S|KLRAQ1_uc002rwl.2_Silent_p.S172S|KLRAQ1_uc002rwk.2_Silent_p.S218S|KLRAQ1_uc010yok.1_Silent_p.S218S	NM_001135629	NP_001129101	Q6ZMI0	KLRAQ_HUMAN	KLRAQ motif containing 1 isoform 1	218										ovary(1)	1														0.382979	55.342258	55.905358	18	29	KEEP	---	---	---	---	capture		Silent	SNP	48688331	48688331	8727	2	C	G	G	G	301	24	KLRAQ1	3	3
STON1-GTF2A1L	286749	broad.mit.edu	37	2	48898788	48898788	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:48898788C>T	uc002rwp.1	+	c.3410C>T	c.(3409-3411)ACG>ATG	p.T1137M	STON1-GTF2A1L_uc010yol.1_Missense_Mutation_p.T1090M|GTF2A1L_uc002rws.1_Missense_Mutation_p.T433M|GTF2A1L_uc010yom.1_Missense_Mutation_p.T399M|GTF2A1L_uc002rwt.2_Missense_Mutation_p.T433M	NM_172311	NP_758515	B7ZL16	B7ZL16_HUMAN	STON1-GTF2A1L protein	1090					endocytosis|intracellular protein transport|transcription initiation from RNA polymerase II promoter	clathrin adaptor complex|transcription factor TFIIA complex	RNA polymerase II transcription factor activity			ovary(3)|pancreas(1)	4		all_hematologic(82;0.151)|Acute lymphoblastic leukemia(82;0.176)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)											0.383333	137.770379	139.184439	46	74	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	48898788	48898788	15837	2	C	T	T	T	247	19	STON1-GTF2A1L	1	1
ARHGAP25	9938	broad.mit.edu	37	2	68962337	68962337	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:68962337C>T	uc010fdg.2	+	c.6C>T	c.(4-6)TCC>TCT	p.S2S	ARHGAP25_uc010yqk.1_Intron|ARHGAP25_uc002seu.2_Silent_p.S2S|ARHGAP25_uc010yql.1_Silent_p.S2S	NM_001007231	NP_001007232	P42331	RHG25_HUMAN	Rho GTPase activating protein 25 isoform a	2					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(2)|breast(2)	4														0.173913	26.362597	33.283316	12	57	KEEP	---	---	---	---	capture		Silent	SNP	68962337	68962337	886	2	C	T	T	T	275	22	ARHGAP25	2	2
CLEC4F	165530	broad.mit.edu	37	2	71046978	71046978	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:71046978C>A	uc002shf.2	-	c.107G>T	c.(106-108)AGG>ATG	p.R36M	CLEC4F_uc010yqv.1_Missense_Mutation_p.R36M	NM_173535	NP_775806	Q8N1N0	CLC4F_HUMAN	C-type lectin, superfamily member 13	36	Cytoplasmic (Potential).				endocytosis	integral to membrane	receptor activity|sugar binding			ovary(5)	5						Colon(107;10 2157 6841 26035)								0.666667	59.26235	59.930821	18	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	71046978	71046978	3654	2	C	A	A	A	312	24	CLEC4F	2	2
ALMS1	7840	broad.mit.edu	37	2	73827957	73827957	+	Missense_Mutation	SNP	G	T	T	rs61741524		TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:73827957G>T	uc002sje.1	+	c.11824G>T	c.(11824-11826)GGT>TGT	p.G3942C	ALMS1_uc002sjf.1_Missense_Mutation_p.G3898C|ALMS1_uc002sjh.1_Missense_Mutation_p.G3328C	NM_015120	NP_055935	Q8TCU4	ALMS1_HUMAN	Alstrom syndrome 1	3940					G2/M transition of mitotic cell cycle|visual perception	centrosome|cilium|cytosol|microtubule basal body|spindle pole				ovary(2)|breast(2)|lung(1)|pancreas(1)	6														0.259259	18.812554	20.229831	7	20	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	73827957	73827957	538	2	G	T	T	T	507	39	ALMS1	1	1
WDR54	84058	broad.mit.edu	37	2	74652753	74652753	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:74652753T>C	uc002slb.2	+	c.930T>C	c.(928-930)TTT>TTC	p.F310F		NM_032118	NP_115494	Q9H977	WDR54_HUMAN	WD repeat domain 54	310											0														0.314685	139.41836	143.790488	45	98	KEEP	---	---	---	---	capture		Silent	SNP	74652753	74652753	17879	2	T	C	C	C	829	64	WDR54	4	4
REG1A	5967	broad.mit.edu	37	2	79348687	79348687	+	Splice_Site_SNP	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:79348687G>T	uc002snz.2	+	c.65_splice	c.e3-1	p.G22_splice	REG1A_uc010ffx.1_Splice_Site_SNP_p.G22_splice|REG1A_uc010ysd.1_Splice_Site_SNP_p.G22_splice	NM_002909	NP_002900			regenerating islet-derived 1 alpha precursor						positive regulation of cell proliferation	extracellular region	growth factor activity|sugar binding				0														0.238095	128.533697	143.091029	55	176	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	79348687	79348687	13679	2	G	T	T	T	455	35	REG1A	5	2
CAPG	822	broad.mit.edu	37	2	85628374	85628374	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:85628374C>T	uc002spl.1	-	c.430G>A	c.(430-432)GGG>AGG	p.G144R	CAPG_uc002spm.1_Missense_Mutation_p.G144R|CAPG_uc010ysq.1_Missense_Mutation_p.G144R|CAPG_uc010fgi.1_Missense_Mutation_p.G144R|CAPG_uc010fgj.1_Missense_Mutation_p.G38R	NM_001747	NP_001738	P40121	CAPG_HUMAN	gelsolin-like capping protein	144	Nuclear localization signal (Potential).				barbed-end actin filament capping|protein complex assembly	F-actin capping protein complex|melanosome|nuclear membrane|nucleolus	actin binding				0														0.25641	49.962381	54.160534	20	58	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	85628374	85628374	2738	2	C	T	T	T	286	22	CAPG	2	2
ZBTB11	27107	broad.mit.edu	37	3	101370100	101370100	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:101370100T>A	uc003dve.3	-	c.3072A>T	c.(3070-3072)TTA>TTT	p.L1024F		NM_014415	NP_055230	O95625	ZBT11_HUMAN	zinc finger protein ZNF-U69274	1024					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0														0.294643	88.249498	92.466034	33	79	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	101370100	101370100	18110	3	T	A	A	A	686	53	ZBTB11	3	3
MYLK	4638	broad.mit.edu	37	3	123456294	123456294	+	Nonsense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:123456294C>A	uc003ego.2	-	c.685G>T	c.(685-687)GGA>TGA	p.G229*	MYLK_uc011bjw.1_Nonsense_Mutation_p.G229*|MYLK_uc003egp.2_Nonsense_Mutation_p.G229*|MYLK_uc003egq.2_Nonsense_Mutation_p.G229*|MYLK_uc003egr.2_Nonsense_Mutation_p.G229*|MYLK_uc003egs.2_Nonsense_Mutation_p.G53*|MYLK_uc010hrs.1_Nonsense_Mutation_p.G229*	NM_053025	NP_444253	Q15746	MYLK_HUMAN	myosin light chain kinase isoform 1	229	Ig-like C2-type 2.				aorta smooth muscle tissue morphogenesis|muscle contraction|protein phosphorylation	cytosol	actin binding|ATP binding|calmodulin binding|metal ion binding|myosin light chain kinase activity			ovary(6)	6		Lung NSC(201;0.0496)		GBM - Glioblastoma multiforme(114;0.0736)						766				0.265306	57.603408	62.488498	26	72	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	123456294	123456294	10451	3	C	A	A	A	286	22	MYLK	5	2
SOX14	8403	broad.mit.edu	37	3	137484280	137484280	+	Nonsense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:137484280C>A	uc003erm.1	+	c.654C>A	c.(652-654)TAC>TAA	p.Y218*		NM_004189	NP_004180	O95416	SOX14_HUMAN	SRY-box 14	218					negative regulation of transcription from RNA polymerase II promoter|nervous system development|transcription, DNA-dependent	nucleus	sequence-specific DNA binding|transcription repressor activity				0														0.454545	49.418424	49.478088	15	18	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	137484280	137484280	15445	3	C	A	A	A	220	17	SOX14	5	2
DZIP1L	199221	broad.mit.edu	37	3	137822452	137822452	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:137822452T>A	uc003erq.2	-	c.362A>T	c.(361-363)CAG>CTG	p.Q121L	DZIP1L_uc003err.1_Missense_Mutation_p.Q121L	NM_173543	NP_775814	Q8IYY4	DZI1L_HUMAN	DAZ interacting protein 1-like	121						intracellular	zinc ion binding			ovary(1)|pancreas(1)	2														0.416667	15.372726	15.445516	5	7	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	137822452	137822452	5050	3	T	A	A	A	715	55	DZIP1L	3	3
ZIC4	84107	broad.mit.edu	37	3	147108946	147108946	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:147108946G>T	uc011bno.1	-	c.926C>A	c.(925-927)ACT>AAT	p.T309N	ZIC4_uc003ewc.1_Missense_Mutation_p.T189N|ZIC4_uc003ewd.1_Missense_Mutation_p.T259N	NM_032153	NP_115529	Q8N9L1	ZIC4_HUMAN	zinc finger protein of the cerebellum 4	259						nucleus	DNA binding|zinc ion binding				0														0.352941	35.59559	36.241392	12	22	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	147108946	147108946	18272	3	G	T	T	T	468	36	ZIC4	2	2
ZIC4	84107	broad.mit.edu	37	3	147114004	147114004	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:147114004G>C	uc011bno.1	-	c.473C>G	c.(472-474)GCT>GGT	p.A158G	ZIC4_uc003ewc.1_Missense_Mutation_p.A38G|ZIC4_uc003ewd.1_Missense_Mutation_p.A108G	NM_032153	NP_115529	Q8N9L1	ZIC4_HUMAN	zinc finger protein of the cerebellum 4	108						nucleus	DNA binding|zinc ion binding				0														0.428571	24.848361	24.945444	9	12	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	147114004	147114004	18272	3	G	C	C	C	442	34	ZIC4	3	3
SHOX2	6474	broad.mit.edu	37	3	157820574	157820574	+	Nonsense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:157820574C>A	uc003fbs.2	-	c.520G>T	c.(520-522)GAA>TAA	p.E174*	SHOX2_uc010hvw.2_Nonsense_Mutation_p.E150*|SHOX2_uc003fbr.2_Nonsense_Mutation_p.E150*	NM_003030	NP_003021	O60902	SHOX2_HUMAN	short stature homeobox 2 isoform b	150	Homeobox.				nervous system development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulator activity				0			Lung(72;0.00318)|LUSC - Lung squamous cell carcinoma(72;0.0043)											0.484848	94.304727	94.317344	32	34	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	157820574	157820574	14784	3	C	A	A	A	390	30	SHOX2	5	2
SLITRK3	22865	broad.mit.edu	37	3	164907292	164907292	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:164907292G>T	uc003fej.3	-	c.1327C>A	c.(1327-1329)CGT>AGT	p.R443S	SLITRK3_uc003fek.2_Missense_Mutation_p.R443S	NM_014926	NP_055741	O94933	SLIK3_HUMAN	slit and trk like 3 protein precursor	443	LRR 8.|Extracellular (Potential).					integral to membrane				ovary(6)|pancreas(1)	7														0.403846	62.752122	63.175019	21	31	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	164907292	164907292	15242	3	G	T	T	T	481	37	SLITRK3	1	1
DVL3	1857	broad.mit.edu	37	3	183888495	183888495	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:183888495C>T	uc003fms.2	+	c.2103C>T	c.(2101-2103)TTC>TTT	p.F701F	DVL3_uc011bqw.1_Silent_p.F684F|DVL3_uc003fmt.2_Silent_p.F372F|DVL3_uc003fmu.2_Silent_p.F533F	NM_004423	NP_004414	Q92997	DVL3_HUMAN	dishevelled 3	701				PPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM -> LR AATWPQCPRN (in Ref. 4; BAA13199).	canonical Wnt receptor signaling pathway|intracellular signal transduction|positive regulation of JUN kinase activity|positive regulation of protein phosphorylation|positive regulation of transcription, DNA-dependent	cytoplasm	beta-catenin binding|frizzled binding|protease binding|protein heterodimerization activity|signal transducer activity			ovary(1)|breast(1)	2	all_cancers(143;1.12e-10)|Ovarian(172;0.0339)		Epithelial(37;2.08e-34)|OV - Ovarian serous cystadenocarcinoma(80;1.31e-22)											0.647059	35.428743	35.752637	11	6	KEEP	---	---	---	---	capture		Silent	SNP	183888495	183888495	5023	3	C	T	T	T	389	30	DVL3	2	2
AHSG	197	broad.mit.edu	37	3	186333533	186333533	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:186333533G>T	uc003fql.3	+	c.273G>T	c.(271-273)GTG>GTT	p.V91V	AHSG_uc003fqj.2_Silent_p.V91V|AHSG_uc003fqk.3_Silent_p.V91V|AHSG_uc003fqm.3_Silent_p.V90V|AHSG_uc010hyp.2_Intron	NM_001622	NP_001613	P02765	FETUA_HUMAN	alpha-2-HS-glycoprotein	91	Cystatin fetuin-A-type 1.				acute-phase response|negative regulation of bone mineralization|negative regulation of insulin receptor signaling pathway|pinocytosis|positive regulation of phagocytosis|regulation of inflammatory response|skeletal system development	extracellular space	cysteine-type endopeptidase inhibitor activity|protein binding				0	all_cancers(143;3.64e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;3.27e-20)	GBM - Glioblastoma multiforme(93;0.0463)										0.512821	58.460655	58.465853	20	19	KEEP	---	---	---	---	capture		Silent	SNP	186333533	186333533	423	3	G	T	T	T	587	46	AHSG	2	2
HRG	3273	broad.mit.edu	37	3	186395105	186395105	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:186395105C>A	uc003fqq.2	+	c.1011C>A	c.(1009-1011)GCC>GCA	p.A337A		NM_000412	NP_000403	P04196	HRG_HUMAN	histidine-rich glycoprotein precursor	337					fibrinolysis|platelet activation|platelet degranulation	extracellular region|plasma membrane|platelet alpha granule lumen	cysteine-type endopeptidase inhibitor activity|heparin binding			ovary(1)|central_nervous_system(1)	2	all_cancers(143;6.64e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;5.73e-20)	GBM - Glioblastoma multiforme(93;0.0683)										0.466667	41.467389	41.49385	14	16	KEEP	---	---	---	---	capture		Silent	SNP	186395105	186395105	7646	3	C	A	A	A	275	22	HRG	2	2
C3orf59	151963	broad.mit.edu	37	3	192516397	192516397	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:192516397G>T	uc011bsp.1	-	c.1254C>A	c.(1252-1254)GTC>GTA	p.V418V		NM_178496	NP_848591	Q8IYB1	M21D2_HUMAN	hypothetical protein LOC151963	418											0	all_cancers(143;1.56e-08)|Ovarian(172;0.0634)		OV - Ovarian serous cystadenocarcinoma(49;2.8e-18)|LUSC - Lung squamous cell carcinoma(58;8.04e-06)|Lung(62;8.62e-06)	GBM - Glioblastoma multiforme(46;3.86e-05)										0.220339	25.731911	29.996571	13	46	KEEP	---	---	---	---	capture		Silent	SNP	192516397	192516397	2330	3	G	T	T	T	574	45	C3orf59	2	2
C3orf21	152002	broad.mit.edu	37	3	194991426	194991426	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:194991426G>T	uc003fum.3	-	c.362C>A	c.(361-363)GCG>GAG	p.A121E		NM_152531	NP_689744	Q8NBI6	CC021_HUMAN	hypothetical protein LOC152002	121						integral to membrane	transferase activity, transferring glycosyl groups				0	all_cancers(143;9.33e-09)|Ovarian(172;0.0634)		Epithelial(36;1.73e-20)|all cancers(36;1.42e-18)|OV - Ovarian serous cystadenocarcinoma(49;1.56e-17)|Lung(62;0.000117)|LUSC - Lung squamous cell carcinoma(58;0.000146)	GBM - Glioblastoma multiforme(46;1.36e-05)										0.291667	20.518122	21.449422	7	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	194991426	194991426	2307	3	G	T	T	T	494	38	C3orf21	1	1
ARPP21	10777	broad.mit.edu	37	3	35763114	35763114	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:35763114C>T	uc011axy.1	+	c.911C>T	c.(910-912)TCA>TTA	p.S304L	ARPP21_uc003cga.2_Missense_Mutation_p.S284L|ARPP21_uc003cgb.2_Missense_Mutation_p.S338L|ARPP21_uc003cgf.2_Missense_Mutation_p.S139L|ARPP21_uc003cgg.2_5'UTR	NM_016300	NP_057384	Q9UBL0	ARP21_HUMAN	cyclic AMP-regulated phosphoprotein, 21 kD	338	Ser-rich.					cytoplasm	nucleic acid binding			ovary(2)	2														0.227273	11.663529	13.165592	5	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	35763114	35763114	996	3	C	T	T	T	377	29	ARPP21	2	2
SCN10A	6336	broad.mit.edu	37	3	38739735	38739735	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:38739735G>T	uc003ciq.2	-	c.4976C>A	c.(4975-4977)ACG>AAG	p.T1659K		NM_006514	NP_006505	Q9Y5Y9	SCNAA_HUMAN	sodium channel, voltage-gated, type X, alpha	1659	IV.				sensory perception	voltage-gated sodium channel complex				ovary(5)|large_intestine(1)|kidney(1)|skin(1)	8				KIRC - Kidney renal clear cell carcinoma(284;0.0769)|Kidney(284;0.0945)	Benzocaine(DB01086)|Bupivacaine(DB00297)|Chloroprocaine(DB01161)|Cocaine(DB00907)|Dibucaine(DB00527)|Dyclonine(DB00645)|Hexylcaine(DB00473)|Levobupivacaine(DB01002)|Lidocaine(DB00281)|Mepivacaine(DB00961)|Oxybuprocaine(DB00892)|Procaine(DB00721)|Proparacaine(DB00807)|Ropivacaine(DB00296)									0.443038	113.326436	113.547411	35	44	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	38739735	38739735	14394	3	G	T	T	T	520	40	SCN10A	1	1
ULK4	54986	broad.mit.edu	37	3	41504603	41504603	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:41504603G>C	uc003ckv.3	-	c.3368C>G	c.(3367-3369)TCC>TGC	p.S1123C		NM_017886	NP_060356	Q96C45	ULK4_HUMAN	unc-51-like kinase 4	1123					protein phosphorylation		ATP binding|protein serine/threonine kinase activity				0				KIRC - Kidney renal clear cell carcinoma(284;0.214)						538				0.326087	91.336595	93.795901	30	62	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	41504603	41504603	17536	3	G	C	C	C	533	41	ULK4	3	3
CCR2	729230	broad.mit.edu	37	3	46399269	46399269	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:46399269T>A	uc003cpn.3	+	c.251T>A	c.(250-252)CTG>CAG	p.L84Q	CCR2_uc003cpm.3_Missense_Mutation_p.L84Q	NM_001123041	NP_001116513	P41597	CCR2_HUMAN	chemokine (C-C motif) receptor 2 isoform A	84	Helical; Name=2; (Potential).				astrocyte cell migration|blood vessel remodeling|cellular defense response|chemokine-mediated signaling pathway|dendritic cell chemotaxis|elevation of cytosolic calcium ion concentration|immune response|inflammatory response|interspecies interaction between organisms|JAK-STAT cascade|monocyte extravasation|negative regulation of adenylate cyclase activity|negative regulation of angiogenesis|negative regulation of eosinophil degranulation|negative regulation of type 2 immune response|positive regulation of alpha-beta T cell proliferation|positive regulation of immune complex clearance by monocytes and macrophages|positive regulation of inflammatory response|positive regulation of interferon-gamma production|positive regulation of interleukin-2 production|positive regulation of monocyte chemotaxis|positive regulation of T cell chemotaxis|positive regulation of T cell extravasation|positive regulation of T-helper 1 type immune response|positive regulation of tumor necrosis factor biosynthetic process|regulation of vascular endothelial growth factor production|T-helper 17 cell chemotaxis	cytosol|dendrite|integral to plasma membrane|perikaryon|perinuclear region of cytoplasm|soluble fraction	C-C chemokine receptor activity|CCR2 chemokine receptor binding|protein homodimerization activity			lung(1)|breast(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.00114)|KIRC - Kidney renal clear cell carcinoma(197;0.0174)|Kidney(197;0.0206)										0.391304	248.824813	250.967107	81	126	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	46399269	46399269	3068	3	T	A	A	A	715	55	CCR2	3	3
SETD2	29072	broad.mit.edu	37	3	47163563	47163563	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:47163563T>A	uc003cqv.2	-	c.2530A>T	c.(2530-2532)AGC>TGC	p.S844C	SETD2_uc003cqs.2_Missense_Mutation_p.S855C	NM_014159	NP_054878	Q9BYW2	SETD2_HUMAN	SET domain containing 2	855					oxidation-reduction process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nucleus	DNA binding|histone-lysine N-methyltransferase activity|oxidoreductase activity|transition metal ion binding			kidney(24)|ovary(5)|skin(1)|central_nervous_system(1)|breast(1)	32		Acute lymphoblastic leukemia(5;0.0169)		BRCA - Breast invasive adenocarcinoma(193;0.000302)|KIRC - Kidney renal clear cell carcinoma(197;0.00732)|Kidney(197;0.00844)										0.391892	82.264912	83.019768	29	45	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	47163563	47163563	14620	3	T	A	A	A	702	54	SETD2	3	3
SCAP	22937	broad.mit.edu	37	3	47460980	47460980	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:47460980G>T	uc003crh.1	-	c.1778C>A	c.(1777-1779)TCG>TAG	p.S593*	SCAP_uc011baz.1_Nonsense_Mutation_p.S338*|SCAP_uc003crg.2_Nonsense_Mutation_p.S201*	NM_012235	NP_036367	Q12770	SCAP_HUMAN	SREBF chaperone protein	593	Lumenal (By similarity).				cholesterol metabolic process|negative regulation of cholesterol biosynthetic process|positive regulation of low-density lipoprotein particle receptor biosynthetic process|positive regulation of transcription via sterol regulatory element binding involved in ER-nuclear sterol response pathway	endoplasmic reticulum membrane|ER to Golgi transport vesicle membrane|Golgi membrane|integral to membrane	unfolded protein binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.000278)|KIRC - Kidney renal clear cell carcinoma(197;0.00592)|Kidney(197;0.00679)		Pancreas(149;978 1908 29304 37806 46700)								0.383721	89.274401	90.318669	33	53	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	47460980	47460980	14358	3	G	T	T	T	481	37	SCAP	5	1
SMARCC1	6599	broad.mit.edu	37	3	47703910	47703910	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:47703910G>A	uc003crq.2	-	c.2072C>T	c.(2071-2073)TCA>TTA	p.S691L	SMARCC1_uc011bbc.1_Non-coding_Transcript|SMARCC1_uc011bbd.1_Missense_Mutation_p.S582L	NM_003074	NP_003065	Q92922	SMRC1_HUMAN	SWI/SNF-related matrix-associated	691					chromatin assembly or disassembly|chromatin remodeling|nervous system development|transcription, DNA-dependent	nBAF complex|npBAF complex|nucleoplasm|SWI/SNF complex|WINAC complex	DNA binding|protein N-terminus binding|transcription coactivator activity			lung(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(193;7.47e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.00862)|Kidney(197;0.01)										0.433962	65.738974	65.935178	23	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	47703910	47703910	15273	3	G	A	A	A	585	45	SMARCC1	2	2
