Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	validation_status	validation_method	validation_tumor_sample	validation_alt_allele
NPHP4	261734	broad.mit.edu	37	1	5940091	5940092	+	Intron	INS	-	CA	CA	rs140612295	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:5940091_5940092insCA	uc001alq.1	-						NPHP4_uc001als.1_Intron|NPHP4_uc009vlt.1_Intron|NPHP4_uc001alt.1_Intron	NM_015102	NP_055917			nephroretinin						actin cytoskeleton organization|cell-cell adhesion|signal transduction|visual behavior	cell-cell junction|centrosome|cilium|microtubule basal body	protein binding|structural molecule activity			pancreas(1)	1	Ovarian(185;0.0634)	all_cancers(23;7.53e-41)|all_epithelial(116;3.96e-23)|all_lung(118;5.12e-09)|all_hematologic(16;5.45e-07)|Lung NSC(185;5.49e-07)|all_neural(13;3.21e-06)|Acute lymphoblastic leukemia(12;3.44e-05)|Breast(487;0.000601)|Renal(390;0.0007)|Colorectal(325;0.00113)|Hepatocellular(190;0.00213)|Glioma(11;0.00223)|Myeloproliferative disorder(586;0.0256)|Ovarian(437;0.04)|Lung SC(97;0.128)|Medulloblastoma(700;0.213)		Epithelial(90;1.69e-36)|GBM - Glioblastoma multiforme(13;5.07e-29)|OV - Ovarian serous cystadenocarcinoma(86;1.05e-19)|Colorectal(212;4.54e-07)|COAD - Colon adenocarcinoma(227;3.14e-05)|Kidney(185;0.00012)|BRCA - Breast invasive adenocarcinoma(365;0.00102)|KIRC - Kidney renal clear cell carcinoma(229;0.00179)|STAD - Stomach adenocarcinoma(132;0.00472)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
Unknown	0	broad.mit.edu	37	1	11691947	11691958	+	IGR	DEL	AAGGAAGGAAGA	-	-	rs149099969	by1000genomes;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:11691947_11691958delAAGGAAGGAAGA								PTCHD2 (94308 upstream) : FBXO2 (16492 downstream)																																			---	---	---	---
VPS13D	55187	broad.mit.edu	37	1	12330940	12330941	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12330940_12330941delTT	uc001atv.2	+						VPS13D_uc001atw.2_Intron	NM_015378	NP_056193			vacuolar protein sorting 13D isoform 1						protein localization					ovary(4)|pancreas(1)	5	Ovarian(185;0.249)	Lung NSC(185;4.08e-05)|all_lung(284;4.55e-05)|Renal(390;0.000147)|Colorectal(325;0.00058)|Breast(348;0.00093)|Ovarian(437;0.00965)|Hepatocellular(190;0.0202)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0327)|Colorectal(212;4.63e-06)|BRCA - Breast invasive adenocarcinoma(304;0.000289)|COAD - Colon adenocarcinoma(227;0.000801)|Kidney(185;0.00216)|KIRC - Kidney renal clear cell carcinoma(229;0.00544)|STAD - Stomach adenocarcinoma(313;0.012)|READ - Rectum adenocarcinoma(331;0.0476)|Lung(427;0.209)														---	---	---	---
PRAMEF11	440560	broad.mit.edu	37	1	12888267	12888268	+	Intron	INS	-	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12888267_12888268insG	uc001auk.2	-							NM_001146344	NP_001139816			PRAME family member 11												0																		---	---	---	---
Unknown	0	broad.mit.edu	37	1	13197573	13197573	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:13197573delT								LOC440563 (13606 upstream) : PRAMEF3 (131260 downstream)																																			---	---	---	---
CLCNKB	1188	broad.mit.edu	37	1	16372282	16372283	+	Intron	DEL	GT	-	-	rs57591489		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16372282_16372283delGT	uc001axw.3	+						FAM131C_uc010obz.1_Intron|CLCNKB_uc001axx.3_Intron	NM_000085	NP_000076			chloride channel Kb isoform 1						excretion	chloride channel complex|integral to plasma membrane	voltage-gated chloride channel activity			skin(1)	1		Colorectal(325;3.46e-05)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.000567)|Ovarian(437;0.0221)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|Colorectal(212;8.04e-08)|COAD - Colon adenocarcinoma(227;5.46e-06)|BRCA - Breast invasive adenocarcinoma(304;9.02e-05)|Kidney(64;0.00016)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(313;0.00655)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
CROCC	9696	broad.mit.edu	37	1	17278378	17278378	+	Intron	DEL	T	-	-	rs35956886		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17278378delT	uc001azt.2	+						CROCC_uc009voz.1_Intron|CROCC_uc001azu.2_Intron	NM_014675	NP_055490			ciliary rootlet coiled-coil						cell cycle|cell projection organization|centrosome organization|protein localization	actin cytoskeleton|centriole|ciliary rootlet|plasma membrane	kinesin binding|structural molecule activity			ovary(2)|breast(2)|central_nervous_system(1)	5		Colorectal(325;3.46e-05)|Breast(348;0.000162)|Lung NSC(340;0.000174)|all_lung(284;0.000234)|Renal(390;0.000518)|Ovarian(437;0.00669)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00459)|BRCA - Breast invasive adenocarcinoma(304;7.63e-06)|COAD - Colon adenocarcinoma(227;1.07e-05)|Kidney(64;0.000163)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.181)														---	---	---	---
UBR4	23352	broad.mit.edu	37	1	19439932	19439932	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:19439932delA	uc001bbi.2	-						UBR4_uc001bbj.1_3'UTR	NM_020765	NP_065816			retinoblastoma-associated factor 600						interspecies interaction between organisms	cytoplasm|cytoskeleton|integral to membrane|nucleus	calmodulin binding|ubiquitin-protein ligase activity|zinc ion binding			kidney(10)|ovary(7)|breast(4)|pancreas(2)|skin(2)	25		Colorectal(325;3.46e-05)|Renal(390;0.000147)|all_lung(284;0.000328)|Lung NSC(340;0.000406)|Breast(348;0.000814)|Ovarian(437;0.00774)|Myeloproliferative disorder(586;0.0256)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00674)|BRCA - Breast invasive adenocarcinoma(304;5.43e-05)|Kidney(64;0.000337)|KIRC - Kidney renal clear cell carcinoma(64;0.00426)|STAD - Stomach adenocarcinoma(196;0.00715)|READ - Rectum adenocarcinoma(331;0.0816)												OREG0013168	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
NBL1	4681	broad.mit.edu	37	1	19957089	19957090	+	Intron	DEL	CA	-	-	rs140589895		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:19957089_19957090delCA	uc009vpl.1	+							NM_005380	NP_005371			neuroblastoma, suppression of tumorigenicity 1 2							extracellular region				ovary(1)	1		Colorectal(325;3.46e-05)|Renal(390;0.000147)|all_lung(284;0.000321)|Lung NSC(340;0.000398)|Breast(348;0.00043)|Ovarian(437;0.00373)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00462)|BRCA - Breast invasive adenocarcinoma(304;5.9e-05)|Kidney(64;0.000173)|GBM - Glioblastoma multiforme(114;0.0012)|KIRC - Kidney renal clear cell carcinoma(64;0.0026)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
HSPG2	3339	broad.mit.edu	37	1	22235083	22235084	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:22235083_22235084delAA	uc001bfj.2	-						HSPG2_uc009vqd.2_Intron	NM_005529	NP_005520			heparan sulfate proteoglycan 2 precursor						angiogenesis|cell adhesion|lipid metabolic process|lipoprotein metabolic process	basement membrane|extracellular space|plasma membrane	protein C-terminus binding			ovary(5)|large_intestine(2)|central_nervous_system(1)|skin(1)	9		Colorectal(325;3.46e-05)|all_lung(284;7.93e-05)|Lung NSC(340;8.71e-05)|Renal(390;0.000219)|Breast(348;0.00222)|Ovarian(437;0.00308)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0498)|OV - Ovarian serous cystadenocarcinoma(117;1.14e-26)|Colorectal(126;4.18e-07)|COAD - Colon adenocarcinoma(152;1.82e-05)|GBM - Glioblastoma multiforme(114;3.13e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000756)|STAD - Stomach adenocarcinoma(196;0.00656)|KIRC - Kidney renal clear cell carcinoma(1967;0.00942)|READ - Rectum adenocarcinoma(331;0.0721)|Lung(427;0.223)	Becaplermin(DB00102)|Palifermin(DB00039)													---	---	---	---
Unknown	0	broad.mit.edu	37	1	26545075	26545075	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:26545075delT								CATSPER4 (16043 upstream) : CCDC21 (15618 downstream)																																			---	---	---	---
TAF12	6883	broad.mit.edu	37	1	28948279	28948279	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:28948279delA	uc001bqw.2	-						TAF12_uc001bqx.2_Intron|TAF12_uc001bqy.2_Intron|TAF12_uc009vti.2_Intron	NM_005644	NP_005635			TAF12 RNA polymerase II, TATA box binding						histone H3 acetylation|regulation of transcription, DNA-dependent|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|viral reproduction	PCAF complex|STAGA complex|transcription factor TFIID complex|transcription factor TFTC complex	DNA binding|protein binding|transcription coactivator activity			ovary(1)	1		Colorectal(325;3.46e-05)|Lung NSC(340;0.000451)|all_lung(284;0.00063)|Renal(390;0.00121)|Breast(348;0.00502)|all_neural(195;0.0227)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0308)|Medulloblastoma(700;0.123)		Colorectal(126;3.21e-08)|COAD - Colon adenocarcinoma(152;1.74e-06)|STAD - Stomach adenocarcinoma(196;0.00303)|KIRC - Kidney renal clear cell carcinoma(1967;0.0109)|BRCA - Breast invasive adenocarcinoma(304;0.0228)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
RBBP4	5928	broad.mit.edu	37	1	33133737	33133737	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:33133737delA	uc001bvr.2	+						RBBP4_uc001bvs.2_Intron|RBBP4_uc010ohj.1_Intron|RBBP4_uc010ohk.1_Intron	NM_005610	NP_005601			retinoblastoma binding protein 4 isoform a						cell cycle|CenH3-containing nucleosome assembly at centromere|DNA replication|negative regulation of cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	CAF-1 complex|ESC/E(Z) complex|NuRD complex|NURF complex|Sin3 complex	histone binding|histone deacetylase binding			ovary(1)	1		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0837)																---	---	---	---
ZMYM6	9204	broad.mit.edu	37	1	35480538	35480538	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35480538delA	uc001byh.2	-						ZMYM6_uc001byf.1_Intron|ZMYM6_uc010oht.1_Intron|ZMYM6_uc009vup.2_Intron|ZMYM6_uc009vuq.1_Intron|ZMYM6_uc009vur.1_Intron	NM_007167	NP_009098			zinc finger protein 258						multicellular organismal development	nucleus	DNA binding|zinc ion binding			ovary(3)	3		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.13)																---	---	---	---
ZMYM4	9202	broad.mit.edu	37	1	35826960	35826960	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35826960delT	uc001byt.2	+						ZMYM4_uc009vuu.2_Intron|ZMYM4_uc001byu.2_Intron|ZMYM4_uc009vuv.2_Intron	NM_005095	NP_005086			zinc finger protein 262						multicellular organismal development		DNA binding|zinc ion binding			large_intestine(2)|ovary(1)|kidney(1)|skin(1)	5		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---
COL8A2	1296	broad.mit.edu	37	1	36563081	36563081	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36563081delT	uc001bzv.1	-	2					COL8A2_uc001bzw.1_3'UTR	NM_005202	NP_005193			collagen, type VIII, alpha 2 precursor						angiogenesis|cell-cell adhesion|extracellular matrix organization	basement membrane|collagen	extracellular matrix structural constituent|protein binding, bridging			central_nervous_system(1)	1		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.164)																---	---	---	---
HPCAL4	51440	broad.mit.edu	37	1	40148562	40148562	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40148562delT	uc001cdr.2	-						HPCAL4_uc010oix.1_Intron	NM_016257	NP_057341			hippocalcin-like protein 4						central nervous system development	intracellular	calcium ion binding			central_nervous_system(1)	1	all_cancers(7;4.65e-13)|Lung NSC(20;2.88e-06)|Ovarian(52;0.00167)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;1.87e-18)|Epithelial(16;4.3e-17)|all cancers(16;8.48e-16)|LUSC - Lung squamous cell carcinoma(16;0.000261)|Lung(16;0.000457)															---	---	---	---
BMP8B	656	broad.mit.edu	37	1	40229212	40229212	+	Intron	DEL	A	-	-	rs113575841		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40229212delA	uc001cdz.1	-						PPIE_uc001cdv.2_Intron|PPIE_uc001cdw.2_Intron	NM_001720	NP_001711			bone morphogenetic protein 8B preproprotein						cartilage development|cell differentiation|growth|ossification	extracellular space	cytokine activity|growth factor activity				0	all_cancers(7;5.56e-14)|all_lung(5;3.88e-17)|all_epithelial(6;3.78e-16)|Lung NSC(20;7.03e-07)|Ovarian(52;0.00167)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;1.87e-18)|Epithelial(16;1.92e-17)|all cancers(16;4.03e-16)|LUSC - Lung squamous cell carcinoma(16;0.000261)|Lung(16;0.000457)															---	---	---	---
Unknown	0	broad.mit.edu	37	1	40277713	40277720	+	IGR	DEL	TTCTTTCT	-	-	rs76602115		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40277713_40277720delTTCTTTCT								BMP8B (23180 upstream) : TRIT1 (28988 downstream)																																			---	---	---	---
HIVEP3	59269	broad.mit.edu	37	1	41990611	41990611	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:41990611delA	uc001cgz.3	-						HIVEP3_uc001cha.3_Intron|HIVEP3_uc001cgy.2_Intron	NM_024503	NP_078779			human immunodeficiency virus type I enhancer						positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(4)|large_intestine(1)|central_nervous_system(1)	6	Ovarian(52;0.00769)|all_hematologic(146;0.109)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0367)																---	---	---	---
PLK3	1263	broad.mit.edu	37	1	45266473	45266473	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45266473delC	uc001cmn.2	+						PLK3_uc001cmo.2_5'Flank	NM_004073	NP_004064			polo-like kinase 3							membrane	ATP binding|protein binding|protein serine/threonine kinase activity				0	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---
ZCCHC11	23318	broad.mit.edu	37	1	52937901	52937902	+	Intron	DEL	AA	-	-	rs78098408		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52937901_52937902delAA	uc001ctx.2	-						ZCCHC11_uc001cty.2_Intron|ZCCHC11_uc001ctz.2_Intron|ZCCHC11_uc009vze.1_Intron|ZCCHC11_uc009vzf.1_Intron|ZCCHC11_uc001cub.2_Intron	NM_015269	NP_056084			zinc finger, CCHC domain containing 11 isoform						miRNA catabolic process|pre-miRNA processing|RNA 3'-end processing|stem cell maintenance	cytoplasm|nucleolus	nucleic acid binding|protein binding|protein binding|RNA uridylyltransferase activity|zinc ion binding			ovary(2)|skin(1)	3																		---	---	---	---
ZCCHC11	23318	broad.mit.edu	37	1	52959246	52959246	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52959246delA	uc001ctx.2	-						ZCCHC11_uc001cty.2_Intron|ZCCHC11_uc001ctz.2_Intron|ZCCHC11_uc009vze.1_Intron|ZCCHC11_uc009vzf.1_Intron|ZCCHC11_uc001cub.2_Intron|ZCCHC11_uc001cuc.2_Intron	NM_015269	NP_056084			zinc finger, CCHC domain containing 11 isoform						miRNA catabolic process|pre-miRNA processing|RNA 3'-end processing|stem cell maintenance	cytoplasm|nucleolus	nucleic acid binding|protein binding|protein binding|RNA uridylyltransferase activity|zinc ion binding			ovary(2)|skin(1)	3																		---	---	---	---
C1orf83	127428	broad.mit.edu	37	1	54519996	54519996	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:54519996delA	uc001cwt.1	+						C1orf83_uc001cwu.1_Intron|TMEM59_uc001cwp.2_5'Flank|TMEM59_uc001cwq.2_5'Flank|TMEM59_uc001cwr.2_5'Flank|TMEM59_uc001cws.1_5'Flank	NM_153035	NP_694580			hypothetical protein LOC127428						transcription, DNA-dependent	nucleus	DNA binding				0																		---	---	---	---
USP24	23358	broad.mit.edu	37	1	55563397	55563397	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55563397delA	uc001cyg.3	-							NM_015306	NP_056121			ubiquitin specific protease 24						ubiquitin-dependent protein catabolic process		binding|cysteine-type peptidase activity|ubiquitin thiolesterase activity			ovary(6)|kidney(6)|breast(1)	13																		---	---	---	---
USP24	23358	broad.mit.edu	37	1	55609729	55609730	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55609729_55609730delTT	uc001cyg.3	-							NM_015306	NP_056121			ubiquitin specific protease 24						ubiquitin-dependent protein catabolic process		binding|cysteine-type peptidase activity|ubiquitin thiolesterase activity			ovary(6)|kidney(6)|breast(1)	13																		---	---	---	---
DAB1	1600	broad.mit.edu	37	1	57476486	57476486	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57476486delT	uc001cys.1	-						DAB1_uc001cyt.1_Intron|DAB1_uc001cyq.1_Intron|DAB1_uc001cyr.1_Intron|DAB1_uc009vzw.1_Intron|DAB1_uc009vzx.1_Intron	NM_021080	NP_066566			disabled homolog 1						cell differentiation|nervous system development					skin(2)|ovary(1)	3																		---	---	---	---
USP1	7398	broad.mit.edu	37	1	62914561	62914561	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:62914561delT	uc001daj.1	+						USP1_uc001dak.1_Intron|USP1_uc001dal.1_Intron	NM_001017415	NP_001017415			ubiquitin specific protease 1						DNA repair|monoubiquitinated protein deubiquitination|regulation of DNA repair|response to UV|ubiquitin-dependent protein catabolic process	nucleoplasm	cysteine-type endopeptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(1)	1		all_neural(321;0.0281)		BRCA - Breast invasive adenocarcinoma(111;8.01e-05)|KIRC - Kidney renal clear cell carcinoma(1967;0.00245)|OV - Ovarian serous cystadenocarcinoma(397;0.0535)														---	---	---	---
RAVER2	55225	broad.mit.edu	37	1	65234509	65234509	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:65234509delT	uc001dbs.1	+							NM_018211	NP_060681			ribonucleoprotein, PTB-binding 2							cytoplasm|nucleus	nucleotide binding|RNA binding			large_intestine(1)	1																		---	---	---	---
SERBP1	26135	broad.mit.edu	37	1	67878790	67878790	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67878790delT	uc001ddv.2	-	8					SERBP1_uc001ddx.2_3'UTR|SERBP1_uc001ddy.2_3'UTR|SERBP1_uc001ddw.2_3'UTR	NM_001018067	NP_001018077			SERPINE1 mRNA binding protein 1 isoform 1						regulation of mRNA stability	nucleus|perinuclear region of cytoplasm	mRNA 3'-UTR binding|protein binding			skin(1)	1																		---	---	---	---
ZZZ3	26009	broad.mit.edu	37	1	78046892	78046893	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:78046892_78046893delTT	uc001dhq.2	-						ZZZ3_uc001dhr.2_Intron|ZZZ3_uc001dhp.2_Intron	NM_015534	NP_056349			zinc finger, ZZ-type containing 3						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(4)|large_intestine(1)	5																		---	---	---	---
Unknown	0	broad.mit.edu	37	1	79132403	79132403	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:79132403delA								IFI44 (2642 upstream) : ELTD1 (223048 downstream)																																			---	---	---	---
LPHN2	23266	broad.mit.edu	37	1	82416923	82416923	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:82416923delA	uc001dit.3	+						LPHN2_uc001dis.2_Intron|LPHN2_uc001diu.2_Intron|LPHN2_uc001div.2_Intron|LPHN2_uc009wcd.2_Intron|LPHN2_uc001diw.2_Intron	NM_012302	NP_036434			latrophilin 2 precursor						neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity|latrotoxin receptor activity|sugar binding			ovary(3)|lung(3)|breast(2)|central_nervous_system(1)	9				all cancers(265;0.00142)|Epithelial(280;0.00829)|OV - Ovarian serous cystadenocarcinoma(397;0.077)|STAD - Stomach adenocarcinoma(256;0.248)														---	---	---	---
SPATA1	64173	broad.mit.edu	37	1	85014434	85014452	+	Intron	DEL	TTTTTTTTTTTTTTTTTTT	-	-	rs6143309		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85014434_85014452delTTTTTTTTTTTTTTTTTTT	uc001djz.1	+						SPATA1_uc001djy.1_Intron	NM_001081472	NP_001074941			spermatogenesis associated 1											central_nervous_system(1)	1				Epithelial(280;4.36e-10)|all cancers(265;7.1e-09)|BRCA - Breast invasive adenocarcinoma(282;8.45e-09)|OV - Ovarian serous cystadenocarcinoma(397;0.00286)|KIRC - Kidney renal clear cell carcinoma(1967;0.0111)														---	---	---	---
CTBS	1486	broad.mit.edu	37	1	85020568	85020568	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85020568delT	uc001dka.2	-	7					SPATA1_uc001djz.1_Intron|CTBS_uc001dkc.2_3'UTR|CTBS_uc001dkd.2_3'UTR|CTBS_uc001dkb.2_3'UTR	NM_004388	NP_004379			chitobiase, di-N-acetyl- precursor							lysosome	cation binding				0				all cancers(265;0.00727)|Epithelial(280;0.0192)|OV - Ovarian serous cystadenocarcinoma(397;0.166)														---	---	---	---
RPL5	6125	broad.mit.edu	37	1	93301569	93301569	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:93301569delT	uc001doz.2	+						FAM69A_uc001dpc.2_Intron|RPL5_uc001dpa.2_Intron|RPL5_uc001dpb.2_Intron|RPL5_uc001dpd.2_5'Flank|SNORD21_uc001dpe.2_5'Flank	NM_000969	NP_000960			ribosomal protein L5						endocrine pancreas development|ribosomal large subunit biogenesis|rRNA processing|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit|nucleolus	5S rRNA binding|protein binding|structural constituent of ribosome				0		all_lung(203;0.00265)|Lung NSC(277;0.0056)|all_neural(321;0.185)|Melanoma(281;0.192)|Glioma(108;0.203)		GBM - Glioblastoma multiforme(16;0.000305)|all cancers(265;0.000343)|Epithelial(280;0.0927)														---	---	---	---
SASS6	163786	broad.mit.edu	37	1	100572825	100572825	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:100572825delA	uc001dsu.2	-						SASS6_uc009wdz.2_Intron	NM_194292	NP_919268			spindle assembly abnormal protein 6						centriole replication	centriole				upper_aerodigestive_tract(1)|ovary(1)	2		all_epithelial(167;4.58e-06)|all_lung(203;0.00125)|Lung NSC(277;0.00131)		Epithelial(280;0.085)|all cancers(265;0.139)|COAD - Colon adenocarcinoma(174;0.15)|Lung(183;0.197)														---	---	---	---
STXBP3	6814	broad.mit.edu	37	1	109315233	109315233	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109315233delT	uc001dvy.2	+						STXBP3_uc001dvz.2_Intron	NM_007269	NP_009200			syntaxin binding protein 3						negative regulation of calcium ion-dependent exocytosis|neutrophil degranulation|platelet aggregation|protein transport|vesicle docking involved in exocytosis	cytosol|nucleus|platelet alpha granule|specific granule|tertiary granule	syntaxin-2 binding			ovary(3)|central_nervous_system(1)	4		all_epithelial(167;0.000154)|all_lung(203;0.00026)|Lung NSC(277;0.000508)		Colorectal(144;0.0386)|Lung(183;0.104)|COAD - Colon adenocarcinoma(174;0.137)|Epithelial(280;0.231)														---	---	---	---
LRIG2	9860	broad.mit.edu	37	1	113635953	113635953	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:113635953delT	uc001edf.1	+						LRIG2_uc009wgn.1_Intron	NM_014813	NP_055628			leucine-rich repeats and immunoglobulin-like							cytoplasm|integral to membrane|plasma membrane				ovary(3)	3	Lung SC(450;0.246)	all_cancers(81;1.56e-05)|all_epithelial(167;2.62e-05)|all_lung(203;0.000665)|Lung NSC(69;0.000986)		Lung(183;0.0279)|Colorectal(144;0.0885)|COAD - Colon adenocarcinoma(174;0.134)|all cancers(265;0.139)|Epithelial(280;0.143)|LUSC - Lung squamous cell carcinoma(189;0.15)														---	---	---	---