CAMKV	79012	broad.mit.edu	37	3	49896879	49896879	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:49896879G>T	uc003cxt.1	-	c.1378C>A	c.(1378-1380)CCT>ACT	p.P460T	TRAIP_uc003cxs.1_5'Flank|TRAIP_uc010hla.1_5'Flank|TRAIP_uc011bcx.1_5'Flank|CAMKV_uc011bcy.1_Missense_Mutation_p.P385T|CAMKV_uc003cxv.1_Missense_Mutation_p.P432T|CAMKV_uc003cxw.1_Missense_Mutation_p.P292T|CAMKV_uc003cxx.1_Missense_Mutation_p.P292T|CAMKV_uc003cxu.2_Missense_Mutation_p.P429T|CAMKV_uc011bcz.1_Missense_Mutation_p.P392T|CAMKV_uc011bda.1_Missense_Mutation_p.P386T	NM_024046	NP_076951	Q8NCB2	CAMKV_HUMAN	CaM kinase-like vesicle-associated	460	Ala-rich.				protein phosphorylation	cytoplasmic vesicle membrane|plasma membrane	ATP binding|protein serine/threonine kinase activity			ovary(2)|lung(2)|large_intestine(2)|central_nervous_system(1)	7				BRCA - Breast invasive adenocarcinoma(193;4.62e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.00551)|Kidney(197;0.00621)						82				0.384615	107.709636	108.91026	40	64	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	49896879	49896879	2725	3	G	T	T	T	559	43	CAMKV	2	2
MAPKAPK3	7867	broad.mit.edu	37	3	50679165	50679165	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:50679165G>T	uc003day.1	+	c.387G>T	c.(385-387)AGG>AGT	p.R129S	MAPKAPK3_uc003daz.1_Missense_Mutation_p.R129S|MAPKAPK3_uc003dba.1_Missense_Mutation_p.R129S|MAPKAPK3_uc010hlr.1_Missense_Mutation_p.R129S	NM_004635	NP_004626	Q16644	MAPK3_HUMAN	mitogen-activated protein kinase-activated	129	Protein kinase.				activation of MAPK activity|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|Ras protein signal transduction|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	ATP binding|MAP kinase kinase activity|protein serine/threonine kinase activity			ovary(1)|central_nervous_system(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.000292)|KIRC - Kidney renal clear cell carcinoma(197;0.0188)|Kidney(197;0.0223)						122				0.4	43.97795	44.331401	16	24	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	50679165	50679165	9673	3	G	T	T	T	529	41	MAPKAPK3	2	2
CACNA2D3	55799	broad.mit.edu	37	3	54596898	54596898	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:54596898G>T	uc003dhf.2	+	c.616G>T	c.(616-618)GAC>TAC	p.D206Y	CACNA2D3_uc011beu.1_Non-coding_Transcript|CACNA2D3_uc003dhg.1_Missense_Mutation_p.D112Y|CACNA2D3_uc003dhh.1_Non-coding_Transcript|CACNA2D3_uc010hmv.1_5'UTR	NM_018398	NP_060868	Q8IZS8	CA2D3_HUMAN	calcium channel, voltage-dependent, alpha	206	Extracellular (Potential).					integral to membrane	calcium channel activity|metal ion binding|voltage-gated ion channel activity			large_intestine(3)|ovary(1)|breast(1)|central_nervous_system(1)|skin(1)	7				KIRC - Kidney renal clear cell carcinoma(284;0.00287)|Kidney(284;0.00327)										0.346154	21.963423	22.508366	9	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	54596898	54596898	2666	3	G	T	T	T	585	45	CACNA2D3	2	2
ARHGEF3	50650	broad.mit.edu	37	3	56779265	56779265	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:56779265C>T	uc003dih.2	-	c.934G>A	c.(934-936)GAT>AAT	p.D312N	ARHGEF3_uc011bew.1_Missense_Mutation_p.D280N|ARHGEF3_uc011bev.1_Missense_Mutation_p.D251N|ARHGEF3_uc003dif.2_Missense_Mutation_p.D286N|ARHGEF3_uc003dig.2_Missense_Mutation_p.D280N|ARHGEF3_uc010hmy.1_Missense_Mutation_p.D78N|ARHGEF3_uc003dii.2_Missense_Mutation_p.D280N	NM_001128615	NP_001122087	Q9NR81	ARHG3_HUMAN	Rho guanine nucleotide exchange factor 3 isoform	280	DH.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|Rho protein signal transduction	cytosol	Rho guanyl-nucleotide exchange factor activity			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.0161)|Kidney(284;0.019)|OV - Ovarian serous cystadenocarcinoma(275;0.193)										0.445652	125.255304	125.492979	41	51	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	56779265	56779265	918	3	C	T	T	T	377	29	ARHGEF3	2	2
PDZRN3	23024	broad.mit.edu	37	3	73433556	73433556	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:73433556G>T	uc003dpl.1	-	c.2161C>A	c.(2161-2163)CTG>ATG	p.L721M	PDZRN3_uc011bgh.1_Missense_Mutation_p.L378M|PDZRN3_uc010hoe.1_Missense_Mutation_p.L419M|PDZRN3_uc011bgf.1_Missense_Mutation_p.L438M|PDZRN3_uc011bgg.1_Missense_Mutation_p.L441M	NM_015009	NP_055824	Q9UPQ7	PZRN3_HUMAN	PDZ domain containing ring finger 3	721							ubiquitin-protein ligase activity|zinc ion binding			ovary(2)|pancreas(2)|large_intestine(1)	5		Prostate(10;0.114)|Lung NSC(201;0.187)|Lung SC(41;0.236)		BRCA - Breast invasive adenocarcinoma(55;0.00041)|Epithelial(33;0.0023)|LUSC - Lung squamous cell carcinoma(21;0.0048)|Lung(16;0.0105)|KIRC - Kidney renal clear cell carcinoma(39;0.111)|Kidney(39;0.134)										0.368421	38.424918	39.008034	14	24	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	73433556	73433556	12130	3	G	T	T	T	438	34	PDZRN3	2	2
ROBO1	6091	broad.mit.edu	37	3	78766425	78766425	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:78766425C>A	uc003dqe.2	-	c.917G>T	c.(916-918)AGA>ATA	p.R306I	ROBO1_uc003dqb.2_Missense_Mutation_p.R267I|ROBO1_uc003dqc.2_Missense_Mutation_p.R267I|ROBO1_uc003dqd.2_Missense_Mutation_p.R267I|ROBO1_uc003dqf.1_5'Flank	NM_002941	NP_002932	Q9Y6N7	ROBO1_HUMAN	roundabout 1 isoform a	306	Extracellular (Potential).|Ig-like C2-type 3.				activation of caspase activity|axon midline choice point recognition|cell migration involved in sprouting angiogenesis|chemorepulsion involved in postnatal olfactory bulb interneuron migration|homophilic cell adhesion|negative regulation of chemokine-mediated signaling pathway|negative regulation of mammary gland epithelial cell proliferation|negative regulation of negative chemotaxis|positive regulation of axonogenesis|Roundabout signaling pathway	cell surface|cytoplasm|integral to plasma membrane	axon guidance receptor activity|identical protein binding|LRR domain binding			large_intestine(2)	2		Lung SC(41;0.0257)|Lung NSC(201;0.0439)		LUSC - Lung squamous cell carcinoma(21;0.008)|Epithelial(33;0.00999)|Lung(72;0.0177)|BRCA - Breast invasive adenocarcinoma(55;0.0274)						693				0.35	159.053629	162.22888	56	104	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	78766425	78766425	13992	3	C	A	A	A	312	24	ROBO1	2	2
OGG1	4968	broad.mit.edu	37	3	9807579	9807579	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:9807579C>T	uc003bsm.2	+	c.1035C>T	c.(1033-1035)ATC>ATT	p.I345I	OGG1_uc003bsk.2_3'UTR|OGG1_uc003bsl.2_3'UTR|OGG1_uc003bsn.2_Silent_p.I278I|OGG1_uc003bso.2_3'UTR|CAMK1_uc003bst.2_Intron|CAMK1_uc003bsu.2_Intron	NM_016821	NP_058214	O15527	OGG1_HUMAN	8-oxoguanine DNA-glycosylase 1 isoform 2a	335					depurination|nucleotide-excision repair|regulation of protein import into nucleus, translocation|regulation of transcription, DNA-dependent|response to oxidative stress|response to radiation	mitochondrion|nuclear matrix|nuclear speck	damaged DNA binding|endonuclease activity|oxidized purine base lesion DNA N-glycosylase activity|protein binding				0	Medulloblastoma(99;0.227)								p.I345I(PANC02.13-Tumor)	40				0.395349	49.570614	49.980987	17	26	KEEP	---	---	---	---	capture		Silent	SNP	9807579	9807579	11250	3	C	T	T	T	395	31	OGG1	1	1
ADH1C	126	broad.mit.edu	37	4	100268269	100268269	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:100268269C>A	uc003huu.2	-	c.153G>T	c.(151-153)GAG>GAT	p.E51D		NM_000669	NP_000660	P00326	ADH1G_HUMAN	class I alcohol dehydrogenase, gamma subunit	51					ethanol oxidation|xenobiotic metabolic process	cytosol	alcohol dehydrogenase (NAD) activity|zinc ion binding				0				OV - Ovarian serous cystadenocarcinoma(123;1.08e-07)	Fomepizole(DB01213)|NADH(DB00157)									0.247934	74.06715	81.017153	30	91	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	100268269	100268269	310	4	C	A	A	A	363	28	ADH1C	2	2
C4orf21	55345	broad.mit.edu	37	4	113541332	113541332	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:113541332A>T	uc003iau.2	-	c.177T>A	c.(175-177)GAT>GAA	p.D59E	C4orf21_uc003iaw.2_Missense_Mutation_p.D59E	NM_018392	NP_060862	Q6ZU11	YD002_HUMAN	prematurely terminated mRNA decay factor-like	Error:Variant_position_missing_in_Q6ZU11_after_alignment						integral to membrane	zinc ion binding				0		Ovarian(17;0.156)		OV - Ovarian serous cystadenocarcinoma(123;0.000676)										0.238806	42.279464	46.444475	16	51	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	113541332	113541332	2349	4	A	T	T	T	102	8	C4orf21	3	3
SYNPO2	171024	broad.mit.edu	37	4	119979067	119979067	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:119979067G>T	uc010inb.2	+	c.3764G>T	c.(3763-3765)AGG>ATG	p.R1255M	SYNPO2_uc011cgh.1_3'UTR|SYNPO2_uc010inc.2_Missense_Mutation_p.R1125M	NM_133477	NP_597734	Q9UMS6	SYNP2_HUMAN	synaptopodin 2 isoform a	Error:Variant_position_missing_in_Q9UMS6_after_alignment						nucleus|Z disc	14-3-3 protein binding|actin binding|muscle alpha-actinin binding			ovary(2)	2														0.333333	37.659386	38.681122	14	28	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	119979067	119979067	15978	4	G	T	T	T	455	35	SYNPO2	2	2
BOD1L	259282	broad.mit.edu	37	4	13601770	13601770	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:13601770C>A	uc003gmz.1	-	c.6754G>T	c.(6754-6756)GGG>TGG	p.G2252W	BOD1L_uc010idr.1_Missense_Mutation_p.G1589W	NM_148894	NP_683692	Q8NFC6	BOD1L_HUMAN	biorientation of chromosomes in cell division	2252							DNA binding			ovary(5)|breast(1)	6														0.45	27.475093	27.518183	9	11	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	13601770	13601770	1508	4	C	A	A	A	299	23	BOD1L	1	1
SC4MOL	6307	broad.mit.edu	37	4	166254679	166254679	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:166254679G>C	uc003ire.2	+	c.157G>C	c.(157-159)GGA>CGA	p.G53R	SC4MOL_uc010irb.2_Missense_Mutation_p.G53R|SC4MOL_uc003irf.2_Intron	NM_006745	NP_006736	Q15800	ERG25_HUMAN	sterol-C4-methyl oxidase-like isoform 1	53					cholesterol biosynthetic process|fatty acid biosynthetic process|oxidation-reduction process	endoplasmic reticulum membrane|integral to membrane|plasma membrane	C-4 methylsterol oxidase activity|iron ion binding				0	all_hematologic(180;0.221)	Prostate(90;0.0959)|Melanoma(52;0.18)		GBM - Glioblastoma multiforme(119;0.0875)	NADH(DB00157)									0.264151	36.049695	38.700043	14	39	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	166254679	166254679	14346	4	G	C	C	C	559	43	SC4MOL	3	3
KLKB1	3818	broad.mit.edu	37	4	187179225	187179225	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:187179225G>T	uc003iyy.2	+	c.1776G>T	c.(1774-1776)TTG>TTT	p.L592F	KLKB1_uc011clc.1_Missense_Mutation_p.L390F|KLKB1_uc011cld.1_Missense_Mutation_p.G508C	NM_000892	NP_000883	P03952	KLKB1_HUMAN	plasma kallikrein B1 precursor	592	Peptidase S1.				blood coagulation, intrinsic pathway|Factor XII activation|fibrinolysis|plasminogen activation|positive regulation of fibrinolysis	cytoplasm|extracellular space|plasma membrane	serine-type endopeptidase activity			ovary(1)	1		all_cancers(14;1.55e-52)|all_epithelial(14;7.69e-39)|all_lung(41;1.34e-13)|Lung NSC(41;3.58e-13)|Melanoma(20;1.91e-06)|Colorectal(36;0.00664)|Hepatocellular(41;0.00886)|Renal(120;0.00988)|Prostate(90;0.00996)|all_hematologic(60;0.014)|all_neural(102;0.243)		OV - Ovarian serous cystadenocarcinoma(60;1.29e-10)|BRCA - Breast invasive adenocarcinoma(30;3.8e-05)|GBM - Glioblastoma multiforme(59;0.000131)|STAD - Stomach adenocarcinoma(60;0.000292)|LUSC - Lung squamous cell carcinoma(40;0.00241)|READ - Rectum adenocarcinoma(43;0.168)										0.509804	83.950973	83.955243	26	25	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	187179225	187179225	8726	4	G	T	T	T	607	47	KLKB1	2	2
FAT1	2195	broad.mit.edu	37	4	187509957	187509957	+	Missense_Mutation	SNP	T	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:187509957T>G	uc003izf.2	-	c.13556A>C	c.(13555-13557)TAC>TCC	p.Y4519S	FAT1_uc010isn.2_Missense_Mutation_p.Y166S|FAT1_uc003ize.2_Missense_Mutation_p.Y410S	NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	4519	Cytoplasmic (Potential).				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12						Colon(197;1040 2055 4143 4984 49344)								0.230769	15.705209	18.358604	9	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	187509957	187509957	5925	4	T	G	G	G	741	57	FAT1	4	4
FAT1	2195	broad.mit.edu	37	4	187510319	187510319	+	Missense_Mutation	SNP	T	A	A	rs34174591	byFrequency;by1000genomes	TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:187510319T>A	uc003izf.2	-	c.13194A>T	c.(13192-13194)CAA>CAT	p.Q4398H	FAT1_uc010isn.2_Missense_Mutation_p.Q45H|FAT1_uc003ize.2_Missense_Mutation_p.Q289H	NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	4398	Cytoplasmic (Potential).				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12						Colon(197;1040 2055 4143 4984 49344)								0.522059	220.009505	220.068108	71	65	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	187510319	187510319	5925	4	T	A	A	A	725	56	FAT1	3	3
WHSC2	7469	broad.mit.edu	37	4	1989724	1989724	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:1989724G>A	uc003gem.2	-	c.588C>T	c.(586-588)ACC>ACT	p.T196T	WHSC2_uc003gek.2_5'Flank|WHSC2_uc003gel.2_Silent_p.T110T|WHSC2_uc003gen.2_Silent_p.T50T|MIR943_hsa-mir-943|MI0005768_5'Flank	NM_005663	NP_005654	Q9H3P2	NELFA_HUMAN	Wolf-Hirschhorn syndrome candidate 2 protein	185					multicellular organismal development|positive regulation of viral transcription|regulation of transcription, DNA-dependent|transcription elongation from RNA polymerase II promoter|viral reproduction	nucleoplasm					0			OV - Ovarian serous cystadenocarcinoma(23;0.0155)											0.230769	8.019389	8.882019	3	10	KEEP	---	---	---	---	capture		Silent	SNP	1989724	1989724	17938	4	G	A	A	A	496	39	WHSC2	1	1
PTTG2	10744	broad.mit.edu	37	4	37962455	37962455	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:37962455C>G	uc011bye.1	+	c.400C>G	c.(400-402)CGC>GGC	p.R134G	TBC1D1_uc003gtb.2_Intron|TBC1D1_uc011byd.1_Intron|TBC1D1_uc010ifd.2_Intron	NM_006607	NP_006598	Q9NZH5	PTTG2_HUMAN	pituitary tumor-transforming 2	134					chromosome organization|DNA metabolic process	cytoplasm|nucleus	SH3 domain binding				0														0.256757	51.989826	55.959988	19	55	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	37962455	37962455	13279	4	C	G	G	G	351	27	PTTG2	3	3
GABRB1	2560	broad.mit.edu	37	4	47405585	47405585	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:47405585C>A	uc003gxh.2	+	c.692C>A	c.(691-693)CCA>CAA	p.P231Q	GABRB1_uc011bze.1_Missense_Mutation_p.P161Q	NM_000812	NP_000803	P18505	GBRB1_HUMAN	gamma-aminobutyric acid (GABA) A receptor, beta	231	Extracellular (Probable).				synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)	2					Ethchlorvynol(DB00189)|Flurazepam(DB00690)|Lorazepam(DB00186)|Midazolam(DB00683)									0.555556	112.578297	112.742991	35	28	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	47405585	47405585	6417	4	C	A	A	A	273	21	GABRB1	2	2
KDR	3791	broad.mit.edu	37	4	55976632	55976632	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:55976632A>G	uc003has.2	-	c.1193T>C	c.(1192-1194)GTC>GCC	p.V398A	KDR_uc003hat.1_Missense_Mutation_p.V398A|KDR_uc011bzx.1_Missense_Mutation_p.V398A	NM_002253	NP_002244	P35968	VGFR2_HUMAN	kinase insert domain receptor precursor	398	Ig-like C2-type 4.|Extracellular (Potential).				angiogenesis|cell differentiation|interspecies interaction between organisms|positive regulation of endothelial cell migration|positive regulation of endothelial cell proliferation|positive regulation of focal adhesion assembly|positive regulation of positive chemotaxis|protein phosphorylation|regulation of cell shape	integral to plasma membrane	ATP binding|growth factor binding|Hsp90 protein binding|integrin binding|receptor signaling protein tyrosine kinase activity|vascular endothelial growth factor receptor activity			lung(9)|soft_tissue(4)|central_nervous_system(4)|large_intestine(2)|ovary(2)|kidney(1)	22	all_cancers(7;0.0255)|all_lung(4;0.00175)|Lung NSC(11;0.00384)|all_epithelial(27;0.034)|Glioma(25;0.08)|all_neural(26;0.101)		Epithelial(7;0.189)		Sorafenib(DB00398)|Sunitinib(DB01268)					1022	TSP Lung(20;0.16)			0.52381	112.575069	112.606174	33	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	55976632	55976632	8445	4	A	G	G	G	130	10	KDR	4	4
TECRL	253017	broad.mit.edu	37	4	65147209	65147209	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:65147209G>C	uc003hcv.2	-	c.901C>G	c.(901-903)CCT>GCT	p.P301A	TECRL_uc010ihi.2_Non-coding_Transcript	NM_001010874	NP_001010874	Q5HYJ1	TECRL_HUMAN	steroid 5 alpha-reductase 2-like 2	301					lipid metabolic process|oxidation-reduction process	cytoplasm|integral to membrane	oxidoreductase activity, acting on the CH-CH group of donors				0														0.219512	25.962112	28.926153	9	32	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	65147209	65147209	16273	4	G	C	C	C	533	41	TECRL	3	3
MFSD7	84179	broad.mit.edu	37	4	680325	680325	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:680325G>A	uc003gay.2	-	c.290C>T	c.(289-291)GCG>GTG	p.A97V	MFSD7_uc003gaw.2_5'Flank|MFSD7_uc003gax.2_Missense_Mutation_p.A97V|MFSD7_uc003gaz.2_Missense_Mutation_p.A75V|MFSD7_uc003gba.2_Missense_Mutation_p.A97V|MFSD7_uc003gbb.1_Missense_Mutation_p.A33V	NM_032219	NP_115595	Q6UXD7	MFSD7_HUMAN	major facilitator superfamily domain containing	97					transmembrane transport	integral to membrane					0														0.392157	56.402961	56.917188	20	31	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	680325	680325	9927	4	G	A	A	A	494	38	MFSD7	1	1
UGT2B10	7365	broad.mit.edu	37	4	69682288	69682288	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:69682288G>C	uc003hee.2	+	c.551G>C	c.(550-552)GGA>GCA	p.G184A	UGT2B10_uc011cam.1_Intron	NM_001075	NP_001066	P36537	UDB10_HUMAN	UDP glucuronosyltransferase 2B10 isoform 1	184					lipid metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glucuronosyltransferase activity			ovary(2)	2						Melanoma(133;755 1763 25578 26334 46021)								0.505051	176.244714	176.246863	50	49	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	69682288	69682288	17514	4	G	C	C	C	533	41	UGT2B10	3	3
CSN2	1447	broad.mit.edu	37	4	70823408	70823408	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:70823408G>A	uc003hes.3	-	c.259C>T	c.(259-261)CCT>TCT	p.P87S	CSN2_uc003het.3_Missense_Mutation_p.P86S	NM_001891	NP_001882	P05814	CASB_HUMAN	casein beta precursor	87					calcium ion transport	extracellular region	calcium ion binding|enzyme inhibitor activity|transporter activity				0														0.213115	30.642039	35.280277	13	48	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	70823408	70823408	4089	4	G	A	A	A	546	42	CSN2	2	2
GRSF1	2926	broad.mit.edu	37	4	71701992	71701992	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr4:71701992G>A	uc010iia.1	-	c.397C>T	c.(397-399)CCT>TCT	p.P133S	GRSF1_uc011caz.1_Missense_Mutation_p.P15S|GRSF1_uc003hfs.2_5'UTR	NM_002092	NP_002083	Q12849	GRSF1_HUMAN	G-rich RNA sequence binding factor 1 isoform 1	133	RRM 1.				mRNA polyadenylation		mRNA binding|nucleotide binding				0		all_hematologic(202;0.21)	Lung(101;0.235)											0.145833	13.395595	19.182089	7	41	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	71701992	71701992	7089	4	G	A	A	A	559	43	GRSF1	2	2
FER	2241	broad.mit.edu	37	5	108203468	108203468	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:108203468G>T	uc003kop.1	+	c.482G>T	c.(481-483)GGG>GTG	p.G161V	FER_uc011cve.1_Missense_Mutation_p.G101V|FER_uc011cvf.1_Non-coding_Transcript|FER_uc011cvg.1_5'UTR	NM_005246	NP_005237	P16591	FER_HUMAN	fer (fps/fes related) tyrosine kinase	161					intracellular signal transduction|peptidyl-tyrosine phosphorylation	cytoplasm|nucleus	ATP binding|non-membrane spanning protein tyrosine kinase activity			lung(2)|ovary(1)|kidney(1)	4		all_cancers(142;2.86e-06)|all_epithelial(76;9.81e-08)|Prostate(80;0.00972)|Lung NSC(167;0.039)|Ovarian(225;0.0448)|all_lung(232;0.0496)|Colorectal(57;0.0986)|Breast(839;0.152)		OV - Ovarian serous cystadenocarcinoma(64;6.77e-10)|Epithelial(69;4.13e-08)|COAD - Colon adenocarcinoma(37;0.0174)		Colon(146;1051 1799 9836 27344 47401)				232				0.407407	26.806942	27.011958	11	16	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	108203468	108203468	6050	5	G	T	T	T	559	43	FER	2	2
AQPEP	206338	broad.mit.edu	37	5	115361800	115361800	+	Silent	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:115361800A>G	uc003kro.2	+	c.2958A>G	c.(2956-2958)CTA>CTG	p.L986L	AQPEP_uc003krp.2_Non-coding_Transcript|AQPEP_uc003krq.2_Non-coding_Transcript|AQPEP_uc003krr.2_Non-coding_Transcript|AQPEP_uc003krs.2_Non-coding_Transcript	NM_173800	NP_776161	Q6Q4G3	AMPQ_HUMAN	laeverin	986	Lumenal (Potential).				proteolysis	integral to membrane	metallopeptidase activity|zinc ion binding				0														0.5	77.575797	77.575797	21	21	KEEP	---	---	---	---	capture		Silent	SNP	115361800	115361800	845	5	A	G	G	G	158	13	AQPEP	4	4