MAGI3	260425	broad.mit.edu	37	1	113992210	113992210	+	Intron	DEL	T	-	-	rs34091729		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:113992210delT	uc001edk.2	+						MAGI3_uc001edh.3_Intron|MAGI3_uc001edi.3_Intron|MAGI3_uc010owm.1_Intron	NM_001142782	NP_001136254			membrane-associated guanylate kinase-related  3						apoptosis|interspecies interaction between organisms|intracellular signal transduction	nucleus|tight junction	ATP binding|guanylate kinase activity|protein binding			lung(3)|ovary(2)|central_nervous_system(1)	6	Lung SC(450;0.184)	all_cancers(81;2.34e-09)|all_epithelial(167;7.41e-09)|all_lung(203;7.13e-06)|Lung NSC(69;1.2e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
PTPN22	26191	broad.mit.edu	37	1	114377352	114377352	+	Intron	DEL	A	-	-	rs79608028		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:114377352delA	uc001eds.2	-						PTPN22_uc009wgq.2_Intron|PTPN22_uc010owo.1_Intron|PTPN22_uc001edt.2_Intron|PTPN22_uc009wgr.2_Intron|PTPN22_uc009wgs.2_Intron|PTPN22_uc001edu.2_Intron	NM_015967	NP_057051			protein tyrosine phosphatase, non-receptor type						negative regulation of T cell activation|negative regulation of T cell receptor signaling pathway|phosphoanandamide dephosphorylation|regulation of B cell receptor signaling pathway|regulation of natural killer cell proliferation|T cell differentiation	internal side of plasma membrane|nucleus|perinuclear region of cytoplasm	kinase binding|protein tyrosine phosphatase activity|SH3 domain binding			kidney(2)|lung(1)|skin(1)	4	Lung SC(450;0.184)	all_cancers(81;1.93e-08)|all_epithelial(167;4.37e-08)|all_lung(203;5.22e-06)|Lung NSC(69;8.94e-06)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
ATP1A1	476	broad.mit.edu	37	1	116935973	116935975	+	Intron	DEL	TTT	-	-	rs111432694		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:116935973_116935975delTTT	uc001ege.2	+						ATP1A1_uc010owv.1_Intron|ATP1A1_uc010oww.1_Intron|ATP1A1_uc010owx.1_Intron|C1orf203_uc009whb.2_Intron	NM_000701	NP_000692			Na+/K+ -ATPase alpha 1 subunit isoform a						ATP biosynthetic process	melanosome|sodium:potassium-exchanging ATPase complex	ATP binding|metal ion binding|protein binding|sodium:potassium-exchanging ATPase activity			ovary(1)	1	Lung SC(450;0.225)	all_cancers(81;1.28e-06)|all_epithelial(167;3.48e-07)|all_lung(203;2.64e-06)|Lung NSC(69;1.98e-05)		Lung(183;0.0164)|LUSC - Lung squamous cell carcinoma(189;0.0548)|Colorectal(144;0.0825)|COAD - Colon adenocarcinoma(174;0.127)|all cancers(265;0.24)	Acetyldigitoxin(DB00511)|Almitrine(DB01430)|Aluminium(DB01370)|Bepridil(DB01244)|Bretylium(DB01158)|Captopril(DB01197)|Deslanoside(DB01078)|Diazoxide(DB01119)|Digitoxin(DB01396)|Digoxin(DB00390)|Esomeprazole(DB00736)|Ethacrynic acid(DB00903)|Furosemide(DB00695)|Hydroflumethiazide(DB00774)|Methyclothiazide(DB00232)|Ouabain(DB01092)|Pantoprazole(DB00213)|Trichlormethiazide(DB01021)													---	---	---	---
NOTCH2	4853	broad.mit.edu	37	1	120495937	120495937	+	Intron	DEL	A	-	-	rs72047996		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:120495937delA	uc001eik.2	-						NOTCH2_uc001eil.2_Intron|NOTCH2_uc001eim.3_Intron	NM_024408	NP_077719			notch 2 preproprotein						anti-apoptosis|bone remodeling|cell cycle arrest|cell fate determination|cell growth|hemopoiesis|induction of apoptosis|negative regulation of cell proliferation|nervous system development|Notch receptor processing|Notch signaling pathway|organ morphogenesis|positive regulation of Ras protein signal transduction|regulation of transcription, DNA-dependent|stem cell maintenance|transcription, DNA-dependent	cell surface|cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to plasma membrane|nucleoplasm	calcium ion binding|ligand-regulated transcription factor activity|protein binding|receptor activity			lung(8)|haematopoietic_and_lymphoid_tissue(7)|ovary(4)|central_nervous_system(2)|skin(2)|kidney(2)|breast(1)|prostate(1)	27	all_neural(166;0.153)	all_lung(203;1.96e-06)|Lung NSC(69;1.47e-05)|all_epithelial(167;0.000809)		Lung(183;0.0242)|LUSC - Lung squamous cell carcinoma(189;0.133)				N|F|Mis		marginal zone lymphoma|DLBCL				Alagille_Syndrome				---	---	---	---
NBPF9	400818	broad.mit.edu	37	1	145109313	145109313	+	Intron	DEL	A	-	-	rs71648352		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145109313delA	uc010oye.1	+						NBPF10_uc009wir.2_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|SEC22B_uc001eml.1_Intron					RecName: Full=Neuroblastoma breakpoint family member 8;							cytoplasm					0																		---	---	---	---
MTMR11	10903	broad.mit.edu	37	1	149902648	149902648	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:149902648delA	uc001etl.3	-						SF3B4_uc001etj.1_5'Flank|SF3B4_uc001etk.1_5'Flank|SF3B4_uc009wll.1_5'Flank|MTMR11_uc001etm.1_Intron|MTMR11_uc010pbm.1_3'UTR	NM_001145862	NP_001139334			myotubularin related protein 11 isoform a								phosphatase activity			central_nervous_system(1)	1	Breast(34;0.0009)|Ovarian(49;0.0377)|all_hematologic(923;0.0597)|Hepatocellular(266;0.161)|Colorectal(459;0.171)		LUSC - Lung squamous cell carcinoma(543;0.221)|STAD - Stomach adenocarcinoma(528;0.247)															---	---	---	---
ANP32E	81611	broad.mit.edu	37	1	150198745	150198746	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150198745_150198746insA	uc001etw.2	-						ANP32E_uc010pbt.1_Intron|ANP32E_uc010pbu.1_Intron|ANP32E_uc010pbv.1_Intron|ANP32E_uc001etv.3_Intron	NM_030920	NP_112182			acidic (leucine-rich) nuclear phosphoprotein 32							cytoplasmic membrane-bounded vesicle|nucleus	phosphatase inhibitor activity				0	Lung NSC(24;7.29e-29)|Breast(34;0.00211)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.161)|Colorectal(459;0.171)		LUSC - Lung squamous cell carcinoma(543;0.171)															---	---	---	---
FAM63A	55793	broad.mit.edu	37	1	150974465	150974467	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150974465_150974467delTTT	uc001ewf.2	-						FAM63A_uc001ewc.2_Intron|FAM63A_uc010pcm.1_Intron|FAM63A_uc001ewd.2_Intron|FAM63A_uc001ewe.2_Intron|FAM63A_uc010pcn.1_Intron|FAM63A_uc001ewg.2_Intron	NM_018379	NP_001156731			hypothetical protein LOC55793 isoform 1								protein binding			ovary(1)	1	all_lung(15;1.09e-34)|Lung NSC(24;1.1e-30)|Lung SC(34;0.00202)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.0997)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0486)|LUSC - Lung squamous cell carcinoma(543;0.211)															---	---	---	---
VPS72	6944	broad.mit.edu	37	1	151157067	151157068	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151157067_151157068delTT	uc001exe.1	-						VPS72_uc001exf.1_Intron	NM_005997	NP_005988			transcription factor-like 1						chromatin modification|negative regulation of transcription from RNA polymerase II promoter	nucleus|protein complex	DNA binding|sequence-specific DNA binding transcription factor activity			breast(1)|pancreas(1)	2	Lung SC(34;0.00471)|Ovarian(49;0.0147)|all_hematologic(923;0.0597)|Hepatocellular(266;0.0997)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0486)|LUSC - Lung squamous cell carcinoma(543;0.211)															---	---	---	---
POGZ	23126	broad.mit.edu	37	1	151384339	151384339	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151384339delA	uc001eyd.1	-						POGZ_uc001eye.1_Intron|POGZ_uc010pdb.1_Intron|POGZ_uc001eyf.1_Intron|POGZ_uc010pdc.1_Intron|POGZ_uc009wmv.1_Intron|POGZ_uc010pdd.1_Intron	NM_015100	NP_055915			pogo transposable element with ZNF domain						cell division|kinetochore assembly|mitotic sister chromatid cohesion|regulation of transcription, DNA-dependent	cytoplasm|nuclear chromatin	DNA binding|protein binding|zinc ion binding			ovary(3)	3	Lung SC(34;0.00471)|Ovarian(49;0.00672)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.112)|LUSC - Lung squamous cell carcinoma(543;0.181)															---	---	---	---
NUP210L	91181	broad.mit.edu	37	1	153995962	153995962	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153995962delT	uc001fdw.2	-						NUP210L_uc009woq.2_Intron|NUP210L_uc010peh.1_Intron	NM_207308	NP_997191			nucleoporin 210kDa-like isoform 1							integral to membrane				skin(5)|ovary(4)|large_intestine(1)|central_nervous_system(1)	11	all_lung(78;9.35e-31)|Lung NSC(65;1.33e-28)|Hepatocellular(266;0.0877)|Melanoma(130;0.128)		LUSC - Lung squamous cell carcinoma(543;0.151)|Colorectal(543;0.198)															---	---	---	---
Unknown	0	broad.mit.edu	37	1	154350594	154350594	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154350594delT								ATP8B2 (26815 upstream) : IL6R (27075 downstream)																																			---	---	---	---
RAG1AP1	55974	broad.mit.edu	37	1	155202458	155202458	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155202458delG	uc010pey.1	+						uc001fjg.2_5'Flank	NM_018845				recombination activating gene 1 activating						positive regulation of gene expression, epigenetic	Golgi membrane|integral to membrane|plasma membrane	glucoside transmembrane transporter activity				0	all_epithelial(22;4.71e-30)|all_lung(78;3.15e-27)|all_hematologic(923;0.0359)|Hepatocellular(266;0.0877)		Epithelial(20;2.28e-10)|all cancers(21;6.16e-10)|BRCA - Breast invasive adenocarcinoma(34;0.000395)|LUSC - Lung squamous cell carcinoma(543;0.193)															---	---	---	---
DEDD	9191	broad.mit.edu	37	1	161093498	161093498	+	Intron	DEL	T	-	-	rs112931699		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161093498delT	uc001fxz.2	-						NIT1_uc001fxw.2_Intron|DEDD_uc009wty.2_Intron|DEDD_uc001fya.2_Intron|DEDD_uc001fyb.2_Intron|DEDD_uc010pkb.1_Intron|DEDD_uc001fyc.2_Intron	NM_001039712	NP_001034801			death effector domain-containing protein						apoptosis|induction of apoptosis via death domain receptors|negative regulation of transcription, DNA-dependent|spermatogenesis|transcription, DNA-dependent	cytoplasm|nucleolus	DNA binding|protein binding				0	all_cancers(52;3.39e-19)|Breast(13;0.000577)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00165)															---	---	---	---
UFC1	51506	broad.mit.edu	37	1	161127696	161127696	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161127696delA	uc001fyd.3	+						USP21_uc010pkc.1_5'Flank|USP21_uc010pkd.1_5'Flank|USP21_uc010pke.1_5'Flank|USP21_uc010pkf.1_5'Flank	NM_016406	NP_057490			ubiquitin-fold modifier conjugating enzyme 1						protein ufmylation		protein binding|UFM1 conjugating enzyme activity				0	all_cancers(52;3.73e-19)|Breast(13;0.000577)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00275)															---	---	---	---
RGS4	5999	broad.mit.edu	37	1	163038839	163038839	+	5'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:163038839delT	uc009wuy.2	+	1					RGS4_uc001gcl.3_Intron|RGS4_uc009wuz.2_5'Flank|RGS4_uc009wva.2_5'Flank	NM_005613	NP_005604			regulator of G-protein signaling 4 isoform 2						inactivation of MAPK activity|regulation of G-protein coupled receptor protein signaling pathway	plasma membrane	calmodulin binding|GTPase activator activity|signal transducer activity			ovary(2)|central_nervous_system(1)	3																OREG0013952	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
MGST3	4259	broad.mit.edu	37	1	165618961	165618961	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:165618961delT	uc001gdf.2	+						MGST3_uc001gdg.2_Intron	NM_004528	NP_004519			microsomal glutathione S-transferase 3						leukotriene biosynthetic process|leukotriene production involved in inflammatory response|signal transduction|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glutathione peroxidase activity|glutathione transferase activity				0	all_hematologic(923;0.0773)|Acute lymphoblastic leukemia(8;0.155)				Glutathione(DB00143)													---	---	---	---
DPT	1805	broad.mit.edu	37	1	168694454	168694458	+	Intron	DEL	TTCCT	-	-	rs72221109		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:168694454_168694458delTTCCT	uc001gfp.2	-							NM_001937	NP_001928			dermatopontin precursor						cell adhesion	extracellular space|proteinaceous extracellular matrix				ovary(1)	1	all_hematologic(923;0.208)																	---	---	---	---
C1orf114	57821	broad.mit.edu	37	1	169366387	169366387	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169366387delT	uc001gga.1	-						C1orf114_uc001gfz.1_Intron|C1orf114_uc009wvq.1_Intron	NM_021179	NP_067002			hypothetical protein LOC57821												0	all_hematologic(923;0.208)																	---	---	---	---
BAT2L2	23215	broad.mit.edu	37	1	171452363	171452363	+	5'Flank	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:171452363delA	uc010pmg.1	+						BAT2L2_uc001ghq.1_5'Flank|BAT2L2_uc001ghr.1_5'Flank	NM_015172	NP_055987			HBxAg transactivated protein 2								protein C-terminus binding				0																		---	---	---	---
TNFSF18	8995	broad.mit.edu	37	1	173013161	173013161	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173013161delT	uc001giu.2	-							NM_005092	NP_005083			tumor necrosis factor (ligand) superfamily,						anti-apoptosis|cell-cell signaling|immune response|signal transduction	extracellular space|integral to membrane	cytokine activity|tumor necrosis factor receptor binding			central_nervous_system(1)	1																		---	---	---	---
CEP350	9857	broad.mit.edu	37	1	180049940	180049954	+	Intron	DEL	CCATATTGAATATTG	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:180049940_180049954delCCATATTGAATATTG	uc001gnt.2	+						CEP350_uc009wxl.2_Intron|CEP350_uc001gnv.2_Intron	NM_014810	NP_055625			centrosome-associated protein 350							centrosome|nucleus|spindle				ovary(4)	4																		---	---	---	---
SMG7	9887	broad.mit.edu	37	1	183513992	183513992	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183513992delA	uc001gqg.2	+						SMG7_uc010pob.1_Intron|SMG7_uc001gqf.2_Intron|SMG7_uc001gqh.2_Intron|SMG7_uc001gqi.2_Intron|SMG7_uc010poc.1_Intron	NM_173156	NP_775179			SMG-7 homolog isoform 1						mRNA export from nucleus|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|regulation of dephosphorylation	cytoplasm|intermediate filament cytoskeleton|nucleus	protein phosphatase 2A binding			upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
HMCN1	83872	broad.mit.edu	37	1	185939797	185939797	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:185939797delT	uc001grq.1	+						HMCN1_uc001grr.1_Intron	NM_031935	NP_114141			hemicentin 1 precursor						response to stimulus|visual perception	basement membrane	calcium ion binding			ovary(22)|skin(1)	23																		---	---	---	---
PDC	5132	broad.mit.edu	37	1	186415429	186415429	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186415429delT	uc001gsa.2	-						PDC_uc001grz.2_Intron	NM_002597	NP_002588			phosducin isoform a						G-protein coupled receptor protein signaling pathway|phototransduction|visual perception	actin cytoskeleton|cytosol|nucleus|photoreceptor inner segment|photoreceptor outer segment	phospholipase inhibitor activity			skin(1)	1		Breast(1374;1.53e-05)		KIRC - Kidney renal clear cell carcinoma(1967;3.23e-08)|Colorectal(1306;0.0129)														---	---	---	---
PTGS2	5743	broad.mit.edu	37	1	186646667	186646667	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186646667delA	uc001gsb.2	-						PTGS2_uc009wyo.2_Intron	NM_000963	NP_000954			prostaglandin-endoperoxide synthase 2 precursor						cellular component movement|cyclooxygenase pathway|hormone biosynthetic process|positive regulation of brown fat cell differentiation|positive regulation of cell migration involved in sprouting angiogenesis|positive regulation of fever generation|positive regulation of fibroblast growth factor production|positive regulation of nitric oxide biosynthetic process|positive regulation of platelet-derived growth factor production|positive regulation of prostaglandin biosynthetic process|positive regulation of transforming growth factor-beta production|positive regulation vascular endothelial growth factor production|regulation of blood pressure|response to oxidative stress|xenobiotic metabolic process	endoplasmic reticulum lumen|endoplasmic reticulum membrane|microsome|neuron projection|nucleus	enzyme binding|heme binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|peroxidase activity|prostaglandin-endoperoxide synthase activity			ovary(1)|central_nervous_system(1)	2					Acetaminophen(DB00316)|Aspirin(DB00945)|Balsalazide(DB01014)|Bromfenac(DB00963)|Carprofen(DB00821)|Celecoxib(DB00482)|Ciclopirox(DB01188)|Diclofenac(DB00586)|Diflunisal(DB00861)|Epoprostenol(DB01240)|Etodolac(DB00749)|Etoricoxib(DB01628)|Fenoprofen(DB00573)|Flurbiprofen(DB00712)|gamma-Homolinolenic acid(DB00154)|Ginseng(DB01404)|Ibuprofen(DB01050)|Icosapent(DB00159)|Indomethacin(DB00328)|Ketoprofen(DB01009)|Ketorolac(DB00465)|Lenalidomide(DB00480)|Lumiracoxib(DB01283)|Meclofenamic acid(DB00939)|Mefenamic acid(DB00784)|Meloxicam(DB00814)|Mesalazine(DB00244)|Nabumetone(DB00461)|Naproxen(DB00788)|Oxaprozin(DB00991)|Phenylbutazone(DB00812)|Rofecoxib(DB00533)|Salicyclic acid(DB00936)|Salsalate(DB01399)|Sulindac(DB00605)|Suprofen(DB00870)|Tenoxicam(DB00469)|Thalidomide(DB01041)|Tiaprofenic acid(DB01600)|Tolmetin(DB00500)|Valdecoxib(DB00580)													---	---	---	---
Unknown	0	broad.mit.edu	37	1	198918980	198918980	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:198918980delA								MIR181A1 (90698 upstream) : None (None downstream)																																			---	---	---	---
CACNA1S	779	broad.mit.edu	37	1	201019881	201019881	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201019881delA	uc001gvv.2	-							NM_000069	NP_000060			calcium channel, voltage-dependent, L type,						axon guidance	I band|T-tubule|voltage-gated calcium channel complex	high voltage-gated calcium channel activity			ovary(3)|central_nervous_system(1)|skin(1)	5					Magnesium Sulfate(DB00653)|Verapamil(DB00661)													---	---	---	---
CACNA1S	779	broad.mit.edu	37	1	201063292	201063292	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201063292delC	uc001gvv.2	-							NM_000069	NP_000060			calcium channel, voltage-dependent, L type,						axon guidance	I band|T-tubule|voltage-gated calcium channel complex	high voltage-gated calcium channel activity			ovary(3)|central_nervous_system(1)|skin(1)	5					Magnesium Sulfate(DB00653)|Verapamil(DB00661)													---	---	---	---
CR1	1378	broad.mit.edu	37	1	207679188	207679188	+	Intron	DEL	A	-	-	rs56283462		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207679188delA	uc001hfy.2	+						CR1_uc009xcl.1_Intron|CR1_uc001hfx.2_Intron|CR1_uc010psg.1_Intron|CR1_uc009xcj.1_Intron|CR1_uc009xck.1_Intron	NM_000573	NP_000564			complement receptor 1 isoform F precursor						complement activation, classical pathway|innate immune response	integral to plasma membrane	complement receptor activity			ovary(3)	3																		---	---	---	---
RPS6KC1	26750	broad.mit.edu	37	1	213434712	213434712	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:213434712delA	uc010ptr.1	+						RPS6KC1_uc001hkd.2_Intron|RPS6KC1_uc010pts.1_Intron|RPS6KC1_uc010ptt.1_Intron|RPS6KC1_uc010ptu.1_Intron|RPS6KC1_uc010ptv.1_Intron|RPS6KC1_uc001hke.2_Intron	NM_012424	NP_036556			ribosomal protein S6 kinase, 52kDa, polypeptide						cell communication|signal transduction	early endosome|membrane	ATP binding|phosphatidylinositol binding|protein binding|protein serine/threonine kinase activity			lung(4)|ovary(3)|breast(1)	8				OV - Ovarian serous cystadenocarcinoma(81;0.00705)|all cancers(67;0.016)|GBM - Glioblastoma multiforme(131;0.0663)|Epithelial(68;0.145)														---	---	---	---
KCTD3	51133	broad.mit.edu	37	1	215768873	215768873	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:215768873delT	uc001hks.2	+						KCTD3_uc001hkt.2_Intron|KCTD3_uc010pub.1_Intron|KCTD3_uc009xdn.2_Intron	NM_016121	NP_057205			potassium channel tetramerisation domain							voltage-gated potassium channel complex	protein binding|voltage-gated potassium channel activity			ovary(3)	3				all cancers(67;0.0164)|OV - Ovarian serous cystadenocarcinoma(81;0.019)|GBM - Glioblastoma multiforme(131;0.0862)|Epithelial(68;0.13)														---	---	---	---
USH2A	7399	broad.mit.edu	37	1	216495187	216495187	+	Intron	DEL	T	-	-	rs79650190		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216495187delT	uc001hku.1	-						USH2A_uc001hkv.2_Intron	NM_206933	NP_996816			usherin isoform B						maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---
DISP1	84976	broad.mit.edu	37	1	223168206	223168207	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223168206_223168207delTT	uc001hnu.1	+							NM_032890	NP_116279			dispatched A						diaphragm development|protein homotrimerization|regulation of protein secretion|smoothened signaling pathway	basolateral plasma membrane|integral to membrane	hedgehog receptor activity|peptide transporter activity				0				GBM - Glioblastoma multiforme(131;0.102)														---	---	---	---
ENAH	55740	broad.mit.edu	37	1	225695577	225695577	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:225695577delT	uc001hpc.1	-						ENAH_uc001hpd.1_Intron|ENAH_uc001hpb.1_Intron	NM_001008493	NP_001008493			enabled homolog isoform a						axon guidance|intracellular transport|T cell receptor signaling pathway	cytosol|filopodium|focal adhesion|lamellipodium|synapse	actin binding|SH3 domain binding|WW domain binding			ovary(1)|skin(1)	2	Breast(184;0.206)			GBM - Glioblastoma multiforme(131;0.19)														---	---	---	---
TMEM63A	9725	broad.mit.edu	37	1	226036149	226036149	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:226036149delA	uc001hpm.1	-							NM_014698	NP_055513			transmembrane protein 63A							integral to membrane|lysosomal membrane	nucleotide binding			ovary(1)|breast(1)	2	Breast(184;0.197)																	---	---	---	---
CDC42BPA	8476	broad.mit.edu	37	1	227330825	227330825	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:227330825delT	uc001hqr.2	-						CDC42BPA_uc001hqs.2_Intron|CDC42BPA_uc009xes.2_Intron|CDC42BPA_uc010pvs.1_Intron	NM_003607	NP_003598			CDC42-binding protein kinase alpha isoform B						actin cytoskeleton reorganization|intracellular signal transduction	cell leading edge|cell-cell junction|cytoplasm	ATP binding|identical protein binding|magnesium ion binding|protein serine/threonine kinase activity|small GTPase regulator activity			lung(6)|breast(2)|stomach(1)|ovary(1)|pancreas(1)	11		all_cancers(173;0.156)|Prostate(94;0.0792)																---	---	---	---
NUP133	55746	broad.mit.edu	37	1	229631436	229631436	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229631436delA	uc001htn.2	-							NM_018230	NP_060700			nucleoporin 133kDa						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|nuclear pore organization|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			breast(4)|skin(2)|ovary(1)	7	Breast(184;0.104)|Ovarian(103;0.249)	Prostate(94;0.167)																---	---	---	---
LYST	1130	broad.mit.edu	37	1	235929142	235929143	+	Intron	DEL	TT	-	-	rs113006318		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:235929142_235929143delTT	uc001hxj.2	-						LYST_uc009xgb.1_Intron|LYST_uc010pxs.1_Intron	NM_000081	NP_000072			lysosomal trafficking regulator						defense response to bacterium|defense response to protozoan|defense response to virus|endosome to lysosome transport via multivesicular body sorting pathway|leukocyte chemotaxis|mast cell secretory granule organization|melanosome organization|natural killer cell mediated cytotoxicity|protein transport	cytoplasm|microtubule cytoskeleton	protein binding			ovary(6)|breast(4)|central_nervous_system(2)	12	Ovarian(103;0.0634)|Breast(184;0.23)	all_cancers(173;0.00246)|Prostate(94;0.0771)|Acute lymphoblastic leukemia(190;0.228)	OV - Ovarian serous cystadenocarcinoma(106;0.000674)											Chediak-Higashi_syndrome				---	---	---	---
ERO1LB	56605	broad.mit.edu	37	1	236399233	236399233	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236399233delT	uc001hxt.2	-							NM_019891	NP_063944			endoplasmic reticulum oxidoreductin 1-Lbeta						electron transport chain|protein thiol-disulfide exchange|transport	endoplasmic reticulum membrane	flavin adenine dinucleotide binding|oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor|unfolded protein binding				0	Ovarian(103;0.0634)|Breast(184;0.247)	all_cancers(173;0.123)|Acute lymphoblastic leukemia(190;0.205)|Prostate(94;0.219)	OV - Ovarian serous cystadenocarcinoma(106;0.00162)															---	---	---	---
GREM2	64388	broad.mit.edu	37	1	240656841	240656841	+	Intron	DEL	A	-	-	rs45519645	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:240656841delA	uc001hys.2	-							NM_022469	NP_071914			gremlin 2 precursor						BMP signaling pathway	extracellular space	cytokine activity				0		all_cancers(173;0.0196)	OV - Ovarian serous cystadenocarcinoma(106;0.0123)															---	---	---	---
PLD5	200150	broad.mit.edu	37	1	242270726	242270726	+	Intron	DEL	A	-	-	rs149488733		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:242270726delA	uc001hzn.1	-						PLD5_uc001hzl.3_Intron|PLD5_uc001hzm.3_Intron|PLD5_uc001hzo.1_Intron					RecName: Full=Inactive phospholipase D5;          Short=Inactive PLD 5; AltName: Full=Inactive choline phosphatase 5; AltName: Full=Inactive phosphatidylcholine-hydrolyzing phospholipase D5; AltName: Full=PLDc;							integral to membrane	catalytic activity			ovary(6)	6	Melanoma(84;0.242)		OV - Ovarian serous cystadenocarcinoma(106;0.0329)															---	---	---	---
OR2L13	284521	broad.mit.edu	37	1	248247982	248247982	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248247982delT	uc001ids.2	+							NM_175911	NP_787107			olfactory receptor, family 2, subfamily L,						sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity|protein binding			central_nervous_system(2)|ovary(1)|skin(1)	4	all_cancers(71;0.000149)|all_epithelial(71;1.27e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0132)															---	---	---	---
MYT1L	23040	broad.mit.edu	37	2	1890247	1890247	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1890247delT	uc002qxe.2	-						MYT1L_uc002qxd.2_Intron|MYT1L_uc010ewl.1_Intron	NM_015025	NP_055840			myelin transcription factor 1-like						cell differentiation|nervous system development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(5)|central_nervous_system(1)	6	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.037)|all_epithelial(98;0.241)		OV - Ovarian serous cystadenocarcinoma(76;0.169)|all cancers(51;0.244)														---	---	---	---
KIDINS220	57498	broad.mit.edu	37	2	8887028	8887029	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:8887028_8887029insA	uc002qzc.2	-						KIDINS220_uc010yiv.1_Intron|KIDINS220_uc002qzd.2_Intron|KIDINS220_uc010yiw.1_Intron|KIDINS220_uc002qzb.2_Intron|KIDINS220_uc002qze.2_3'UTR	NM_020738	NP_065789			kinase D-interacting substrate of 220 kDa						activation of MAPKK activity|nerve growth factor receptor signaling pathway	cytosol|integral to membrane				ovary(3)|central_nervous_system(1)	4	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
NBAS	51594	broad.mit.edu	37	2	15567927	15567928	+	Intron	INS	-	A	A	rs142040693		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:15567927_15567928insA	uc002rcc.1	-						NBAS_uc002rcd.1_Intron	NM_015909	NP_056993			neuroblastoma-amplified protein											ovary(2)|liver(1)|skin(1)	4																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	17035642	17035642	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:17035642delT								FAM49A (188546 upstream) : RAD51AP2 (656344 downstream)																																			---	---	---	---
WDR35	57539	broad.mit.edu	37	2	20138257	20138257	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:20138257delA	uc002rdi.2	-						WDR35_uc002rdj.2_Intron|WDR35_uc010ext.2_Intron|WDR35_uc002rdh.2_Intron|WDR35_uc002rdk.3_Intron	NM_001006657	NP_001006658			WD repeat domain 35 isoform 1											ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---
ALK	238	broad.mit.edu	37	2	29940691	29940691	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:29940691delA	uc002rmy.2	-							NM_004304	NP_004295			anaplastic lymphoma kinase precursor						protein autophosphorylation|transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|protein binding|transmembrane receptor protein tyrosine kinase activity		NPM1/ALK(632)|EML4/ALK(246)|CLTC/ALK(44)|TPM3/ALK(33)|ATIC/ALK(24)|RANBP2/ALK(16)|TPM4/ALK(12)|TFG/ALK(7)|MSN/ALK(6)|CARS/ALK(5)|VCL/ALK(4)|KIF5B/ALK(4)|PPFIBP1/ALK(3)|SEC31A/ALK(3)|SQSTM1/ALK(2)	haematopoietic_and_lymphoid_tissue(726)|lung(262)|autonomic_ganglia(148)|soft_tissue(61)|breast(4)|kidney(4)|large_intestine(3)|skin(3)|ovary(3)|thyroid(2)|central_nervous_system(1)|pancreas(1)	1218	Acute lymphoblastic leukemia(172;0.155)				Adenosine triphosphate(DB00171)			T|Mis|A	NPM1|TPM3|TFG|TPM4|ATIC|CLTC|MSN|ALO17|CARS|EML4	ALCL|NSCLC|Neuroblastoma	neuroblastoma			Neuroblastoma_Familial_Clustering_of|Congenital_Central_Hypoventilation_Syndrome				---	---	---	---
Unknown	0	broad.mit.edu	37	2	33861952	33861952	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:33861952delA								FAM98A (37590 upstream) : MYADML (89180 downstream)																																			---	---	---	---
HEATR5B	54497	broad.mit.edu	37	2	37229751	37229751	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:37229751delA	uc002rpp.1	-						HEATR5B_uc002rpo.1_5'Flank|HEATR5B_uc010ezy.1_Intron	NM_019024	NP_061897			HEAT repeat containing 5B								binding			ovary(5)|skin(2)|breast(1)	8		all_hematologic(82;0.21)																---	---	---	---
CCDC75	253635	broad.mit.edu	37	2	37315480	37315480	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:37315480delA	uc010ezz.2	+						CCDC75_uc002rpr.3_Intron	NM_174931	NP_777591			coiled-coil domain containing 75							intracellular	nucleic acid binding				0		all_hematologic(82;0.21)																---	---	---	---
C2orf56	55471	broad.mit.edu	37	2	37469850	37469850	+	Intron	DEL	A	-	-	rs142499241	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:37469850delA	uc002rqa.3	+						C2orf56_uc010ynj.1_Intron|C2orf56_uc002rqc.3_Intron|C2orf56_uc010ynk.1_Intron|C2orf56_uc010ynl.1_Intron|C2orf56_uc010fah.2_Intron	NM_144736	NP_653337			hypothetical protein LOC55471 isoform 1						mitochondrial respiratory chain complex I assembly	mitochondrion	enzyme binding|methyltransferase activity			central_nervous_system(1)	1		all_hematologic(82;0.21)																---	---	---	---
ATL2	64225	broad.mit.edu	37	2	38526334	38526334	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:38526334delT	uc002rqq.2	-						ATL2_uc010ynm.1_Intron|ATL2_uc010ynn.1_Intron|ATL2_uc010yno.1_Intron|ATL2_uc002rqs.2_Intron|ATL2_uc002rqr.2_Intron	NM_001135673	NP_001129145			atlastin GTPase 2 isoform 2						endoplasmic reticulum organization|Golgi organization|protein homooligomerization	endoplasmic reticulum membrane|integral to membrane	GTP binding|GTPase activity|identical protein binding			ovary(1)|kidney(1)|skin(1)	3																		---	---	---	---
HNRPLL	92906	broad.mit.edu	37	2	38813168	38813168	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:38813168delT	uc002rqw.2	-						HNRPLL_uc002rqx.2_Intron	NM_138394	NP_612403			heterogeneous nuclear ribonucleoprotein L-like						mRNA processing|positive regulation of RNA splicing	nucleus|ribonucleoprotein complex	mRNA binding|nucleotide binding|protein binding			skin(1)	1		all_hematologic(82;0.248)																---	---	---	---
Unknown	0	broad.mit.edu	37	2	42303348	42303348	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:42303348delA								PKDCC (17682 upstream) : EML4 (93142 downstream)																																			---	---	---	---
EML4	27436	broad.mit.edu	37	2	42483549	42483549	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:42483549delC	uc002rsi.2	+						EML4_uc002rsh.3_Intron|EML4_uc010fap.2_Intron	NM_019063	NP_061936			echinoderm microtubule associated protein like 4						microtubule-based process|mitosis	cytoplasm|microtubule	protein binding		EML4/ALK(246)	lung(246)|ovary(2)|central_nervous_system(1)|skin(1)	250								T	ALK	NSCLC								---	---	---	---
THADA	63892	broad.mit.edu	37	2	43768234	43768234	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:43768234delA	uc002rsw.3	-						THADA_uc010far.2_Intron|THADA_uc002rsx.3_Intron|THADA_uc002rsy.3_Intron|THADA_uc010fas.1_Intron|THADA_uc002rsz.2_Intron|THADA_uc010fat.1_Intron|THADA_uc002rta.2_Intron	NM_001083953	NP_001077422			thyroid adenoma associated								binding			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(82;0.00361)|all_hematologic(82;0.00837)																---	---	---	---
LHCGR	3973	broad.mit.edu	37	2	48952906	48952906	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48952906delA	uc002rwu.3	-						GTF2A1L_uc002rwt.2_Intron|LHCGR_uc002rwv.2_Intron	NM_000233	NP_000224			luteinizing hormone/choriogonadotropin receptor						male genitalia development|male gonad development	endosome|integral to plasma membrane	luteinizing hormone receptor activity			ovary(3)|lung(2)|breast(2)|skin(1)	8		all_hematologic(82;0.151)|Acute lymphoblastic leukemia(82;0.176)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)		Cetrorelix(DB00050)|Choriogonadotropin alfa(DB00097)|Goserelin(DB00014)|Lutropin alfa(DB00044)|Menotropins(DB00032)									Familial_Male-Limited_Precocious_Puberty				---	---	---	---
PSME4	23198	broad.mit.edu	37	2	54114939	54114940	+	Intron	INS	-	A	A	rs13388442	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:54114939_54114940insA	uc002rxp.2	-						PSME4_uc010yop.1_Intron|PSME4_uc010yoq.1_Intron|PSME4_uc010fbu.1_Intron|PSME4_uc010fbv.1_Intron|PSME4_uc010fbt.1_5'Flank	NM_014614	NP_055429			proteasome (prosome, macropain) activator						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|cell differentiation|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|M/G1 transition of mitotic cell cycle|mRNA metabolic process|multicellular organismal development|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|spermatogenesis|viral reproduction	nuclear speck|proteasome complex	binding			ovary(2)|breast(2)|pancreas(1)	5			Lung(47;0.125)|LUSC - Lung squamous cell carcinoma(58;0.181)															---	---	---	---
Unknown	0	broad.mit.edu	37	2	55931430	55931430	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:55931430delT								PNPT1 (10419 upstream) : EFEMP1 (161673 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	2	58687298	58687298	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:58687298delT								FANCL (218783 upstream) : None (None downstream)																																			---	---	---	---
USP34	9736	broad.mit.edu	37	2	61560996	61560996	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61560996delT	uc002sbe.2	-							NM_014709	NP_055524			ubiquitin specific protease 34						positive regulation of canonical Wnt receptor signaling pathway|protein K48-linked deubiquitination|ubiquitin-dependent protein catabolic process|Wnt receptor signaling pathway		cysteine-type endopeptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(8)|breast(5)|skin(3)|lung(2)|prostate(1)	19			Epithelial(17;0.229)															---	---	---	---
EHBP1	23301	broad.mit.edu	37	2	63220993	63220993	+	Intron	DEL	T	-	-	rs78094292		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:63220993delT	uc002sby.2	+						EHBP1_uc010fcp.2_Intron|EHBP1_uc002sbz.2_Intron|EHBP1_uc002scb.2_Intron	NM_015252	NP_056067			EH domain binding protein 1 isoform 1							cytoplasm|membrane				ovary(1)|breast(1)	2	Lung NSC(7;0.0951)|all_lung(7;0.169)		LUSC - Lung squamous cell carcinoma(7;7.74e-05)|Epithelial(17;0.189)											Hereditary_Prostate_Cancer				---	---	---	---
PNO1	56902	broad.mit.edu	37	2	68388973	68388973	+	Intron	DEL	A	-	-	rs113134222		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:68388973delA	uc002seh.2	+							NM_020143	NP_064528			partner of NOB1							nucleolus	RNA binding				0																		---	---	---	---
HK2	3099	broad.mit.edu	37	2	75081242	75081243	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:75081242_75081243delTT	uc002snd.2	+							NM_000189	NP_000180			hexokinase 2						apoptotic mitochondrial changes|glucose transport|glycolysis|transmembrane transport	cytosol|mitochondrial outer membrane	ATP binding|glucokinase activity			ovary(1)|lung(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	81428038	81428038	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:81428038delT								CTNNA2 (552134 upstream) : None (None downstream)																																			---	---	---	---
SUCLG1	8802	broad.mit.edu	37	2	84676961	84676962	+	Intron	INS	-	A	A	rs77955793		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:84676961_84676962insA	uc002son.2	-						SUCLG1_uc010ysk.1_Intron	NM_003849	NP_003840			succinate-CoA ligase, GDP-forming alpha subunit						tricarboxylic acid cycle		ATP citrate synthase activity|GTP binding|succinate-CoA ligase (GDP-forming) activity				0					Succinic acid(DB00139)													---	---	---	---
TCF7L1	83439	broad.mit.edu	37	2	85529268	85529268	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:85529268delA	uc002soy.2	+							NM_031283	NP_112573			HMG-box transcription factor TCF-3						chromatin organization|regulation of Wnt receptor signaling pathway|Wnt receptor signaling pathway	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			lung(1)|breast(1)|central_nervous_system(1)	3																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	92195739	92195742	+	IGR	DEL	AGGA	-	-	rs11694625		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:92195739_92195742delAGGA								FKSG73 (65245 upstream) : None (None downstream)																																			---	---	---	---
MRPL30	51263	broad.mit.edu	37	2	99779654	99779655	+	Intron	DEL	AC	-	-	rs68130738		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:99779654_99779655delAC	uc002szr.2	+						MRPL30_uc002szl.1_Intron	NM_145213	NP_660214			SubName: Full=HCG1989457, isoform CRA_a; SubName: Full=Putative uncharacterized protein MRPL30;						translation	mitochondrion|ribosome	structural constituent of ribosome			ovary(1)	1																		---	---	---	---
EIF5B	9669	broad.mit.edu	37	2	99995647	99995647	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:99995647delA	uc002tab.2	+							NM_015904	NP_056988			eukaryotic translation initiation factor 5B						regulation of translational initiation	cytosol	GTP binding|GTPase activity|protein binding|translation initiation factor activity			ovary(2)|pancreas(1)	3																		---	---	---	---
AFF3	3899	broad.mit.edu	37	2	100627740	100627741	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:100627740_100627741insA	uc002tag.2	-						AFF3_uc002taf.2_Intron|AFF3_uc010fiq.1_Intron|AFF3_uc010yvr.1_Intron|AFF3_uc002tah.1_Intron|AFF3_uc010fir.1_Intron	NM_002285	NP_002276			AF4/FMR2 family, member 3 isoform 1						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(2)|pancreas(1)|lung(1)|kidney(1)|skin(1)	6																		---	---	---	---
RGPD4	285190	broad.mit.edu	37	2	108479623	108479623	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:108479623delT	uc010ywk.1	+						RGPD4_uc002tdu.2_Intron|RGPD4_uc010ywl.1_Intron	NM_182588	NP_872394			RANBP2-like and GRIP domain containing 4						intracellular transport		binding			skin(2)	2																		---	---	---	---
SEPT10	151011	broad.mit.edu	37	2	110325591	110325591	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:110325591delT	uc002tew.2	-						SEPT10_uc010ywu.1_Intron|SEPT10_uc002tex.2_Intron|SEPT10_uc002tey.2_Intron|SEPT10_uc010ywv.1_Intron|SEPT10_uc002tev.1_Intron|SEPT10_uc010fjo.2_Intron|SEPT10_uc002tez.1_5'Flank	NM_144710	NP_653311			septin 10 isoform 1						cell cycle|cell division	septin complex	GTP binding				0																		---	---	---	---
LRP1B	53353	broad.mit.edu	37	2	141598363	141598364	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141598363_141598364insT	uc002tvj.1	-							NM_018557	NP_061027			low density lipoprotein-related protein 1B						protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)											TSP Lung(27;0.18)			---	---	---	---
ACVR2A	92	broad.mit.edu	37	2	148683686	148683686	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:148683686delA	uc002twg.2	+	11	1572	c.1303delA	c.(1303-1305)AAAfs	p.K435fs	ACVR2A_uc010zbn.1_Frame_Shift_Del_p.K327fs|ACVR2A_uc002twh.2_Frame_Shift_Del_p.K435fs	NM_001616	NP_001607	P27037	AVR2A_HUMAN	activin A receptor, type IIA precursor	435	Cytoplasmic (Potential).|Protein kinase.				activin receptor signaling pathway|BMP signaling pathway|positive regulation of activin receptor signaling pathway|positive regulation of bone mineralization|positive regulation of erythrocyte differentiation|positive regulation of osteoblast differentiation|positive regulation of protein phosphorylation	cytoplasm|inhibin-betaglycan-ActRII complex|integral to plasma membrane	ATP binding|coreceptor activity|inhibin beta-A binding|metal ion binding|receptor signaling protein serine/threonine kinase activity|transforming growth factor beta receptor activity			stomach(8)|large_intestine(2)|lung(1)|breast(1)|kidney(1)	13				BRCA - Breast invasive adenocarcinoma(221;0.0969)														---	---	---	---
ORC4L	5000	broad.mit.edu	37	2	148712820	148712820	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:148712820delT	uc002twi.2	-						ORC4L_uc002twj.2_Intron|ORC4L_uc010zbo.1_Intron|ORC4L_uc010zbp.1_Intron|ORC4L_uc010fnr.2_Intron|ORC4L_uc010zbq.1_Intron|ORC4L_uc002twk.2_Intron|ORC4L_uc010zbr.1_Intron	NM_181741	NP_859525			origin recognition complex subunit 4						cell cycle checkpoint|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|S phase of mitotic cell cycle	nuclear origin of replication recognition complex|nucleoplasm	ATP binding|DNA replication origin binding|nucleoside-triphosphatase activity|protein binding				0				BRCA - Breast invasive adenocarcinoma(221;0.0963)|COAD - Colon adenocarcinoma(177;0.203)														---	---	---	---
TNFAIP6	7130	broad.mit.edu	37	2	152214427	152214427	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152214427delT	uc002txk.2	+							NM_007115	NP_009046			tumor necrosis factor, alpha-induced protein 6						cell adhesion|cell-cell signaling|inflammatory response|signal transduction		hyaluronic acid binding				0				BRCA - Breast invasive adenocarcinoma(221;0.131)														---	---	---	---
PRPF40A	55660	broad.mit.edu	37	2	153529686	153529686	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:153529686delA	uc002tyi.2	-						PRPF40A_uc002tyh.3_Intron|PRPF40A_uc010zcd.1_Intron|PRPF40A_uc002tyj.2_Intron	NM_017892	NP_060362			formin binding protein 3						mRNA processing|RNA splicing	nuclear matrix|nuclear speck	protein binding				0																		---	---	---	---
PLA2R1	22925	broad.mit.edu	37	2	160885499	160885499	+	Intron	DEL	A	-	-	rs80051025		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160885499delA	uc002ube.1	-						PLA2R1_uc010zcp.1_Intron|PLA2R1_uc002ubf.2_Intron	NM_007366	NP_031392			phospholipase A2 receptor 1 isoform 1 precursor						endocytosis	extracellular space|integral to plasma membrane	receptor activity|sugar binding			skin(2)|ovary(1)	3																		---	---	---	---
TBR1	10716	broad.mit.edu	37	2	162272776	162272776	+	5'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:162272776delA	uc002ubw.1	+	1					TBR1_uc010foy.2_5'Flank	NM_006593	NP_006584			T-box, brain, 1							nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
SCN1A	6323	broad.mit.edu	37	2	166859325	166859325	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:166859325delT	uc010zcz.1	-						SCN1A_uc002udo.3_Intron|SCN1A_uc010fpk.2_Intron	NM_006920	NP_008851			sodium channel, voltage-gated, type I, alpha							voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(6)|skin(6)|large_intestine(1)	13					Lamotrigine(DB00555)|Levetiracetam(DB01202)|Phenacemide(DB01121)|Phenytoin(DB00252)|Topiramate(DB00273)|Zonisamide(DB00909)													---	---	---	---
LASS6	253782	broad.mit.edu	37	2	169417609	169417609	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:169417609delA	uc002ueb.1	+						LASS6_uc002uec.1_Intron	NM_203463	NP_982288			longevity assurance homolog 6							endoplasmic reticulum membrane|integral to membrane|nuclear membrane	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|sphingosine N-acyltransferase activity			skin(1)	1																		---	---	---	---
KLHL23	151230	broad.mit.edu	37	2	170606424	170606427	+	3'UTR	DEL	TATA	-	-	rs72113382		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170606424_170606427delTATA	uc002ufh.1	+	6					KLHL23_uc002ufi.1_3'UTR|uc002ufj.3_5'Flank	NM_144711	NP_653312			kelch-like 23												0																		---	---	---	---