SLC6A19	340024	broad.mit.edu	37	5	1208962	1208962	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:1208962G>T	uc003jbw.3	+	c.304G>T	c.(304-306)GGT>TGT	p.G102C		NM_001003841	NP_001003841	Q695T7	S6A19_HUMAN	solute carrier family 6, member 19	102	Cytoplasmic (Potential).				cellular nitrogen compound metabolic process	integral to plasma membrane	amino acid transmembrane transporter activity|neurotransmitter:sodium symporter activity				0	all_cancers(3;3.55e-15)|Lung NSC(6;2.89e-14)|all_lung(6;2.2e-13)|all_epithelial(6;3.75e-10)		Epithelial(17;0.000356)|all cancers(22;0.00137)|OV - Ovarian serous cystadenocarcinoma(19;0.00239)|Lung(60;0.185)											0.272727	22.261317	23.797416	9	24	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	1208962	1208962	15179	5	G	T	T	T	559	43	SLC6A19	2	2
PCDHA2	56146	broad.mit.edu	37	5	140175792	140175792	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140175792C>A	uc003lhd.2	+	c.1243C>A	c.(1243-1245)CGC>AGC	p.R415S	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhc.1_Missense_Mutation_p.R415S|PCDHA2_uc011czy.1_Missense_Mutation_p.R415S	NM_018905	NP_061728	Q9Y5H9	PCDA2_HUMAN	protocadherin alpha 2 isoform 1 precursor	415	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(4)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)											0.44375	219.601186	220.039233	71	89	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	140175792	140175792	11944	5	C	A	A	A	299	23	PCDHA2	1	1
PCDHA13	56136	broad.mit.edu	37	5	140263227	140263227	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140263227C>A	uc003lif.2	+	c.1374C>A	c.(1372-1374)CCC>CCA	p.P458P	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc003lhq.2_Intron|PCDHA8_uc003lhs.2_Intron|PCDHA9_uc003lhu.2_Intron|PCDHA10_uc003lhw.2_Intron|PCDHA10_uc003lhx.2_Intron|PCDHA11_uc003lia.2_Intron|PCDHA12_uc003lic.2_Intron|PCDHA13_uc003lie.1_Silent_p.P458P|PCDHA13_uc003lid.2_Silent_p.P458P	NM_018904	NP_061727	Q9Y5I0	PCDAD_HUMAN	protocadherin alpha 13 isoform 1 precursor	458	Cadherin 5.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|central_nervous_system(1)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			Melanoma(147;1739 1852 5500 27947 37288)								0.463415	119.371605	119.462849	38	44	KEEP	---	---	---	---	capture		Silent	SNP	140263227	140263227	11943	5	C	A	A	A	288	23	PCDHA13	1	1
PCDHB2	56133	broad.mit.edu	37	5	140475761	140475761	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140475761C>A	uc003lil.2	+	c.1387C>A	c.(1387-1389)CGC>AGC	p.R463S	PCDHB2_uc003lim.1_Missense_Mutation_p.R124S	NM_018936	NP_061759	Q9Y5E7	PCDB2_HUMAN	protocadherin beta 2 precursor	463	Extracellular (Potential).|Cadherin 5.				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to plasma membrane	calcium ion binding			ovary(3)|pancreas(1)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)											0.352459	124.115518	126.445261	43	79	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	140475761	140475761	11962	5	C	A	A	A	299	23	PCDHB2	1	1
PCDHB7	56129	broad.mit.edu	37	5	140554470	140554470	+	Missense_Mutation	SNP	C	A	A	rs17844475		TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140554470C>A	uc003lit.2	+	c.2054C>A	c.(2053-2055)ACC>AAC	p.T685N	PCDHB8_uc011dai.1_5'Flank	NM_018940	NP_061763	Q9Y5E2	PCDB7_HUMAN	protocadherin beta 7 precursor	685	Extracellular (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|central_nervous_system(1)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)											0.277108	123.809144	131.214705	46	120	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	140554470	140554470	11967	5	C	A	A	A	234	18	PCDHB7	2	2
PCDHB10	56126	broad.mit.edu	37	5	140572519	140572519	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140572519G>C	uc003lix.2	+	c.394G>C	c.(394-396)GTA>CTA	p.V132L		NM_018930	NP_061753	Q9UN67	PCDBA_HUMAN	protocadherin beta 10 precursor	132	Extracellular (Potential).|Cadherin 1.				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to membrane|plasma membrane	calcium ion binding			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)											0.382353	121.342419	122.597119	39	63	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	140572519	140572519	11955	5	G	C	C	C	468	36	PCDHB10	3	3
PCDHB15	56121	broad.mit.edu	37	5	140627409	140627409	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140627409C>A	uc003lje.2	+	c.2263C>A	c.(2263-2265)CTG>ATG	p.L755M		NM_018935	NP_061758	Q9Y5E8	PCDBF_HUMAN	protocadherin beta 15 precursor	755	Cytoplasmic (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding			ovary(2)|breast(2)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)											0.410891	235.401729	236.797075	83	119	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	140627409	140627409	11960	5	C	A	A	A	415	32	PCDHB15	2	2
PCDHGB3	56102	broad.mit.edu	37	5	140750841	140750841	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140750841C>A	uc003ljw.1	+	c.880C>A	c.(880-882)CTG>ATG	p.L294M	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGA6_uc003ljy.1_5'Flank|PCDHGB3_uc011dat.1_Missense_Mutation_p.L294M|PCDHGA6_uc011dau.1_5'Flank	NM_018924	NP_061747	Q9Y5G1	PCDGF_HUMAN	protocadherin gamma subfamily B, 3 isoform 1	294	Extracellular (Potential).|Cadherin 3.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)											0.416	156.562488	157.333485	52	73	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	140750841	140750841	11984	5	C	A	A	A	363	28	PCDHGB3	2	2
PCDHGB3	56102	broad.mit.edu	37	5	140752016	140752016	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140752016G>A	uc003ljw.1	+	c.2055G>A	c.(2053-2055)CAG>CAA	p.Q685Q	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGA6_uc003ljy.1_5'Flank|PCDHGB3_uc011dat.1_Silent_p.Q685Q|PCDHGA6_uc011dau.1_5'Flank	NM_018924	NP_061747	Q9Y5G1	PCDGF_HUMAN	protocadherin gamma subfamily B, 3 isoform 1	685	Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)											0.439394	92.917438	93.135698	29	37	KEEP	---	---	---	---	capture		Silent	SNP	140752016	140752016	11984	5	G	A	A	A	451	35	PCDHGB3	2	2
PCDHGA7	56108	broad.mit.edu	37	5	140763012	140763012	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140763012G>A	uc003lka.1	+	c.546G>A	c.(544-546)GTG>GTA	p.V182V	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003ljz.1_Silent_p.V182V	NM_018920	NP_061743	Q9Y5G6	PCDG7_HUMAN	protocadherin gamma subfamily A, 7 isoform 1	182	Extracellular (Potential).|Cadherin 2.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)											0.269231	17.529727	18.769098	7	19	KEEP	---	---	---	---	capture		Silent	SNP	140763012	140763012	11979	5	G	A	A	A	587	46	PCDHGA7	2	2
PCDHGB5	56101	broad.mit.edu	37	5	140779392	140779392	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:140779392C>G	uc003lkf.1	+	c.1698C>G	c.(1696-1698)GAC>GAG	p.D566E	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc011daw.1_Missense_Mutation_p.D566E	NM_018925	NP_061748	Q9Y5G0	PCDGH_HUMAN	protocadherin gamma subfamily B, 5 isoform 1	566	Cadherin 6.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)											0.424242	44.85521	45.017677	14	19	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	140779392	140779392	11986	5	C	G	G	G	246	19	PCDHGB5	3	3
PCDH1	5097	broad.mit.edu	37	5	141248253	141248253	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:141248253T>A	uc003llp.2	-	c.784A>T	c.(784-786)AGC>TGC	p.S262C	PCDH1_uc011dbf.1_Missense_Mutation_p.S240C|PCDH1_uc003llq.2_Missense_Mutation_p.S262C	NM_032420	NP_115796	Q08174	PCDH1_HUMAN	protocadherin 1 isoform 2 precursor	262	Extracellular (Potential).|Cadherin 2.			S -> T (in Ref. 4; AAA36419).	cell-cell signaling|homophilic cell adhesion|nervous system development	cell-cell junction|integral to plasma membrane	calcium ion binding			ovary(5)	5		Lung NSC(810;0.027)|all_lung(500;0.0321)|all_hematologic(541;0.0433)|Prostate(461;0.0453)|Breast(839;0.128)|Lung SC(612;0.238)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)	GBM - Glioblastoma multiforme(465;1.06e-05)		Ovarian(132;1609 1739 4190 14731 45037)								0.347826	23.256165	23.697926	8	15	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	141248253	141248253	11926	5	T	A	A	A	715	55	PCDH1	3	3
RBM27	54439	broad.mit.edu	37	5	145643117	145643117	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:145643117C>T	uc003lnz.3	+	c.2254C>T	c.(2254-2256)CTT>TTT	p.L752F	RBM27_uc003lny.2_Missense_Mutation_p.L697F	NM_018989	NP_061862	Q9P2N5	RBM27_HUMAN	RNA binding motif protein 27	752					mRNA processing	cytoplasm|nuclear speck	nucleotide binding|RNA binding|zinc ion binding			central_nervous_system(2)|pancreas(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)											0.382812	143.896517	145.453123	49	79	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	145643117	145643117	13589	5	C	T	T	T	416	32	RBM27	2	2
ANKH	56172	broad.mit.edu	37	5	14712990	14712990	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:14712990C>T	uc003jfm.3	-	c.1358G>A	c.(1357-1359)CGG>CAG	p.R453Q	ANKH_uc003jfl.3_Missense_Mutation_p.R166Q	NM_054027	NP_473368	Q9HCJ1	ANKH_HUMAN	progressive ankylosis protein	453	Cytoplasmic (Potential).				locomotory behavior|regulation of bone mineralization|skeletal system development	integral to plasma membrane|outer membrane	inorganic diphosphate transmembrane transporter activity|inorganic phosphate transmembrane transporter activity				0														0.333333	8.521883	8.743347	3	6	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	14712990	14712990	630	5	C	T	T	T	299	23	ANKH	1	1
SLC36A3	285641	broad.mit.edu	37	5	150657056	150657056	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:150657056G>A	uc003ltx.2	-	c.1434C>T	c.(1432-1434)ATC>ATT	p.I478I	GM2A_uc011dcs.1_Intron|SLC36A3_uc003ltv.2_Silent_p.I422I|SLC36A3_uc003ltw.2_Silent_p.I437I	NM_001145017	NP_001138489	Q495N2	S36A3_HUMAN	solute carrier family 36, member 3 isoform 1	437	Helical; (Potential).					integral to membrane				ovary(2)	2		Medulloblastoma(196;0.109)|all_hematologic(541;0.243)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)											0.416667	104.794763	105.306969	35	49	KEEP	---	---	---	---	capture		Silent	SNP	150657056	150657056	15092	5	G	A	A	A	473	37	SLC36A3	1	1
FAM71B	153745	broad.mit.edu	37	5	156590160	156590160	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:156590160C>A	uc003lwn.2	-	c.1116G>T	c.(1114-1116)TTG>TTT	p.L372F		NM_130899	NP_570969	Q8TC56	FA71B_HUMAN	family with sequence similarity 71, member B	372						nucleus				ovary(3)|pancreas(1)	4	Renal(175;0.00212)	Medulloblastoma(196;0.0523)|all_neural(177;0.21)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)											0.392857	31.518166	31.799802	11	17	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	156590160	156590160	5831	5	C	A	A	A	376	29	FAM71B	2	2
ADAM19	8728	broad.mit.edu	37	5	156915298	156915298	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:156915298G>T	uc003lwz.2	-	c.2525C>A	c.(2524-2526)CCC>CAC	p.P842H	ADAM19_uc003lww.1_Missense_Mutation_p.P575H|ADAM19_uc003lwy.2_Missense_Mutation_p.P441H|ADAM19_uc011ddr.1_Missense_Mutation_p.P773H	NM_033274	NP_150377	Q9H013	ADA19_HUMAN	ADAM metallopeptidase domain 19 preproprotein	842	Cytoplasmic (Potential).|SH3-binding (Potential).				proteolysis	integral to membrane	metalloendopeptidase activity|SH3 domain binding|zinc ion binding			ovary(3)|large_intestine(2)|upper_aerodigestive_tract(1)|pancreas(1)	7	Renal(175;0.00488)	Medulloblastoma(196;0.0359)|all_neural(177;0.14)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)											0.28	105.284401	111.816133	42	108	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	156915298	156915298	241	5	G	T	T	T	559	43	ADAM19	2	2
MARCH11	441061	broad.mit.edu	37	5	16177991	16177991	+	Splice_Site_SNP	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:16177991C>T	uc003jfo.2	-	c.538_splice	c.e2-1	p.G180_splice		NM_001102562	NP_001096032			membrane-associated ring finger (C3HC4) 11							cytoplasmic vesicle membrane|integral to membrane	ligase activity|zinc ion binding				0														0.25	12.26251	13.401493	5	15	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	16177991	16177991	9683	5	C	T	T	T	312	24	MARCH11	5	2
UNC5A	90249	broad.mit.edu	37	5	176297470	176297470	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:176297470G>A	uc003mey.2	+	c.821G>A	c.(820-822)GGA>GAA	p.G274E	UNC5A_uc003mex.1_Missense_Mutation_p.G274E|UNC5A_uc010jkg.1_Missense_Mutation_p.G234E	NM_133369	NP_588610	Q6ZN44	UNC5A_HUMAN	netrin receptor Unc5h1 precursor	274	TSP type-1.|Extracellular (Potential).				apoptosis|axon guidance|regulation of apoptosis	integral to membrane|plasma membrane					0	all_cancers(89;0.000119)|Renal(175;0.000269)|Lung NSC(126;0.00696)|all_lung(126;0.0115)	Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)											0.230769	32.28654	36.624232	15	50	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	176297470	176297470	17549	5	G	A	A	A	533	41	UNC5A	2	2
CCDC127	133957	broad.mit.edu	37	5	205950	205950	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:205950C>A	uc003jam.1	-	c.245G>T	c.(244-246)CGG>CTG	p.R82L		NM_145265	NP_660308	Q96BQ5	CC127_HUMAN	coiled-coil domain containing 127	82	Potential.										0			all cancers(22;0.0236)|Lung(60;0.113)											0.54386	103.333615	103.43004	31	26	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	205950	205950	2883	5	C	A	A	A	299	23	CCDC127	1	1
PRDM9	56979	broad.mit.edu	37	5	23509160	23509160	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:23509160C>T	uc003jgo.2	+	c.18C>T	c.(16-18)TCC>TCT	p.S6S		NM_020227	NP_064612	Q9NQV7	PRDM9_HUMAN	PR domain containing 9	6					meiosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nucleoplasm	histone-lysine N-methyltransferase activity|nucleic acid binding|zinc ion binding			ovary(3)|large_intestine(2)|pancreas(1)	6														0.307692	22.134918	22.969706	8	18	KEEP	---	---	---	---	capture		Silent	SNP	23509160	23509160	12906	5	C	T	T	T	275	22	PRDM9	2	2
ADAMTS12	81792	broad.mit.edu	37	5	33535096	33535096	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:33535096C>A	uc003jia.1	-	c.4448G>T	c.(4447-4449)TGT>TTT	p.C1483F	ADAMTS12_uc010iuq.1_Missense_Mutation_p.C1398F	NM_030955	NP_112217	P58397	ATS12_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1483	TSP type-1 8.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(4)|lung(1)|kidney(1)|skin(1)	7														0.216216	19.478546	22.228432	8	29	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	33535096	33535096	258	5	C	A	A	A	221	17	ADAMTS12	2	2
ADAMTS12	81792	broad.mit.edu	37	5	33535098	33535098	+	Splice_Site_SNP	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:33535098C>A	uc003jia.1	-	c.4447_splice	c.e23-1	p.C1483_splice	ADAMTS12_uc010iuq.1_Splice_Site_SNP_p.C1398_splice	NM_030955	NP_112217			ADAM metallopeptidase with thrombospondin type 1						proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(4)|lung(1)|kidney(1)|skin(1)	7														0.222222	19.680091	22.235868	8	28	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	33535098	33535098	258	5	C	A	A	A	260	20	ADAMTS12	5	2
RAI14	26064	broad.mit.edu	37	5	34803879	34803879	+	Nonsense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:34803879C>T	uc003jis.2	+	c.328C>T	c.(328-330)CAG>TAG	p.Q110*	RAI14_uc003jir.2_Nonsense_Mutation_p.Q107*|RAI14_uc010iur.2_Nonsense_Mutation_p.Q107*|RAI14_uc011coj.1_Nonsense_Mutation_p.Q107*|RAI14_uc010ius.1_Nonsense_Mutation_p.Q36*|RAI14_uc003jit.2_Nonsense_Mutation_p.Q107*|RAI14_uc011cok.1_Nonsense_Mutation_p.Q99*	NM_001145525	NP_001138997	Q9P0K7	RAI14_HUMAN	retinoic acid induced 14 isoform d	107	ANK 3.					cell cortex|cytoskeleton	protein binding			ovary(1)	1	all_lung(31;0.000191)													0.470588	24.90717	24.91904	8	9	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	34803879	34803879	13468	5	C	T	T	T	377	29	RAI14	5	2
RICTOR	253260	broad.mit.edu	37	5	38963016	38963016	+	Nonsense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:38963016G>A	uc003jlo.2	-	c.1528C>T	c.(1528-1530)CAG>TAG	p.Q510*	RICTOR_uc003jlp.2_Nonsense_Mutation_p.Q510*|RICTOR_uc010ivf.2_Nonsense_Mutation_p.Q225*	NM_152756	NP_689969	Q6R327	RICTR_HUMAN	rapamycin-insensitive companion of mTOR	510					actin cytoskeleton reorganization|embryo development|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of TOR signaling cascade|regulation of protein kinase B signaling cascade|T cell costimulation	cytosol|TORC2 complex	protein binding			ovary(3)|skin(2)|kidney(1)|central_nervous_system(1)	7	all_lung(31;0.000396)									698				0.308411	89.674374	93.153537	33	74	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	38963016	38963016	13833	5	G	A	A	A	585	45	RICTOR	5	2
CARD6	84674	broad.mit.edu	37	5	40853331	40853331	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:40853331A>G	uc003jmg.2	+	c.1897A>G	c.(1897-1899)ATG>GTG	p.M633V		NM_032587	NP_115976	Q9BX69	CARD6_HUMAN	caspase recruitment domain family, member 6	633					apoptosis|regulation of apoptosis	intracellular				ovary(2)|skin(2)|lung(1)	5														0.468085	212.450928	212.57404	66	75	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	40853331	40853331	2769	5	A	G	G	G	156	12	CARD6	4	4
HTR1A	3350	broad.mit.edu	37	5	63256879	63256879	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:63256879C>T	uc011cqt.1	-	c.668G>A	c.(667-669)CGC>CAC	p.R223H		NM_000524	NP_000515	P08908	5HT1A_HUMAN	5-hydroxytryptamine (serotonin) receptor 1A	223	Cytoplasmic (By similarity).				behavior|positive regulation of cell proliferation	integral to plasma membrane	serotonin receptor activity			ovary(2)|pancreas(2)	4		Lung NSC(810;3.55e-06)|Prostate(74;0.0352)|Ovarian(174;0.0545)|Breast(144;0.0575)|Colorectal(97;0.234)		Lung(70;0.105)	Alprenolol(DB00866)|Aripiprazole(DB01238)|Buspirone(DB00490)|Clozapine(DB00363)|Eletriptan(DB00216)|Ergoloid mesylate(DB01049)|Fluvoxamine(DB00176)|Lisuride(DB00589)|Methysergide(DB00247)|Mirtazapine(DB00370)|Pindolol(DB00960)|Propranolol(DB00571)|Quetiapine(DB01224)|Sertraline(DB01104)|Tegaserod(DB01079)|Trazodone(DB00656)|Venlafaxine(DB00285)|Ziprasidone(DB00246)									0.376147	101.59394	103.077637	41	68	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	63256879	63256879	7736	5	C	T	T	T	351	27	HTR1A	1	1
CENPH	64946	broad.mit.edu	37	5	68491617	68491617	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:68491617A>T	uc003jvp.2	+	c.313A>T	c.(313-315)AGG>TGG	p.R105W	CENPH_uc010ixc.2_Missense_Mutation_p.S105C	NM_022909	NP_075060	Q9H3R5	CENPH_HUMAN	centromere protein H	105	Potential.				cell division|CenH3-containing nucleosome assembly at centromere|chromosome segregation|kinetochore organization|mitotic prometaphase	condensed chromosome kinetochore|cytosol|nucleoplasm	kinetochore binding|protein binding			large_intestine(1)	1		Lung NSC(167;5.51e-05)|Prostate(74;0.00634)|Ovarian(174;0.0448)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;1.41e-56)|Epithelial(20;1.29e-52)|all cancers(19;3.15e-48)|Lung(70;0.0178)										0.35	37.306747	38.114479	14	26	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	68491617	68491617	3365	5	A	T	T	T	88	7	CENPH	3	3
HAPLN1	1404	broad.mit.edu	37	5	82937482	82937482	+	Nonsense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr5:82937482C>A	uc003kim.2	-	c.898G>T	c.(898-900)GGA>TGA	p.G300*	HAPLN1_uc003kin.2_Nonsense_Mutation_p.G300*	NM_001884	NP_001875	P10915	HPLN1_HUMAN	hyaluronan and proteoglycan link protein 1	300	Link 2.				cell adhesion	proteinaceous extracellular matrix	hyaluronic acid binding			large_intestine(3)|ovary(1)	4		Lung NSC(167;0.0484)|all_lung(232;0.0522)|Ovarian(174;0.142)		OV - Ovarian serous cystadenocarcinoma(54;7.82e-42)|Epithelial(54;5.88e-35)|all cancers(79;1.14e-29)						115				0.394286	207.92879	209.642556	69	106	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	82937482	82937482	7236	5	C	A	A	A	299	23	HAPLN1	5	1
ASCC3	10973	broad.mit.edu	37	6	101214441	101214441	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:101214441C>A	uc003pqk.2	-	c.1737G>T	c.(1735-1737)CAG>CAT	p.Q579H	ASCC3_uc011eai.1_Missense_Mutation_p.Q481H|ASCC3_uc003pql.2_Missense_Mutation_p.Q579H	NM_006828	NP_006819	Q8N3C0	HELC1_HUMAN	activating signal cointegrator 1 complex subunit	579	Helicase ATP-binding 1.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|microtubule cytoskeleton	ATP binding|ATP-dependent helicase activity|nucleic acid binding			ovary(5)	5		all_cancers(76;1.45e-07)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(87;0.00149)|Hepatocellular(1;0.0893)|Colorectal(196;0.13)		BRCA - Breast invasive adenocarcinoma(108;0.0539)|all cancers(137;0.103)|GBM - Glioblastoma multiforme(226;0.199)										0.478261	98.637289	98.667282	33	36	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	101214441	101214441	1051	6	C	A	A	A	311	24	ASCC3	2	2