HAT1	8520	broad.mit.edu	37	2	172809273	172809273	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:172809273delT	uc002uhi.2	+						HAT1_uc010fqi.2_Intron|HAT1_uc002uhj.2_Intron	NM_003642	NP_003633			histone acetyltransferase 1						chromatin silencing at telomere|DNA packaging	cytoplasm|nuclear matrix|nucleoplasm	histone acetyltransferase activity|protein binding			large_intestine(1)|ovary(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.216)															---	---	---	---
Unknown	0	broad.mit.edu	37	2	173020728	173020728	+	IGR	DEL	T	-	-	rs35217322	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:173020728delT								DLX2 (53250 upstream) : ITGA6 (271354 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	2	175164719	175164719	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:175164719delA								OLA1 (51354 upstream) : SP9 (35102 downstream)																																			---	---	---	---
NFE2L2	4780	broad.mit.edu	37	2	178097083	178097083	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:178097083delA	uc002ulh.3	-						NFE2L2_uc002ulg.3_Intron|NFE2L2_uc010zfa.1_Intron|NFE2L2_uc002uli.3_Intron|NFE2L2_uc010fra.2_3'UTR	NM_006164	NP_006155			nuclear factor erythroid 2-like 2 isoform 1						transcription from RNA polymerase II promoter	centrosome|cytosol|nucleus|plasma membrane	protein dimerization activity|protein domain specific binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(1)	1			Epithelial(96;0.00442)|OV - Ovarian serous cystadenocarcinoma(117;0.00739)|all cancers(119;0.0195)|LUSC - Lung squamous cell carcinoma(2;0.036)|Lung(16;0.0935)					Mis		NSCLC|HNSCC					HNSCC(56;0.16)			---	---	---	---
TTC30B	150737	broad.mit.edu	37	2	178415367	178415367	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:178415367delT	uc002uln.2	-	1					TTC30B_uc010zfc.1_3'UTR	NM_152517	NP_689730			tetratricopeptide repeat domain 30B						cell projection organization	cilium	binding				0			OV - Ovarian serous cystadenocarcinoma(117;0.00151)|Epithelial(96;0.00931)|all cancers(119;0.0362)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179478747	179478747	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179478747delT	uc010zfg.1	-						uc002ump.1_Intron|TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron	NM_133378	NP_596869			titin isoform N2-A								ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179540766	179540766	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179540766delA	uc010zfg.1	-						TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Intron|TTN_uc010fre.1_Intron|TTN_uc002una.1_Intron|TTN_uc010frf.1_Intron	NM_133378	NP_596869			titin isoform N2-A								ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179548634	179548634	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179548634delT	uc010zfg.1	-						TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Intron|TTN_uc010fre.1_Intron	NM_133378	NP_596869			titin isoform N2-A								ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
NCKAP1	10787	broad.mit.edu	37	2	183859387	183859387	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:183859387delA	uc002upc.2	-						NCKAP1_uc002upb.2_Intron	NM_013436	NP_038464			NCK-associated protein 1 isoform 1						apoptosis|central nervous system development	integral to membrane|lamellipodium membrane	protein binding			ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.0942)|Epithelial(96;0.209)															---	---	---	---
Unknown	0	broad.mit.edu	37	2	186692860	186692860	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:186692860delT	uc002upm.2	+						uc010zfu.1_Intron					Homo sapiens cDNA FLJ44048 fis, clone TESTI4030669.																														---	---	---	---
C2orf60	129450	broad.mit.edu	37	2	200804960	200804960	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:200804960delA	uc002uvi.3	-						C2orf60_uc002uvj.3_Intron|C2orf60_uc002uvk.3_Intron|C2orf60_uc010fss.2_Intron	NM_001039693	NP_001034782			hypothetical protein LOC129450						wybutosine biosynthetic process		iron ion binding|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein homodimerization activity|tRNA binding				0																		---	---	---	---
AOX1	316	broad.mit.edu	37	2	201495240	201495241	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:201495240_201495241delAA	uc002uvx.2	+						AOX1_uc010zhf.1_Intron|AOX1_uc010fsu.2_Intron	NM_001159	NP_001150			aldehyde oxidase 1						inflammatory response|reactive oxygen species metabolic process	cytoplasm	2 iron, 2 sulfur cluster binding|aldehyde oxidase activity|flavin adenine dinucleotide binding|iron ion binding|NAD binding|xanthine dehydrogenase activity			ovary(4)|pancreas(1)|skin(1)	6					Brimonidine(DB00484)|Chlorpromazine(DB00477)|Famciclovir(DB00426)|Menadione(DB00170)|Methotrexate(DB00563)|NADH(DB00157)|Palonosetron(DB00377)|Penciclovir(DB00299)|Raloxifene(DB00481)|Zaleplon(DB00962)|Zonisamide(DB00909)													---	---	---	---
ALS2	57679	broad.mit.edu	37	2	202631829	202631829	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202631829delA	uc002uyo.2	-						ALS2_uc002uyp.3_Intron|ALS2_uc002uyq.2_Intron|ALS2_uc002uyr.2_Intron	NM_020919	NP_065970			alsin isoform 1						cell death|endosome organization|positive regulation of Rac GTPase activity|regulation of endosome size	centrosome|cytosol|early endosome|growth cone|lamellipodium|protein complex|ruffle	protein homodimerization activity|protein serine/threonine kinase activator activity|Rab GTPase binding|Rab guanyl-nucleotide exchange factor activity|Rac guanyl-nucleotide exchange factor activity|Ran guanyl-nucleotide exchange factor activity			skin(5)|lung(1)|breast(1)	7																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	202919066	202919081	+	IGR	DEL	AGAAGGAAGGAAGGAG	-	-	rs7575134	by1000genomes;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202919066_202919081delAGAAGGAAGGAAGGAG								FZD7 (15906 upstream) : SUMO1 (151822 downstream)																																			---	---	---	---
CYP20A1	57404	broad.mit.edu	37	2	204137273	204137274	+	Intron	INS	-	A	A	rs72103565		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:204137273_204137274insA	uc002uzv.3	+						CYP20A1_uc002uzx.3_Intron|CYP20A1_uc010zif.1_Intron|CYP20A1_uc002uzy.3_Intron|CYP20A1_uc002uzw.3_Intron|CYP20A1_uc010ftw.2_Intron	NM_177538	NP_803882			cytochrome P450, family 20, subfamily A,							integral to membrane	electron carrier activity|heme binding|monooxygenase activity|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen				0																		---	---	---	---
INO80D	54891	broad.mit.edu	37	2	206911107	206911107	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:206911107delA	uc002vaz.3	-							NM_017759	NP_060229			INO80 complex subunit D						DNA recombination|DNA repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(1)	1																		---	---	---	---
NDUFS1	4719	broad.mit.edu	37	2	206997836	206997837	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:206997836_206997837delAA	uc002vbe.2	-						NDUFS1_uc010ziq.1_Intron|NDUFS1_uc010zir.1_Intron|NDUFS1_uc010zis.1_Intron|NDUFS1_uc010zit.1_Intron|NDUFS1_uc010ziu.1_Intron	NM_005006	NP_004997			NADH dehydrogenase (ubiquinone) Fe-S protein 1,						apoptosis|ATP metabolic process|mitochondrial electron transport, NADH to ubiquinone|reactive oxygen species metabolic process|regulation of mitochondrial membrane potential|transport	mitochondrial intermembrane space|mitochondrial respiratory chain complex I	2 iron, 2 sulfur cluster binding|4 iron, 4 sulfur cluster binding|electron carrier activity|metal ion binding|NADH dehydrogenase (ubiquinone) activity|protein binding			ovary(1)	1					NADH(DB00157)													---	---	---	---
Unknown	0	broad.mit.edu	37	2	208896716	208896717	+	IGR	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:208896716_208896717delTT								PLEKHM3 (6432 upstream) : CRYGD (89615 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	2	222809530	222809530	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:222809530delA								EPHA4 (370608 upstream) : PAX3 (255077 downstream)																																			---	---	---	---
KIAA1486	57624	broad.mit.edu	37	2	226447379	226447379	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:226447379delC	uc002voe.2	+	4	1421	c.1246delC	c.(1246-1248)CCCfs	p.P416fs	KIAA1486_uc010fxa.1_Intron|KIAA1486_uc002vof.1_Frame_Shift_Del_p.P186fs	NM_020864	NP_065915	Q9P242	K1486_HUMAN	hypothetical protein LOC57624	416	Pro-rich.									ovary(2)|central_nervous_system(1)	3		Renal(207;0.0112)|all_lung(227;0.0477)|Lung NSC(271;0.0644)|all_hematologic(139;0.101)|Esophageal squamous(248;0.129)		Epithelial(121;6.73e-10)|all cancers(144;4.32e-07)|Lung(261;0.0161)|LUSC - Lung squamous cell carcinoma(224;0.0223)														---	---	---	---
Unknown	0	broad.mit.edu	37	2	234699315	234699315	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:234699315delT								UGT1A10 (17366 upstream) : HJURP (46172 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	2	241579567	241579574	+	IGR	DEL	TCCTTCCC	-	-	rs142912596	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:241579567_241579574delTCCTTCCC								GPR35 (8892 upstream) : AQP12B (36262 downstream)																																			---	---	---	---
CHL1	10752	broad.mit.edu	37	3	425656	425656	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:425656delT	uc003bou.2	+						CHL1_uc003bot.2_Intron|CHL1_uc003bow.1_Intron|CHL1_uc011asi.1_Intron|uc003box.1_Intron	NM_006614	NP_006605			cell adhesion molecule with homology to L1CAM						axon guidance|cell adhesion|signal transduction	integral to membrane|plasma membrane|proteinaceous extracellular matrix				skin(5)|central_nervous_system(4)|large_intestine(2)|ovary(1)	12		all_cancers(2;1.14e-06)|all_epithelial(2;0.00367)|all_lung(1;0.061)|Lung NSC(2;0.201)		Epithelial(13;5.36e-06)|all cancers(10;1.4e-05)|OV - Ovarian serous cystadenocarcinoma(96;0.00323)|COAD - Colon adenocarcinoma(1;0.00925)|Colorectal(20;0.0198)														---	---	---	---
TTLL3	26140	broad.mit.edu	37	3	9842117	9842117	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:9842117delT	uc003btd.3	+						ARPC4_uc003bsz.1_Intron|ARPC4_uc003bta.1_Intron|ARPC4_uc003btb.1_Intron|ARPC4_uc003btc.1_Intron					RecName: Full=Tubulin--tyrosine ligase-like protein 3; AltName: Full=HOTTL;						axoneme assembly|cilium assembly|protein polyglycylation	cilium axoneme|cytoplasm|microtubule	protein-glycine ligase activity, initiating|tubulin-tyrosine ligase activity			large_intestine(2)	2	Medulloblastoma(99;0.227)																	---	---	---	---
ATP2B2	491	broad.mit.edu	37	3	10427117	10427117	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10427117delA	uc003bvt.2	-						ATP2B2_uc003bvv.2_Intron|ATP2B2_uc003bvw.2_Intron|ATP2B2_uc010hdo.2_Intron	NM_001001331	NP_001001331			plasma membrane calcium ATPase 2 isoform 1						ATP biosynthetic process|cytosolic calcium ion homeostasis|platelet activation	cytosol|integral to membrane|plasma membrane	ATP binding|ATP binding|calcium ion binding|calcium-transporting ATPase activity|calcium-transporting ATPase activity|calmodulin binding|calmodulin binding|metal ion binding|PDZ domain binding|protein C-terminus binding			ovary(3)|skin(2)|central_nervous_system(1)	6																		---	---	---	---
TPRXL	348825	broad.mit.edu	37	3	13978445	13978445	+	5'Flank	DEL	A	-	-	rs11328893		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:13978445delA	uc011avd.1	+							NR_002223				RecName: Full=Putative protein TPRXL;												0																		---	---	---	---
SATB1	6304	broad.mit.edu	37	3	18457303	18457303	+	Intron	DEL	G	-	-	rs112868614		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:18457303delG	uc003cbh.2	-						SATB1_uc003cbi.2_Intron|SATB1_uc003cbj.2_Intron	NM_002971	NP_002962			special AT-rich sequence binding protein 1						cellular component disassembly involved in apoptosis|interspecies interaction between organisms|negative regulation of transcription from RNA polymerase II promoter	nuclear matrix|PML body	double-stranded DNA binding|sequence-specific DNA binding			skin(2)|ovary(1)|lung(1)	4																		---	---	---	---
EFHB	151651	broad.mit.edu	37	3	19946899	19946899	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:19946899delA	uc003cbl.3	-						EFHB_uc003cbm.2_Intron	NM_144715	NP_653316			EF hand domain family, member B						signal transduction	proteinaceous extracellular matrix	calcium ion binding				0																		---	---	---	---
RARB	5915	broad.mit.edu	37	3	25635836	25635836	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:25635836delT	uc011awl.1	+						RARB_uc003cdi.1_Intron|RARB_uc003cdh.2_Intron	NM_016152	NP_057236			retinoic acid receptor, beta isoform 2						embryonic digestive tract development|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	cytoplasm|nucleoplasm	protein binding|retinoic acid receptor activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)|large_intestine(1)|pancreas(1)	3					Acitretin(DB00459)|Adapalene(DB00210)|Alitretinoin(DB00523)|Etretinate(DB00926)|Tamibarotene(DB04942)|Tazarotene(DB00799)													---	---	---	---
KIF15	56992	broad.mit.edu	37	3	44847648	44847648	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:44847648delC	uc003cnx.3	+						KIF15_uc010hiq.2_Intron|KIF15_uc003cny.1_Intron	NM_020242	NP_064627			kinesin family member 15						blood coagulation|cell proliferation|microtubule-based movement|mitosis	centrosome|cytosol|microtubule|plus-end kinesin complex|spindle	ATP binding|DNA binding|microtubule motor activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.0099)|KIRC - Kidney renal clear cell carcinoma(197;0.0564)|Kidney(197;0.0707)														---	---	---	---
LRRC2	79442	broad.mit.edu	37	3	46560368	46560368	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:46560368delT	uc010hji.2	-	9					LRRC2_uc003cpu.3_3'UTR	NM_024512	NP_078788			leucine rich repeat containing 2											ovary(1)	1		Ovarian(412;0.0563)		OV - Ovarian serous cystadenocarcinoma(275;6.37e-05)|BRCA - Breast invasive adenocarcinoma(193;0.00133)|KIRC - Kidney renal clear cell carcinoma(197;0.0214)|Kidney(197;0.0254)														---	---	---	---
QRICH1	54870	broad.mit.edu	37	3	49081575	49081575	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49081575delA	uc010hkq.2	-						QRICH1_uc003cvu.2_Intron|QRICH1_uc003cvv.2_Intron	NM_198880	NP_942581			glutamine-rich 1											ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;8.88e-05)|Kidney(197;0.00239)|KIRC - Kidney renal clear cell carcinoma(197;0.00258)														---	---	---	---
C3orf62	375341	broad.mit.edu	37	3	49308392	49308392	+	3'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49308392delA	uc003cwn.2	-	3					C3orf62_uc003cwm.2_3'UTR	NM_198562	NP_940964			hypothetical protein LOC375341												0				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.00218)|KIRC - Kidney renal clear cell carcinoma(197;0.00244)														---	---	---	---
DOCK3	1795	broad.mit.edu	37	3	51417604	51417604	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51417604delC	uc011bds.1	+	52	5572	c.5549delC	c.(5548-5550)ACCfs	p.T1850fs		NM_004947	NP_004938	Q8IZD9	DOCK3_HUMAN	dedicator of cytokinesis 3	1850						cytoplasm	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity|SH3 domain binding				0				BRCA - Breast invasive adenocarcinoma(193;0.00105)|KIRC - Kidney renal clear cell carcinoma(197;0.00449)|Kidney(197;0.00518)														---	---	---	---
CACNA1D	776	broad.mit.edu	37	3	53774595	53774595	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:53774595delT	uc003dgv.3	+						CACNA1D_uc003dgu.3_Intron|CACNA1D_uc003dgy.3_Intron|CACNA1D_uc003dgw.3_Intron|CACNA1D_uc003dgx.1_Intron	NM_001128840	NP_001122312			calcium channel, voltage-dependent, L type,						axon guidance|energy reserve metabolic process|regulation of insulin secretion	voltage-gated calcium channel complex	voltage-gated calcium channel activity			ovary(6)|upper_aerodigestive_tract(2)|liver(1)|central_nervous_system(1)|skin(1)	11				BRCA - Breast invasive adenocarcinoma(193;0.00029)|KIRC - Kidney renal clear cell carcinoma(284;0.0145)|Kidney(284;0.0175)|OV - Ovarian serous cystadenocarcinoma(275;0.0613)	Verapamil(DB00661)													---	---	---	---
ACOX2	8309	broad.mit.edu	37	3	58494879	58494879	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:58494879delT	uc003dkl.2	-							NM_003500	NP_003491			acyl-Coenzyme A oxidase 2						bile acid biosynthetic process|fatty acid beta-oxidation using acyl-CoA oxidase	peroxisomal matrix	3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase activity|acyl-CoA dehydrogenase activity|pristanoyl-CoA oxidase activity				0				BRCA - Breast invasive adenocarcinoma(55;0.000194)|Kidney(10;0.00255)|KIRC - Kidney renal clear cell carcinoma(10;0.00268)|OV - Ovarian serous cystadenocarcinoma(275;0.156)														---	---	---	---
MORC1	27136	broad.mit.edu	37	3	108813922	108813922	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108813922delA	uc003dxl.2	-						MORC1_uc011bhn.1_Intron	NM_014429	NP_055244			MORC family CW-type zinc finger 1						cell differentiation|multicellular organismal development|spermatogenesis	nucleus	ATP binding|zinc ion binding			ovary(3)|skin(3)|breast(2)	8																		---	---	---	---
TMPRSS7	344805	broad.mit.edu	37	3	111794490	111794491	+	Intron	DEL	TT	-	-	rs112959291		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111794490_111794491delTT	uc010hqb.2	+						TMPRSS7_uc011bhr.1_Intron	NM_001042575	NP_001036040			transmembrane protease, serine 7						proteolysis	integral to membrane|plasma membrane	serine-type endopeptidase activity			ovary(1)|kidney(1)	2																		---	---	---	---
STXBP5L	9515	broad.mit.edu	37	3	120628675	120628675	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:120628675delG	uc003eec.3	+						STXBP5L_uc011bji.1_Intron	NM_014980	NP_055795			syntaxin binding protein 5-like						exocytosis|protein transport	cytoplasm|integral to membrane|plasma membrane				ovary(7)|skin(2)	9				GBM - Glioblastoma multiforme(114;0.0694)														---	---	---	---
GOLGB1	2804	broad.mit.edu	37	3	121447905	121447905	+	Intron	DEL	A	-	-	rs78490595		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121447905delA	uc003eei.3	-						GOLGB1_uc010hrc.2_Intron|GOLGB1_uc003eej.3_Intron|GOLGB1_uc011bjm.1_Intron|GOLGB1_uc010hrd.1_Intron	NM_004487	NP_004478			golgi autoantigen, golgin subfamily b,						Golgi organization	ER-Golgi intermediate compartment|Golgi membrane|Golgi stack|integral to membrane	protein binding			ovary(6)|breast(2)|skin(2)	10				GBM - Glioblastoma multiforme(114;0.0989)														---	---	---	---
IQCB1	9657	broad.mit.edu	37	3	121518237	121518237	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121518237delA	uc010hre.1	-						IQCB1_uc003eek.2_Intron|IQCB1_uc010hrf.1_Intron	NM_001023570	NP_001018864			IQ motif containing B1 isoform a						cilium assembly|maintenance of organ identity|photoreceptor cell maintenance	centrosome|photoreceptor connecting cilium	calmodulin binding				0				GBM - Glioblastoma multiforme(114;0.0983)														---	---	---	---
CASR	846	broad.mit.edu	37	3	121973380	121973380	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121973380delT	uc003eev.3	+						CASR_uc003eew.3_Intron	NM_000388	NP_000379			calcium-sensing receptor precursor						anatomical structure morphogenesis|calcium ion import|cellular calcium ion homeostasis|chemosensory behavior|detection of calcium ion|ossification	integral to plasma membrane	G-protein coupled receptor activity|phosphatidylinositol phospholipase C activity			ovary(4)|skin(2)|upper_aerodigestive_tract(1)	7				GBM - Glioblastoma multiforme(114;0.226)	Cinacalcet(DB01012)													---	---	---	---
SLC12A8	84561	broad.mit.edu	37	3	124810944	124810944	+	Splice_Site	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124810944delC	uc003ehv.3	-	11	1914	c.1803_splice	c.e11+1	p.G601_splice	SLC12A8_uc003ehw.3_Splice_Site_p.G630_splice|SLC12A8_uc003eht.3_Splice_Site_p.G402_splice|SLC12A8_uc003ehu.3_Splice_Site_p.G354_splice|SLC12A8_uc010hry.2_Intron	NM_024628	NP_078904			solute carrier family 12, member 8						potassium ion transport	integral to membrane	symporter activity				0																		---	---	---	---
MGLL	11343	broad.mit.edu	37	3	127441207	127441207	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:127441207delC	uc003ejx.2	-						MGLL_uc003ejw.2_Intron|MGLL_uc011bko.1_Intron|MGLL_uc010hsp.1_Intron|MGLL_uc003ejv.2_Intron	NM_001003794	NP_001003794			monoglyceride lipase isoform 2						arachidonic acid metabolic process|fatty acid biosynthetic process|inflammatory response|platelet activation|regulation of endocannabinoid signaling pathway|regulation of inflammatory response|regulation of sensory perception of pain|triglyceride catabolic process	plasma membrane	acylglycerol lipase activity|carboxylesterase activity|lysophospholipase activity|protein homodimerization activity				0																		---	---	---	---
RUVBL1	8607	broad.mit.edu	37	3	127783636	127783637	+	3'UTR	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:127783636_127783637insT	uc003ekf.2	-	10					RUVBL1_uc003eke.2_3'UTR|SEC61A1_uc003ekb.2_Intron|SEC61A1_uc003ekc.2_Intron|SEC61A1_uc003ekd.2_Intron|SEC61A1_uc003ekg.2_5'Flank	NM_003707	NP_003698			RuvB-like 1						cell division|CenH3-containing nucleosome assembly at centromere|DNA recombination|DNA repair|histone H2A acetylation|histone H4 acetylation|mitosis|regulation of growth|regulation of transcription from RNA polymerase II promoter|spermatogenesis|transcription, DNA-dependent	Golgi apparatus|Ino80 complex|membrane|microtubule organizing center|MLL1 complex|NuA4 histone acetyltransferase complex|nuclear matrix	ATP binding|DNA helicase activity|protein binding			skin(1)	1				GBM - Glioblastoma multiforme(114;0.181)														---	---	---	---
KIAA1257	57501	broad.mit.edu	37	3	128707386	128707387	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128707386_128707387delAA	uc003elj.3	-						KIAA1257_uc003elg.1_Intron|KIAA1257_uc003eli.3_Intron	NM_020741	NP_065792			hypothetical protein LOC57501												0																		---	---	---	---
PLSCR1	5359	broad.mit.edu	37	3	146239126	146239126	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:146239126delT	uc003evx.3	-						PLSCR1_uc003evy.3_Intron|PLSCR1_uc011bnn.1_Intron|PLSCR1_uc003evz.3_Intron	NM_021105	NP_066928			phospholipid scramblase 1						phospholipid scrambling|platelet activation|response to virus	integral to membrane|plasma membrane	calcium ion binding|phospholipid scramblase activity|SH3 domain binding			ovary(2)	2																		---	---	---	---
HLTF	6596	broad.mit.edu	37	3	148757291	148757291	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:148757291delT	uc003ewq.1	-						HLTF_uc003ewr.1_Intron|HLTF_uc003ews.1_Intron|HLTF_uc010hve.1_Intron	NM_139048	NP_620636			helicase-like transcription factor						chromatin modification|transcription, DNA-dependent	nucleus	ATP binding|DNA binding|helicase activity|ligase activity|zinc ion binding			ovary(1)	1			LUSC - Lung squamous cell carcinoma(72;0.0473)|Lung(72;0.0607)															---	---	---	---
DHX36	170506	broad.mit.edu	37	3	154017854	154017854	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:154017854delT	uc003ezy.3	-						DHX36_uc010hvq.2_Intron|DHX36_uc003ezz.3_Intron	NM_020865	NP_065916			DEAH (Asp-Glu-Ala-His) box polypeptide 36							cytoplasm|nucleus	ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding			skin(1)	1			LUSC - Lung squamous cell carcinoma(72;0.114)|Lung(72;0.173)															---	---	---	---
MFSD1	64747	broad.mit.edu	37	3	158542255	158542255	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:158542255delA	uc003fcl.1	+						MFSD1_uc003fcm.1_Intron|MFSD1_uc003fcn.1_Intron|MFSD1_uc011bow.1_Intron|MFSD1_uc011box.1_Intron	NM_022736	NP_073573			major facilitator superfamily domain containing						transmembrane transport	integral to membrane					0			Lung(72;0.00372)|LUSC - Lung squamous cell carcinoma(72;0.00523)															---	---	---	---
IFT80	57560	broad.mit.edu	37	3	160018920	160018920	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160018920delA	uc011boy.1	-						IFT80_uc003fda.2_Intron|IFT80_uc003fdb.1_Intron|IFT80_uc003fdd.1_Intron|IFT80_uc003fde.1_Intron	NM_020800	NP_065851			WD repeat domain 56							cilium axoneme|microtubule basal body				ovary(1)	1			Lung(72;0.00334)|LUSC - Lung squamous cell carcinoma(72;0.00523)															---	---	---	---
PHC3	80012	broad.mit.edu	37	3	169847493	169847495	+	Intron	DEL	ATT	-	-	rs79158343		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169847493_169847495delATT	uc010hws.1	-						PHC3_uc003fgl.2_Intron|PHC3_uc011bpq.1_Intron|PHC3_uc011bpr.1_Intron	NM_024947	NP_079223			polyhomeotic like 3						multicellular organismal development	PcG protein complex	DNA binding|zinc ion binding			ovary(1)|central_nervous_system(1)	2	all_cancers(22;2.67e-22)|all_epithelial(15;4.73e-27)|all_lung(20;6.31e-17)|Lung NSC(18;2.61e-16)|Ovarian(172;0.000337)|Breast(254;0.169)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.0655)															---	---	---	---
PIK3CA	5290	broad.mit.edu	37	3	178917363	178917364	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:178917363_178917364insT	uc003fjk.2	+							NM_006218	NP_006209			phosphoinositide-3-kinase, catalytic, alpha						epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|platelet activation|T cell costimulation|T cell receptor signaling pathway		1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity			breast(1564)|large_intestine(776)|endometrium(246)|urinary_tract(195)|ovary(141)|skin(112)|stomach(98)|thyroid(77)|central_nervous_system(69)|lung(65)|upper_aerodigestive_tract(58)|haematopoietic_and_lymphoid_tissue(27)|cervix(25)|biliary_tract(22)|liver(20)|oesophagus(17)|pancreas(11)|penis(8)|pituitary(8)|autonomic_ganglia(4)|prostate(3)|kidney(2)|meninges(1)|eye(1)|NS(1)|soft_tissue(1)|bone(1)	3553	all_cancers(143;1.19e-17)|Ovarian(172;0.00769)|Breast(254;0.155)		OV - Ovarian serous cystadenocarcinoma(80;9.59e-28)|GBM - Glioblastoma multiforme(14;0.003)|BRCA - Breast invasive adenocarcinoma(182;0.0282)				57	Mis		colorectal|gastric|gliobastoma|breast					HNSCC(19;0.045)|TSP Lung(28;0.18)			---	---	---	---
EIF4G1	1981	broad.mit.edu	37	3	184046178	184046178	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184046178delA	uc003fnp.2	+						EIF4G1_uc003fnt.2_Intron|EIF4G1_uc003fnq.2_Intron|EIF4G1_uc003fnr.2_Intron|EIF4G1_uc010hxx.2_Intron|EIF4G1_uc003fns.2_Intron|EIF4G1_uc010hxy.2_Intron|EIF4G1_uc003fnv.3_Intron|EIF4G1_uc003fnu.3_Intron|EIF4G1_uc003fnw.2_Intron|EIF4G1_uc003fnx.2_Intron|EIF4G1_uc003fny.3_Intron|EIF4G1_uc003foa.2_5'Flank	NM_198241	NP_937884			eukaryotic translation initiation factor 4						insulin receptor signaling pathway|interspecies interaction between organisms|nuclear-transcribed mRNA poly(A) tail shortening|regulation of translational initiation	cytosol|eukaryotic translation initiation factor 4F complex	protein binding|translation initiation factor activity			lung(2)|ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	all_cancers(143;1.06e-10)|Ovarian(172;0.0339)		Epithelial(37;1.53e-33)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)															---	---	---	---
TBCCD1	55171	broad.mit.edu	37	3	186268857	186268857	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186268857delT	uc003fqg.2	-						TBCCD1_uc011bry.1_Intron|TBCCD1_uc003fqh.2_Intron	NM_018138	NP_060608			TBCC domain containing 1						cell morphogenesis|maintenance of centrosome location|maintenance of Golgi location|regulation of cell migration|regulation of cell shape	spindle pole centrosome	binding			large_intestine(1)|ovary(1)	2	all_cancers(143;3.75e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;4.3e-21)	GBM - Glioblastoma multiforme(93;0.0474)														---	---	---	---
AHSG	197	broad.mit.edu	37	3	186337591	186337591	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186337591delG	uc003fqk.3	+						AHSG_uc003fql.3_Intron|AHSG_uc003fqm.3_Intron|AHSG_uc010hyp.2_Intron	NM_001622	NP_001613			alpha-2-HS-glycoprotein						acute-phase response|negative regulation of bone mineralization|negative regulation of insulin receptor signaling pathway|pinocytosis|positive regulation of phagocytosis|regulation of inflammatory response|skeletal system development	extracellular space	cysteine-type endopeptidase inhibitor activity|protein binding				0	all_cancers(143;3.64e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;3.27e-20)	GBM - Glioblastoma multiforme(93;0.0463)														---	---	---	---
Unknown	0	broad.mit.edu	37	3	187141216	187141216	+	IGR	DEL	A	-	-	rs80024997		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:187141216delA								RTP4 (51849 upstream) : SST (245480 downstream)																																			---	---	---	---
RTP2	344892	broad.mit.edu	37	3	187416873	187416873	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:187416873delA	uc003fro.1	-							NM_001004312	NP_001004312			receptor transporting protein 2						protein insertion into membrane	cell surface|integral to membrane|plasma membrane	olfactory receptor binding				0	all_cancers(143;4.06e-12)|Ovarian(172;0.0418)		OV - Ovarian serous cystadenocarcinoma(80;1.76e-18)	GBM - Glioblastoma multiforme(93;0.0515)														---	---	---	---
PCYT1A	5130	broad.mit.edu	37	3	195984819	195984820	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195984819_195984820delAA	uc003fwg.2	-						PCYT1A_uc003fwh.2_Intron	NM_005017	NP_005008			choline phosphate cytidylyltransferase 1 alpha							cytosol|soluble fraction	choline-phosphate cytidylyltransferase activity				0	all_cancers(143;1.19e-08)|Ovarian(172;0.0634)|Breast(254;0.206)		Epithelial(36;1.28e-24)|all cancers(36;1.01e-22)|OV - Ovarian serous cystadenocarcinoma(49;3.88e-19)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.00259)	Choline(DB00122)													---	---	---	---
UBXN7	26043	broad.mit.edu	37	3	196118944	196118944	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196118944delA	uc003fwm.3	-						UBXN7_uc003fwn.3_Intron|UBXN7_uc010iae.2_Intron	NM_015562	NP_056377			UBX domain containing 7								protein binding			ovary(2)|pancreas(1)	3																		---	---	---	---
LMLN	89782	broad.mit.edu	37	3	197702144	197702144	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:197702144delT	uc011buo.1	+						LMLN_uc003fyt.2_Intron|LMLN_uc010iar.2_Intron|LMLN_uc010ias.2_Intron|LMLN_uc003fyu.2_Intron	NM_033029	NP_149018			leishmanolysin-like isoform 2						cell adhesion|cell division|mitosis|proteolysis	cytoplasm|membrane	metalloendopeptidase activity|zinc ion binding			skin(1)	1	all_cancers(143;1.15e-09)|Ovarian(172;0.0418)|Breast(254;0.0976)	Lung NSC(153;0.132)	Epithelial(36;9.84e-24)|all cancers(36;3.18e-22)|OV - Ovarian serous cystadenocarcinoma(49;5.35e-19)|LUSC - Lung squamous cell carcinoma(58;6.94e-07)|Lung(62;9.92e-07)	GBM - Glioblastoma multiforme(93;0.111)														---	---	---	---
PDE6B	5158	broad.mit.edu	37	4	650964	650964	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:650964delC	uc003gap.2	+						PDE6B_uc003gao.3_Intron|PDE6B_uc011buy.1_Intron|uc003gaq.1_5'Flank	NM_000283	NP_000274			phosphodiesterase 6B isoform 1						cytosolic calcium ion homeostasis|GMP metabolic process|phototransduction, visible light|platelet activation|visual perception	cytosol|membrane	3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding				0																		---	---	---	---
NAT8L	339983	broad.mit.edu	37	4	2065876	2065876	+	3'UTR	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:2065876delC	uc003geq.1	+	3						NM_178557	NP_848652			N-acetyltransferase 8-like (GCN5-related,							integral to membrane|microsome|mitochondrial membrane|rough endoplasmic reticulum membrane	aspartate N-acetyltransferase activity				0			OV - Ovarian serous cystadenocarcinoma(23;0.0315)															---	---	---	---
BOD1L	259282	broad.mit.edu	37	4	13582681	13582681	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:13582681delA	uc003gmz.1	-							NM_148894	NP_683692			biorientation of chromosomes in cell division								DNA binding			ovary(5)|breast(1)	6																		---	---	---	---
PROM1	8842	broad.mit.edu	37	4	16040629	16040629	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:16040629delA	uc003goo.2	-						PROM1_uc003gor.2_Intron|PROM1_uc003gos.2_Intron|PROM1_uc003got.2_Intron|PROM1_uc003gou.2_Intron|PROM1_uc003gop.2_Intron|PROM1_uc003goq.3_Intron|PROM1_uc010iec.1_Intron	NM_006017	NP_006008			prominin 1 isoform 1						camera-type eye photoreceptor cell differentiation|photoreceptor cell maintenance|retina layer formation	apical plasma membrane|cell surface|integral to plasma membrane|microvillus membrane|photoreceptor outer segment membrane|plasma membrane	beta-actinin binding|cadherin binding			ovary(3)|upper_aerodigestive_tract(1)|lung(1)|kidney(1)|central_nervous_system(1)	7																		---	---	---	---
ARAP2	116984	broad.mit.edu	37	4	36230062	36230062	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:36230062delT	uc003gsq.1	-						ARAP2_uc003gsr.1_Intron	NM_015230	NP_056045			ArfGAP with RhoGAP domain, ankyrin repeat and PH						regulation of ARF GTPase activity|small GTPase mediated signal transduction	cytosol	ARF GTPase activator activity|phosphatidylinositol-3,4,5-trisphosphate binding|zinc ion binding			ovary(1)|pancreas(1)|skin(1)	3																		---	---	---	---
FAM114A1	92689	broad.mit.edu	37	4	38907017	38907018	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:38907017_38907018insT	uc003gtn.2	+						FAM114A1_uc011byh.1_Intron	NM_138389	NP_612398			hypothetical protein LOC92689							cytoplasm				ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	4	41763168	41763168	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:41763168delA								PHOX2B (12181 upstream) : TMEM33 (173969 downstream)																																			---	---	---	---
GUF1	60558	broad.mit.edu	37	4	44682662	44682662	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:44682662delT	uc003gww.3	+						GUF1_uc010ifz.1_Intron	NM_021927	NP_068746			GUF1 GTPase homolog						translation	mitochondrial inner membrane	GTP binding|GTPase activity			upper_aerodigestive_tract(1)	1																		---	---	---	---
CORIN	10699	broad.mit.edu	37	4	47695103	47695103	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47695103delA	uc003gxm.2	-						CORIN_uc011bzf.1_Intron|CORIN_uc011bzg.1_Intron|CORIN_uc011bzh.1_Intron|CORIN_uc011bzi.1_Intron|CORIN_uc003gxn.3_Intron	NM_006587	NP_006578			corin						peptide hormone processing|regulation of systemic arterial blood pressure by atrial natriuretic peptide	integral to membrane|plasma membrane	scavenger receptor activity|serine-type endopeptidase activity|serine-type exopeptidase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
NFXL1	152518	broad.mit.edu	37	4	47899965	47899965	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47899965delA	uc010igh.2	-						NFXL1_uc003gxp.2_Intron|NFXL1_uc003gxq.3_Intron|NFXL1_uc010igi.2_Intron	NM_152995	NP_694540			nuclear transcription factor, X-box binding-like							integral to membrane|nucleus	sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|lung(1)|skin(1)	3																		---	---	---	---
SPATA18	132671	broad.mit.edu	37	4	52926826	52926827	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:52926826_52926827delTT	uc003gzl.2	+						SPATA18_uc010igl.1_Intron|SPATA18_uc011bzq.1_Intron|SPATA18_uc003gzk.1_Intron	NM_145263	NP_660306			spermatogenesis associated 18 homolog						mitochondrial protein catabolic process|mitochondrion degradation by induced vacuole formation|response to DNA damage stimulus	mitochondrial outer membrane	protein binding			ovary(2)|skin(2)	4			GBM - Glioblastoma multiforme(4;1.77e-13)|LUSC - Lung squamous cell carcinoma(32;0.00204)															---	---	---	---
Unknown	0	broad.mit.edu	37	4	66084344	66084345	+	IGR	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:66084344_66084345delAA								TECRL (809166 upstream) : EPHA5 (100937 downstream)																																			---	---	---	---
UBA6	55236	broad.mit.edu	37	4	68547233	68547234	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:68547233_68547234delAA	uc003hdg.3	-						UBA6_uc003hdi.2_Intron|UBA6_uc003hdj.2_Intron	NM_018227	NP_060697			ubiquitin-activating enzyme E1-like 2						protein ubiquitination|ubiquitin-dependent protein catabolic process	cytoplasm	ATP binding|FAT10 activating enzyme activity|ligase activity|protein binding				0																		---	---	---	---
BTC	685	broad.mit.edu	37	4	75676091	75676091	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:75676091delT	uc003hig.2	-							NM_001729	NP_001720			betacellulin precursor						positive regulation of cell division|positive regulation of cell proliferation	extracellular space|integral to membrane|plasma membrane|soluble fraction	epidermal growth factor receptor binding|growth factor activity			central_nervous_system(1)|skin(1)	2			Lung(101;0.219)															---	---	---	---
FRAS1	80144	broad.mit.edu	37	4	79101922	79101922	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79101922delT	uc003hlb.2	+						FRAS1_uc003hkw.2_Intron	NM_025074	NP_079350			Fraser syndrome 1						cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5																		---	---	---	---
ENOPH1	58478	broad.mit.edu	37	4	83378359	83378359	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:83378359delA	uc003hmv.2	+						ENOPH1_uc003hmw.2_Intron|ENOPH1_uc003hmx.2_Intron	NM_021204	NP_067027			enolase-phosphatase 1						L-methionine salvage from methylthioadenosine	cytoplasm|nucleus	2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity|2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity|acireductone synthase activity|magnesium ion binding|phosphoglycolate phosphatase activity				0																		---	---	---	---
TMEM150C	441027	broad.mit.edu	37	4	83424090	83424091	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:83424090_83424091delAA	uc003hmy.1	-						TMEM150C_uc011ccj.1_Intron	NM_001080506	NP_001073975			transmembrane protein 150C							integral to membrane				ovary(1)	1																		---	---	---	---
WDFY3	23001	broad.mit.edu	37	4	85724310	85724310	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:85724310delT	uc003hpd.2	-							NM_014991	NP_055806			WD repeat and FYVE domain containing 3 isoform							cytoplasmic part|extrinsic to membrane|nuclear envelope	1-phosphatidylinositol binding|metal ion binding|protein binding			ovary(2)|central_nervous_system(1)	3		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;0.000808)														---	---	---	---
PDLIM5	10611	broad.mit.edu	37	4	95504022	95504022	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:95504022delT	uc003hti.2	+						PDLIM5_uc003htf.2_Intron|PDLIM5_uc003htg.2_Intron|PDLIM5_uc011cdx.1_Intron|PDLIM5_uc003hth.2_Intron|PDLIM5_uc003htj.2_Intron|PDLIM5_uc003htk.2_Intron|PDLIM5_uc011cdy.1_Intron|PDLIM5_uc003htl.2_5'Flank	NM_006457	NP_006448			PDZ and LIM domain 5 isoform a						regulation of dendritic spine morphogenesis|regulation of synaptogenesis	actin cytoskeleton|cell junction|cytosol|postsynaptic density|postsynaptic membrane|synaptosome	actin binding|actinin binding|protein kinase C binding|zinc ion binding			ovary(1)|skin(1)	2		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;1.84e-09)														---	---	---	---
NFKB1	4790	broad.mit.edu	37	4	103505709	103505709	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:103505709delT	uc011ceq.1	+						NFKB1_uc011cep.1_Intron|NFKB1_uc011cer.1_Intron	NM_003998	NP_003989			nuclear factor kappa-B, subunit 1 isoform 1						anti-apoptosis|apoptosis|cellular response to mechanical stimulus|inflammatory response|innate immune response|membrane protein intracellular domain proteolysis|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of calcidiol 1-monooxygenase activity|nerve growth factor receptor signaling pathway|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of NF-kappaB transcription factor activity|positive regulation of transcription, DNA-dependent|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway|transcription from RNA polymerase II promoter	cytosol|I-kappaB/NF-kappaB complex|mitochondrion|nucleoplasm	protein binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			ovary(2)|breast(2)|skin(1)	5		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;6.59e-08)	Dexamethasone(DB01234)|Pranlukast(DB01411)|Thalidomide(DB01041)													---	---	---	---
CFI	3426	broad.mit.edu	37	4	110667668	110667668	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:110667668delA	uc003hzr.3	-						CFI_uc003hzq.2_Intron|CFI_uc011cft.1_Intron|CFI_uc003hzs.3_Intron	NM_000204	NP_000195			complement factor I preproprotein						complement activation, classical pathway|innate immune response|proteolysis	extracellular space|membrane	scavenger receptor activity|serine-type endopeptidase activity				0		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.000331)														---	---	---	---
RRH	10692	broad.mit.edu	37	4	110763480	110763480	+	Intron	DEL	A	-	-	rs73838892	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:110763480delA	uc003hzv.2	+							NM_006583	NP_006574			peropsin						phototransduction|protein-chromophore linkage|visual perception	integral to plasma membrane	G-protein coupled receptor activity|photoreceptor activity			ovary(1)	1		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.00109)														---	---	---	---
ANK2	287	broad.mit.edu	37	4	114153295	114153295	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:114153295delT	uc003ibe.3	+						ANK2_uc003ibd.3_Intron|ANK2_uc003ibf.3_Intron|ANK2_uc003ibc.2_Intron|ANK2_uc011cgb.1_Intron	NM_001148	NP_001139			ankyrin 2 isoform 1						axon guidance|signal transduction	apical plasma membrane|basolateral plasma membrane|cytoskeleton|cytosol|sarcomere	protein binding|protein binding			central_nervous_system(7)|ovary(3)|large_intestine(2)|breast(1)|skin(1)	14		Ovarian(17;0.0448)|Hepatocellular(203;0.218)		OV - Ovarian serous cystadenocarcinoma(123;4.92e-05)														---	---	---	---
CEP170L	645455	broad.mit.edu	37	4	119436577	119436577	+	5'Flank	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:119436577delT	uc003icb.2	+							NR_003135				RecName: Full=Cep170-like protein;												0																		---	---	---	---
TNIP3	79931	broad.mit.edu	37	4	122071541	122071541	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:122071541delT	uc010ing.2	-						TNIP3_uc010inh.2_Intron|TNIP3_uc011cgj.1_Intron	NM_024873	NP_079149			TNFAIP3 interacting protein 3											ovary(1)	1																		---	---	---	---
EXOSC9	5393	broad.mit.edu	37	4	122728636	122728636	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:122728636delT	uc003iea.2	+						EXOSC9_uc003idz.2_Intron|EXOSC9_uc003ieb.2_Intron|EXOSC9_uc010inp.1_Intron	NM_005033	NP_005024			exosome component 9 isoform 2						exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay|immune response|nuclear mRNA surveillance|nuclear polyadenylation-dependent rRNA catabolic process|positive regulation of cell growth|rRNA processing	cytosol|nuclear exosome (RNase complex)|nucleolus|nucleolus|nucleus	3'-5'-exoribonuclease activity|AU-rich element binding|protein binding				0																		---	---	---	---
KIAA1109	84162	broad.mit.edu	37	4	123192151	123192151	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:123192151delT	uc003ieh.2	+						KIAA1109_uc003iel.1_Intron|KIAA1109_uc003iek.2_Intron	NM_015312	NP_056127			fragile site-associated protein						regulation of cell growth|regulation of epithelial cell differentiation	integral to membrane|nucleus				ovary(8)|skin(2)|pancreas(1)|central_nervous_system(1)	12																		---	---	---	---
KIAA1109	84162	broad.mit.edu	37	4	123202672	123202672	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:123202672delT	uc003ieh.2	+						KIAA1109_uc003iel.1_Intron	NM_015312	NP_056127			fragile site-associated protein						regulation of cell growth|regulation of epithelial cell differentiation	integral to membrane|nucleus				ovary(8)|skin(2)|pancreas(1)|central_nervous_system(1)	12																		---	---	---	---
MFSD8	256471	broad.mit.edu	37	4	128851730	128851731	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:128851730_128851731insA	uc003ifp.2	-						MFSD8_uc011cgu.1_Intron|MFSD8_uc011cgv.1_Intron|MFSD8_uc011cgw.1_Intron	NM_152778	NP_689991			major facilitator superfamily domain containing						cell death|transmembrane transport	integral to membrane|lysosomal membrane				ovary(1)|liver(1)	2																		---	---	---	---
SCLT1	132320	broad.mit.edu	37	4	129864050	129864050	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:129864050delA	uc003igp.2	-						SCLT1_uc003ign.2_Intron|SCLT1_uc003igo.2_Intron|SCLT1_uc003igq.2_Intron|SCLT1_uc010iob.1_Intron	NM_144643	NP_653244			sodium channel associated protein 1							centrosome				ovary(3)|lung(1)|central_nervous_system(1)	5																		---	---	---	---