GRIK2	2898	broad.mit.edu	37	6	102372516	102372517	+	Missense_Mutation	DNP	CC	AA	AA			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:102372516_102372517CC>AA	uc003pqp.3	+	c.1789_1790CC>AA	c.(1789-1791)CCT>AAT	p.P597N	GRIK2_uc003pqo.3_Missense_Mutation_p.P597N|GRIK2_uc010kcw.2_Missense_Mutation_p.P597N	NM_021956	NP_068775	Q13002	GRIK2_HUMAN	glutamate receptor, ionotropic, kainate 2	597	Cytoplasmic (Potential).				glutamate signaling pathway|induction of programmed cell death in response to chemical stimulus|neuron apoptosis|positive regulation of synaptic transmission|regulation of short-term neuronal synaptic plasticity	cell junction|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|kainate selective glutamate receptor activity			ovary(2)|breast(1)|pancreas(1)	4		all_cancers(76;1.19e-07)|Acute lymphoblastic leukemia(125;6.17e-11)|all_hematologic(75;6.01e-08)|all_epithelial(87;0.0121)|Colorectal(196;0.14)		all cancers(137;0.112)|BRCA - Breast invasive adenocarcinoma(108;0.124)|GBM - Glioblastoma multiforme(226;0.206)	L-Glutamic Acid(DB00142)									0.342105	75.726877	77.401029	26	50	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	102372516	102372517	7053	6	CC	AA	AA	AA	286	22	GRIK2	2	2
ELOVL2	54898	broad.mit.edu	37	6	10995395	10995395	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:10995395C>A	uc003mzp.3	-	c.350G>T	c.(349-351)TGG>TTG	p.W117L		NM_017770	NP_060240	Q9NXB9	ELOV2_HUMAN	elongation of very long chain fatty acids-like	117					fatty acid elongation, polyunsaturated fatty acid|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process|very long-chain fatty acid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	fatty acid elongase activity|protein binding				0	Breast(50;0.0418)|Ovarian(93;0.0919)	all_hematologic(90;0.117)	Epithelial(50;0.176)											0.422222	58.742722	58.973597	19	26	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	10995395	10995395	5266	6	C	A	A	A	273	21	ELOVL2	2	2
FYN	2534	broad.mit.edu	37	6	112025246	112025246	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:112025246T>A	uc003pvj.2	-	c.503A>T	c.(502-504)AAC>ATC	p.N168I	FYN_uc003pvi.2_Missense_Mutation_p.N168I|FYN_uc003pvk.2_Missense_Mutation_p.N168I|FYN_uc003pvh.2_Missense_Mutation_p.N168I|FYN_uc010kdy.1_5'Flank	NM_002037	NP_002028	P06241	FYN_HUMAN	protein-tyrosine kinase fyn isoform a	168	SH2.				axon guidance|calcium ion transport|feeding behavior|interspecies interaction between organisms|intracellular protein kinase cascade|learning|leukocyte migration|platelet activation|protein phosphorylation|regulation of defense response to virus by virus|T cell costimulation|T cell receptor signaling pathway|viral reproduction	cytosol|endosome|plasma membrane	ATP binding|glycoprotein binding|identical protein binding|metal ion binding|non-membrane spanning protein tyrosine kinase activity			lung(4)|central_nervous_system(1)|skin(1)	6		all_cancers(87;1.37e-05)|Acute lymphoblastic leukemia(125;2.15e-07)|all_hematologic(75;5.28e-06)|all_epithelial(87;0.00125)|Colorectal(196;0.0211)		all cancers(137;0.0451)|OV - Ovarian serous cystadenocarcinoma(136;0.0476)|Epithelial(106;0.102)	Dasatinib(DB01254)					141				0.622642	105.158152	105.852733	33	20	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	112025246	112025246	6377	6	T	A	A	A	780	60	FYN	3	3
GPR126	57211	broad.mit.edu	37	6	142630733	142630733	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:142630733C>T	uc010khe.2	+	c.55C>T	c.(55-57)CCT>TCT	p.P19S	GPR126_uc010khc.2_Missense_Mutation_p.P19S|GPR126_uc010khd.2_Missense_Mutation_p.P19S|GPR126_uc010khf.2_Missense_Mutation_p.P19S|GPR126_uc003qix.2_Missense_Mutation_p.P19S	NM_198569	NP_940971	Q86SQ4	GP126_HUMAN	G protein-coupled receptor 126 beta 1 precursor	19					neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(1)	1	Breast(32;0.176)			OV - Ovarian serous cystadenocarcinoma(155;9.33e-06)|GBM - Glioblastoma multiforme(68;0.00121)										0.428571	9.087848	9.103795	3	4	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	142630733	142630733	6914	6	C	T	T	T	390	30	GPR126	2	2
LPA	4018	broad.mit.edu	37	6	160998325	160998325	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:160998325G>T	uc003qtl.2	-	c.4474C>A	c.(4474-4476)CCA>ACA	p.P1492T		NM_005577	NP_005568	P08519	APOA_HUMAN	lipoprotein Lp(a) precursor	4000	Kringle 36.				blood circulation|lipid metabolic process|lipid transport|lipoprotein metabolic process|proteolysis|receptor-mediated endocytosis	plasma lipoprotein particle	apolipoprotein binding|endopeptidase inhibitor activity|fibronectin binding|heparin binding|serine-type endopeptidase activity			ovary(3)|pancreas(1)	4		Breast(66;0.000496)|Ovarian(120;0.0303)|Prostate(117;0.0965)		OV - Ovarian serous cystadenocarcinoma(65;2.5e-17)|BRCA - Breast invasive adenocarcinoma(81;6.48e-06)	Aminocaproic Acid(DB00513)									0.658537	95.438647	96.350188	27	14	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	160998325	160998325	9276	6	G	T	T	T	572	44	LPA	2	2
PARK2	5071	broad.mit.edu	37	6	161969941	161969941	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:161969941G>T	uc003qtx.3	-	c.1028C>A	c.(1027-1029)CCG>CAG	p.P343Q	PARK2_uc003qtv.3_Intron|PARK2_uc010kkd.2_Missense_Mutation_p.P152Q|PARK2_uc003qtw.3_Missense_Mutation_p.P152Q|PARK2_uc003qty.3_Missense_Mutation_p.P315Q|PARK2_uc003qtz.3_Missense_Mutation_p.P194Q|PARK2_uc010kke.1_Missense_Mutation_p.P362Q|PARK2_uc011egf.1_Missense_Mutation_p.P17Q	NM_004562	NP_004553	O60260	PRKN2_HUMAN	parkin isoform 1	343	IBR-type.				aggresome assembly|central nervous system development|mitochondrion degradation|negative regulation of actin filament bundle assembly|negative regulation of cell death|negative regulation of protein phosphorylation|negative regulation of release of cytochrome c from mitochondria|neuron death|positive regulation of I-kappaB kinase/NF-kappaB cascade|protein autoubiquitination|protein K48-linked ubiquitination|protein K63-linked ubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|regulation of reactive oxygen species metabolic process	aggresome|cytosol|endoplasmic reticulum|Golgi apparatus|mitochondrion|nucleus|perinuclear region of cytoplasm	chaperone binding|PDZ domain binding|protein kinase binding|ubiquitin-protein ligase activity|zinc ion binding				0		all_cancers(1;8.13e-65)|all_epithelial(1;5.77e-64)|Colorectal(1;9.65e-15)|all_lung(1;1.66e-13)|Lung NSC(1;7.54e-11)|Melanoma(1;1.75e-09)|Breast(66;7.81e-05)|Ovarian(120;0.000981)|Prostate(117;0.0288)|Esophageal squamous(34;0.102)		UCEC - Uterine corpus endometrioid carcinoma (4;0.0663)|all cancers(1;1.9e-63)|Epithelial(1;1.5e-59)|Colorectal(1;2.16e-23)|OV - Ovarian serous cystadenocarcinoma(65;3.53e-20)|COAD - Colon adenocarcinoma(1;2.11e-15)|STAD - Stomach adenocarcinoma(1;4.64e-07)|BRCA - Breast invasive adenocarcinoma(81;1.49e-06)|READ - Rectum adenocarcinoma(1;2.95e-06)|GBM - Glioblastoma multiforme(2;7.23e-06)|Lung(1;0.00163)|KIRC - Kidney renal clear cell carcinoma(4;0.00371)|LUSC - Lung squamous cell carcinoma(1;0.00442)|Kidney(4;0.0046)										0.742857	166.210336	169.946108	52	18	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	161969941	161969941	11866	6	G	T	T	T	507	39	PARK2	1	1
SLC17A1	6568	broad.mit.edu	37	6	25813179	25813179	+	Silent	SNP	A	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:25813179A>C	uc003nfh.3	-	c.777T>G	c.(775-777)CTT>CTG	p.L259L	SLC17A1_uc011djy.1_Non-coding_Transcript|SLC17A1_uc010jqb.1_Silent_p.L257L|SLC17A1_uc010jqc.1_Intron	NM_005074	NP_005065	Q14916	NPT1_HUMAN	solute carrier family 17 (sodium phosphate),	259	Helical; (Potential).				sodium ion transport|urate metabolic process	integral to plasma membrane|membrane fraction	sodium-dependent phosphate transmembrane transporter activity|symporter activity			ovary(3)|pancreas(1)	4														0.566038	107.258177	107.460374	30	23	KEEP	---	---	---	---	capture		Silent	SNP	25813179	25813179	14912	6	A	C	C	C	158	13	SLC17A1	4	4
HIST1H1E	3008	broad.mit.edu	37	6	26157085	26157085	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:26157085A>G	uc003ngq.2	+	c.467A>G	c.(466-468)AAG>AGG	p.K156R	HIST1H2BD_uc003ngr.2_5'Flank|HIST1H2BD_uc003ngs.2_5'Flank	NM_005321	NP_005312	P10412	H14_HUMAN	histone cluster 1, H1e	156					nucleosome assembly	nucleosome|nucleus	DNA binding|protein binding			large_intestine(1)|ovary(1)	2														0.454545	16.874117	16.893878	5	6	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	26157085	26157085	7411	6	A	G	G	G	39	3	HIST1H1E	4	4
HIST1H2BD	3017	broad.mit.edu	37	6	26158556	26158556	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:26158556C>A	uc003ngr.2	+	c.159C>A	c.(157-159)ACC>ACA	p.T53T	HIST1H2BD_uc003ngs.2_Silent_p.T53T	NM_021063	NP_066407	P58876	H2B1D_HUMAN	histone cluster 1, H2bd	53					nucleosome assembly	nucleosome|nucleus	DNA binding			ovary(1)|pancreas(1)	2														0.548193	293.818464	294.153827	91	75	KEEP	---	---	---	---	capture		Silent	SNP	26158556	26158556	7428	6	C	A	A	A	288	23	HIST1H2BD	1	1
OR11A1	26531	broad.mit.edu	37	6	29394980	29394980	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:29394980C>A	uc003nmg.2	-	c.439G>T	c.(439-441)GTC>TTC	p.V147F		NM_013937	NP_039225	Q9GZK7	O11A1_HUMAN	olfactory receptor, family 11, subfamily A,	147	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1														0.295455	32.952349	34.602974	13	31	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	29394980	29394980	11330	6	C	A	A	A	234	18	OR11A1	2	2
C6orf15	29113	broad.mit.edu	37	6	31079369	31079369	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:31079369T>C	uc003nsk.1	-	c.767A>G	c.(766-768)TAT>TGT	p.Y256C		NM_014070	NP_054789	Q6UXA7	CF015_HUMAN	STG protein precursor	256	Gly-rich.										0														0.574468	95.24809	95.481121	27	20	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	31079369	31079369	2440	6	T	C	C	C	637	49	C6orf15	4	4
BAT2	7916	broad.mit.edu	37	6	31599147	31599147	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:31599147C>T	uc003nvb.3	+	c.2697C>T	c.(2695-2697)GGC>GGT	p.G899G	BAT2_uc011dnv.1_Intron|BAT2_uc003nvc.3_Silent_p.G899G	NM_080686	NP_542417	P48634	PRC2A_HUMAN	HLA-B associated transcript-2	899	4 X 57 AA type A repeats.					cytoplasm|nucleus	protein binding				0														0.363636	21.597966	21.956127	8	14	KEEP	---	---	---	---	capture		Silent	SNP	31599147	31599147	1340	6	C	T	T	T	327	26	BAT2	2	2
TNXB	7148	broad.mit.edu	37	6	32014146	32014146	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:32014146A>T	uc003nzl.2	-	c.10406T>A	c.(10405-10407)GTA>GAA	p.V3469E	TNXB_uc003nzg.1_5'Flank|TNXB_uc003nzh.1_5'UTR	NM_019105	NP_061978	P22105	TENX_HUMAN	tenascin XB isoform 1 precursor	3516	Fibronectin type-III 27.				actin cytoskeleton organization|cell adhesion|collagen metabolic process|elastic fiber assembly|signal transduction	extracellular space|intracellular|proteinaceous extracellular matrix	heparin binding|integrin binding				0														0.529412	27.875255	27.888084	9	8	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	32014146	32014146	16887	6	A	T	T	T	182	14	TNXB	3	3
TAP1	6890	broad.mit.edu	37	6	32818283	32818283	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:32818283C>A	uc003ocg.2	-	c.1242G>T	c.(1240-1242)GTG>GTT	p.V414V	TAP1_uc011dqi.1_Silent_p.V153V	NM_000593	NP_000584	Q03518	TAP1_HUMAN	transporter 1, ATP-binding cassette, sub-family	414	Cytoplasmic (Potential).|ABC transmembrane type-1.				antigen processing and presentation of endogenous peptide antigen via MHC class I|cytosol to ER transport|intracellular transport of viral proteins in host cell|positive regulation of T cell mediated cytotoxicity	cytosol|plasma membrane|TAP complex	ADP binding|ATP binding|MHC class I protein binding|oligopeptide-transporting ATPase activity|peptide antigen binding|protein homodimerization activity|TAP1 binding|TAP2 binding|tapasin binding				0														0.21875	16.111711	18.442318	7	25	KEEP	---	---	---	---	capture		Silent	SNP	32818283	32818283	16071	6	C	A	A	A	314	25	TAP1	2	2
SPDEF	25803	broad.mit.edu	37	6	34512074	34512074	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:34512074C>A	uc003ojq.1	-	c.159G>T	c.(157-159)CAG>CAT	p.Q53H	SPDEF_uc011dsq.1_Missense_Mutation_p.Q53H	NM_012391	NP_036523	O95238	SPDEF_HUMAN	SAM pointed domain containing ets transcription	53					negative regulation of gene-specific transcription from RNA polymerase II promoter|negative regulation of survival gene product expression	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			skin(3)|ovary(1)|central_nervous_system(1)	5														0.5	45.889069	45.889069	16	16	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	34512074	34512074	15536	6	C	A	A	A	311	24	SPDEF	2	2
CPNE5	57699	broad.mit.edu	37	6	36724072	36724073	+	Missense_Mutation	DNP	CC	AA	AA			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:36724072_36724073CC>AA	uc003omr.1	-	c.858_859GG>TT	c.(856-861)GTGGTA>GTTTTA	p.V287L	CPNE5_uc003omp.1_5'UTR|CPNE5_uc010jwn.1_5'UTR|CPNE5_uc003omq.1_5'UTR	NM_020939	NP_065990	Q9HCH3	CPNE5_HUMAN	copine V	287										skin(1)	1										537				0.259259	17.257836	18.728032	7	20	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	36724072	36724073	3953	6	CC	AA	AA	AA	234	18	CPNE5	2	2
LRFN2	57497	broad.mit.edu	37	6	40399866	40399866	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:40399866C>A	uc003oph.1	-	c.987G>T	c.(985-987)CTG>CTT	p.L329L		NM_020737	NP_065788	Q9ULH4	LRFN2_HUMAN	leucine rich repeat and fibronectin type III	329	Extracellular (Potential).|Ig-like.					cell junction|integral to membrane|postsynaptic membrane				ovary(2)	2	Ovarian(28;0.0418)|Colorectal(47;0.196)													0.485714	51.568334	51.574707	17	18	KEEP	---	---	---	---	capture		Silent	SNP	40399866	40399866	9311	6	C	A	A	A	262	21	LRFN2	2	2
EFHC1	114327	broad.mit.edu	37	6	52343958	52343958	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:52343958G>T	uc003pap.3	+	c.1402G>T	c.(1402-1404)GGC>TGC	p.G468C	EFHC1_uc011dwv.1_Missense_Mutation_p.G377C|EFHC1_uc011dww.1_Missense_Mutation_p.G449C	NM_018100	NP_060570	Q5JVL4	EFHC1_HUMAN	EF-hand domain (C-terminal) containing 1	468	DM10 3.					axoneme|neuronal cell body	calcium ion binding|protein C-terminus binding			ovary(2)	2	Lung NSC(77;0.109)													0.19802	43.635047	52.220194	20	81	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	52343958	52343958	5134	6	G	T	T	T	611	47	EFHC1	2	2
HCRTR2	3062	broad.mit.edu	37	6	55119937	55119937	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:55119937G>T	uc003pcl.2	+	c.406G>T	c.(406-408)GTG>TTG	p.V136L	HCRTR2_uc010jzv.2_Non-coding_Transcript|HCRTR2_uc010jzw.1_Missense_Mutation_p.V71L	NM_001526	NP_001517	O43614	OX2R_HUMAN	orexin receptor 2	136	Helical; Name=3; (Potential).				feeding behavior	integral to plasma membrane	neuropeptide receptor activity			ovary(2)	2	Lung NSC(77;0.107)|Renal(3;0.122)		LUSC - Lung squamous cell carcinoma(124;0.23)											0.5	63.426556	63.426556	19	19	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	55119937	55119937	7285	6	G	T	T	T	520	40	HCRTR2	1	1
ZNF451	26036	broad.mit.edu	37	6	57012581	57012581	+	Silent	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:57012581A>G	uc003pdm.1	+	c.1698A>G	c.(1696-1698)GTA>GTG	p.V566V	ZNF451_uc003pdl.2_Silent_p.V566V|ZNF451_uc003pdn.1_Silent_p.V566V|ZNF451_uc003pdk.1_Silent_p.V566V	NM_001031623	NP_001026794	Q9Y4E5	ZN451_HUMAN	zinc finger protein 451 isoform 1	566					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)|pancreas(1)	2	Lung NSC(77;0.145)		LUSC - Lung squamous cell carcinoma(124;0.0785)|Lung(124;0.13)											0.555556	181.971321	182.233586	55	44	KEEP	---	---	---	---	capture		Silent	SNP	57012581	57012581	18515	6	A	G	G	G	184	15	ZNF451	4	4
PRIM2	5558	broad.mit.edu	37	6	57398234	57398234	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:57398234C>A	uc003pdx.2	+	c.937C>A	c.(937-939)CTG>ATG	p.L313M		NM_000947	NP_000938	P49643	PRI2_HUMAN	DNA primase polypeptide 2	313					DNA replication, synthesis of RNA primer|DNA strand elongation involved in DNA replication|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication	alpha DNA polymerase:primase complex|nucleoplasm	4 iron, 4 sulfur cluster binding|DNA binding|DNA primase activity|metal ion binding				0				Colorectal(6;0.041)|READ - Rectum adenocarcinoma(7;0.193)										0.186441	40.49081	51.363174	22	96	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	57398234	57398234	12934	6	C	A	A	A	415	32	PRIM2	2	2
F13A1	2162	broad.mit.edu	37	6	6318847	6318847	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:6318847G>A	uc003mwv.2	-	c.51C>T	c.(49-51)CCC>CCT	p.P17P	F13A1_uc011dib.1_Silent_p.P17P	NM_000129	NP_000120	P00488	F13A_HUMAN	coagulation factor XIII A1 subunit precursor	17					peptide cross-linking|platelet activation|platelet degranulation	extracellular region|platelet alpha granule lumen	acyltransferase activity|metal ion binding|protein-glutamine gamma-glutamyltransferase activity			ovary(2)|central_nervous_system(1)|pancreas(1)	4	Ovarian(93;0.0816)	all_hematologic(90;0.152)			L-Glutamine(DB00130)									0.205882	64.522227	75.434223	28	108	KEEP	---	---	---	---	capture		Silent	SNP	6318847	6318847	5534	6	G	A	A	A	600	47	F13A1	2	2
BAI3	577	broad.mit.edu	37	6	70049223	70049223	+	Splice_Site_SNP	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:70049223A>T	uc003pev.3	+	c.3288_splice	c.e26-2	p.M1096_splice	BAI3_uc010kak.2_Splice_Site_SNP_p.M1096_splice|BAI3_uc011dxx.1_Splice_Site_SNP_p.M302_splice|BAI3_uc003pex.1_Splice_Site_SNP_p.M226_splice	NM_001704	NP_001695			brain-specific angiogenesis inhibitor 3						neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(7)|skin(6)|pancreas(4)|central_nervous_system(3)|lung(3)|urinary_tract(1)	24		all_lung(197;0.212)								992				0.427083	258.020979	258.908539	82	110	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	70049223	70049223	1321	6	A	T	T	T	91	7	BAI3	5	3
TFR2	7036	broad.mit.edu	37	7	100225567	100225567	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:100225567G>T	uc003uvv.1	-	c.1568C>A	c.(1567-1569)CCC>CAC	p.P523H	TFR2_uc010lhc.1_Missense_Mutation_p.P64H|TFR2_uc003uvu.1_Missense_Mutation_p.P352H	NM_003227	NP_003218	Q9UP52	TFR2_HUMAN	transferrin receptor 2	523	Extracellular (Potential).				cellular iron ion homeostasis|iron ion transport|proteolysis	cytoplasm|integral to plasma membrane	peptidase activity|transferrin receptor activity			ovary(1)|pancreas(1)	2	Lung NSC(181;0.0261)|all_lung(186;0.0392)|Esophageal squamous(72;0.0439)									219				0.521739	102.318803	102.343556	36	33	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	100225567	100225567	16339	7	G	T	T	T	559	43	TFR2	2	2
RELN	5649	broad.mit.edu	37	7	103234901	103234902	+	Missense_Mutation	DNP	GG	TT	TT			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:103234901_103234902GG>TT	uc003vca.2	-	c.3577_3578CC>AA	c.(3577-3579)CCT>AAT	p.P1193N	RELN_uc010liz.2_Missense_Mutation_p.P1193N	NM_005045	NP_005036	P78509	RELN_HUMAN	reelin isoform a	1193					axon guidance|cell adhesion|cerebral cortex tangential migration|glial cell differentiation|neuron migration|peptidyl-tyrosine phosphorylation|positive regulation of protein kinase activity|positive regulation of small GTPase mediated signal transduction|response to pain|spinal cord patterning	cytoplasm|dendrite|extracellular space|proteinaceous extracellular matrix	metal ion binding|protein serine/threonine/tyrosine kinase activity|serine-type peptidase activity			ovary(8)|large_intestine(2)|central_nervous_system(2)|pancreas(1)|skin(1)	14				COAD - Colon adenocarcinoma(1;8.98e-05)|Colorectal(1;0.00184)		NSCLC(146;835 1944 15585 22231 52158)								0.214765	73.510367	84.722181	32	117	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	103234901	103234902	13689	7	GG	TT	TT	TT	455	35	RELN	2	2
RELN	5649	broad.mit.edu	37	7	103292158	103292158	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:103292158A>T	uc003vca.2	-	c.1842T>A	c.(1840-1842)GCT>GCA	p.A614A	RELN_uc010liz.2_Silent_p.A614A	NM_005045	NP_005036	P78509	RELN_HUMAN	reelin isoform a	614					axon guidance|cell adhesion|cerebral cortex tangential migration|glial cell differentiation|neuron migration|peptidyl-tyrosine phosphorylation|positive regulation of protein kinase activity|positive regulation of small GTPase mediated signal transduction|response to pain|spinal cord patterning	cytoplasm|dendrite|extracellular space|proteinaceous extracellular matrix	metal ion binding|protein serine/threonine/tyrosine kinase activity|serine-type peptidase activity			ovary(8)|large_intestine(2)|central_nervous_system(2)|pancreas(1)|skin(1)	14				COAD - Colon adenocarcinoma(1;8.98e-05)|Colorectal(1;0.00184)		NSCLC(146;835 1944 15585 22231 52158)								0.166667	12.802698	17.226444	7	35	KEEP	---	---	---	---	capture		Silent	SNP	103292158	103292158	13689	7	A	T	T	T	80	7	RELN	3	3