CCRN4L	25819	broad.mit.edu	37	4	139964069	139964069	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:139964069delA	uc003ihl.2	+						CCRN4L_uc003ihk.1_Intron	NM_012118	NP_036250			CCR4 carbon catabolite repression 4-like						rhythmic process|transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding transcription factor activity			ovary(1)	1	all_hematologic(180;0.162)																	---	---	---	---
INPP4B	8821	broad.mit.edu	37	4	143043165	143043165	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:143043165delA	uc003iix.3	-						INPP4B_uc003iiw.3_Intron|INPP4B_uc011chm.1_Intron|INPP4B_uc011chn.1_Intron|INPP4B_uc011cho.1_Intron	NM_003866	NP_003857			inositol polyphosphate-4-phosphatase, type II,						signal transduction		phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity|phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity			ovary(1)|lung(1)	2	all_hematologic(180;0.158)																	---	---	---	---
LRBA	987	broad.mit.edu	37	4	151765372	151765372	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:151765372delA	uc010ipj.2	-						LRBA_uc003ilt.3_Intron|LRBA_uc003ilu.3_Intron	NM_006726	NP_006717			LPS-responsive vesicle trafficking, beach and							endoplasmic reticulum|Golgi apparatus|integral to membrane|lysosome|plasma membrane	protein binding			ovary(3)|breast(3)|skin(1)	7	all_hematologic(180;0.151)																	---	---	---	---
Unknown	0	broad.mit.edu	37	4	153018828	153018831	+	IGR	DEL	AGGA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:153018828_153018831delAGGA								PET112L (336682 upstream) : FBXW7 (223580 downstream)														p.?(1)																					---	---	---	---
TMEM192	201931	broad.mit.edu	37	4	166022124	166022131	+	Intron	DEL	TTTTTTTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:166022124_166022131delTTTTTTTT	uc003iqz.3	-							NM_001100389	NP_001093859			transmembrane protein 192							Golgi apparatus|integral to membrane|late endosome|lysosomal membrane|nucleus				skin(1)	1	all_hematologic(180;0.221)	Prostate(90;0.0959)|Melanoma(52;0.18)		GBM - Glioblastoma multiforme(119;0.0926)														---	---	---	---
ODZ3	55714	broad.mit.edu	37	4	183268148	183268149	+	Intron	INS	-	G	G	rs138363616	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:183268148_183268149insG	uc003ivd.1	+						ODZ3_uc010irv.1_Intron	NM_001080477	NP_001073946			odz, odd Oz/ten-m homolog 3						signal transduction	integral to membrane					0		all_lung(41;2.69e-14)|Lung NSC(41;1.92e-11)|Melanoma(52;1.74e-05)|Colorectal(36;0.0062)|Breast(14;0.00748)|all_hematologic(60;0.0162)|Renal(120;0.0246)|Hepatocellular(41;0.0268)|Prostate(90;0.0283)|all_neural(102;0.155)|Medulloblastoma(177;0.184)		all cancers(43;1.42e-24)|Epithelial(43;6.86e-23)|OV - Ovarian serous cystadenocarcinoma(60;2.16e-11)|Colorectal(24;9.75e-06)|STAD - Stomach adenocarcinoma(60;2.96e-05)|COAD - Colon adenocarcinoma(29;0.00103)|GBM - Glioblastoma multiforme(59;0.00462)|LUSC - Lung squamous cell carcinoma(40;0.0391)|READ - Rectum adenocarcinoma(43;0.0487)														---	---	---	---
WWC2	80014	broad.mit.edu	37	4	184207093	184207093	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:184207093delT	uc010irx.2	+						WWC2_uc003ivk.3_Intron|WWC2_uc003ivl.3_Intron|WWC2_uc010iry.2_Intron|WWC2_uc003ivn.3_Intron|WWC2_uc010irz.2_Intron|WWC2_uc003ivo.3_Intron	NM_024949	NP_079225			WW and C2 domain containing 2											ovary(2)|lung(1)	3		all_lung(41;5.28e-14)|Lung NSC(41;1.35e-13)|Colorectal(36;0.00681)|Hepatocellular(41;0.00886)|Renal(120;0.00992)|Prostate(90;0.0237)|all_hematologic(60;0.0592)|Esophageal squamous(56;0.179)|all_neural(102;0.202)		all cancers(43;3.38e-24)|Epithelial(43;1.4e-20)|OV - Ovarian serous cystadenocarcinoma(60;1.09e-09)|GBM - Glioblastoma multiforme(59;3.33e-05)|Colorectal(24;3.58e-05)|STAD - Stomach adenocarcinoma(60;4.21e-05)|COAD - Colon adenocarcinoma(29;0.000171)|LUSC - Lung squamous cell carcinoma(40;0.0145)|READ - Rectum adenocarcinoma(43;0.242)														---	---	---	---
FAT1	2195	broad.mit.edu	37	4	187530579	187530580	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187530579_187530580delTT	uc003izf.2	-							NM_005245	NP_005236			FAT tumor suppressor 1 precursor						actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12															HNSCC(5;0.00058)			---	---	---	---
SDHAP3	728609	broad.mit.edu	37	5	1593156	1593156	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:1593156delA	uc010itg.1	-						SDHAP3_uc011cme.1_Intron					Homo sapiens cDNA clone IMAGE:40127561.												0																		---	---	---	---
MARCH6	10299	broad.mit.edu	37	5	10415851	10415851	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:10415851delT	uc003jet.1	+						MARCH6_uc011cmu.1_Intron|MARCH6_uc003jeu.1_Intron|MARCH6_uc011cmv.1_Intron	NM_005885	NP_005876			membrane-associated ring finger (C3HC4) 6						protein K48-linked ubiquitination	integral to endoplasmic reticulum membrane	ubiquitin conjugating enzyme binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|breast(1)	2																		---	---	---	---
DNAH5	1767	broad.mit.edu	37	5	13708059	13708059	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:13708059delA	uc003jfd.2	-						DNAH5_uc003jfc.2_Intron	NM_001369	NP_001360			dynein, axonemal, heavy chain 5						microtubule-based movement	cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(14)|skin(13)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|pancreas(1)	31	Lung NSC(4;0.00476)													Kartagener_syndrome				---	---	---	---
DNAH5	1767	broad.mit.edu	37	5	13737196	13737196	+	Intron	DEL	T	-	-	rs79669609	byFrequency;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:13737196delT	uc003jfd.2	-						DNAH5_uc003jfc.2_Intron	NM_001369	NP_001360			dynein, axonemal, heavy chain 5						microtubule-based movement	cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(14)|skin(13)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|pancreas(1)	31	Lung NSC(4;0.00476)													Kartagener_syndrome				---	---	---	---
MYO10	4651	broad.mit.edu	37	5	16679957	16679958	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:16679957_16679958insA	uc003jft.3	-						MYO10_uc011cnb.1_Intron|MYO10_uc011cnc.1_Intron|MYO10_uc011cnd.1_Intron|MYO10_uc011cne.1_Intron|MYO10_uc010itx.2_Intron	NM_012334	NP_036466			myosin X						axon guidance|signal transduction	myosin complex	actin binding|ATP binding|motor activity			ovary(2)|pancreas(1)	3																		---	---	---	---
NPR3	4883	broad.mit.edu	37	5	32786466	32786466	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:32786466delT	uc003jhv.2	+	8					NPR3_uc011cnz.1_3'UTR|NPR3_uc003jhu.2_3'UTR|C5orf23_uc003jhw.1_5'Flank	NM_000908	NP_000899			natriuretic peptide receptor C/guanylate cyclase						osteoclast proliferation|positive regulation of urine volume|regulation of blood pressure|regulation of osteoblast proliferation|skeletal system development	integral to membrane	hormone binding|natriuretic peptide receptor activity			ovary(1)|central_nervous_system(1)	2					Nesiritide(DB04899)													---	---	---	---
RXFP3	51289	broad.mit.edu	37	5	33938339	33938339	+	3'UTR	DEL	G	-	-	rs3832336		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:33938339delG	uc003jic.1	+	1						NM_016568	NP_057652			relaxin/insulin-like family peptide receptor 3							integral to plasma membrane	N-formyl peptide receptor activity			upper_aerodigestive_tract(1)	1																		---	---	---	---
RAI14	26064	broad.mit.edu	37	5	34822965	34822965	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:34822965delT	uc003jir.2	+						RAI14_uc010iur.2_Intron|RAI14_uc011coj.1_Intron|RAI14_uc003jis.2_Intron|RAI14_uc003jit.2_Intron|RAI14_uc011cok.1_Intron	NM_015577	NP_056392			retinoic acid induced 14 isoform a							cell cortex|cytoskeleton	protein binding			ovary(1)	1	all_lung(31;0.000191)																	---	---	---	---
NIPBL	25836	broad.mit.edu	37	5	37045454	37045454	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37045454delA	uc003jkl.3	+						NIPBL_uc003jkk.3_Intron	NM_133433	NP_597677			delangin isoform A						brain development|cellular protein localization|cellular response to X-ray|cognition|developmental growth|ear morphogenesis|embryonic arm morphogenesis|embryonic digestive tract morphogenesis|external genitalia morphogenesis|eye morphogenesis|face morphogenesis|gall bladder development|maintenance of mitotic sister chromatid cohesion|metanephros development|negative regulation of transcription from RNA polymerase II promoter|outflow tract morphogenesis|positive regulation of histone deacetylation|regulation of developmental growth|regulation of embryonic development|regulation of hair cycle|response to DNA damage stimulus|sensory perception of sound|uterus morphogenesis	SMC loading complex	chromo shadow domain binding|histone deacetylase binding|protein C-terminus binding|protein N-terminus binding			ovary(4)|lung(2)|large_intestine(1)|breast(1)|kidney(1)	9	all_lung(31;0.000447)|Hepatocellular(1;0.108)		Epithelial(62;0.072)|COAD - Colon adenocarcinoma(61;0.14)|all cancers(62;0.191)|Colorectal(62;0.202)															---	---	---	---
C5orf42	65250	broad.mit.edu	37	5	37138697	37138697	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37138697delA	uc011cpa.1	-						C5orf42_uc003jkp.1_Intron|C5orf42_uc011coy.1_Intron|C5orf42_uc003jks.2_Intron|C5orf42_uc011coz.1_Intron	NM_023073	NP_075561			hypothetical protein LOC65250											ovary(4)|breast(2)|skin(1)	7	all_lung(31;0.000616)		COAD - Colon adenocarcinoma(61;0.14)|Epithelial(62;0.177)|Colorectal(62;0.202)															---	---	---	---
NUP155	9631	broad.mit.edu	37	5	37342847	37342847	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37342847delT	uc003jku.1	-						NUP155_uc003jkt.1_Intron|NUP155_uc010iuz.1_Intron	NM_153485	NP_705618			nucleoporin 155kDa isoform 1						carbohydrate metabolic process|glucose transport|mRNA transport|nucleocytoplasmic transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	nuclear membrane|nuclear pore	protein binding|structural constituent of nuclear pore|transporter activity			ovary(1)	1	all_lung(31;0.000137)		COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---
FYB	2533	broad.mit.edu	37	5	39119141	39119141	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:39119141delA	uc003jls.2	-						FYB_uc003jlt.2_Intron|FYB_uc003jlu.2_Intron|FYB_uc011cpl.1_Intron	NM_199335	NP_955367			FYN binding protein (FYB-120/130) isoform 2						cell junction assembly|immune response|intracellular protein kinase cascade|NLS-bearing substrate import into nucleus|protein phosphorylation|T cell receptor signaling pathway	cytosol|nucleus	protein binding			ovary(2)	2	all_lung(31;0.000343)		Epithelial(62;0.235)															---	---	---	---
PAIP1	10605	broad.mit.edu	37	5	43535227	43535227	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:43535227delA	uc003job.2	-						PAIP1_uc003joa.2_Intron|PAIP1_uc010ivp.2_Intron|PAIP1_uc010ivo.2_Intron|PAIP1_uc003joc.2_Intron	NM_006451	NP_006442			poly(A) binding protein interacting protein 1						mRNA stabilization|nuclear-transcribed mRNA poly(A) tail shortening|translational initiation	cytosol	protein binding|RNA binding|translation activator activity			ovary(1)	1	Lung NSC(6;2.07e-05)																	---	---	---	---
PARP8	79668	broad.mit.edu	37	5	50092791	50092791	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:50092791delT	uc003jon.3	+						PARP8_uc011cpz.1_Intron|PARP8_uc003joo.2_Intron|PARP8_uc003jop.2_Intron	NM_024615	NP_078891			poly (ADP-ribose) polymerase family, member 8							intracellular	NAD+ ADP-ribosyltransferase activity			lung(3)|large_intestine(1)|ovary(1)	5		Lung NSC(810;0.0305)|Breast(144;0.222)																---	---	---	---
MOCS2	4338	broad.mit.edu	37	5	52404220	52404220	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:52404220delA	uc011cqf.1	-						MOCS2_uc003joz.2_Intron|uc003jpb.1_5'Flank	NM_176806	NP_789776			molybdopterin synthase small subunit MOCS2A						Mo-molybdopterin cofactor biosynthetic process|water-soluble vitamin metabolic process	cytosol|molybdopterin synthase complex	nucleotide binding				0		Lung NSC(810;3.08e-05)|Breast(144;0.0848)																---	---	---	---
Unknown	0	broad.mit.edu	37	5	56405309	56405316	+	IGR	DEL	GAAGGAAG	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:56405309_56405316delGAAGGAAG								MIER3 (137808 upstream) : GPBP1 (64459 downstream)																																			---	---	---	---
DEPDC1B	55789	broad.mit.edu	37	5	59940773	59940773	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:59940773delA	uc003jsh.2	-						DEPDC1B_uc011cqm.1_Intron|DEPDC1B_uc011cqn.1_Intron	NM_018369	NP_060839			DEP domain containing 1B isoform 1						regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(1)	1		Lung NSC(810;0.000214)|Prostate(74;0.0147)|Breast(144;0.0991)|Ovarian(174;0.17)																---	---	---	---
KIF2A	3796	broad.mit.edu	37	5	61648395	61648395	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:61648395delT	uc003jsy.3	+						KIF2A_uc003jsz.3_Intron|KIF2A_uc010iwp.2_Intron|KIF2A_uc003jsx.3_Intron|KIF2A_uc010iwq.2_Intron	NM_004520	NP_004511			kinesin heavy chain member 2 isoform 1						blood coagulation|cell differentiation|cell division|microtubule-based movement|mitotic prometaphase|mitotic spindle organization|nervous system development	centrosome|cytosol|microtubule|spindle pole	ATP binding|microtubule motor activity|protein binding				0		Lung NSC(810;8.94e-06)|Prostate(74;0.0132)|Ovarian(174;0.051)|Breast(144;0.077)		Lung(70;0.14)														---	---	---	---
PPWD1	23398	broad.mit.edu	37	5	64865346	64865346	+	Intron	DEL	A	-	-	rs149512	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:64865346delA	uc003jtv.3	+						PPWD1_uc011cqv.1_Intron|PPWD1_uc011cqw.1_Intron	NM_015342	NP_056157			peptidylprolyl isomerase domain and WD repeat						protein folding	catalytic step 2 spliceosome	peptidyl-prolyl cis-trans isomerase activity			ovary(1)	1		Lung NSC(167;7.21e-05)|Prostate(74;0.0174)|Ovarian(174;0.186)		Lung(70;0.00451)														---	---	---	---
C5orf44	80006	broad.mit.edu	37	5	64933654	64933654	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:64933654delT	uc003jtz.3	+						C5orf44_uc003jua.3_Intron|C5orf44_uc003juc.3_Intron|C5orf44_uc010iwv.2_Intron	NM_024941	NP_079217			hypothetical protein LOC80006 isoform 2											ovary(1)	1																		---	---	---	---
RAD17	5884	broad.mit.edu	37	5	68677967	68677967	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:68677967delT	uc003jwo.2	+						RAD17_uc003jwg.2_Intron|RAD17_uc003jwh.2_Intron|RAD17_uc003jwi.2_Intron|RAD17_uc003jwj.2_Intron|RAD17_uc003jwk.2_Intron|RAD17_uc003jwl.2_Intron|RAD17_uc003jwm.2_Intron|RAD17_uc003jwn.2_Intron	NM_133339	NP_579917			RAD17 homolog isoform 2						cell cycle|DNA damage checkpoint|DNA repair|DNA replication|DNA replication checkpoint|mitotic cell cycle checkpoint|negative regulation of DNA replication|regulation of phosphorylation	nucleoplasm	ATP binding|nucleoside-triphosphatase activity|protein binding				0		Lung NSC(167;5.19e-05)|Prostate(74;0.0143)|Ovarian(174;0.0448)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;9.36e-57)|Epithelial(20;1.21e-52)|all cancers(19;3.34e-48)|Lung(70;0.0183)									Direct_reversal_of_damage|Other_conserved_DNA_damage_response_genes					---	---	---	---
MARVELD2	153562	broad.mit.edu	37	5	68737186	68737186	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:68737186delA	uc003jwq.2	+						MARVELD2_uc010ixf.2_Intron|MARVELD2_uc003jwr.1_Intron|MARVELD2_uc003jws.1_Intron	NM_001038603	NP_001033692			MARVEL domain containing 2 isoform 1						sensory perception of sound	integral to membrane|tight junction					0		Lung NSC(167;0.000937)|Prostate(74;0.0187)|Ovarian(174;0.16)		OV - Ovarian serous cystadenocarcinoma(47;7.31e-57)|Epithelial(20;1.05e-52)|all cancers(19;2.63e-48)|Lung(70;0.0183)														---	---	---	---
BDP1	55814	broad.mit.edu	37	5	70828418	70828421	+	Intron	DEL	TTTG	-	-	rs34000891		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:70828418_70828421delTTTG	uc003kbp.1	+						BDP1_uc003kbo.2_Intron|BDP1_uc003kbq.1_Intron|BDP1_uc003kbr.1_Intron	NM_018429	NP_060899			transcription factor-like nuclear regulator						regulation of transcription, DNA-dependent|transcription from RNA polymerase III promoter	nucleoplasm	DNA binding			skin(2)	2		Lung NSC(167;0.000422)|Prostate(74;0.00815)|Ovarian(174;0.0176)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;5.28e-56)|Epithelial(20;2.31e-50)														---	---	---	---
COL4A3BP	10087	broad.mit.edu	37	5	74670244	74670244	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:74670244delA	uc011csu.1	-						COL4A3BP_uc003kds.2_Intron|COL4A3BP_uc003kdt.2_Intron	NM_005713	NP_005704			alpha 3 type IV collagen binding protein isoform						ER to Golgi ceramide transport|immune response	cytosol|endoplasmic reticulum membrane|Golgi apparatus	ceramide binding|phosphatidylinositol-4-phosphate binding|protein binding|protein kinase activity			skin(1)	1		all_lung(232;0.00101)|Lung NSC(167;0.00278)|Ovarian(174;0.0129)|Prostate(461;0.174)		OV - Ovarian serous cystadenocarcinoma(47;1e-53)														---	---	---	---
POLK	51426	broad.mit.edu	37	5	74872798	74872798	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:74872798delA	uc003kdw.2	+						POLK_uc003kdx.2_Intron|POLK_uc003kdy.2_Intron|POLK_uc003kea.2_Intron|POLK_uc003keb.2_Intron|POLK_uc010izq.2_Intron|POLK_uc003kec.2_Intron|POLK_uc010izr.2_Intron|POLK_uc010izs.2_Intron|POLK_uc003ked.2_Intron|POLK_uc003kee.2_Intron|POLK_uc003kef.2_Intron	NM_016218	NP_057302			DNA-directed DNA polymerase kappa						DNA replication|nucleotide-excision repair, DNA gap filling	nucleus	damaged DNA binding|DNA-directed DNA polymerase activity|metal ion binding			ovary(2)|kidney(2)	4		all_lung(232;0.0131)|Lung NSC(167;0.0282)|Ovarian(174;0.0798)|Prostate(461;0.184)		OV - Ovarian serous cystadenocarcinoma(47;2.9e-54)|all cancers(79;1.27e-42)									DNA_polymerases_(catalytic_subunits)|Direct_reversal_of_damage					---	---	---	---
SV2C	22987	broad.mit.edu	37	5	75577223	75577225	+	Intron	DEL	AAA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:75577223_75577225delAAA	uc003kei.1	+							NM_014979	NP_055794			synaptic vesicle glycoprotein 2C						neurotransmitter transport	cell junction|integral to membrane|synaptic vesicle membrane	transmembrane transporter activity			skin(1)	1		all_lung(232;0.007)|Lung NSC(167;0.0148)|Ovarian(174;0.0798)|Prostate(461;0.184)		OV - Ovarian serous cystadenocarcinoma(47;1.16e-50)|all cancers(79;7.25e-40)														---	---	---	---
BHMT	635	broad.mit.edu	37	5	78421780	78421780	+	Intron	DEL	G	-	-	rs694290	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:78421780delG	uc003kfu.3	+						BHMT_uc011cti.1_Intron	NM_001713	NP_001704			betaine-homocysteine methyltransferase						protein methylation|regulation of homocysteine metabolic process	cytoplasm	betaine-homocysteine S-methyltransferase activity|homocysteine S-methyltransferase activity|zinc ion binding			ovary(1)	1		all_lung(232;0.00051)|Lung NSC(167;0.00131)|Ovarian(174;0.0261)|Prostate(461;0.191)		OV - Ovarian serous cystadenocarcinoma(54;1.88e-45)|Epithelial(54;8.07e-41)|all cancers(79;3.51e-36)	L-Methionine(DB00134)													---	---	---	---
JMY	133746	broad.mit.edu	37	5	78602365	78602365	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:78602365delA	uc003kfx.3	+						JMY_uc003kfw.1_Intron	NM_152405	NP_689618			junction-mediating and regulatory protein						'de novo' actin filament nucleation|actin polymerization-dependent cell motility|Arp2/3 complex-mediated actin nucleation|cell cycle arrest|DNA repair|induction of apoptosis|positive regulation of sequence-specific DNA binding transcription factor activity|regulation of transcription from RNA polymerase II promoter	cell leading edge|cytoplasm|cytoskeleton|nucleus	actin binding|transcription coactivator activity				0		all_lung(232;0.00051)|Lung NSC(167;0.00131)|Ovarian(174;0.0261)|Prostate(461;0.191)		OV - Ovarian serous cystadenocarcinoma(54;4.45e-45)|Epithelial(54;5.85e-40)|all cancers(79;2.89e-35)														---	---	---	---
HOMER1	9456	broad.mit.edu	37	5	78697992	78697994	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:78697992_78697994delTTT	uc003kfy.2	-						HOMER1_uc010jab.2_Intron|HOMER1_uc010jac.2_Intron|HOMER1_uc010jad.2_Intron	NM_004272	NP_004263			homer 1						activation of phospholipase C activity by metabotropic glutamate receptor signaling pathway|synaptic transmission	cell junction|integral to plasma membrane|postsynaptic density|postsynaptic membrane					0		Lung NSC(167;0.00131)|all_lung(232;0.00151)|Ovarian(174;0.0261)|Prostate(461;0.191)		OV - Ovarian serous cystadenocarcinoma(54;1.87e-44)|Epithelial(54;7.07e-41)|all cancers(79;5.5e-36)														---	---	---	---
ARRDC3	57561	broad.mit.edu	37	5	90674409	90674409	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90674409delT	uc003kjz.2	-						LOC100129716_uc003kka.3_5'Flank	NM_020801	NP_065852			arrestin domain containing 3						signal transduction	cytoplasm	protein binding			ovary(1)|breast(1)	2		all_cancers(142;2.22e-05)|all_epithelial(76;1.58e-07)|all_lung(232;0.000521)|Lung NSC(167;0.000548)|Ovarian(174;0.0798)|Colorectal(57;0.207)		OV - Ovarian serous cystadenocarcinoma(54;4.56e-30)|Epithelial(54;7.55e-26)|all cancers(79;3.63e-22)														---	---	---	---
CHD1	1105	broad.mit.edu	37	5	98228483	98228484	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:98228483_98228484delTT	uc003knf.2	-							NM_001270	NP_001261			chromodomain helicase DNA binding protein 1						regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	cytoplasm|nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|methylated histone residue binding			lung(2)|ovary(1)|breast(1)|pancreas(1)	5		all_cancers(142;5.36e-08)|all_epithelial(76;6.97e-11)|Lung NSC(167;0.000693)|Prostate(80;0.000986)|all_lung(232;0.00119)|Ovarian(225;0.024)|Colorectal(57;0.117)		COAD - Colon adenocarcinoma(37;0.0717)	Epirubicin(DB00445)													---	---	---	---
WDR36	134430	broad.mit.edu	37	5	110454591	110454591	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:110454591delA	uc003kpd.2	+						WDR36_uc010jbu.2_Intron	NM_139281	NP_644810			WD repeat domain 36						response to stimulus|rRNA processing|visual perception	small-subunit processome				ovary(1)|skin(1)	2		all_cancers(142;2.72e-05)|all_epithelial(76;4.4e-07)|Prostate(80;0.00955)|Lung NSC(167;0.0418)|Ovarian(225;0.0443)|Colorectal(57;0.0465)|all_lung(232;0.0508)|Breast(839;0.244)		OV - Ovarian serous cystadenocarcinoma(64;1.39e-08)|Epithelial(69;1.82e-07)|all cancers(49;2.04e-05)|COAD - Colon adenocarcinoma(37;0.111)														---	---	---	---
ATG12	9140	broad.mit.edu	37	5	115173167	115173167	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:115173167delA	uc003krh.2	-						ATG12_uc003kri.2_Intron|ATG12_uc003krj.2_Intron	NM_004707	NP_004698			APG12 autophagy 12-like						autophagic vacuole assembly|negative regulation of type I interferon production	pre-autophagosomal structure membrane	protein binding				0		all_cancers(142;0.00377)|all_epithelial(76;0.000129)|Prostate(80;0.0132)|Ovarian(225;0.0776)|Lung NSC(810;0.245)		OV - Ovarian serous cystadenocarcinoma(64;7.59e-08)|Epithelial(69;7.05e-07)|all cancers(49;3.11e-05)														---	---	---	---
COMMD10	51397	broad.mit.edu	37	5	115553612	115553612	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:115553612delA	uc003krt.1	+							NM_016144	NP_057228			COMM domain containing 10								protein binding			ovary(1)	1		all_cancers(142;0.0834)|all_epithelial(76;0.00314)|Prostate(80;0.0102)|Ovarian(225;0.232)		OV - Ovarian serous cystadenocarcinoma(64;4.3e-07)|Epithelial(69;8.06e-07)|all cancers(49;4.06e-05)														---	---	---	---
CSNK1G3	1456	broad.mit.edu	37	5	122930883	122930883	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:122930883delT	uc003ktm.2	+						CSNK1G3_uc003ktl.2_Intron|CSNK1G3_uc003ktn.2_Intron|CSNK1G3_uc003kto.2_Intron|CSNK1G3_uc011cwr.1_Intron|CSNK1G3_uc011cws.1_Intron|CSNK1G3_uc010jda.2_Intron	NM_004384	NP_004375			casein kinase 1, gamma 3 isoform 1						Wnt receptor signaling pathway	cytoplasm	ATP binding|protein serine/threonine kinase activity				0		all_cancers(142;0.0156)|Prostate(80;0.0322)|Lung NSC(810;0.245)	KIRC - Kidney renal clear cell carcinoma(527;0.165)|Kidney(363;0.229)	OV - Ovarian serous cystadenocarcinoma(64;0.000121)|Epithelial(69;0.000227)|all cancers(49;0.00176)														---	---	---	---
HSPA4	3308	broad.mit.edu	37	5	132405883	132405883	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:132405883delA	uc003kyj.2	+							NM_002154	NP_002145			heat shock 70kDa protein 4						cellular chaperone-mediated protein complex assembly|protein import into mitochondrial outer membrane|response to unfolded protein	cytoplasm|nucleus	ATP binding			lung(1)|breast(1)	2			KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---
BRD8	10902	broad.mit.edu	37	5	137476822	137476824	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137476822_137476824delTTT	uc003lcf.1	-						BRD8_uc003lcc.1_Intron|NME5_uc003lce.2_5'Flank	NM_139199	NP_631938			bromodomain containing 8 isoform 2						cell surface receptor linked signaling pathway|histone H2A acetylation|histone H4 acetylation|regulation of growth|regulation of transcription from RNA polymerase II promoter	mitochondrion|NuA4 histone acetyltransferase complex	sequence-specific DNA binding transcription factor activity|thyroid hormone receptor activity			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0109)															---	---	---	---
MATR3	9782	broad.mit.edu	37	5	138654561	138654562	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:138654561_138654562insA	uc003ldu.2	+						MATR3_uc010jfb.2_Intron|MATR3_uc003ldt.2_Intron|MATR3_uc003ldw.2_Intron|MATR3_uc003ldx.2_Intron|MATR3_uc010jfc.2_Intron|MATR3_uc003ldy.2_Intron|MATR3_uc011czb.1_Intron|MATR3_uc003ldz.2_Intron|MATR3_uc003lea.2_Intron|MATR3_uc003leb.2_Intron|MATR3_uc003lec.2_Intron	NM_199189	NP_954659			matrin 3							nuclear inner membrane|nuclear matrix	nucleotide binding|protein binding|RNA binding|structural molecule activity|zinc ion binding			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00325)															---	---	---	---
IK	3550	broad.mit.edu	37	5	140032872	140032875	+	Intron	DEL	TTTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140032872_140032875delTTTT	uc003lgq.2	+						IK_uc011czk.1_Intron	NM_006083	NP_006074			RED protein						cell-cell signaling|immune response	extracellular space|nucleus|soluble fraction				large_intestine(1)	1		all_hematologic(541;4.8e-07)|all_lung(500;0.000434)|Lung NSC(810;0.00161)|Breast(839;0.128)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
DIAPH1	1729	broad.mit.edu	37	5	140963624	140963625	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140963624_140963625delAA	uc003llb.3	-						DIAPH1_uc003llc.3_Intron	NM_005219	NP_005210			diaphanous 1 isoform 1						regulation of microtubule-based process|sensory perception of sound	cytoplasm|cytoskeleton|ruffle membrane	actin binding|receptor binding|Rho GTPase binding			skin(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
SH3RF2	153769	broad.mit.edu	37	5	145317353	145317353	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:145317353delT	uc003lnt.2	+						SH3RF2_uc011dbl.1_5'Flank	NM_152550	NP_689763			SH3 domain containing ring finger 2								ligase activity|protein phosphatase 1 binding|zinc ion binding			ovary(1)|skin(1)	2			KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)															---	---	---	---
STK32A	202374	broad.mit.edu	37	5	146730738	146730738	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:146730738delT	uc010jgn.1	+						STK32A_uc003lom.2_Intron|STK32A_uc011dbw.1_Intron	NM_001112724	NP_001106195			serine/threonine kinase 32A isoform 1								ATP binding|metal ion binding|protein serine/threonine kinase activity			lung(2)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
GRIA1	2890	broad.mit.edu	37	5	153174311	153174311	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:153174311delA	uc003lva.3	+						GRIA1_uc003luy.3_Intron|GRIA1_uc003luz.3_Intron|GRIA1_uc011dcv.1_Intron|GRIA1_uc011dcw.1_Intron|GRIA1_uc011dcx.1_Intron|GRIA1_uc011dcy.1_Intron|GRIA1_uc011dcz.1_Intron	NM_001114183	NP_001107655			glutamate receptor, ionotropic, AMPA 1 isoform						synaptic transmission	alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex|cell junction|dendritic spine|endocytic vesicle membrane|endoplasmic reticulum membrane|neuronal cell body|postsynaptic density|postsynaptic membrane	alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|extracellular-glutamate-gated ion channel activity|kainate selective glutamate receptor activity|PDZ domain binding			ovary(4)|skin(2)	6		Medulloblastoma(196;0.0391)|all_neural(177;0.16)|all_hematologic(541;0.21)	Kidney(363;0.000173)|KIRC - Kidney renal clear cell carcinoma(527;0.000785)		Desflurane(DB01189)|Enflurane(DB00228)|Halothane(DB01159)|Isoflurane(DB00753)|L-Glutamic Acid(DB00142)|Methoxyflurane(DB01028)|Sevoflurane(DB01236)													---	---	---	---
Unknown	0	broad.mit.edu	37	5	154872934	154872934	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:154872934delA								KIF4B (475249 upstream) : SGCD (262129 downstream)																																			---	---	---	---
GABRP	2568	broad.mit.edu	37	5	170221218	170221219	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:170221218_170221219insT	uc003mau.2	+						GABRP_uc011dev.1_Intron	NM_014211	NP_055026			gamma-aminobutyric acid (GABA) A receptor, pi							cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			breast(1)	1	Renal(175;0.000159)|Lung NSC(126;0.0122)|all_lung(126;0.0193)	Medulloblastoma(196;0.0109)|all_neural(177;0.0298)	Kidney(164;7.24e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000516)															---	---	---	---
LMAN2	10960	broad.mit.edu	37	5	176773463	176773463	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176773463delT	uc003mge.2	-						LMAN2_uc003mgd.2_Intron	NM_006816	NP_006807			lectin, mannose-binding 2 precursor						protein transport	endoplasmic reticulum membrane|ER-Golgi intermediate compartment membrane|Golgi membrane|integral to membrane	metal ion binding|sugar binding				0	all_cancers(89;2.04e-05)|Renal(175;0.000269)|Lung NSC(126;0.000832)|all_lung(126;0.00152)	all_neural(177;0.00802)|Medulloblastoma(196;0.0145)|all_hematologic(541;0.248)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
GFPT2	9945	broad.mit.edu	37	5	179751635	179751635	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:179751635delA	uc003mlw.1	-							NM_005110	NP_005101			glutamine-fructose-6-phosphate transaminase 2						dolichol-linked oligosaccharide biosynthetic process|energy reserve metabolic process|fructose 6-phosphate metabolic process|glutamine metabolic process|post-translational protein modification|protein N-linked glycosylation via asparagine|UDP-N-acetylglucosamine biosynthetic process	cytosol	glutamine-fructose-6-phosphate transaminase (isomerizing) activity|sugar binding			ovary(1)|skin(1)	2	all_cancers(89;4.97e-05)|all_epithelial(37;1.22e-05)|Renal(175;0.000269)|Lung NSC(126;0.00199)|all_lung(126;0.00351)|Breast(19;0.137)	Medulloblastoma(196;0.0392)|all_neural(177;0.0529)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)		L-Glutamine(DB00130)													---	---	---	---
SERPINB9	5272	broad.mit.edu	37	6	2896157	2896157	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:2896157delA	uc003mug.2	-						uc003mue.2_Intron	NM_004155	NP_004146			serpin peptidase inhibitor, clade B, member 9						anti-apoptosis|cellular response to estrogen stimulus|immune response|mast cell mediated immunity|regulation of proteolysis	cytosol|extracellular space|nucleus	caspase inhibitor activity|protease binding|serine-type endopeptidase inhibitor activity				0	Ovarian(93;0.0412)	all_hematologic(90;0.108)																---	---	---	---
Unknown	0	broad.mit.edu	37	6	3222230	3222231	+	5'Flank	INS	-	C	C	rs143261088		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:3222230_3222231insC	uc011dhu.1	+											Synthetic construct Homo sapiens gateway clone IMAGE:100018300 3' read TUBB2A mRNA.																														---	---	---	---
FARS2	10667	broad.mit.edu	37	6	5610545	5610546	+	Intron	DEL	AA	-	-	rs28433048		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:5610545_5610546delAA	uc010jnv.1	+						FARS2_uc003mwr.2_Intron	NM_006567	NP_006558			phenylalanyl-tRNA synthetase 2 precursor						phenylalanyl-tRNA aminoacylation|tRNA processing	mitochondrial matrix|soluble fraction	ATP binding|magnesium ion binding|phenylalanine-tRNA ligase activity|tRNA binding				0	Ovarian(93;0.11)	all_hematologic(90;0.0104)			L-Phenylalanine(DB00120)													---	---	---	---
GCNT2	2651	broad.mit.edu	37	6	10530192	10530192	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:10530192delA	uc010joo.2	+						GCNT2_uc010jol.2_Intron|GCNT2_uc010jom.2_Intron|GCNT2_uc010jop.2_Intron|GCNT2_uc003mza.2_Intron|GCNT2_uc003mzc.3_Intron|GCNT2_uc010jon.2_3'UTR	NM_145649	NP_663624			glucosaminyl (N-acetyl) transferase 2,							Golgi membrane|integral to membrane	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity			ovary(2)	2	Ovarian(93;0.107)|Breast(50;0.148)	all_hematologic(90;0.107)		KIRC - Kidney renal clear cell carcinoma(1;0.099)|Kidney(1;0.119)														---	---	---	---
NEDD9	4739	broad.mit.edu	37	6	11214314	11214314	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:11214314delA	uc003mzv.2	-						NEDD9_uc010joz.2_Intron|NEDD9_uc003mzw.3_Intron|NEDD9_uc003mzx.2_Intron	NM_006403	NP_006394			neural precursor cell expressed, developmentally						actin filament bundle assembly|cell adhesion|cell division|integrin-mediated signaling pathway|mitosis|regulation of growth	cell cortex|focal adhesion|Golgi apparatus|lamellipodium|nucleus	protein binding				0	Breast(50;0.0768)|Ovarian(93;0.152)	all_hematologic(90;0.135)	Epithelial(50;0.0647)|all cancers(50;0.179)															---	---	---	---
CDKAL1	54901	broad.mit.edu	37	6	20955922	20955922	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:20955922delT	uc003ndc.1	+						CDKAL1_uc003ndd.1_Intron|CDKAL1_uc003nde.1_Intron	NM_017774	NP_060244			CDK5 regulatory subunit associated protein						RNA modification	integral to membrane	4 iron, 4 sulfur cluster binding|metal ion binding|transferase activity			ovary(2)	2	all_epithelial(95;0.0708)|Breast(50;0.131)|Ovarian(93;0.227)		OV - Ovarian serous cystadenocarcinoma(7;0.0241)|all cancers(50;0.123)|Epithelial(50;0.248)															---	---	---	---
ZNF187	7741	broad.mit.edu	37	6	28243891	28243891	+	Intron	DEL	T	-	-	rs144467021	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28243891delT	uc011dld.1	+						ZNF187_uc011dlc.1_Intron|ZNF187_uc003nku.3_Intron|ZNF187_uc003nkw.3_Intron|ZNF187_uc011dle.1_Intron|ZNF187_uc011dlf.1_Intron|ZNF187_uc011dlg.1_Intron	NM_001111039	NP_001104509			zinc finger protein 187 isoform b						viral reproduction	nucleus	nucleic acid binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0																		---	---	---	---
GNL1	2794	broad.mit.edu	37	6	30523847	30523847	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30523847delC	uc003nqh.2	-						GNL1_uc011dmi.1_5'Flank|GNL1_uc011dmj.1_5'Flank|GNL1_uc011dmk.1_Intron|PRR3_uc003nqi.1_5'Flank|PRR3_uc003nqj.1_5'Flank	NM_005275	NP_005266			guanine nucleotide binding protein-like 1						response to DNA damage stimulus|signal transduction|T cell mediated immunity	extracellular space|intracellular	GTP binding|structural molecule activity			ovary(3)	3																		---	---	---	---
HLA-DQB1	3119	broad.mit.edu	37	6	32632888	32632888	+	Intron	DEL	G	-	-	rs71835881		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32632888delG	uc003obw.2	-						HLA-DQB1_uc010juc.1_5'Flank|HLA-DQB1_uc003obv.2_Intron|HLA-DQB1_uc011dqd.1_Intron|HLA-DQB1_uc011dqe.1_Intron	NM_002123	NP_002114			major histocompatibility complex, class II, DQ						antigen processing and presentation of peptide or polysaccharide antigen via MHC class II|interferon-gamma-mediated signaling pathway|T cell costimulation|T cell receptor signaling pathway	endoplasmic reticulum membrane|endosome membrane|Golgi apparatus|integral to membrane|lysosomal membrane|MHC class II protein complex	MHC class II receptor activity				0					Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)									Melanoma_Familial_Clustering_of|ACTH-independent_macronodular_adrenal_hyperplasia|T-cell_Lymphoma_(Cutaneous)__Familial_Clustering_of|Sj_gren_syndrome				---	---	---	---
C6orf106	64771	broad.mit.edu	37	6	34654280	34654281	+	Intron	INS	-	A	A	rs74753449		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34654280_34654281insA	uc003ojr.2	-						C6orf106_uc003ojs.2_Intron	NM_024294	NP_077270			chromosome 6 open reading frame 106 isoform a											skin(2)|ovary(1)	3																		---	---	---	---
CPNE5	57699	broad.mit.edu	37	6	36733014	36733014	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:36733014delG	uc003omr.1	-						CPNE5_uc003oms.1_Intron	NM_020939	NP_065990			copine V											skin(1)	1																		---	---	---	---
DNAH8	1769	broad.mit.edu	37	6	38819285	38819285	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38819285delA	uc003ooe.1	+							NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21																		---	---	---	---
DNAH8	1769	broad.mit.edu	37	6	38941356	38941356	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38941356delA	uc003ooe.1	+						DNAH8_uc003oog.1_Intron	NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21																		---	---	---	---
Unknown	0	broad.mit.edu	37	6	42521030	42521037	+	IGR	DEL	GAAGGAAG	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42521030_42521037delGAAGGAAG								TRERF1 (101165 upstream) : UBR2 (11021 downstream)																																			---	---	---	---
KIAA0240	23506	broad.mit.edu	37	6	42789978	42789978	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42789978delT	uc003osn.1	+						KIAA0240_uc003osm.1_Intron|KIAA0240_uc011duw.1_Intron|KIAA0240_uc003oso.1_Intron|KIAA0240_uc003osp.1_Intron	NM_015349	NP_056164			hypothetical protein LOC23506											ovary(1)	1	Colorectal(47;0.196)		Colorectal(64;0.00237)|COAD - Colon adenocarcinoma(64;0.00473)|all cancers(41;0.00524)|KIRC - Kidney renal clear cell carcinoma(15;0.02)|Kidney(15;0.0388)|OV - Ovarian serous cystadenocarcinoma(102;0.104)															---	---	---	---
TNFRSF21	27242	broad.mit.edu	37	6	47251477	47251478	+	Intron	DEL	AG	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47251477_47251478delAG	uc003oyv.2	-							NM_014452	NP_055267			tumor necrosis factor receptor superfamily,						cellular lipid metabolic process	cytoplasm|integral to membrane	protein binding|receptor activity				0			Lung(136;0.189)															---	---	---	---
CD2AP	23607	broad.mit.edu	37	6	47576839	47576839	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47576839delT	uc003oyw.2	+							NM_012120	NP_036252			CD2-associated protein						cell division|mitosis|protein complex assembly|signal transduction|substrate-dependent cell migration, cell extension	cytoplasm|filamentous actin|nucleolus|plasma membrane|ruffle	SH3 domain binding|structural constituent of cytoskeleton			ovary(1)|skin(1)	2			Lung(136;0.105)|LUSC - Lung squamous cell carcinoma(51;0.138)															---	---	---	---
CENPQ	55166	broad.mit.edu	37	6	49459995	49459995	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49459995delT	uc003ozh.1	+	9						NM_018132	NP_060602			centromere protein Q						CenH3-containing nucleosome assembly at centromere|mitotic prometaphase	chromosome, centromeric region|cytosol|nucleoplasm				ovary(2)	2	Lung NSC(77;0.0128)																	---	---	---	---
RIMS1	22999	broad.mit.edu	37	6	72892857	72892857	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:72892857delG	uc003pga.2	+						RIMS1_uc011dyb.1_Intron|RIMS1_uc003pgc.2_Intron|RIMS1_uc003pgb.3_Intron	NM_014989	NP_055804			regulating synaptic membrane exocytosis 1						calcium ion-dependent exocytosis|cellular membrane fusion|glutamate secretion|intracellular protein transport|protein complex assembly|regulated secretory pathway|response to stimulus|synaptic vesicle exocytosis|visual perception	cell junction|presynaptic membrane	metal ion binding|Rab GTPase binding			ovary(7)|pancreas(2)|breast(1)	10		all_epithelial(107;0.179)|all_hematologic(105;0.212)																---	---	---	---
DDX43	55510	broad.mit.edu	37	6	74115749	74115751	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:74115749_74115751delTTT	uc003pgw.2	+						DDX43_uc011dyn.1_Intron	NM_018665	NP_061135			DEAD (Asp-Glu-Ala-Asp) box polypeptide 43							intracellular	ATP binding|ATP-dependent RNA helicase activity|RNA binding			ovary(2)|upper_aerodigestive_tract(1)|skin(1)	4																		---	---	---	---
CD109	135228	broad.mit.edu	37	6	74472832	74472832	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:74472832delT	uc003php.2	+						CD109_uc010kaz.2_Intron|CD109_uc003phq.2_Intron|CD109_uc010kba.2_Intron	NM_133493	NP_598000			CD109 antigen isoform 1 precursor							anchored to membrane|extracellular space|plasma membrane	serine-type endopeptidase inhibitor activity			large_intestine(2)|ovary(2)	4																		---	---	---	---
BCKDHB	594	broad.mit.edu	37	6	81053717	81053719	+	Intron	DEL	TTG	-	-	rs142572622		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:81053717_81053719delTTG	uc003pjd.2	+						BCKDHB_uc003pje.2_3'UTR	NM_000056	NP_000047			branched chain keto acid dehydrogenase E1 beta						branched chain family amino acid catabolic process	mitochondrial alpha-ketoglutarate dehydrogenase complex	3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity|carboxy-lyase activity|protein binding				0		all_cancers(76;1.38e-05)|Acute lymphoblastic leukemia(125;1.15e-05)|all_hematologic(105;0.00118)|all_epithelial(107;0.0149)		BRCA - Breast invasive adenocarcinoma(397;0.0291)														---	---	---	---
ME1	4199	broad.mit.edu	37	6	84108027	84108027	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:84108027delA	uc003pjy.2	-						ME1_uc011dzb.1_Intron|ME1_uc011dzc.1_Intron	NM_002395	NP_002386			cytosolic malic enzyme 1						carbohydrate metabolic process|cellular lipid metabolic process|malate metabolic process|NADP biosynthetic process|response to carbohydrate stimulus|response to hormone stimulus	cytosol	ADP binding|electron carrier activity|malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activity|manganese ion binding|NAD binding|NADP binding			upper_aerodigestive_tract(1)|ovary(1)	2		all_cancers(76;1.28e-06)|Acute lymphoblastic leukemia(125;5.03e-07)|all_hematologic(105;0.000238)|all_epithelial(107;0.00218)		BRCA - Breast invasive adenocarcinoma(397;0.0641)	NADH(DB00157)													---	---	---	---
ZNF292	23036	broad.mit.edu	37	6	87926157	87926157	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:87926157delA	uc003plm.3	+						ZNF292_uc003pll.1_Intron	NM_015021	NP_055836			zinc finger protein 292						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(4)	4		all_cancers(76;3.82e-09)|Prostate(29;1.34e-10)|Acute lymphoblastic leukemia(125;2.17e-10)|all_hematologic(105;1.08e-06)|all_epithelial(107;5.31e-05)		BRCA - Breast invasive adenocarcinoma(108;0.0199)														---	---	---	---
RNGTT	8732	broad.mit.edu	37	6	89614282	89614282	+	Intron	DEL	A	-	-	rs113231405		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:89614282delA	uc003pmr.2	-						RNGTT_uc003pms.2_Intron|RNGTT_uc011dzu.1_Intron|RNGTT_uc003pmt.2_Intron	NM_003800	NP_003791			RNA guanylyltransferase and 5'-phosphatase						interspecies interaction between organisms|mRNA capping|transcription from RNA polymerase II promoter|viral reproduction	nucleoplasm	GTP binding|mRNA guanylyltransferase activity|polynucleotide 5'-phosphatase activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			upper_aerodigestive_tract(1)	1		all_cancers(76;4.07e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.49e-10)|all_hematologic(105;7.79e-07)|all_epithelial(107;6.86e-05)		BRCA - Breast invasive adenocarcinoma(108;0.151)														---	---	---	---
CASP8AP2	9994	broad.mit.edu	37	6	90583283	90583283	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90583283delT	uc003pnr.2	+						CASP8AP2_uc003pnt.2_Intron|CASP8AP2_uc011dzz.1_Intron	NM_001137667	NP_001131139			caspase 8 associated protein 2						cell cycle|cellular response to mechanical stimulus|induction of apoptosis via death domain receptors|regulation of transcription, DNA-dependent|signal transduction|transcription, DNA-dependent	cytoplasm|nucleus	caspase activator activity|death receptor binding|transcription corepressor activity			ovary(2)	2		all_cancers(76;3.64e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.45e-10)|all_hematologic(105;7.74e-07)|all_epithelial(107;4.69e-05)|Lung NSC(302;0.238)		BRCA - Breast invasive adenocarcinoma(108;0.0953)														---	---	---	---