RELN	5649	broad.mit.edu	37	7	103322703	103322703	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:103322703G>T	uc003vca.2	-	c.1149C>A	c.(1147-1149)AGC>AGA	p.S383R	RELN_uc010liz.2_Missense_Mutation_p.S383R	NM_005045	NP_005036	P78509	RELN_HUMAN	reelin isoform a	383					axon guidance|cell adhesion|cerebral cortex tangential migration|glial cell differentiation|neuron migration|peptidyl-tyrosine phosphorylation|positive regulation of protein kinase activity|positive regulation of small GTPase mediated signal transduction|response to pain|spinal cord patterning	cytoplasm|dendrite|extracellular space|proteinaceous extracellular matrix	metal ion binding|protein serine/threonine/tyrosine kinase activity|serine-type peptidase activity			ovary(8)|large_intestine(2)|central_nervous_system(2)|pancreas(1)|skin(1)	14				COAD - Colon adenocarcinoma(1;8.98e-05)|Colorectal(1;0.00184)		NSCLC(146;835 1944 15585 22231 52158)								0.226667	38.643786	43.785166	17	58	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	103322703	103322703	13689	7	G	T	T	T	438	34	RELN	2	2
ORC5L	5001	broad.mit.edu	37	7	103838232	103838232	+	Nonsense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:103838232C>A	uc003vcb.2	-	c.382G>T	c.(382-384)GAG>TAG	p.E128*	ORC5L_uc011klp.1_5'UTR|ORC5L_uc003vcc.2_Nonsense_Mutation_p.E128*|ORC5L_uc003vcd.2_Nonsense_Mutation_p.E128*	NM_002553	NP_002544	O43913	ORC5_HUMAN	origin recognition complex subunit 5 isoform 1	128					cell cycle checkpoint|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|S phase of mitotic cell cycle	cytoplasm|nuclear origin of replication recognition complex|nucleoplasm	ATP binding|DNA replication origin binding|identical protein binding				0														0.555556	61.801082	61.897498	20	16	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	103838232	103838232	11676	7	C	A	A	A	416	32	ORC5L	5	2
LAMB4	22798	broad.mit.edu	37	7	107696229	107696229	+	Silent	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:107696229A>G	uc010ljo.1	-	c.3603T>C	c.(3601-3603)GCT>GCC	p.A1201A	LAMB4_uc003vey.2_Silent_p.A1201A|LAMB4_uc010ljp.1_Silent_p.A170A	NM_007356	NP_031382	A4D0S4	LAMB4_HUMAN	laminin, beta 4 precursor	1201	Domain II.				cell adhesion	basement membrane				ovary(4)|breast(2)|large_intestine(1)	7														0.232143	32.889466	36.540107	13	43	KEEP	---	---	---	---	capture		Silent	SNP	107696229	107696229	8936	7	A	G	G	G	184	15	LAMB4	4	4
THAP5	168451	broad.mit.edu	37	7	108205269	108205269	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:108205269T>A	uc003vfm.2	-	c.554A>T	c.(553-555)AAC>ATC	p.N185I	THAP5_uc003vfl.2_Missense_Mutation_p.N143I	NM_001130475	NP_001123947	Q7Z6K1	THAP5_HUMAN	THAP domain containing 5 isoform 1	185					cell cycle|negative regulation of cell cycle	nucleus	DNA binding|metal ion binding|protease binding				0														0.282051	28.203906	29.872354	11	28	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	108205269	108205269	16375	7	T	A	A	A	780	60	THAP5	3	3
CTTNBP2	83992	broad.mit.edu	37	7	117432001	117432001	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:117432001G>T	uc003vjf.2	-	c.1249C>A	c.(1249-1251)CCT>ACT	p.P417T		NM_033427	NP_219499	Q8WZ74	CTTB2_HUMAN	cortactin binding protein 2	417	Pro-rich.									ovary(4)	4	Lung NSC(10;0.0018)|all_lung(10;0.002)			LUSC - Lung squamous cell carcinoma(290;0.133)										0.474138	157.735469	157.800751	55	61	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	117432001	117432001	4204	7	G	T	T	T	533	41	CTTNBP2	2	2
GPR37	2861	broad.mit.edu	37	7	124404849	124404849	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:124404849T>A	uc003vli.2	-	c.182A>T	c.(181-183)AAT>ATT	p.N61I		NM_005302	NP_005293	O15354	GPR37_HUMAN	G protein-coupled receptor 37 precursor	61	Extracellular (Potential).					endoplasmic reticulum membrane|integral to plasma membrane	G-protein coupled receptor activity			ovary(1)|central_nervous_system(1)	2														0.6	70.481857	70.78819	21	14	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	124404849	124404849	6966	7	T	A	A	A	676	52	GPR37	3	3
PLXNA4	91584	broad.mit.edu	37	7	131815315	131815315	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:131815315G>T	uc003vra.3	-	c.5608C>A	c.(5608-5610)CAC>AAC	p.H1870N	PLXNA4_uc003vqz.3_Missense_Mutation_p.H155N	NM_020911	NP_065962	Q9HCM2	PLXA4_HUMAN	plexin A4 isoform 1	1870	Cytoplasmic (Potential).					integral to membrane|intracellular|plasma membrane				ovary(1)	1														0.185714	26.266808	32.723407	13	57	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	131815315	131815315	12548	7	G	T	T	T	611	47	PLXNA4	2	2
LRGUK	136332	broad.mit.edu	37	7	133881855	133881855	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:133881855G>T	uc003vrm.1	+	c.1543G>T	c.(1543-1545)GAA>TAA	p.E515*		NM_144648	NP_653249	Q96M69	LRGUK_HUMAN	leucine-rich repeats and guanylate kinase domain	515	Guanylate kinase-like.						ATP binding|kinase activity			lung(2)|kidney(1)|skin(1)	4										973				0.204082	20.934231	24.910335	10	39	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	133881855	133881855	9316	7	G	T	T	T	429	33	LRGUK	5	2
DGKI	9162	broad.mit.edu	37	7	137263069	137263069	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:137263069C>A	uc003vtt.2	-	c.1645G>T	c.(1645-1647)GCA>TCA	p.A549S	DGKI_uc003vtu.2_Missense_Mutation_p.A249S	NM_004717	NP_004708	O75912	DGKI_HUMAN	diacylglycerol kinase, iota	549					activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|intracellular signal transduction|platelet activation	nucleus|plasma membrane	ATP binding|diacylglycerol kinase activity|metal ion binding			ovary(1)|kidney(1)	2														0.139535	9.136771	14.520981	6	37	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	137263069	137263069	4650	7	C	A	A	A	364	28	DGKI	2	2
OR9A4	130075	broad.mit.edu	37	7	141619191	141619191	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:141619191T>C	uc003vwu.1	+	c.516T>C	c.(514-516)AAT>AAC	p.N172N		NM_001001656	NP_001001656	Q8NGU2	OR9A4_HUMAN	olfactory receptor, family 9, subfamily A,	172	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	Melanoma(164;0.0171)													0.307087	102.166256	106.390244	39	88	KEEP	---	---	---	---	capture		Silent	SNP	141619191	141619191	11660	7	T	C	C	C	660	51	OR9A4	4	4
FAM131B	9715	broad.mit.edu	37	7	143054044	143054044	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:143054044A>G	uc010lpa.2	-	c.682T>C	c.(682-684)TCG>CCG	p.S228P	FAM131B_uc010loz.2_Missense_Mutation_p.S168P|FAM131B_uc003wct.2_Missense_Mutation_p.S200P|FAM131B_uc003wcu.3_Missense_Mutation_p.S200P	NM_001031690	NP_001026860	Q86XD5	F131B_HUMAN	hypothetical protein LOC9715 isoform a	200											0	Melanoma(164;0.205)													0.142857	8.578349	12.857849	5	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	143054044	143054044	5637	7	A	G	G	G	130	10	FAM131B	4	4
FAM131B	9715	broad.mit.edu	37	7	143057165	143057165	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:143057165G>T	uc010lpa.2	-	c.106C>A	c.(106-108)CAC>AAC	p.H36N	FAM131B_uc010loz.2_5'Flank|FAM131B_uc003wct.2_Missense_Mutation_p.H8N|FAM131B_uc003wcu.3_Missense_Mutation_p.H8N|ZYX_uc011ktd.1_5'Flank	NM_001031690	NP_001026860	Q86XD5	F131B_HUMAN	hypothetical protein LOC9715 isoform a	8											0	Melanoma(164;0.205)													0.315789	17.358678	17.923852	6	13	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	143057165	143057165	5637	7	G	T	T	T	598	46	FAM131B	2	2
AGAP3	116988	broad.mit.edu	37	7	150839674	150839674	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:150839674G>C	uc003wjg.1	+	c.2226G>C	c.(2224-2226)TGG>TGC	p.W742C	AGAP3_uc003wje.1_Missense_Mutation_p.W411C|AGAP3_uc003wjj.1_Missense_Mutation_p.W241C|AGAP3_uc003wjk.1_Missense_Mutation_p.W160C	NM_031946	NP_114152	Q96P47	AGAP3_HUMAN	centaurin, gamma 3 isoform a	706	Arf-GAP.				regulation of ARF GTPase activity|small GTPase mediated signal transduction	cytoplasm|membrane	ARF GTPase activator activity|GTP binding|GTPase activity|zinc ion binding			central_nervous_system(2)|ovary(1)	3														0.448276	35.063179	35.131699	13	16	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	150839674	150839674	371	7	G	C	C	C	559	43	AGAP3	3	3
MAD1L1	8379	broad.mit.edu	37	7	2108973	2108973	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:2108973G>A	uc003slh.1	-	c.1074C>T	c.(1072-1074)AGC>AGT	p.S358S	MAD1L1_uc003sle.1_Silent_p.S87S|MAD1L1_uc003slf.1_Silent_p.S358S|MAD1L1_uc003slg.1_Silent_p.S358S|MAD1L1_uc010ksh.1_Silent_p.S358S|MAD1L1_uc003sli.1_Silent_p.S266S|MAD1L1_uc010ksi.1_Silent_p.S311S|MAD1L1_uc010ksj.2_Silent_p.S358S	NM_001013836	NP_001013858	Q9Y6D9	MD1L1_HUMAN	MAD1-like 1 protein	358	Potential.				cell division|mitotic anaphase|mitotic cell cycle spindle assembly checkpoint|mitotic metaphase|mitotic prometaphase|mitotic telophase	actin cytoskeleton|centrosome|condensed chromosome kinetochore|cytosol|mitochondrion|nucleus|spindle	protein binding			central_nervous_system(1)	1		Ovarian(82;0.0272)		UCEC - Uterine corpus endometrioid carcinoma (27;0.134)|OV - Ovarian serous cystadenocarcinoma(56;3.63e-14)										0.454545	27.748415	27.787637	10	12	KEEP	---	---	---	---	capture		Silent	SNP	2108973	2108973	9524	7	G	A	A	A	490	38	MAD1L1	1	1
DNAH11	8701	broad.mit.edu	37	7	21730382	21730382	+	Splice_Site_SNP	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:21730382G>C	uc003svc.2	+	c.5946_splice	c.e36-1	p.R1982_splice		NM_003777	NP_003768			dynein, axonemal, heavy chain 11						microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(8)|large_intestine(3)|pancreas(3)|central_nervous_system(1)	15														0.262626	71.515253	76.554617	26	73	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	21730382	21730382	4781	7	G	C	C	C	429	33	DNAH11	5	3
TTYH3	80727	broad.mit.edu	37	7	2696151	2696151	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:2696151C>T	uc003smp.2	+	c.1233C>T	c.(1231-1233)CAC>CAT	p.H411H	TTYH3_uc010ksn.2_Silent_p.H131H|TTYH3_uc003smq.2_Silent_p.H240H	NM_025250	NP_079526	Q9C0H2	TTYH3_HUMAN	tweety 3	411	Cytoplasmic (Potential).					chloride channel complex|plasma membrane	chloride channel activity				0		Ovarian(82;0.0112)		OV - Ovarian serous cystadenocarcinoma(56;2.04e-14)										0.175439	14.808347	20.520774	10	47	KEEP	---	---	---	---	capture		Silent	SNP	2696151	2696151	17296	7	C	T	T	T	220	17	TTYH3	2	2
HOXA6	3203	broad.mit.edu	37	7	27185361	27185361	+	Silent	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:27185361G>C	uc003syo.1	-	c.618C>G	c.(616-618)CGC>CGG	p.R206R	HOXA5_uc003syn.1_5'Flank	NM_024014	NP_076919	P31267	HXA6_HUMAN	homeobox A6	206	Homeobox.				regulation of transcription, DNA-dependent	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulator activity			ovary(1)|central_nervous_system(1)	2														0.267081	125.524157	133.367348	43	118	KEEP	---	---	---	---	capture		Silent	SNP	27185361	27185361	7588	7	G	C	C	C	535	42	HOXA6	3	3
HOXA13	3209	broad.mit.edu	37	7	27238027	27238027	+	Nonsense_Mutation	SNP	A	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:27238027A>C	uc003szb.1	-	c.957T>G	c.(955-957)TAT>TAG	p.Y319*		NM_000522	NP_000513	P31271	HXA13_HUMAN	homeobox A13	319					skeletal system development	nucleus	transcription regulator activity				0										52		OREG0003748	type=REGULATORY REGION|Gene=HOXA13|Dataset=Stanford ENCODE Dataset|EvidenceSubtype=Transient transfection luciferase assay	0.25	68.558912	74.009561	24	72	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	27238027	27238027	7583	7	A	C	C	C	206	16	HOXA13	5	4
AEBP1	165	broad.mit.edu	37	7	44148746	44148746	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:44148746C>T	uc003tkb.2	+	c.1059C>T	c.(1057-1059)ACC>ACT	p.T353T	AEBP1_uc003tkc.3_5'Flank|AEBP1_uc003tkd.2_5'Flank	NM_001129	NP_001120	Q8IUX7	AEBP1_HUMAN	adipocyte enhancer binding protein 1 precursor	353					cell adhesion|muscle organ development|proteolysis|regulation of transcription, DNA-dependent|skeletal system development	cytoplasm|extracellular space|nucleus	DNA binding|metallocarboxypeptidase activity|sequence-specific DNA binding transcription factor activity|zinc ion binding				0														0.363636	23.594567	23.954227	8	14	KEEP	---	---	---	---	capture		Silent	SNP	44148746	44148746	350	7	C	T	T	T	288	23	AEBP1	1	1
PKD1L1	168507	broad.mit.edu	37	7	47842854	47842854	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:47842854C>T	uc003tny.1	-	c.7916G>A	c.(7915-7917)TGC>TAC	p.C2639Y	C7orf69_uc003tnz.3_Intron|C7orf69_uc003toa.1_Intron	NM_138295	NP_612152	Q8TDX9	PK1L1_HUMAN	polycystin-1L1	2639	Cytoplasmic (Potential).				cell-cell adhesion	integral to membrane				ovary(7)|breast(1)	8														0.1875	15.17047	19.548282	9	39	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	47842854	47842854	12388	7	C	T	T	T	325	25	PKD1L1	2	2
ZPBP	11055	broad.mit.edu	37	7	50070781	50070781	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:50070781G>T	uc003tou.2	-	c.613C>A	c.(613-615)CTT>ATT	p.L205I	ZPBP_uc011kci.1_Missense_Mutation_p.L131I|ZPBP_uc010kyw.2_Missense_Mutation_p.L204I	NM_007009	NP_008940	Q9BS86	ZPBP1_HUMAN	zona pellucida binding protein isoform 1	205					binding of sperm to zona pellucida	extracellular region					0	Glioma(55;0.08)|all_neural(89;0.245)													0.171429	24.065836	31.203066	12	58	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	50070781	50070781	18823	7	G	T	T	T	455	35	ZPBP	2	2
DDC	1644	broad.mit.edu	37	7	50605626	50605626	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:50605626C>A	uc003tpf.3	-	c.367G>T	c.(367-369)GGG>TGG	p.G123W	DDC_uc010kza.2_Intron|DDC_uc003tpg.3_Missense_Mutation_p.G123W	NM_000790	NP_000781	P20711	DDC_HUMAN	dopa decarboxylase (aromatic L-amino acid	123	2.|2 X approximate tandem repeats.				cellular amino acid metabolic process|hormone biosynthetic process|neurotransmitter secretion	cytosol	aromatic-L-amino-acid decarboxylase activity|protein binding|pyridoxal phosphate binding			ovary(2)	2	Glioma(55;0.08)|all_neural(89;0.245)				Amantadine(DB00915)|Carbidopa(DB00190)|Flupenthixol(DB00875)|L-Tryptophan(DB00150)|Levodopa(DB01235)|Pimozide(DB01100)|Pyridoxal Phosphate(DB00114)|Remoxipride(DB00409)									0.545455	58.713967	58.785018	18	15	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	50605626	50605626	4496	7	C	A	A	A	299	23	DDC	1	1
DDC	1644	broad.mit.edu	37	7	50605628	50605628	+	Missense_Mutation	SNP	A	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:50605628A>C	uc003tpf.3	-	c.365T>G	c.(364-366)CTC>CGC	p.L122R	DDC_uc010kza.2_Intron|DDC_uc003tpg.3_Missense_Mutation_p.L122R	NM_000790	NP_000781	P20711	DDC_HUMAN	dopa decarboxylase (aromatic L-amino acid	122	2.|2 X approximate tandem repeats.				cellular amino acid metabolic process|hormone biosynthetic process|neurotransmitter secretion	cytosol	aromatic-L-amino-acid decarboxylase activity|protein binding|pyridoxal phosphate binding			ovary(2)	2	Glioma(55;0.08)|all_neural(89;0.245)				Amantadine(DB00915)|Carbidopa(DB00190)|Flupenthixol(DB00875)|L-Tryptophan(DB00150)|Levodopa(DB01235)|Pimozide(DB01100)|Pyridoxal Phosphate(DB00114)|Remoxipride(DB00409)									0.515152	51.372155	51.378657	17	16	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	50605628	50605628	4496	7	A	C	C	C	143	11	DDC	4	4
COBL	23242	broad.mit.edu	37	7	51287625	51287625	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:51287625G>A	uc003tps.2	-	c.58C>T	c.(58-60)CGT>TGT	p.R20C	COBL_uc003tpr.3_Missense_Mutation_p.R20C|COBL_uc011kcl.1_Missense_Mutation_p.R20C|COBL_uc010kzc.2_Missense_Mutation_p.R20C|COBL_uc003tpt.2_Missense_Mutation_p.R20C	NM_015198	NP_056013	O75128	COBL_HUMAN	cordon-bleu homolog	20										ovary(2)|skin(1)	3	Glioma(55;0.08)					NSCLC(189;2119 2138 12223 30818 34679)								0.5	56.637752	56.637752	18	18	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	51287625	51287625	3791	7	G	A	A	A	481	37	COBL	1	1
FZD9	8326	broad.mit.edu	37	7	72849355	72849355	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:72849355C>G	uc003tyb.2	+	c.1018C>G	c.(1018-1020)CTG>GTG	p.L340V		NM_003508	NP_003499	O00144	FZD9_HUMAN	frizzled 9 precursor	340	Cytoplasmic (Potential).				B cell differentiation|brain development|canonical Wnt receptor signaling pathway|embryo development|gonad development|neuroblast proliferation|regulation of gene-specific transcription from RNA polymerase II promoter|vasculature development	cell surface|filopodium membrane|integral to membrane|perinuclear region of cytoplasm	G-protein coupled receptor activity|PDZ domain binding|protein heterodimerization activity|protein homodimerization activity|Wnt receptor activity|Wnt-protein binding			central_nervous_system(1)	1		Lung NSC(55;0.0659)|all_lung(88;0.152)				Pancreas(144;909 1878 36867 38226 39554)								0.42623	74.630121	74.921423	26	35	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	72849355	72849355	6388	7	C	G	G	G	311	24	FZD9	3	3
GLCCI1	113263	broad.mit.edu	37	7	8062173	8062174	+	Missense_Mutation	DNP	TG	AT	AT			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:8062173_8062174TG>AT	uc003srk.2	+	c.670_671TG>AT	c.(670-672)TGG>ATG	p.W224M		NM_138426	NP_612435	Q86VQ1	GLCI1_HUMAN	glucocorticoid induced transcript 1	224											0		Ovarian(82;0.0608)		UCEC - Uterine corpus endometrioid carcinoma (126;0.206)										0.592593	53.705541	53.908613	16	11	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	8062173	8062174	6699	7	TG	AT	AT	AT	663	51	GLCCI1	3	3
KIAA1324L	222223	broad.mit.edu	37	7	86537030	86537030	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:86537030C>A	uc011kha.1	-	c.2514G>T	c.(2512-2514)AGG>AGT	p.R838S	KIAA1324L_uc003uif.1_Missense_Mutation_p.R598S|KIAA1324L_uc011kgz.1_Missense_Mutation_p.R724S|KIAA1324L_uc003uie.2_Missense_Mutation_p.R671S	NM_001142749	NP_001136221	A8MWY0	K132L_HUMAN	hypothetical protein LOC222223 isoform 1	838	Extracellular (Potential).					integral to membrane				ovary(6)	6	Esophageal squamous(14;0.0058)													0.462687	100.529343	100.609121	31	36	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	86537030	86537030	8533	7	C	A	A	A	233	18	KIAA1324L	2	2
KIAA1324L	222223	broad.mit.edu	37	7	86568131	86568131	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:86568131T>C	uc011kha.1	-	c.993A>G	c.(991-993)CAA>CAG	p.Q331Q	KIAA1324L_uc003uif.1_Silent_p.Q91Q|KIAA1324L_uc011kgz.1_Silent_p.Q217Q|KIAA1324L_uc003uie.2_Silent_p.Q164Q	NM_001142749	NP_001136221	A8MWY0	K132L_HUMAN	hypothetical protein LOC222223 isoform 1	331	Extracellular (Potential).					integral to membrane				ovary(6)	6	Esophageal squamous(14;0.0058)													0.25	63.492413	68.711913	23	69	KEEP	---	---	---	---	capture		Silent	SNP	86568131	86568131	8533	7	T	C	C	C	673	52	KIAA1324L	4	4
DBF4	10926	broad.mit.edu	37	7	87530130	87530130	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:87530130G>A	uc003ujf.1	+	c.861G>A	c.(859-861)TTG>TTA	p.L287L	DBF4_uc003ujh.1_Silent_p.L27L|DBF4_uc003ujg.1_Silent_p.L63L|DBF4_uc011khf.1_Silent_p.L54L	NM_006716	NP_006707	Q9UBU7	DBF4A_HUMAN	activator of S phase kinase	287					cell cycle checkpoint|DNA replication|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle	nucleoplasm	enzyme activator activity|nucleic acid binding|protein binding|zinc ion binding			lung(2)	2	Esophageal squamous(14;0.00202)	Breast(660;0.0334)								763				0.266667	70.870427	76.106728	28	77	KEEP	---	---	---	---	capture		Silent	SNP	87530130	87530130	4419	7	G	A	A	A	581	45	DBF4	2	2
DBF4	10926	broad.mit.edu	37	7	87537065	87537065	+	Missense_Mutation	SNP	A	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:87537065A>G	uc003ujf.1	+	c.1612A>G	c.(1612-1614)AGT>GGT	p.S538G	DBF4_uc003ujh.1_Missense_Mutation_p.S278G|DBF4_uc003ujg.1_Missense_Mutation_p.S314G|DBF4_uc011khf.1_Missense_Mutation_p.S305G	NM_006716	NP_006707	Q9UBU7	DBF4A_HUMAN	activator of S phase kinase	538					cell cycle checkpoint|DNA replication|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle	nucleoplasm	enzyme activator activity|nucleic acid binding|protein binding|zinc ion binding			lung(2)	2	Esophageal squamous(14;0.00202)	Breast(660;0.0334)								763				0.266667	50.25779	53.953388	20	55	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	87537065	87537065	4419	7	A	G	G	G	91	7	DBF4	4	4
SAMD9L	219285	broad.mit.edu	37	7	92762522	92762522	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:92762522G>A	uc003umh.1	-	c.2763C>T	c.(2761-2763)CTC>CTT	p.L921L	SAMD9L_uc003umj.1_Silent_p.L921L|SAMD9L_uc003umi.1_Silent_p.L921L|SAMD9L_uc010lfb.1_Silent_p.L921L|SAMD9L_uc003umk.1_Silent_p.L921L|SAMD9L_uc010lfc.1_Silent_p.L921L|SAMD9L_uc010lfd.1_Silent_p.L921L|SAMD9L_uc011khx.1_Intron	NM_152703	NP_689916	Q8IVG5	SAM9L_HUMAN	sterile alpha motif domain containing 9-like	921										ovary(4)	4	all_cancers(62;4.15e-11)|all_epithelial(64;2.29e-10)|Breast(17;0.000675)|Lung NSC(181;0.0755)|all_lung(186;0.0989)		STAD - Stomach adenocarcinoma(171;0.000302)											0.459459	53.37099	53.423984	17	20	KEEP	---	---	---	---	capture		Silent	SNP	92762522	92762522	14307	7	G	A	A	A	574	45	SAMD9L	2	2
COL1A2	1278	broad.mit.edu	37	7	94052404	94052404	+	Missense_Mutation	SNP	G	A	A	rs72658196		TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:94052404G>A	uc003ung.1	+	c.2539G>A	c.(2539-2541)GGT>AGT	p.G847S	COL1A2_uc011kib.1_Intron|COL1A2_uc010lfi.1_Intron	NM_000089	NP_000080	P08123	CO1A2_HUMAN	alpha 2 type I collagen precursor	847			Missing (in OI2A).		axon guidance|blood vessel development|collagen fibril organization|leukocyte migration|odontogenesis|platelet activation|regulation of blood pressure|Rho protein signal transduction|skeletal system development|skin morphogenesis|transforming growth factor beta receptor signaling pathway	collagen type I|extracellular space|plasma membrane	extracellular matrix structural constituent|identical protein binding|platelet-derived growth factor binding|protein binding, bridging			central_nervous_system(3)|ovary(2)	5	all_cancers(62;2.46e-09)|all_epithelial(64;2.7e-08)		STAD - Stomach adenocarcinoma(171;0.0031)		Collagenase(DB00048)									0.191176	29.64767	35.69864	13	55	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	94052404	94052404	3816	7	G	A	A	A	559	43	COL1A2	2	2
PEG10	23089	broad.mit.edu	37	7	94292998	94292998	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:94292998C>A	uc003uno.2	+	c.130C>A	c.(130-132)CTT>ATT	p.L44I	PEG10_uc011kie.1_Missense_Mutation_p.L120I	NM_015068	NP_055883	Q86TG7	PEG10_HUMAN	paternally expressed 10 isoform RF1/2	44	Potential.				apoptosis|cell differentiation|negative regulation of transforming growth factor beta receptor signaling pathway	cytoplasm|nucleus	DNA binding|protein binding|zinc ion binding			central_nervous_system(1)	1	all_cancers(62;8.26e-10)|all_epithelial(64;5.59e-09)|Lung NSC(181;0.188)|all_lung(186;0.215)		STAD - Stomach adenocarcinoma(171;0.0031)											0.416667	14.5728	14.645535	5	7	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	94292998	94292998	12140	7	C	A	A	A	312	24	PEG10	2	2
NCALD	83988	broad.mit.edu	37	8	102731843	102731843	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:102731843G>A	uc003yke.2	-	c.15C>T	c.(13-15)AAC>AAT	p.N5N	NCALD_uc003ykf.2_Silent_p.N5N|NCALD_uc003ykg.2_Silent_p.N5N|NCALD_uc003ykh.2_Silent_p.N5N|NCALD_uc003yki.2_Silent_p.N5N|NCALD_uc003ykj.2_Silent_p.N5N|NCALD_uc003ykk.2_Silent_p.N5N|NCALD_uc003ykl.2_Silent_p.N5N	NM_032041	NP_114430	P61601	NCALD_HUMAN	neurocalcin delta	5					synaptic transmission|vesicle-mediated transport	clathrin coat of trans-Golgi network vesicle|cytosol	actin binding|calcium ion binding|clathrin binding|tubulin binding				0	all_cancers(14;8.94e-08)|all_epithelial(15;7.03e-10)|Lung NSC(17;1.36e-05)|all_lung(17;2.7e-05)		all cancers(13;1.09e-06)|OV - Ovarian serous cystadenocarcinoma(57;0.000699)											0.280822	107.3218	113.62103	41	105	KEEP	---	---	---	---	capture		Silent	SNP	102731843	102731843	10600	8	G	A	A	A	620	48	NCALD	2	2
RP1L1	94137	broad.mit.edu	37	8	10480505	10480505	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:10480505G>T	uc003wtc.2	-	c.207C>A	c.(205-207)TCC>TCA	p.S69S		NM_178857	NP_849188	A6NKC6	A6NKC6_HUMAN	retinitis pigmentosa 1-like 1	69					intracellular signal transduction					ovary(4)|breast(3)|central_nervous_system(1)	8				COAD - Colon adenocarcinoma(149;0.0811)										0.333333	16.244463	16.687043	6	12	KEEP	---	---	---	---	capture		Silent	SNP	10480505	10480505	14012	8	G	T	T	T	548	43	RP1L1	2	2
LRP12	29967	broad.mit.edu	37	8	105503136	105503136	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:105503136C>A	uc003yma.2	-	c.2345G>T	c.(2344-2346)GGA>GTA	p.G782V	LRP12_uc003ymb.2_Missense_Mutation_p.G763V|LRP12_uc003ylz.2_Missense_Mutation_p.G188V	NM_013437	NP_038465	Q9Y561	LRP12_HUMAN	low density lipoprotein-related protein 12	782	Cytoplasmic (Potential).				endocytosis|regulation of growth	coated pit|integral to plasma membrane	low-density lipoprotein receptor activity|protein binding				0			OV - Ovarian serous cystadenocarcinoma(57;1.21e-06)|STAD - Stomach adenocarcinoma(118;0.229)											0.223022	68.718794	78.479839	31	108	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	105503136	105503136	9327	8	C	A	A	A	390	30	LRP12	2	2
CSMD3	114788	broad.mit.edu	37	8	113299337	113299337	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:113299337C>G	uc003ynu.2	-	c.9287G>C	c.(9286-9288)TGT>TCT	p.C3096S	CSMD3_uc003yns.2_Missense_Mutation_p.C2298S|CSMD3_uc003ynt.2_Missense_Mutation_p.C3056S|CSMD3_uc011lhx.1_Missense_Mutation_p.C2927S	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	3096	Extracellular (Potential).|Sushi 22.					integral to membrane|plasma membrane				ovary(20)|lung(11)|kidney(8)|large_intestine(6)|skin(3)|central_nervous_system(2)|urinary_tract(1)|breast(1)	52										2888	TCGA Ovarian(7;0.080)			0.267606	116.321469	123.223317	38	104	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	113299337	113299337	4087	8	C	G	G	G	221	17	CSMD3	3	3
CSMD3	114788	broad.mit.edu	37	8	113347651	113347651	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:113347651C>A	uc003ynu.2	-	c.7072G>T	c.(7072-7074)GCT>TCT	p.A2358S	CSMD3_uc003yns.2_Missense_Mutation_p.A1560S|CSMD3_uc003ynt.2_Missense_Mutation_p.A2318S|CSMD3_uc011lhx.1_Missense_Mutation_p.A2254S|CSMD3_uc003ynw.1_Missense_Mutation_p.A69S	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	2358	Extracellular (Potential).|CUB 13.					integral to membrane|plasma membrane				ovary(20)|lung(11)|kidney(8)|large_intestine(6)|skin(3)|central_nervous_system(2)|urinary_tract(1)|breast(1)	52										2888	TCGA Ovarian(7;0.080)			0.52381	104.767553	104.798376	33	30	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	113347651	113347651	4087	8	C	A	A	A	351	27	CSMD3	1	1
COL14A1	7373	broad.mit.edu	37	8	121228707	121228707	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:121228707C>G	uc003yox.2	+	c.1715C>G	c.(1714-1716)GCA>GGA	p.A572G	COL14A1_uc003yoy.2_Missense_Mutation_p.A250G|COL14A1_uc010mde.1_Missense_Mutation_p.A250G	NM_021110	NP_066933	Q05707	COEA1_HUMAN	collagen, type XIV, alpha 1 precursor	572	Fibronectin type-III 4.				cell-cell adhesion|collagen fibril organization	collagen type XIV|extracellular space	collagen binding|extracellular matrix structural constituent|protein binding, bridging			ovary(4)|kidney(4)|skin(2)|pancreas(1)|central_nervous_system(1)	12	Lung NSC(37;6.52e-07)|Ovarian(258;0.00769)|Hepatocellular(40;0.161)		OV - Ovarian serous cystadenocarcinoma(1;6.47e-38)|STAD - Stomach adenocarcinoma(47;0.00503)							1131				0.518519	248.392294	248.435246	70	65	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	121228707	121228707	3809	8	C	G	G	G	325	25	COL14A1	3	3
TG	7038	broad.mit.edu	37	8	133945830	133945830	+	Missense_Mutation	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:133945830G>A	uc003ytw.2	+	c.4841G>A	c.(4840-4842)AGC>AAC	p.S1614N	TG_uc010mdw.2_Missense_Mutation_p.S373N|TG_uc011ljb.1_Missense_Mutation_p.S47N	NM_003235	NP_003226	P01266	THYG_HUMAN	thyroglobulin precursor	1614	Type IIIA.				hormone biosynthetic process|regulation of synaptic transmission|signal transduction		carboxylesterase activity|hormone activity			ovary(8)|breast(4)|pancreas(1)	13	Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)	Myeloproliferative disorder(644;0.00878)|Acute lymphoblastic leukemia(644;0.0559)|Breast(495;0.0735)	BRCA - Breast invasive adenocarcinoma(115;0.000701)	KIRC - Kidney renal clear cell carcinoma(542;0.0546)						1778				0.263514	105.56603	113.047782	39	109	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	133945830	133945830	16341	8	G	A	A	A	442	34	TG	2	2
SLA	6503	broad.mit.edu	37	8	134050794	134050794	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:134050794G>T	uc011ljd.1	-	c.926C>A	c.(925-927)TCA>TAA	p.S309*	TG_uc003ytw.2_Intron|TG_uc010mdw.2_Intron|TG_uc011ljb.1_Intron|TG_uc011ljc.1_Intron|SLA_uc003ytz.2_Nonsense_Mutation_p.S269*|SLA_uc011lje.1_Nonsense_Mutation_p.S286*|SLA_uc011ljf.1_Nonsense_Mutation_p.S161*|SLA_uc011ljg.1_Nonsense_Mutation_p.S242*	NM_006748	NP_006739	Q13239	SLAP1_HUMAN	Src-like-adaptor isoform c	269	SLA C-terminal.					endosome	SH3/SH2 adaptor activity			lung(1)|liver(1)	2	all_epithelial(106;3.51e-21)|Lung NSC(106;4.24e-06)|Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)	Myeloproliferative disorder(644;0.00878)|Acute lymphoblastic leukemia(644;0.0279)|Breast(495;0.037)	BRCA - Breast invasive adenocarcinoma(115;0.000701)											0.285714	163.324779	172.298207	62	155	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	134050794	134050794	14858	8	G	T	T	T	585	45	SLA	5	2
COL22A1	169044	broad.mit.edu	37	8	139788254	139788254	+	Splice_Site_SNP	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:139788254C>G	uc003yvd.2	-	c.1759_splice	c.e16-1	p.G587_splice		NM_152888	NP_690848			collagen, type XXII, alpha 1						cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(10)|pancreas(1)	11	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)											0.163636	30.764719	42.620841	18	92	KEEP	---	---	---	---	capture		Splice_Site_SNP	SNP	139788254	139788254	3819	8	C	G	G	G	312	24	COL22A1	5	3
OPLAH	26873	broad.mit.edu	37	8	145113021	145113021	+	Missense_Mutation	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:145113021C>T	uc003zar.3	-	c.980G>A	c.(979-981)GGG>GAG	p.G327E	OPLAH_uc003zas.1_5'Flank|OPLAH_uc003zat.1_Missense_Mutation_p.G105E	NM_017570	NP_060040	O14841	OPLA_HUMAN	5-oxoprolinase (ATP-hydrolysing)	327							5-oxoprolinase (ATP-hydrolyzing) activity|ATP binding				0	all_cancers(97;1.06e-10)|all_epithelial(106;1.5e-09)|Lung NSC(106;5.89e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;6.79e-41)|Epithelial(56;1.02e-39)|all cancers(56;2.24e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)		L-Glutamic Acid(DB00142)									0.24	61.650556	67.821066	24	76	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	145113021	145113021	11282	8	C	T	T	T	286	22	OPLAH	2	2
EPHX2	2053	broad.mit.edu	37	8	27364421	27364421	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:27364421G>T	uc003xfu.2	+	c.570G>T	c.(568-570)CTG>CTT	p.L190L	EPHX2_uc010lut.1_Silent_p.L190L|EPHX2_uc010luu.2_Silent_p.L190L|EPHX2_uc010luv.2_Silent_p.L124L|EPHX2_uc003xfv.2_Silent_p.L137L|EPHX2_uc010luw.2_Silent_p.L124L|EPHX2_uc011lam.1_Silent_p.L46L	NM_001979	NP_001970	P34913	HYES_HUMAN	epoxide hydrolase 2, cytoplasmic	190	Phosphatase.				aromatic compound catabolic process|cellular calcium ion homeostasis|drug metabolic process|inflammatory response|positive regulation of vasodilation|reactive oxygen species metabolic process|regulation of blood pressure|response to toxin|xenobiotic metabolic process	cytosol|focal adhesion|Golgi apparatus|nucleolus|peroxisome|soluble fraction	epoxide hydrolase activity|metal ion binding|protein homodimerization activity			ovary(1)	1		Ovarian(32;2.61e-05)|all_epithelial(46;0.207)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0226)|Epithelial(17;1.12e-09)|Colorectal(74;0.157)	Tamoxifen(DB00675)									0.395833	56.115104	56.570784	19	29	KEEP	---	---	---	---	capture		Silent	SNP	27364421	27364421	5373	8	G	T	T	T	574	45	EPHX2	2	2
CSMD1	64478	broad.mit.edu	37	8	3265713	3265713	+	Silent	SNP	C	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:3265713C>T	uc011kwk.1	-	c.1782G>A	c.(1780-1782)GGG>GGA	p.G594G	CSMD1_uc011kwj.1_5'UTR	NM_033225	NP_150094	Q96PZ7	CSMD1_HUMAN	CUB and Sushi multiple domains 1 precursor	594	Extracellular (Potential).|CUB 4.					integral to membrane				breast(20)|large_intestine(5)	25		all_cancers(1;5.7e-41)|all_epithelial(1;2.54e-36)|Lung NSC(1;7.54e-11)|all_lung(1;3.2e-10)|Hepatocellular(1;3.78e-05)|Breast(1;0.000196)|Myeloproliferative disorder(4;0.000374)|Esophageal squamous(1;0.0157)|Ovarian(12;0.091)|Renal(68;0.144)|Colorectal(14;0.234)		all cancers(1;5.03e-41)|Epithelial(1;4.78e-31)|Lung(1;1.14e-14)|LUSC - Lung squamous cell carcinoma(1;2.34e-14)|GBM - Glioblastoma multiforme(1;4.49e-10)|Colorectal(4;1.18e-07)|OV - Ovarian serous cystadenocarcinoma(1;3.2e-07)|BRCA - Breast invasive adenocarcinoma(1;6.17e-07)|COAD - Colon adenocarcinoma(4;0.000539)|READ - Rectum adenocarcinoma(4;0.00896)|Kidney(5;0.00957)|KIRC - Kidney renal clear cell carcinoma(5;0.0689)										0.357143	15.47094	15.722687	5	9	KEEP	---	---	---	---	capture		Silent	SNP	3265713	3265713	4085	8	C	T	T	T	379	30	CSMD1	2	2
KCNU1	157855	broad.mit.edu	37	8	36793073	36793073	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:36793073C>A	uc010lvw.2	+	c.3085C>A	c.(3085-3087)CCT>ACT	p.P1029T		NM_001031836	NP_001027006	A8MYU2	KCNU1_HUMAN	potassium channel, subfamily U, member 1	1029	Cytoplasmic (Potential).					voltage-gated potassium channel complex	binding|catalytic activity|large conductance calcium-activated potassium channel activity|voltage-gated potassium channel activity			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(67;0.0504)|Kidney(114;0.0634)										0.491228	168.576453	168.584453	56	58	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	36793073	36793073	8398	8	C	A	A	A	338	26	KCNU1	2	2
FGFR1	2260	broad.mit.edu	37	8	38274924	38274924	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:38274924T>C	uc003xlp.2	-	c.1563A>G	c.(1561-1563)ACA>ACG	p.T521T	FGFR1_uc010lwf.2_Non-coding_Transcript|FGFR1_uc011lbo.1_Silent_p.T519T|FGFR1_uc011lbp.1_Silent_p.T432T|FGFR1_uc011lbq.1_Silent_p.T430T|FGFR1_uc010lwk.2_Silent_p.T511T	NM_023110	NP_075598	P11362	FGFR1_HUMAN	fibroblast growth factor receptor 1 isoform 1	521	Cytoplasmic (Potential).|Protein kinase.				axon guidance|cell growth|insulin receptor signaling pathway|MAPKKK cascade|positive regulation of cell proliferation|protein phosphorylation|skeletal system development	extracellular region|integral to plasma membrane|membrane fraction	ATP binding|fibroblast growth factor receptor activity|heparin binding|protein homodimerization activity			lung(5)|central_nervous_system(5)|ovary(1)|breast(1)	12	all_cancers(2;9.05e-47)|all_epithelial(2;2.64e-50)|all_lung(3;1.71e-23)|Lung NSC(2;3.61e-23)|Colorectal(12;0.000442)	Breast(189;1.48e-05)|all_lung(54;0.00354)|Lung NSC(58;0.0138)|Hepatocellular(245;0.065)	Epithelial(3;3.96e-34)|all cancers(3;3.06e-30)|BRCA - Breast invasive adenocarcinoma(5;2.28e-21)|COAD - Colon adenocarcinoma(9;0.24)		Palifermin(DB00039)	Melanoma(146;1153 1840 21453 21841 43625)		1		244				0.717391	188.258009	192.088553	66	26	KEEP	---	---	---	---	capture		Silent	SNP	38274924	38274924	6100	8	T	C	C	C	704	55	FGFR1	4	4
CLVS1	157807	broad.mit.edu	37	8	62212569	62212569	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:62212569C>G	uc003xuh.2	+	c.183C>G	c.(181-183)ATC>ATG	p.I61M	CLVS1_uc003xug.2_Missense_Mutation_p.I61M|CLVS1_uc003xui.2_Intron|CLVS1_uc010lyp.2_Missense_Mutation_p.I61M	NM_173519	NP_775790	Q8IUQ0	CLVS1_HUMAN	retinaldehyde binding protein 1-like 1	61					lysosome organization	clathrin-coated vesicle|early endosome membrane|trans-Golgi network	phosphatidylinositol-3,5-bisphosphate binding|transporter activity			ovary(1)|skin(1)	2														0.302326	79.520625	82.518796	26	60	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	62212569	62212569	3709	8	C	G	G	G	369	29	CLVS1	3	3
DNAJC5B	85479	broad.mit.edu	37	8	66992626	66992626	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:66992626C>A	uc003xvs.1	+	c.348C>A	c.(346-348)ATC>ATA	p.I116I	DNAJC5B_uc003xvt.1_Non-coding_Transcript	NM_033105	NP_149096	Q9UF47	DNJ5B_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 5	116					protein folding	membrane	heat shock protein binding|unfolded protein binding				0		Lung NSC(129;0.114)|all_lung(136;0.188)	Epithelial(68;0.0213)|all cancers(69;0.0839)|BRCA - Breast invasive adenocarcinoma(89;0.0886)|OV - Ovarian serous cystadenocarcinoma(28;0.112)											0.28125	75.387319	79.454893	27	69	KEEP	---	---	---	---	capture		Silent	SNP	66992626	66992626	4834	8	C	A	A	A	395	31	DNAJC5B	1	1
MYBL1	4603	broad.mit.edu	37	8	67509761	67509761	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:67509761C>A	uc003xwj.2	-	c.316G>T	c.(316-318)GGG>TGG	p.G106W	MYBL1_uc003xwl.2_Missense_Mutation_p.G106W|MYBL1_uc003xwk.2_Missense_Mutation_p.G106W	NM_001080416	NP_001073885	P10243	MYBA_HUMAN	v-myb myeloblastosis viral oncogene homolog	106	HTH myb-type 2.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|transcription activator activity			ovary(2)|pancreas(1)	3			Epithelial(68;0.00211)|all cancers(69;0.00726)|OV - Ovarian serous cystadenocarcinoma(28;0.00989)|BRCA - Breast invasive adenocarcinoma(89;0.0938)											0.46	69.85727	69.932779	23	27	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	67509761	67509761	10404	8	C	A	A	A	273	21	MYBL1	2	2
ZFHX4	79776	broad.mit.edu	37	8	77768253	77768253	+	Silent	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:77768253T>A	uc003yav.2	+	c.8961T>A	c.(8959-8961)ATT>ATA	p.I2987I	ZFHX4_uc003yau.1_Silent_p.I3032I|ZFHX4_uc003yaw.1_Silent_p.I2987I	NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	2987					regulation of transcription, DNA-dependent	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulator activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)											0.328125	48.367938	50.089959	21	43	KEEP	---	---	---	---	capture		Silent	SNP	77768253	77768253	18223	8	T	A	A	A	822	64	ZFHX4	3	3
PSKH2	85481	broad.mit.edu	37	8	87081723	87081723	+	Silent	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:87081723C>A	uc011lfy.1	-	c.129G>T	c.(127-129)GCG>GCT	p.A43A		NM_033126	NP_149117	Q96QS6	KPSH2_HUMAN	protein serine kinase H2	43					protein phosphorylation		ATP binding|protein serine/threonine kinase activity			lung(2)|ovary(1)	3			STAD - Stomach adenocarcinoma(118;0.129)						p.A43A(HEC1B-Tumor)|p.A43A(HEC1A-Tumor)	100				0.625	43.837315	44.173877	15	9	KEEP	---	---	---	---	capture		Silent	SNP	87081723	87081723	13118	8	C	A	A	A	340	27	PSKH2	1	1
SLC7A13	157724	broad.mit.edu	37	8	87242304	87242305	+	Missense_Mutation	DNP	GC	AG	AG			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:87242304_87242305GC>AG	uc003ydq.1	-	c.202_203GC>CT	c.(202-204)GCA>CTA	p.A68L	SLC7A13_uc003ydr.1_Missense_Mutation_p.A68L	NM_138817	NP_620172	Q8TCU3	S7A13_HUMAN	solute carrier family 7, (cationic amino acid	68	Cytoplasmic (Potential).					integral to membrane	amino acid transmembrane transporter activity			central_nervous_system(1)	1														0.575342	129.962264	130.325634	42	31	KEEP	---	---	---	---	capture		Missense_Mutation	DNP	87242304	87242305	15192	8	GC	AG	AG	AG	598	46	SLC7A13	2	2
NBN	4683	broad.mit.edu	37	8	90949303	90949303	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:90949303C>G	uc003yej.1	-	c.2185G>C	c.(2185-2187)GTA>CTA	p.V729L	NBN_uc003yei.1_Missense_Mutation_p.V647L|NBN_uc011lgb.1_Intron	NM_002485	NP_002476	O60934	NBN_HUMAN	nibrin	729					cell cycle arrest|DNA damage response, signal transduction by p53 class mediator|DNA duplex unwinding|double-strand break repair via homologous recombination|meiosis|mitotic cell cycle G1/S transition checkpoint|mitotic cell cycle G2/M transition DNA damage checkpoint|positive regulation of kinase activity|positive regulation of protein autophosphorylation|regulation of DNA-dependent DNA replication initiation|telomere maintenance	Mre11 complex|nuclear chromosome, telomeric region|nuclear inclusion body|nucleolus|nucleoplasm	protein N-terminus binding|transcription factor binding			central_nervous_system(3)|kidney(3)	6			BRCA - Breast invasive adenocarcinoma(11;0.0344)							478				0.5	121.529341	121.529341	35	35	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	90949303	90949303	10587	8	C	G	G	G	234	18	NBN	3	3
OSR2	116039	broad.mit.edu	37	8	99961564	99961564	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:99961564G>C	uc011lgx.1	+	c.747G>C	c.(745-747)GAG>GAC	p.E249D	OSR2_uc010mbn.2_Missense_Mutation_p.E128D|OSR2_uc003yir.2_Missense_Mutation_p.E128D|OSR2_uc003yiq.2_Missense_Mutation_p.E128D	NM_001142462	NP_001135934	Q8N2R0	OSR2_HUMAN	odd-skipped related 2 isoform a	128					bone morphogenesis|embryonic skeletal system morphogenesis|eyelid development in camera-type eye|mesonephros development|metanephros development|middle ear morphogenesis|odontogenesis|osteoblast proliferation|palate development|positive regulation of epithelial cell proliferation|positive regulation of gene expression	nucleus	sequence-specific DNA binding|transcription activator activity|zinc ion binding			central_nervous_system(1)	1	Breast(36;4.14e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.0136)											0.273743	122.978026	131.25602	49	130	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	99961564	99961564	11705	8	G	C	C	C	451	35	OSR2	3	3
COL15A1	1306	broad.mit.edu	37	9	101748161	101748161	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:101748161A>T	uc004azb.1	+	c.415A>T	c.(415-417)ACG>TCG	p.T139S	COL15A1_uc004aza.2_Missense_Mutation_p.T139S	NM_001855	NP_001846	P39059	COFA1_HUMAN	alpha 1 type XV collagen precursor	139	TSP N-terminal.				angiogenesis|cell adhesion|cell differentiation|signal transduction	collagen type XV|extracellular space|integral to membrane	binding|extracellular matrix structural constituent			ovary(6)	6		Acute lymphoblastic leukemia(62;0.0562)												0.222222	34.005366	38.493325	14	49	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	101748161	101748161	3810	9	A	T	T	T	78	6	COL15A1	3	3
MURC	347273	broad.mit.edu	37	9	103348395	103348395	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:103348395G>T	uc004bba.2	+	c.757G>T	c.(757-759)GAG>TAG	p.E253*		NM_001018116	NP_001018126	Q5BKX8	MURC_HUMAN	muscle-related coiled-coil protein	253					cell differentiation|muscle organ development|transcription, DNA-dependent					ovary(1)	1		Acute lymphoblastic leukemia(62;0.0461)												0.191011	30.613471	38.571242	17	72	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	103348395	103348395	10381	9	G	T	T	T	533	41	MURC	5	2
KIAA0368	23392	broad.mit.edu	37	9	114156013	114156013	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:114156013G>T	uc004bfe.1	-	c.3458C>A	c.(3457-3459)TCT>TAT	p.S1153Y		NM_001080398	NP_001073867			KIAA0368 protein												0														0.178571	8.469611	11.192588	5	23	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	114156013	114156013	8478	9	G	T	T	T	429	33	KIAA0368	2	2
AKNA	80709	broad.mit.edu	37	9	117118346	117118346	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:117118346T>A	uc004biq.3	-	c.2917A>T	c.(2917-2919)AGG>TGG	p.R973W	AKNA_uc004bin.3_Missense_Mutation_p.R220W|AKNA_uc004bio.3_Missense_Mutation_p.R433W|AKNA_uc004bip.3_Missense_Mutation_p.R892W|AKNA_uc004bir.3_Missense_Mutation_p.R973W|AKNA_uc004bis.3_Missense_Mutation_p.R973W|AKNA_uc010mve.2_Missense_Mutation_p.R854W|AKNA_uc004bit.1_5'Flank	NM_030767	NP_110394	Q7Z591	AKNA_HUMAN	AT-hook transcription factor	973					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(4)|central_nervous_system(2)	6														0.458333	67.619877	67.694755	22	26	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	117118346	117118346	466	9	T	A	A	A	713	55	AKNA	3	3
DBC1	1620	broad.mit.edu	37	9	121976387	121976387	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:121976387C>A	uc004bkc.2	-	c.732G>T	c.(730-732)CAG>CAT	p.Q244H	DBC1_uc004bkd.2_Missense_Mutation_p.Q244H	NM_014618	NP_055433	O60477	DBC1_HUMAN	deleted in bladder cancer 1 precursor	244	MACPF.				cell cycle arrest|cell death	cytoplasm	protein binding			ovary(2)|central_nervous_system(2)|large_intestine(1)	5														0.206897	13.748454	16.046728	6	23	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	121976387	121976387	4418	9	C	A	A	A	259	20	DBC1	2	2
TTLL11	158135	broad.mit.edu	37	9	124801637	124801637	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:124801637C>A	uc011lyl.1	-	c.743G>T	c.(742-744)GGC>GTC	p.G248V	TTLL11_uc004blr.2_Non-coding_Transcript|TTLL11_uc011lym.1_5'UTR|TTLL11_uc004blt.1_Missense_Mutation_p.G248V|TTLL11_uc004blu.1_Missense_Mutation_p.G248V	NM_001139442	NP_001132914	Q8NHH1	TTL11_HUMAN	tubulin tyrosine ligase-like family, member 11	248	TTL.				protein modification process	cilium|microtubule basal body	tubulin-tyrosine ligase activity				0														0.653846	52.275824	52.817272	17	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	124801637	124801637	17279	9	C	A	A	A	338	26	TTLL11	2	2
OR1J4	26219	broad.mit.edu	37	9	125282291	125282291	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:125282291G>T	uc011lyw.1	+	c.872G>T	c.(871-873)AGC>ATC	p.S291I		NM_001004452	NP_001004452	Q8NGS1	OR1J4_HUMAN	olfactory receptor, family 1, subfamily J,	291	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0														0.212121	16.662936	19.150257	7	26	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	125282291	125282291	11367	9	G	T	T	T	442	34	OR1J4	2	2
PRDM12	59335	broad.mit.edu	37	9	133542010	133542010	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:133542010C>G	uc004bzt.1	+	c.239C>G	c.(238-240)TCC>TGC	p.S80C		NM_021619	NP_067632	Q9H4Q4	PRD12_HUMAN	PR domain containing 12	80					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_hematologic(13;0.0433)|Acute lymphoblastic leukemia(5;0.0534)		OV - Ovarian serous cystadenocarcinoma(145;0.000344)										0.529412	91.134098	91.173307	27	24	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	133542010	133542010	12895	9	C	G	G	G	390	30	PRDM12	3	3
TSC1	7248	broad.mit.edu	37	9	135781222	135781222	+	Silent	SNP	G	A	A	rs118203568		TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:135781222G>A	uc004cca.2	-	c.1743C>T	c.(1741-1743)TTC>TTT	p.F581F	TSC1_uc004ccb.3_Silent_p.F580F|TSC1_uc011mcq.1_Silent_p.F530F|TSC1_uc011mcr.1_Intron	NM_000368	NP_000359	Q92574	TSC1_HUMAN	tuberous sclerosis 1 protein isoform 1	581					activation of Rho GTPase activity|cell cycle arrest|cell-matrix adhesion|insulin receptor signaling pathway|negative regulation of cell proliferation|negative regulation of protein ubiquitination|negative regulation of TOR signaling cascade|negative regulation of translation|positive regulation of focal adhesion assembly|regulation of phosphoprotein phosphatase activity|regulation of stress fiber assembly|rRNA export from nucleus	cell cortex|lamellipodium|membrane|TSC1-TSC2 complex	chaperone binding|protein N-terminus binding	p.?(1)		lung(3)|central_nervous_system(2)|haematopoietic_and_lymphoid_tissue(1)|urinary_tract(1)|ovary(1)|bone(1)	9				OV - Ovarian serous cystadenocarcinoma(145;4.32e-08)|Epithelial(140;2.72e-06)						536				0.290323	22.861714	24.083489	9	22	KEEP	---	---	---	---	capture		Silent	SNP	135781222	135781222	17156	9	G	A	A	A	581	45	TSC1	2	2
QSOX2	169714	broad.mit.edu	37	9	139107123	139107123	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:139107123T>C	uc010nbi.2	-	c.1237A>G	c.(1237-1239)ATA>GTA	p.I413V		NM_181701	NP_859052	Q6ZRP7	QSOX2_HUMAN	quiescin Q6 sulfhydryl oxidase 2 precursor	413					cell redox homeostasis|oxidation-reduction process	extracellular region|integral to membrane|nuclear membrane|plasma membrane	thiol oxidase activity			ovary(1)	1		Myeloproliferative disorder(178;0.0511)		Epithelial(140;7.78e-08)|OV - Ovarian serous cystadenocarcinoma(145;1.55e-07)										0.64	45.856049	46.276154	16	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	139107123	139107123	13342	9	T	C	C	C	663	51	QSOX2	4	4
ADAMTSL1	92949	broad.mit.edu	37	9	18776906	18776906	+	Silent	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:18776906G>T	uc003zne.3	+	c.2679G>T	c.(2677-2679)ACG>ACT	p.T893T		NM_001040272	NP_001035362	Q8N6G6	ATL1_HUMAN	ADAMTS-like 1 isoform 4 precursor	893	Ig-like C2-type 1.					proteinaceous extracellular matrix	metallopeptidase activity|zinc ion binding			ovary(3)|lung(1)	4				GBM - Glioblastoma multiforme(50;1.29e-17)										0.902439	131.833009	138.36463	37	4	KEEP	---	---	---	---	capture		Silent	SNP	18776906	18776906	275	9	G	T	T	T	496	39	ADAMTSL1	1	1
TMC1	117531	broad.mit.edu	37	9	75357402	75357402	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:75357402G>T	uc004aiz.1	+	c.496G>T	c.(496-498)GCG>TCG	p.A166S	TMC1_uc010moz.1_Missense_Mutation_p.A124S|TMC1_uc004aja.1_Non-coding_Transcript|TMC1_uc004ajb.1_Non-coding_Transcript|TMC1_uc004ajc.1_Missense_Mutation_p.A20S|TMC1_uc010mpa.1_Missense_Mutation_p.A20S	NM_138691	NP_619636	Q8TDI8	TMC1_HUMAN	transmembrane channel-like 1	166	Cytoplasmic (Potential).|Arg/Asp/Glu/Lys-rich (highly charged).				sensory perception of sound	integral to membrane				ovary(1)	1						Pancreas(75;173 1345 14232 34245 43413)								0.416667	46.818082	47.036522	15	21	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	75357402	75357402	16514	9	G	T	T	T	598	46	TMC1	2	2
TRPM6	140803	broad.mit.edu	37	9	77377235	77377235	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:77377235C>A	uc004ajl.1	-	c.4352G>T	c.(4351-4353)GGA>GTA	p.G1451V	TRPM6_uc004ajk.1_Missense_Mutation_p.G1446V|TRPM6_uc010mpb.1_Non-coding_Transcript|TRPM6_uc010mpc.1_Intron|TRPM6_uc010mpd.1_Intron|TRPM6_uc010mpe.1_Intron|TRPM6_uc004ajj.1_Missense_Mutation_p.G407V	NM_017662	NP_060132	Q9BX84	TRPM6_HUMAN	transient receptor potential cation channel,	1451	Cytoplasmic (Potential).				protein phosphorylation|response to toxin	integral to membrane	ATP binding|calcium channel activity|metal ion binding|protein binding|protein serine/threonine kinase activity			lung(3)|central_nervous_system(1)	4										879				0.482143	79.403164	79.413319	27	29	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	77377235	77377235	17141	9	C	A	A	A	390	30	TRPM6	2	2
PRUNE2	158471	broad.mit.edu	37	9	79321559	79321559	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:79321559C>A	uc010mpk.2	-	c.5631G>T	c.(5629-5631)GAG>GAT	p.E1877D	PRUNE2_uc004akj.3_5'Flank|PRUNE2_uc010mpl.1_5'Flank	NM_015225	NP_056040	Q8WUY3	PRUN2_HUMAN	prune homolog 2	1877					apoptosis|G1 phase|induction of apoptosis	cytoplasm	metal ion binding|pyrophosphatase activity				0														0.473684	25.754895	25.767402	9	10	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	79321559	79321559	13092	9	C	A	A	A	363	28	PRUNE2	2	2
PRUNE2	158471	broad.mit.edu	37	9	79323135	79323135	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:79323135G>C	uc010mpk.2	-	c.4055C>G	c.(4054-4056)GCC>GGC	p.A1352G		NM_015225	NP_056040	Q8WUY3	PRUN2_HUMAN	prune homolog 2	1352					apoptosis|G1 phase|induction of apoptosis	cytoplasm	metal ion binding|pyrophosphatase activity				0														0.510204	81.080611	81.085526	25	24	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	79323135	79323135	13092	9	G	C	C	C	546	42	PRUNE2	3	3
AGTPBP1	23287	broad.mit.edu	37	9	88292465	88292465	+	Nonsense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:88292465T>A	uc011lte.1	-	c.478A>T	c.(478-480)AAA>TAA	p.K160*	AGTPBP1_uc011ltc.1_Nonsense_Mutation_p.K50*|AGTPBP1_uc011ltd.1_Nonsense_Mutation_p.K108*|AGTPBP1_uc010mqc.2_Nonsense_Mutation_p.K108*	NM_015239	NP_056054	Q9UPW5	CBPC1_HUMAN	ATP/GTP binding protein 1	108					C-terminal protein deglutamylation|cerebellar Purkinje cell differentiation|eye photoreceptor cell differentiation|mitochondrion organization|neuromuscular process|olfactory bulb development|protein side chain deglutamylation|proteolysis	cytosol|mitochondrion|nucleus	metallocarboxypeptidase activity|tubulin binding|zinc ion binding			ovary(4)|large_intestine(2)	6														0.275862	46.475559	49.098397	16	42	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	88292465	88292465	403	9	T	A	A	A	819	63	AGTPBP1	5	3
S1PR3	1903	broad.mit.edu	37	9	91616117	91616117	+	Missense_Mutation	SNP	T	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:91616117T>A	uc004aqe.2	+	c.2T>A	c.(1-3)ATG>AAG	p.M1K		NM_005226	NP_005217	Q99500	S1PR3_HUMAN	sphingosine-1-phosphate receptor 3	1	Extracellular (By similarity).				anatomical structure morphogenesis|elevation of cytosolic calcium ion concentration|inflammatory response|positive regulation of cell proliferation	integral to plasma membrane	lipid binding|lysosphingolipid and lysophosphatidic acid receptor activity			ovary(2)|central_nervous_system(1)	3												OREG0019291	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	0.283784	55.40698	58.476242	21	53	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	91616117	91616117	14275	9	T	A	A	A	663	51	S1PR3	3	3
ZNF484	83744	broad.mit.edu	37	9	95609812	95609812	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:95609812C>A	uc011lub.1	-	c.1263G>T	c.(1261-1263)AAG>AAT	p.K421N	ANKRD19_uc004asr.3_Intron|ZNF484_uc004asu.1_Missense_Mutation_p.K419N|ZNF484_uc010mrb.1_Missense_Mutation_p.K383N|ZNF484_uc004asv.1_Missense_Mutation_p.K383N	NM_001007101	NP_001007102	Q5JVG2	ZN484_HUMAN	zinc finger protein 484 isoform b	419	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0														0.42623	77.550877	77.837586	26	35	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	95609812	95609812	18531	9	C	A	A	A	311	24	ZNF484	2	2
PHF2	5253	broad.mit.edu	37	9	96438917	96438917	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:96438917G>T	uc004aub.2	+	c.2874G>T	c.(2872-2874)AAG>AAT	p.K958N	PHF2_uc011lug.1_Missense_Mutation_p.K841N|PHF2_uc004auc.2_Missense_Mutation_p.K378N	NM_005392	NP_005383	O75151	PHF2_HUMAN	PHD finger protein 2	958					negative regulation of chromatin silencing at rDNA|transcription, DNA-dependent	nucleolus	methylated histone residue binding|zinc ion binding			ovary(1)	1		Myeloproliferative disorder(762;0.0255)		OV - Ovarian serous cystadenocarcinoma(323;9.11e-28)										0.444444	12.499804	12.523822	4	5	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	96438917	96438917	12253	9	G	T	T	T	438	34	PHF2	2	2
ARHGAP6	395	broad.mit.edu	37	X	11682515	11682515	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:11682515C>A	uc004cup.1	-	c.434G>T	c.(433-435)GGG>GTG	p.G145V	ARHGAP6_uc004cuo.1_Non-coding_Transcript|ARHGAP6_uc004cur.1_Missense_Mutation_p.G145V	NM_013427	NP_038286	O43182	RHG06_HUMAN	Rho GTPase activating protein 6 isoform 1	145					actin filament polymerization|activation of phospholipase C activity|negative regulation of focal adhesion assembly|negative regulation of stress fiber assembly|Rho protein signal transduction	actin filament|cytosol	phospholipase activator activity|phospholipase binding|Rho GTPase activator activity|SH3 domain binding|SH3/SH2 adaptor activity			urinary_tract(1)|lung(1)	2														1	53.751241	53.75121	15	0	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	11682515	11682515	901	23	C	A	A	A	286	22	ARHGAP6	2	2
DCAF12L2	340578	broad.mit.edu	37	X	125299759	125299759	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:125299759C>A	uc004euk.1	-	c.149G>T	c.(148-150)AGG>ATG	p.R50M		NM_001013628	NP_001013650	Q5VW00	DC122_HUMAN	DDB1 and CUL4 associated factor 12-like 2	50										lung(2)|large_intestine(1)|ovary(1)|pancreas(1)	5														0.869565	62.710333	65.764638	20	3	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	125299759	125299759	4436	23	C	A	A	A	312	24	DCAF12L2	2	2
TLR7	51284	broad.mit.edu	37	X	12904999	12904999	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:12904999C>A	uc004cvc.2	+	c.1372C>A	c.(1372-1374)CAG>AAG	p.Q458K		NM_016562	NP_057646	Q9NYK1	TLR7_HUMAN	toll-like receptor 7 precursor	458	Extracellular (Potential).				cellular response to mechanical stimulus|defense response to virus|I-kappaB phosphorylation|inflammatory response|innate immune response|positive regulation of chemokine production|positive regulation of inflammatory response|positive regulation of interferon-alpha biosynthetic process|positive regulation of interferon-beta biosynthetic process|positive regulation of interferon-gamma biosynthetic process|positive regulation of interleukin-8 biosynthetic process|positive regulation of interleukin-8 production|positive regulation of NF-kappaB import into nucleus	early phagosome|endoplasmic reticulum membrane|endosome membrane|integral to membrane|lysosome|plasma membrane	double-stranded RNA binding|single-stranded RNA binding|siRNA binding|transmembrane receptor activity			ovary(1)	1					Imiquimod(DB00724)					69				0.829268	228.842862	237.245907	68	14	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	12904999	12904999	16486	23	C	A	A	A	273	21	TLR7	2	2
ZNF449	203523	broad.mit.edu	37	X	134494750	134494750	+	Silent	SNP	A	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:134494750A>C	uc004eys.2	+	c.1306A>C	c.(1306-1308)AGA>CGA	p.R436R	ZNF449_uc004eyt.2_Silent_p.R316R|ZNF449_uc004eyu.2_Silent_p.R242R	NM_152695	NP_689908	Q6P9G9	ZN449_HUMAN	zinc finger protein 449	436	C2H2-type 5.				regulation of transcription, DNA-dependent|viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2	Acute lymphoblastic leukemia(192;6.56e-05)													0.757576	166.760111	170.745248	50	16	KEEP	---	---	---	---	capture		Silent	SNP	134494750	134494750	18513	23	A	C	C	C	192	15	ZNF449	4	4
DDX26B	203522	broad.mit.edu	37	X	134655006	134655006	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:134655006G>T	uc004eyw.3	+	c.89G>T	c.(88-90)GGC>GTC	p.G30V		NM_182540	NP_872346	Q5JSJ4	DX26B_HUMAN	DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide	30	VWFA.										0	Acute lymphoblastic leukemia(192;6.56e-05)													0.864865	210.539438	220.085838	64	10	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	134655006	134655006	4524	23	G	T	T	T	546	42	DDX26B	2	2
DDX26B	203522	broad.mit.edu	37	X	134709151	134709151	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:134709151G>C	uc004eyw.3	+	c.1773G>C	c.(1771-1773)AAG>AAC	p.K591N	DDX26B_uc004eyx.3_Missense_Mutation_p.K192N	NM_182540	NP_872346	Q5JSJ4	DX26B_HUMAN	DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide	591											0	Acute lymphoblastic leukemia(192;6.56e-05)													0.831169	203.516765	211.530705	64	13	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	134709151	134709151	4524	23	G	C	C	C	451	35	DDX26B	3	3
GPR112	139378	broad.mit.edu	37	X	135485469	135485469	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:135485469C>A	uc004ezu.1	+	c.8642C>A	c.(8641-8643)CCA>CAA	p.P2881Q	GPR112_uc010nsb.1_Missense_Mutation_p.P2676Q	NM_153834	NP_722576	Q8IZF6	GP112_HUMAN	G-protein coupled receptor 112	2881	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(5)|large_intestine(2)|lung(1)|breast(1)|skin(1)|pancreas(1)	11	Acute lymphoblastic leukemia(192;0.000127)									487				0.615385	27.102786	27.254419	8	5	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	135485469	135485469	6903	23	C	A	A	A	273	21	GPR112	2	2
GPR112	139378	broad.mit.edu	37	X	135485479	135485479	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:135485479G>A	uc004ezu.1	+	c.8652G>A	c.(8650-8652)CCG>CCA	p.P2884P	GPR112_uc010nsb.1_Silent_p.P2679P	NM_153834	NP_722576	Q8IZF6	GP112_HUMAN	G-protein coupled receptor 112	2884	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(5)|large_intestine(2)|lung(1)|breast(1)|skin(1)|pancreas(1)	11	Acute lymphoblastic leukemia(192;0.000127)									487				0.636364	21.528785	21.710401	7	4	KEEP	---	---	---	---	capture		Silent	SNP	135485479	135485479	6903	23	G	A	A	A	509	40	GPR112	1	1
CSF2RA	1438	broad.mit.edu	37	X	1419441	1419441	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:1419441G>T	uc010ncv.2	+	c.868G>T	c.(868-870)GCA>TCA	p.A290S	CSF2RA_uc011mhb.1_Missense_Mutation_p.A290S|CSF2RA_uc010nct.2_Missense_Mutation_p.A290S|CSF2RA_uc004cpq.2_Intron|CSF2RA_uc004cpn.2_Missense_Mutation_p.A290S|CSF2RA_uc004cpo.2_Missense_Mutation_p.A290S|CSF2RA_uc010ncu.2_Intron|CSF2RA_uc011mhc.1_Missense_Mutation_p.A157S|CSF2RA_uc004cpp.2_Missense_Mutation_p.A290S|CSF2RA_uc004cpr.2_Missense_Mutation_p.A290S	NM_001161530	NP_001155002	P15509	CSF2R_HUMAN	colony stimulating factor 2 receptor alpha chain	290	Extracellular (Potential).					extracellular region|integral to plasma membrane	cytokine receptor activity			ovary(2)	2		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)			Sargramostim(DB00020)	Esophageal Squamous(131;723 1707 25334 40494 41806)								0.311688	58.732265	61.190125	24	53	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	1419441	1419441	4075	23	G	T	T	T	442	34	CSF2RA	2	2
SPRY3	10251	broad.mit.edu	37	X	155003584	155003584	+	Missense_Mutation	SNP	G	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:155003584G>C	uc004fnq.1	+	c.51G>C	c.(49-51)CAG>CAC	p.Q17H	SPRY3_uc010nvl.1_Missense_Mutation_p.Q17H	NM_005840	NP_005831	O43610	SPY3_HUMAN	sprouty homolog 3	17					multicellular organismal development|regulation of signal transduction	cytoplasm|membrane					0	all_cancers(53;1.86e-17)|all_epithelial(53;2.71e-11)|all_lung(58;1.84e-07)|Lung NSC(58;5.62e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)|Renal(33;0.214)													0.327103	99.439115	102.302722	35	72	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	155003584	155003584	15621	23	G	C	C	C	438	34	SPRY3	3	3
POLA1	5422	broad.mit.edu	37	X	24767091	24767091	+	Silent	SNP	G	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:24767091G>A	uc004dbl.2	+	c.2928G>A	c.(2926-2928)GTG>GTA	p.V976V		NM_016937	NP_058633	P09884	DPOLA_HUMAN	DNA-directed DNA polymerase alpha 1	976					cell proliferation|DNA replication checkpoint|DNA replication, synthesis of RNA primer|DNA-dependent DNA replication initiation|double-strand break repair via nonhomologous end joining|interspecies interaction between organisms|lagging strand elongation|leading strand elongation|M/G1 transition of mitotic cell cycle|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication	alpha DNA polymerase:primase complex|cytoplasm|nuclear envelope|nuclear matrix|nucleolus|nucleoplasm	chromatin binding|DNA-directed DNA polymerase activity|metal ion binding|nucleoside binding			ovary(2)|skin(1)	3					Clofarabine(DB00631)|Fludarabine(DB01073)									0.75	87.625616	89.667927	27	9	KEEP	---	---	---	---	capture		Silent	SNP	24767091	24767091	12615	23	G	A	A	A	574	45	POLA1	2	2
MXRA5	25878	broad.mit.edu	37	X	3229560	3229560	+	Silent	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:3229560A>T	uc004crg.3	-	c.6684T>A	c.(6682-6684)GGT>GGA	p.G2228G		NM_015419	NP_056234	Q9NR99	MXRA5_HUMAN	adlican precursor	2228	Ig-like C2-type 6.					extracellular region				ovary(5)|lung(1)|central_nervous_system(1)	7		all_lung(23;0.00031)|Lung NSC(23;0.000946)												0.795455	122.547966	126.111487	35	9	KEEP	---	---	---	---	capture		Silent	SNP	3229560	3229560	10397	23	A	T	T	T	67	6	MXRA5	3	3
FAM47B	170062	broad.mit.edu	37	X	34962075	34962075	+	Missense_Mutation	SNP	A	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:34962075A>T	uc004ddi.1	+	c.1127A>T	c.(1126-1128)AAG>ATG	p.K376M		NM_152631	NP_689844	Q8NA70	FA47B_HUMAN	hypothetical protein LOC170062	376										ovary(3)|breast(1)	4														0.851852	75.523721	78.725338	23	4	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	34962075	34962075	5791	23	A	T	T	T	39	3	FAM47B	3	3
ZNF81	347344	broad.mit.edu	37	X	47775357	47775357	+	Nonsense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:47775357G>T	uc010nhy.1	+	c.1312G>T	c.(1312-1314)GGA>TGA	p.G438*		NM_007137	NP_009068	P51508	ZNF81_HUMAN	zinc finger protein 81	438					regulation of transcription, DNA-dependent	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		all_lung(315;0.0973)												0.848485	94.120211	97.957732	28	5	KEEP	---	---	---	---	capture		Nonsense_Mutation	SNP	47775357	47775357	18772	23	G	T	T	T	455	35	ZNF81	5	2
CDX4	1046	broad.mit.edu	37	X	72667443	72667443	+	Silent	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:72667443T>C	uc011mqk.1	+	c.354T>C	c.(352-354)CCT>CCC	p.P118P		NM_005193	NP_005184	O14627	CDX4_HUMAN	caudal type homeobox 4	118						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulator activity				0	Renal(35;0.156)													0.727273	27.904214	28.416163	8	3	KEEP	---	---	---	---	capture		Silent	SNP	72667443	72667443	3313	23	T	C	C	C	704	55	CDX4	4	4
TBX22	50945	broad.mit.edu	37	X	79282284	79282284	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:79282284C>G	uc010nmg.1	+	c.715C>G	c.(715-717)CAG>GAG	p.Q239E	TBX22_uc004edi.1_Missense_Mutation_p.Q119E|TBX22_uc004edj.1_Missense_Mutation_p.Q239E	NM_001109878	NP_001103348	Q9Y458	TBX22_HUMAN	T-box 22 isoform 1	239	T-box.				multicellular organismal development|negative regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|transcription repressor activity			large_intestine(3)|central_nervous_system(2)|lung(1)|ovary(1)	7										298				0.864865	121.428225	126.205939	32	5	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	79282284	79282284	16184	23	C	G	G	G	377	29	TBX22	3	3
BRWD3	254065	broad.mit.edu	37	X	79936987	79936987	+	Missense_Mutation	SNP	C	A	A			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:79936987C>A	uc004edt.2	-	c.4507G>T	c.(4507-4509)GCT>TCT	p.A1503S	BRWD3_uc010nmi.1_Non-coding_Transcript|BRWD3_uc004edo.2_Missense_Mutation_p.A1099S|BRWD3_uc004edp.2_Missense_Mutation_p.A1332S|BRWD3_uc004edq.2_Missense_Mutation_p.A1099S|BRWD3_uc010nmj.1_Missense_Mutation_p.A1099S|BRWD3_uc004edr.2_Missense_Mutation_p.A1173S|BRWD3_uc004eds.2_Missense_Mutation_p.A1099S|BRWD3_uc004edu.2_Missense_Mutation_p.A1173S|BRWD3_uc004edv.2_Missense_Mutation_p.A1099S|BRWD3_uc004edw.2_Missense_Mutation_p.A1099S|BRWD3_uc004edx.2_Missense_Mutation_p.A1099S|BRWD3_uc004edy.2_Missense_Mutation_p.A1099S|BRWD3_uc004edz.2_Missense_Mutation_p.A1173S|BRWD3_uc004eea.2_Missense_Mutation_p.A1173S|BRWD3_uc004eeb.2_Missense_Mutation_p.A1099S	NM_153252	NP_694984	Q6RI45	BRWD3_HUMAN	bromodomain and WD repeat domain containing 3	1503										ovary(4)	4														0.816327	136.427481	141.027276	40	9	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	79936987	79936987	1557	23	C	A	A	A	325	25	BRWD3	2	2
HDX	139324	broad.mit.edu	37	X	83591885	83591885	+	Missense_Mutation	SNP	T	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:83591885T>C	uc004eek.1	-	c.1664A>G	c.(1663-1665)GAG>GGG	p.E555G	HDX_uc011mqv.1_Missense_Mutation_p.E555G|HDX_uc004eel.1_Missense_Mutation_p.E497G	NM_144657	NP_653258	Q7Z353	HDX_HUMAN	highly divergent homeobox	555					regulation of transcription, DNA-dependent	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1						Pancreas(53;231 1169 36156 43751 51139)								0.941176	61.362879	63.779916	16	1	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	83591885	83591885	7309	23	T	C	C	C	702	54	HDX	4	4
CHM	1121	broad.mit.edu	37	X	85233835	85233835	+	Missense_Mutation	SNP	C	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:85233835C>G	uc004eet.2	-	c.250G>C	c.(250-252)GAA>CAA	p.E84Q	CHM_uc011mqz.1_Intron|CHM_uc004eeu.3_Non-coding_Transcript|CHM_uc004eev.3_Missense_Mutation_p.E84Q	NM_000390	NP_000381	P24386	RAE1_HUMAN	choroideremia isoform a	84					intracellular protein transport|protein geranylgeranylation|response to stimulus|visual perception	Rab-protein geranylgeranyltransferase complex	GTPase activator activity|Rab geranylgeranyltransferase activity			ovary(1)	1		all_lung(315;5.41e-06)												0.851064	136.306144	141.861712	40	7	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	85233835	85233835	3484	23	C	G	G	G	416	32	CHM	3	3
TGIF2LX	90316	broad.mit.edu	37	X	89177268	89177268	+	Missense_Mutation	SNP	G	T	T			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:89177268G>T	uc004efe.2	+	c.184G>T	c.(184-186)GTT>TTT	p.V62F		NM_138960	NP_620410	Q8IUE1	TF2LX_HUMAN	TGFB-induced factor homeobox 2-like, X-linked	62	Homeobox; TALE-type.				regulation of transcription, DNA-dependent	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1														0.956522	164.125804	167.612559	44	2	KEEP	---	---	---	---	capture		Missense_Mutation	SNP	89177268	89177268	16355	23	G	T	T	T	520	40	TGIF2LX	1	1
SFTPA2	729238	broad.mit.edu	37	10	81319205	81319205	+	Frame_Shift_Del	DEL	A	-	-	rs72659394		TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr10:81319205_81319205delA	uc001kal.3	-	c.35_35delT	c.(34-36)TTGfs	p.L12fs	SFTPA2_uc001kan.3_Frame_Shift_Del_p.L12fs|SFTPA2_uc001kam.2_Non-coding_Transcript	NM_006926	NP_008857	Q8IWL1	SFPA2_HUMAN	RecName: Full=Pulmonary surfactant-associated protein A2;          Short=SP-A2;          Short=SP-A;          Short=PSP-A;          Short=PSPA; AltName: Full=Alveolar proteinosis protein; AltName: Full=35 kDa pulmonary surfactant-associated protein; Flags: Precursor;	12			L -> W.		cell junction assembly|respiratory gaseous exchange	collagen|extracellular space	sugar binding				0	all_cancers(46;0.197)|Breast(12;0.000326)|Prostate(51;0.00985)|all_epithelial(25;0.0149)		Epithelial(14;0.00957)|all cancers(16;0.0179)|Colorectal(32;0.229)											0.31			16	35		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	81319205	81319205	14681	10	A	-	-	-	65	5	SFTPA2	5	5
BSX	390259	broad.mit.edu	37	11	122850161	122850161	+	Frame_Shift_Del	DEL	C	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr11:122850161_122850161delC	uc010rzs.1	-	c.267_267delG	c.(265-267)ATGfs	p.M89fs		NM_001098169	NP_001091639	Q3C1V8	BSH_HUMAN	brain specific homeobox	89							transcription regulator activity				0		Breast(109;0.00249)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0361)										0.67			36	18		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	122850161	122850161	1567	11	C	-	-	-	325	25	BSX	5	5
HOXC4	3221	broad.mit.edu	37	12	54448073	54448073	+	Frame_Shift_Del	DEL	G	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr12:54448073_54448073delG	uc001seu.2	+	c.367_367delG	c.(367-369)GACfs	p.D123fs	HOXC4_uc001sex.2_Frame_Shift_Del_p.D123fs	NM_014620	NP_055435	P09017	HXC4_HUMAN	homeobox C4	123					regulation of transcription, DNA-dependent	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulator activity			ovary(1)	1														0.81			13	3		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	54448073	54448073	7605	12	G	-	-	-	481	37	HOXC4	5	5
AKAP6	9472	broad.mit.edu	37	14	33015489	33015489	+	Frame_Shift_Del	DEL	C	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr14:33015489_33015489delC	uc001wrq.2	+	c.1630_1630delC	c.(1630-1632)CCAfs	p.P544fs	AKAP6_uc010aml.2_Frame_Shift_Del_p.P541fs	NM_004274	NP_004265	Q13023	AKAP6_HUMAN	A-kinase anchor protein 6	544					protein targeting	calcium channel complex|nuclear membrane|sarcoplasmic reticulum	protein kinase A binding|receptor binding			breast(6)|ovary(5)|large_intestine(2)|lung(2)|pancreas(1)	16	Breast(36;0.0388)|Prostate(35;0.15)		LUAD - Lung adenocarcinoma(48;0.00107)|Lung(238;0.00677)|STAD - Stomach adenocarcinoma(7;0.116)	GBM - Glioblastoma multiforme(265;0.019)		Melanoma(49;821 1200 7288 13647 42351)				483				0.85			87	15		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	33015489	33015489	458	14	C	-	-	-	338	26	AKAP6	5	5
ARRDC4	91947	broad.mit.edu	37	15	98509171	98509172	+	Frame_Shift_Del	DEL	TG	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr15:98509171_98509172delTG	uc010bom.2	+	c.421_422delTG	c.(421-423)TGTfs	p.C141fs	ARRDC4_uc002bui.3_Frame_Shift_Del_p.C54fs	NM_183376	NP_899232	Q8NCT1	ARRD4_HUMAN	arrestin domain containing 4	141					signal transduction						0	Melanoma(26;0.00539)|Lung NSC(78;0.0125)|all_lung(78;0.0222)		OV - Ovarian serous cystadenocarcinoma(32;0.0417)											0.30			25	58		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	98509171	98509172	1003	15	TG	-	-	-	715	55	ARRDC4	5	5
OTOA	146183	broad.mit.edu	37	16	21698946	21698947	+	Frame_Shift_Del	DEL	GC	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr16:21698946_21698947delGC	uc002djh.2	+	c.612_613delGC	c.(610-615)CTGCGCfs	p.L204fs	OTOA_uc010vbj.1_Frame_Shift_Del_p.L125fs	NM_144672	NP_653273	Q7RTW8	OTOAN_HUMAN	otoancorin isoform 1	204_205					sensory perception of sound	anchored to membrane|apical plasma membrane|proteinaceous extracellular matrix				ovary(1)	1				GBM - Glioblastoma multiforme(48;0.0414)										0.31			11	24		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	21698946	21698947	11714	16	GC	-	-	-	587	46	OTOA	5	5
GPR45	11250	broad.mit.edu	37	2	105858804	105858804	+	Frame_Shift_Del	DEL	G	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:105858804_105858804delG	uc002tco.1	+	c.489_489delG	c.(487-489)GCGfs	p.A163fs		NM_007227	NP_009158	Q9Y5Y3	GPR45_HUMAN	G protein-coupled receptor 45	163	Helical; Name=4; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity|protein binding			ovary(1)|breast(1)	2														0.66			21	11		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	105858804	105858804	6971	2	G	-	-	-	496	39	GPR45	5	5
AGAP1	116987	broad.mit.edu	37	2	236649676	236649677	+	Frame_Shift_Ins	INS	-	C	C			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:236649676_236649677insC	uc002vvs.2	+	c.380_381insC	c.(379-381)GGCfs	p.G127fs	AGAP1_uc002vvt.2_Frame_Shift_Ins_p.G127fs	NM_001037131	NP_001032208	Q9UPQ3	AGAP1_HUMAN	centaurin, gamma 2 isoform 1	127	Small GTPase-like.				protein transport|regulation of ARF GTPase activity|small GTPase mediated signal transduction	cytoplasm	ARF GTPase activator activity|GTP binding|zinc ion binding			ovary(2)	2														0.37			16	27		---	---	---	---	capture_indel		Frame_Shift_Ins	INS	236649676	236649677	368	2	-	C	C	C	546	42	AGAP1	5	5
GFPT1	2673	broad.mit.edu	37	2	69577211	69577211	+	Frame_Shift_Del	DEL	T	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr2:69577211_69577211delT	uc002sfh.2	-	c.790_790delA	c.(790-792)AGTfs	p.S264fs	GFPT1_uc002sfi.1_3'UTR	NM_002056	NP_002047	Q06210	GFPT1_HUMAN	glucosamine-fructose-6-phosphate	282	Glutamine amidotransferase type-2.				dolichol-linked oligosaccharide biosynthetic process|energy reserve metabolic process|fructose 6-phosphate metabolic process|glutamine metabolic process|post-translational protein modification|protein N-linked glycosylation via asparagine|UDP-N-acetylglucosamine biosynthetic process	cytosol	glutamine-fructose-6-phosphate transaminase (isomerizing) activity|sugar binding				0														0.55			11	9		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	69577211	69577211	6613	2	T	-	-	-	728	56	GFPT1	5	5
IGF2BP2	10644	broad.mit.edu	37	3	185390353	185390353	+	Frame_Shift_Del	DEL	G	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:185390353_185390353delG	uc003fpq.2	-	c.1191_1191delC	c.(1189-1191)CCCfs	p.P397fs	IGF2BP2_uc010hyi.2_Frame_Shift_Del_p.P335fs|IGF2BP2_uc010hyj.2_Frame_Shift_Del_p.P329fs|IGF2BP2_uc010hyk.2_Frame_Shift_Del_p.P256fs|IGF2BP2_uc010hyl.2_Intron|IGF2BP2_uc003fpo.2_Frame_Shift_Del_p.P392fs|IGF2BP2_uc003fpp.2_Intron	NM_006548	NP_006539	Q9Y6M1	IF2B2_HUMAN	insulin-like growth factor 2 mRNA binding	392					anatomical structure morphogenesis|negative regulation of translation|regulation of cytokine biosynthetic process	cytoskeletal part|cytosol|nucleus	mRNA 3'-UTR binding|mRNA 5'-UTR binding|nucleotide binding|protein binding|translation regulator activity				0	all_cancers(143;5.84e-11)|Ovarian(172;0.0386)		OV - Ovarian serous cystadenocarcinoma(80;7.41e-21)											0.38			5	8		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	185390353	185390353	7875	3	G	-	-	-	496	39	IGF2BP2	5	5
SCN5A	6331	broad.mit.edu	37	3	38592373	38592373	+	Frame_Shift_Del	DEL	G	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr3:38592373_38592373delG	uc003cio.2	-	c.5490_5490delC	c.(5488-5490)CCCfs	p.P1830fs	SCN5A_uc003cin.2_Frame_Shift_Del_p.P1829fs|SCN5A_uc003cil.3_Frame_Shift_Del_p.P1830fs|SCN5A_uc010hhi.2_Frame_Shift_Del_p.P1812fs|SCN5A_uc010hhk.2_Frame_Shift_Del_p.P1797fs|SCN5A_uc011ayr.1_Frame_Shift_Del_p.P1776fs	NM_198056	NP_932173	Q14524	SCN5A_HUMAN	voltage-gated sodium channel type V alpha	1830					blood circulation|muscle contraction|regulation of heart contraction	sarcolemma|voltage-gated sodium channel complex	protein binding|voltage-gated sodium channel activity			ovary(4)|pancreas(2)|central_nervous_system(1)	7	Medulloblastoma(35;0.163)			KIRC - Kidney renal clear cell carcinoma(284;0.0822)|Kidney(284;0.1)	Benzonatate(DB00868)|Bepridil(DB01244)|Carbamazepine(DB00564)|Cocaine(DB00907)|Dibucaine(DB00527)|Disopyramide(DB00280)|Encainide(DB01228)|Ethotoin(DB00754)|Flecainide(DB01195)|Fosphenytoin(DB01320)|Hexylcaine(DB00473)|Indecainide(DB00192)|Lamotrigine(DB00555)|Lidocaine(DB00281)|Mephenytoin(DB00532)|Mexiletine(DB00379)|Mibefradil(DB01388)|Moricizine(DB00680)|Oxcarbazepine(DB00776)|Phenytoin(DB00252)|Prilocaine(DB00750)|Procainamide(DB01035)|Propafenone(DB01182)|Quinidine(DB00908)|Riluzole(DB00740)|Tocainide(DB01056)|Verapamil(DB00661)									0.39			35	54		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	38592373	38592373	14404	3	G	-	-	-	600	47	SCN5A	5	5
ATXN1	6310	broad.mit.edu	37	6	16327903	16327904	+	In_Frame_Ins	INS	-	TGA	TGA	rs3817753		TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr6:16327903_16327904insTGA	uc003nbt.2	-	c.638_639insTCA	c.(637-639)CAG>CATCAG	p.212_213insH	ATXN1_uc010jpi.2_In_Frame_Ins_p.212_213insH|ATXN1_uc010jpj.1_Intron	NM_000332	NP_000323	P54253	ATX1_HUMAN	ataxin 1	212_213	Poly-Gln.				cell death|negative regulation of transcription, DNA-dependent|nuclear export|RNA processing	cytoplasm|nuclear inclusion body|nuclear matrix|nucleoplasm	identical protein binding|poly(G) RNA binding|poly(U) RNA binding|protein binding|protein C-terminus binding|protein self-association|transcription repressor activity			central_nervous_system(1)	1	Breast(50;0.063)|Ovarian(93;0.0733)	all_hematologic(90;0.000682)|Ovarian(999;0.00973)												0.38			5	8		---	---	---	---	capture_indel		In_Frame_Ins	INS	16327903	16327904	1228	6	-	TGA	TGA	TGA	363	28	ATXN1	5	5
CALD1	800	broad.mit.edu	37	7	134644834	134644834	+	Frame_Shift_Del	DEL	C	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr7:134644834_134644834delC	uc003vrz.2	+	c.2171_2171delC	c.(2170-2172)TCCfs	p.S724fs	CALD1_uc003vry.2_Frame_Shift_Del_p.S469fs|CALD1_uc003vsa.2_Frame_Shift_Del_p.S495fs|CALD1_uc003vsb.2_Frame_Shift_Del_p.S469fs|CALD1_uc010lmm.2_Frame_Shift_Del_p.S494fs|CALD1_uc011kpt.1_Frame_Shift_Del_p.S243fs|CALD1_uc003vsc.2_Frame_Shift_Del_p.S489fs|CALD1_uc003vsd.2_Frame_Shift_Del_p.S463fs|CALD1_uc011kpu.1_Frame_Shift_Del_p.S474fs|CALD1_uc011kpv.1_Frame_Shift_Del_p.S333fs|CALD1_uc003vse.2_Frame_Shift_Del_p.S587fs|CALD1_uc010lmn.2_Non-coding_Transcript	NM_033138	NP_149129	Q05682	CALD1_HUMAN	caldesmon 1 isoform 1	724					cellular component movement|muscle contraction	cytosol|focal adhesion|myofibril	actin binding|calmodulin binding|myosin binding|tropomyosin binding				0														0.56			40	32		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	134644834	134644834	2697	7	C	-	-	-	390	30	CALD1	5	5
ATAD2	29028	broad.mit.edu	37	8	124408447	124408447	+	Frame_Shift_Del	DEL	C	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:124408447_124408447delC	uc003yqh.3	-	c.151_151delG	c.(151-153)GCGfs	p.A51fs	ATAD2_uc011lii.1_5'UTR|ATAD2_uc003yqi.3_Intron|ATAD2_uc003yqj.2_Frame_Shift_Del_p.A51fs	NM_014109	NP_054828	Q6PL18	ATAD2_HUMAN	ATPase family, AAA domain containing 2	51					regulation of transcription, DNA-dependent|transcription, DNA-dependent	mitochondrion|nucleus	ATP binding|ATPase activity			ovary(2)	2	Lung NSC(37;1.25e-09)|Ovarian(258;0.00838)		STAD - Stomach adenocarcinoma(47;0.00288)											0.71			15	6		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	124408447	124408447	1090	8	C	-	-	-	338	26	ATAD2	5	5
NAT1	9	broad.mit.edu	37	8	18079724	18079725	+	Frame_Shift_Ins	INS	-	G	G			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr8:18079724_18079725insG	uc003wyt.2	+	c.354_355insG	c.(352-357)TTTGATfs	p.F118fs	NAT1_uc010ltd.2_Frame_Shift_Ins_p.F56fs|NAT1_uc003wyu.2_Frame_Shift_Ins_p.F56fs|NAT1_uc003wyv.2_Frame_Shift_Ins_p.F56fs|NAT1_uc010ltc.2_Frame_Shift_Ins_p.F56fs|NAT1_uc003wys.2_Frame_Shift_Ins_p.F118fs|NAT1_uc003wyr.2_Frame_Shift_Ins_p.F56fs|NAT1_uc003wyq.2_Frame_Shift_Ins_p.F56fs|NAT1_uc011kyl.1_Frame_Shift_Ins_p.F56fs	NM_001160175	NP_001153647	P18440	ARY1_HUMAN	N-acetyltransferase 1 isoform b	56_57					xenobiotic metabolic process	cytosol	arylamine N-acetyltransferase activity				0				Colorectal(111;0.0519)|COAD - Colon adenocarcinoma(73;0.208)										0.41			44	64		---	---	---	---	capture_indel		Frame_Shift_Ins	INS	18079724	18079725	10569	8	-	G	G	G	816	63	NAT1	5	5
CDC37L1	55664	broad.mit.edu	37	9	4706108	4706109	+	Frame_Shift_Del	DEL	TA	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chr9:4706108_4706109delTA	uc003zio.2	+	c.1010_1011delTA	c.(1009-1011)GTAfs	p.V337fs		NM_017913	NP_060383	Q7L3B6	CD37L_HUMAN	cell division cycle 37 homolog (S.	337	Required for interaction with STIP1.|Interaction with Hsp70.					cytoplasm					0	all_hematologic(13;0.137)	Breast(48;0.238)		GBM - Glioblastoma multiforme(50;0.0318)										0.80			67	17		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	4706108	4706109	3197	9	TA	-	-	-	741	57	CDC37L1	5	5
RBM10	8241	broad.mit.edu	37	X	47038768	47038768	+	Frame_Shift_Del	DEL	C	-	-			TCGA-64-5775-01	TCGA-64-5775-01										Phase_I	Unspecified				Illumina GAIIx	g.chrX:47038768_47038768delC	uc004dhi.2	+	c.970_970delC	c.(970-972)CCAfs	p.P324fs	RBM10_uc004dhf.2_Frame_Shift_Del_p.P259fs|RBM10_uc004dhg.2_Frame_Shift_Del_p.P182fs|RBM10_uc004dhh.2_Frame_Shift_Del_p.P259fs|RBM10_uc010nhq.2_Frame_Shift_Del_p.P182fs	NM_005676	NP_005667	P98175	RBM10_HUMAN	RNA binding motif protein 10 isoform 1	259					mRNA processing|RNA splicing	chromatin remodeling complex	nucleotide binding|RNA binding|zinc ion binding			large_intestine(1)|ovary(1)|pancreas(1)	3						Melanoma(171;120 2705 19495 39241)								0.70			7	3		---	---	---	---	capture_indel		Frame_Shift_Del	DEL	47038768	47038768	13572	23	C	-	-	-	338	26	RBM10	5	5