CASP8AP2	9994	broad.mit.edu	37	6	90583372	90583372	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90583372delT	uc003pnr.2	+						CASP8AP2_uc003pnt.2_Intron|CASP8AP2_uc011dzz.1_Intron	NM_001137667	NP_001131139			caspase 8 associated protein 2						cell cycle|cellular response to mechanical stimulus|induction of apoptosis via death domain receptors|regulation of transcription, DNA-dependent|signal transduction|transcription, DNA-dependent	cytoplasm|nucleus	caspase activator activity|death receptor binding|transcription corepressor activity			ovary(2)	2		all_cancers(76;3.64e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.45e-10)|all_hematologic(105;7.74e-07)|all_epithelial(107;4.69e-05)|Lung NSC(302;0.238)		BRCA - Breast invasive adenocarcinoma(108;0.0953)														---	---	---	---
KLHL32	114792	broad.mit.edu	37	6	97532863	97532863	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:97532863delT	uc010kcm.1	+						KLHL32_uc003poy.2_Intron|KLHL32_uc011ead.1_Intron|KLHL32_uc003poz.2_Intron|KLHL32_uc011eae.1_Intron|KLHL32_uc003ppa.2_Intron	NM_052904	NP_443136			kelch-like 32											ovary(3)|skin(1)	4		all_cancers(76;1.19e-06)|Acute lymphoblastic leukemia(125;5.83e-10)|all_hematologic(75;3.67e-07)|all_epithelial(107;0.00778)|Colorectal(196;0.122)		BRCA - Breast invasive adenocarcinoma(108;0.0558)														---	---	---	---
ARMC2	84071	broad.mit.edu	37	6	109285993	109285993	+	Intron	DEL	A	-	-	rs77214837		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:109285993delA	uc003pss.3	+						ARMC2_uc011eao.1_Intron	NM_032131	NP_115507			armadillo repeat containing 2								binding				0		all_cancers(87;1.14e-07)|Acute lymphoblastic leukemia(125;2.3e-10)|all_hematologic(75;3.3e-08)|all_epithelial(87;0.000111)|Colorectal(196;0.03)|all_lung(197;0.11)		Epithelial(106;0.000197)|BRCA - Breast invasive adenocarcinoma(108;0.000236)|all cancers(137;0.000279)|OV - Ovarian serous cystadenocarcinoma(136;0.00434)														---	---	---	---
Unknown	0	broad.mit.edu	37	6	111246991	111246992	+	IGR	DEL	GT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:111246991_111246992delGT								AMD1 (30078 upstream) : GTF3C6 (32771 downstream)																																			---	---	---	---
KIAA1919	91749	broad.mit.edu	37	6	111587016	111587016	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:111587016delT	uc003puv.3	+							NM_153369	NP_699200			sodium-dependent glucose transporter 1						carbohydrate transport|sodium ion transport	apical plasma membrane|integral to membrane	symporter activity			ovary(3)	3		all_cancers(87;2.35e-05)|Acute lymphoblastic leukemia(125;2.13e-07)|all_hematologic(75;5.28e-06)|all_epithelial(87;0.00138)|Colorectal(196;0.0209)		OV - Ovarian serous cystadenocarcinoma(136;0.055)|all cancers(137;0.0871)|Epithelial(106;0.0884)														---	---	---	---
REV3L	5980	broad.mit.edu	37	6	111732770	111732770	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:111732770delA	uc003puy.3	-						REV3L_uc003pux.3_Intron|REV3L_uc003puz.3_Intron	NM_002912	NP_002903			DNA polymerase zeta						DNA-dependent DNA replication|translesion synthesis	nucleus|zeta DNA polymerase complex	DNA binding|DNA-directed DNA polymerase activity|metal ion binding|nucleotide binding			large_intestine(2)|ovary(2)|skin(2)	6		all_cancers(87;7.57e-06)|Acute lymphoblastic leukemia(125;2.46e-08)|all_hematologic(75;1.08e-06)|all_epithelial(87;0.00138)|Colorectal(196;0.021)		OV - Ovarian serous cystadenocarcinoma(136;0.0314)|Epithelial(106;0.057)|all cancers(137;0.0663)									DNA_polymerases_(catalytic_subunits)|Direct_reversal_of_damage					---	---	---	---
FYN	2534	broad.mit.edu	37	6	112021117	112021126	+	Intron	DEL	TTTTTTTTTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112021117_112021126delTTTTTTTTTT	uc003pvj.2	-						FYN_uc003pvi.2_Intron|FYN_uc003pvk.2_Intron|FYN_uc003pvh.2_Intron|FYN_uc010kdy.1_Intron	NM_002037	NP_002028			protein-tyrosine kinase fyn isoform a						axon guidance|calcium ion transport|feeding behavior|interspecies interaction between organisms|intracellular protein kinase cascade|learning|leukocyte migration|platelet activation|regulation of defense response to virus by virus|T cell costimulation|T cell receptor signaling pathway|viral reproduction	cytosol|endosome|plasma membrane	ATP binding|glycoprotein binding|identical protein binding|metal ion binding|non-membrane spanning protein tyrosine kinase activity			lung(5)|central_nervous_system(1)|skin(1)	7		all_cancers(87;1.37e-05)|Acute lymphoblastic leukemia(125;2.15e-07)|all_hematologic(75;5.28e-06)|all_epithelial(87;0.00125)|Colorectal(196;0.0211)		all cancers(137;0.0451)|OV - Ovarian serous cystadenocarcinoma(136;0.0476)|Epithelial(106;0.102)	Dasatinib(DB01254)													---	---	---	---
ROS1	6098	broad.mit.edu	37	6	117704316	117704316	+	Intron	DEL	G	-	-	rs4945582	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:117704316delG	uc003pxp.1	-						ROS1_uc011ebi.1_Intron|GOPC_uc003pxq.1_Intron	NM_002944	NP_002935			proto-oncogene c-ros-1 protein precursor						transmembrane receptor protein tyrosine kinase signaling pathway	membrane fraction|sodium:potassium-exchanging ATPase complex	ATP binding|transmembrane receptor protein tyrosine kinase activity			lung(8)|ovary(6)|central_nervous_system(3)|skin(3)|stomach(2)|breast(2)|large_intestine(1)	25		all_cancers(87;0.00846)|all_epithelial(87;0.0242)		GBM - Glioblastoma multiforme(226;0.0387)|OV - Ovarian serous cystadenocarcinoma(136;0.0954)|all cancers(137;0.137)				T	GOPC|ROS1	glioblastoma|NSCLC								---	---	---	---
C6orf170	221322	broad.mit.edu	37	6	121563198	121563198	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:121563198delA	uc003pyo.1	-						C6orf170_uc003pyq.1_Intron|C6orf170_uc003pyp.1_Intron	NM_152730	NP_689943			hypothetical protein LOC221322						multicellular organismal development	cilium|cytoplasm	Rab GTPase activator activity			central_nervous_system(2)|ovary(1)	3				GBM - Glioblastoma multiforme(226;0.00521)														---	---	---	---
C6orf170	221322	broad.mit.edu	37	6	121643100	121643100	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:121643100delT	uc003pyo.1	-						C6orf170_uc003pyq.1_Intron	NM_152730	NP_689943			hypothetical protein LOC221322						multicellular organismal development	cilium|cytoplasm	Rab GTPase activator activity			central_nervous_system(2)|ovary(1)	3				GBM - Glioblastoma multiforme(226;0.00521)														---	---	---	---
TRDN	10345	broad.mit.edu	37	6	123812250	123812250	+	Intron	DEL	A	-	-	rs5879684		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:123812250delA	uc003pzj.1	-						TRDN_uc003pzk.1_Intron|TRDN_uc003pzl.1_Intron|TRDN_uc010ken.2_Intron	NM_006073	NP_006064			triadin						muscle contraction	integral to membrane|plasma membrane|sarcoplasmic reticulum membrane	receptor binding			ovary(1)	1				GBM - Glioblastoma multiforme(226;0.184)														---	---	---	---
RNF217	154214	broad.mit.edu	37	6	125284072	125284072	+	5'UTR	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:125284072delC	uc003pzr.2	+	1					STL_uc003pzq.2_RNA					SubName: Full=IBR domain containing 1, isoform CRA_e; SubName: Full=cDNA FLJ16403 fis, clone UTERU2006568, highly similar to IBR domain-containing protein 1;						protein ubiquitination involved in ubiquitin-dependent protein catabolic process	integral to membrane	ubiquitin-protein ligase activity|zinc ion binding				0			LUSC - Lung squamous cell carcinoma(4;0.0263)|Lung(4;0.0828)	GBM - Glioblastoma multiforme(226;0.0162)														---	---	---	---
Unknown	0	broad.mit.edu	37	6	127683600	127683601	+	IGR	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:127683600_127683601delAA								ECHDC1 (18846 upstream) : C6orf174 (75951 downstream)																																			---	---	---	---
PTPRK	5796	broad.mit.edu	37	6	128718505	128718505	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:128718505delT	uc003qbk.2	-						PTPRK_uc003qbj.2_Intron|PTPRK_uc010kfc.2_Intron|PTPRK_uc011ebu.1_Intron|PTPRK_uc003qbl.1_Intron|PTPRK_uc011ebv.1_Intron|PTPRK_uc003qbm.3_Intron	NM_002844	NP_002835			protein tyrosine phosphatase, receptor type, K						cell migration|cellular response to reactive oxygen species|cellular response to UV|focal adhesion assembly|negative regulation of cell cycle|negative regulation of cell migration|negative regulation of keratinocyte proliferation|negative regulation of transcription, DNA-dependent|protein localization at cell surface|transforming growth factor beta receptor signaling pathway	adherens junction|cell surface|cell-cell junction|integral to plasma membrane|leading edge membrane	beta-catenin binding|gamma-catenin binding|protein kinase binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(3)|skin(2)|pancreas(1)|kidney(1)|central_nervous_system(1)	8				all cancers(137;0.0118)|GBM - Glioblastoma multiforme(226;0.0372)|OV - Ovarian serous cystadenocarcinoma(136;0.24)														---	---	---	---
EPB41L2	2037	broad.mit.edu	37	6	131199492	131199492	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:131199492delA	uc003qch.2	-						EPB41L2_uc003qce.1_Intron|EPB41L2_uc003qcf.1_Intron|EPB41L2_uc003qcg.1_Intron|EPB41L2_uc011eby.1_Intron|EPB41L2_uc003qci.2_Intron|EPB41L2_uc010kfk.2_Intron|EPB41L2_uc010kfl.1_Intron|EPB41L2_uc003qcj.1_5'Flank	NM_001431	NP_001422			erythrocyte membrane protein band 4.1-like 2						cortical actin cytoskeleton organization	extrinsic to membrane|plasma membrane|spectrin	actin binding|structural molecule activity			central_nervous_system(1)|skin(1)	2	Breast(56;0.0639)			OV - Ovarian serous cystadenocarcinoma(155;0.0271)|GBM - Glioblastoma multiforme(226;0.0355)														---	---	---	---
MAP3K5	4217	broad.mit.edu	37	6	136883493	136883493	+	Intron	DEL	T	-	-	rs11322947		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:136883493delT	uc003qhc.2	-						MAP3K5_uc011edj.1_Intron	NM_005923	NP_005914			mitogen-activated protein kinase kinase kinase						activation of JUN kinase activity|activation of MAPKK activity|cellular response to hydrogen peroxide|induction of apoptosis by extracellular signals|interspecies interaction between organisms		ATP binding|caspase activator activity|magnesium ion binding|MAP kinase kinase kinase activity|protein homodimerization activity|protein phosphatase binding			ovary(2)|skin(2)|lung(1)	5	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00137)|OV - Ovarian serous cystadenocarcinoma(155;0.00569)														---	---	---	---
UTRN	7402	broad.mit.edu	37	6	144796037	144796037	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144796037delA	uc003qkt.2	+						UTRN_uc010khq.1_Intron	NM_007124	NP_009055			utrophin						muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)														---	---	---	---
MTHFD1L	25902	broad.mit.edu	37	6	151413789	151413789	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151413789delT	uc003qob.2	+						MTHFD1L_uc003qoc.2_Intron	NM_015440	NP_056255			methylenetetrahydrofolate dehydrogenase (NADP+						folic acid-containing compound biosynthetic process|formate metabolic process|one-carbon metabolic process|tetrahydrofolate metabolic process	mitochondrion	ATP binding|formate-tetrahydrofolate ligase activity|protein homodimerization activity			ovary(3)|large_intestine(1)	4		Ovarian(120;0.128)		OV - Ovarian serous cystadenocarcinoma(155;8.7e-12)														---	---	---	---
ARID1B	57492	broad.mit.edu	37	6	157256774	157256774	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:157256774delT	uc003qqn.2	+						ARID1B_uc003qqo.2_Intron|ARID1B_uc003qqp.2_Intron|ARID1B_uc003qqq.1_Intron	NM_017519	NP_059989			AT rich interactive domain 1B (SWI1-like)						chromatin-mediated maintenance of transcription|nervous system development|transcription, DNA-dependent	SWI/SNF complex	DNA binding|protein binding|transcription coactivator activity			ovary(1)|breast(1)	2		Breast(66;0.000162)|Ovarian(120;0.0265)		OV - Ovarian serous cystadenocarcinoma(65;3.19e-17)|BRCA - Breast invasive adenocarcinoma(81;1.01e-05)														---	---	---	---
RPS6KA2	6196	broad.mit.edu	37	6	166995598	166995598	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:166995598delG	uc003qvb.1	-						RPS6KA2_uc003qvc.1_Intron|RPS6KA2_uc003qvd.1_Intron	NM_021135	NP_066958			ribosomal protein S6 kinase, 90kDa, polypeptide						axon guidance|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|stress-activated MAPK cascade|synaptic transmission|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			ovary(2)|lung(2)|skin(2)|large_intestine(1)|central_nervous_system(1)	8		Breast(66;2.04e-05)|Ovarian(120;0.0652)|Prostate(117;0.105)		OV - Ovarian serous cystadenocarcinoma(33;2.76e-18)|GBM - Glioblastoma multiforme(31;9.94e-06)|BRCA - Breast invasive adenocarcinoma(81;1.36e-05)														---	---	---	---
WDR27	253769	broad.mit.edu	37	6	170070554	170070554	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170070554delA	uc003qwx.2	-						WDR27_uc010kkw.1_Intron|WDR27_uc003qwy.2_Intron|WDR27_uc011egw.1_Intron|WDR27_uc010kkx.2_3'UTR					RecName: Full=WD repeat-containing protein 27;											pancreas(1)	1		Breast(66;1.53e-05)|Ovarian(120;0.216)		OV - Ovarian serous cystadenocarcinoma(33;6.48e-20)|BRCA - Breast invasive adenocarcinoma(81;3.56e-07)|GBM - Glioblastoma multiforme(31;0.00168)														---	---	---	---
PHF10	55274	broad.mit.edu	37	6	170104005	170104006	+	3'UTR	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170104005_170104006insA	uc011egy.1	-	12					WDR27_uc010kkw.1_5'Flank|WDR27_uc003qwx.2_5'Flank|WDR27_uc003qwy.2_5'Flank|WDR27_uc011egw.1_5'Flank|WDR27_uc010kkx.2_5'Flank|C6orf120_uc003qxb.2_3'UTR|PHF10_uc011egz.1_3'UTR	NM_018288	NP_060758			PHD finger protein 10 isoform a						nervous system development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	npBAF complex	zinc ion binding			urinary_tract(1)	1		Breast(66;5.08e-05)|Ovarian(120;0.208)		OV - Ovarian serous cystadenocarcinoma(33;1.4e-21)|BRCA - Breast invasive adenocarcinoma(81;1.4e-07)|GBM - Glioblastoma multiforme(31;0.00176)														---	---	---	---
C6orf70	55780	broad.mit.edu	37	6	170169938	170169938	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170169938delA	uc003qxg.1	+						C6orf70_uc011ehb.1_Intron|C6orf70_uc003qxh.1_Intron|C6orf70_uc010kky.1_Intron|C6orf70_uc003qxi.1_Intron	NM_018341	NP_060811			hypothetical protein LOC55780							integral to membrane				ovary(1)	1		Breast(66;5.08e-05)|Ovarian(120;0.208)		OV - Ovarian serous cystadenocarcinoma(33;1.2e-22)|BRCA - Breast invasive adenocarcinoma(81;1.49e-07)|GBM - Glioblastoma multiforme(31;0.00191)														---	---	---	---
Unknown	0	broad.mit.edu	37	7	4589343	4589343	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4589343delA								SDK1 (280714 upstream) : FOXK1 (94045 downstream)																																			---	---	---	---
PHF14	9678	broad.mit.edu	37	7	11021973	11021973	+	Intron	DEL	T	-	-	rs79565747		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:11021973delT	uc003sry.1	+						PHF14_uc011jxi.1_Intron|PHF14_uc003srz.2_Intron|PHF14_uc011jxj.1_Intron	NM_014660	NP_055475			PHD finger protein 14 isoform 2								zinc ion binding			kidney(2)|skin(1)	3				UCEC - Uterine corpus endometrioid carcinoma (126;0.205)														---	---	---	---
RAPGEF5	9771	broad.mit.edu	37	7	22330863	22330865	+	Intron	DEL	AAA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:22330863_22330865delAAA	uc003svg.2	-							NM_012294	NP_036426			Rap guanine nucleotide exchange factor (GEF) 5						nervous system development|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	nucleus	GTP-dependent protein binding|Rap guanyl-nucleotide exchange factor activity			ovary(1)	1																		---	---	---	---
SKAP2	8935	broad.mit.edu	37	7	26764976	26764977	+	Intron	INS	-	AC	AC	rs112271894		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:26764976_26764977insAC	uc003syc.2	-						SKAP2_uc011jzi.1_Intron|SKAP2_uc011jzj.1_Intron	NM_003930	NP_003921			src kinase associated phosphoprotein 2						B cell activation|cell junction assembly|protein complex assembly|signal transduction	cytosol|plasma membrane	SH3/SH2 adaptor activity			pancreas(1)	1																		---	---	---	---
GARS	2617	broad.mit.edu	37	7	30662267	30662267	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30662267delT	uc003tbm.2	+							NM_002047	NP_002038			glycyl-tRNA synthetase						cell death|diadenosine tetraphosphate biosynthetic process|glycyl-tRNA aminoacylation	cytosol|mitochondrial matrix|soluble fraction	ATP binding|glycine-tRNA ligase activity|protein dimerization activity			ovary(1)	1					Glycine(DB00145)													---	---	---	---
CRHR2	1395	broad.mit.edu	37	7	30694783	30694783	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30694783delG	uc003tbn.2	-						CRHR2_uc010kvw.1_Intron|CRHR2_uc010kvx.1_Intron|CRHR2_uc010kvy.1_Intron|CRHR2_uc003tbo.2_Intron|CRHR2_uc003tbp.2_Intron	NM_001883	NP_001874			corticotropin releasing hormone receptor 2						G-protein signaling, coupled to cAMP nucleotide second messenger	integral to plasma membrane	corticotrophin-releasing factor receptor activity|protein binding			lung(2)|ovary(1)|skin(1)	4																		---	---	---	---
DPY19L2P1	554236	broad.mit.edu	37	7	35161005	35161005	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:35161005delA	uc003teq.1	-						DPY19L2P1_uc003tep.1_Intron|DPY19L2P1_uc010kwz.1_Intron					RecName: Full=Protein dpy-19 homolog 2-like 2; AltName: Full=Dpy-19-like protein 2 pseudogene 2;												0																		---	---	---	---
POU6F2	11281	broad.mit.edu	37	7	39246850	39246850	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:39246850delT	uc003thb.1	+						POU6F2_uc010kxo.2_Intron	NM_007252	NP_009183			POU class 6 homeobox 2 isoform 1						central nervous system development|ganglion mother cell fate determination|transcription from RNA polymerase II promoter|visual perception		sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(1)	1																		---	---	---	---
GLI3	2737	broad.mit.edu	37	7	42263043	42263043	+	Intron	DEL	A	-	-	rs35625471		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:42263043delA	uc011kbh.1	-							NM_000168	NP_000159			GLI-Kruppel family member GLI3						negative regulation of alpha-beta T cell differentiation|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of smoothened signaling pathway|negative regulation of transcription from RNA polymerase II promoter|negative thymic T cell selection|positive regulation of alpha-beta T cell differentiation|positive regulation of transcription from RNA polymerase II promoter|thymocyte apoptosis	cilium|cytosol|nucleolus	beta-catenin binding|histone acetyltransferase binding|histone deacetylase binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(11)|ovary(3)|large_intestine(2)|central_nervous_system(1)|kidney(1)|pancreas(1)	19														Greig_Cephalopolysyndactyly|Pallister-Hall_syndrome				---	---	---	---
ABCA13	154664	broad.mit.edu	37	7	48467345	48467345	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:48467345delT	uc003toq.2	+						ABCA13_uc010kys.1_Intron|ABCA13_uc010kyt.1_Intron	NM_152701	NP_689914			ATP binding cassette, sub-family A (ABC1),						transport	integral to membrane	ATP binding|ATPase activity			ovary(5)|central_nervous_system(4)|skin(1)	10																		---	---	---	---
PSPH	5723	broad.mit.edu	37	7	56082637	56082637	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:56082637delA	uc003trg.2	-						PSPH_uc003trh.2_Intron|PSPH_uc003tri.2_Intron|PSPH_uc003trj.2_Intron	NM_004577	NP_004568			phosphoserine phosphatase						L-serine biosynthetic process	cytoplasm	calcium ion binding|magnesium ion binding|phosphoserine phosphatase activity|protein homodimerization activity			ovary(1)|skin(1)	2	Breast(14;0.214)		Lung(13;0.00024)|LUSC - Lung squamous cell carcinoma(13;0.00099)															---	---	---	---
Unknown	0	broad.mit.edu	37	7	65150713	65150714	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:65150713_65150714insA	uc003tud.1	-						INTS4L2_uc003tue.2_RNA					Homo sapiens hypothetical LOC441242, mRNA (cDNA clone MGC:87648 IMAGE:5267764), complete cds.																														---	---	---	---
GTF2IRD2P1	401375	broad.mit.edu	37	7	72662349	72662350	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72662349_72662350delAA	uc003txs.1	-						FKBP6_uc003twz.2_Intron	NR_002164				RecName: Full=General transcription factor II-I repeat domain-containing protein 2B; AltName: Full=GTF2I repeat domain-containing protein 2B; AltName: Full=Transcription factor GTF2IRD2-beta;												0																		---	---	---	---
MLXIPL	51085	broad.mit.edu	37	7	73019902	73019903	+	Intron	INS	-	A	A	rs58590745	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:73019902_73019903insA	uc003tyn.1	-						MLXIPL_uc003tyk.1_Intron|MLXIPL_uc003tyl.1_Intron|MLXIPL_uc003tym.1_Intron|MLXIPL_uc003tyo.1_Intron|MLXIPL_uc003typ.1_Intron|MLXIPL_uc003tyq.1_Intron	NM_032951	NP_116569			Williams Beuren syndrome chromosome region 14						anatomical structure morphogenesis|energy reserve metabolic process|glucose mediated signaling pathway|intracellular protein kinase cascade|negative regulation of cell cycle arrest|negative regulation of oxidative phosphorylation|negative regulation of peptidyl-serine phosphorylation|positive regulation of cell proliferation|positive regulation of fatty acid biosynthetic process|positive regulation of glycolysis|positive regulation of transcription from RNA polymerase II promoter|triglyceride homeostasis	cytosol|transcription factor complex	carbohydrate response element binding|protein heterodimerization activity|sequence-specific DNA binding transcription factor activity|transcription factor binding			pancreas(1)	1		Lung NSC(55;0.0659)|all_lung(88;0.152)																---	---	---	---
GTF2I	2969	broad.mit.edu	37	7	74105135	74105135	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:74105135delT	uc003uau.2	+						GTF2I_uc003uat.2_Intron|GTF2I_uc003uav.2_Intron|GTF2I_uc003uaw.2_Intron|GTF2I_uc003uay.2_Intron|GTF2I_uc003uax.2_Intron	NM_032999	NP_127492			general transcription factor IIi isoform 1						negative regulation of angiogenesis|signal transduction|transcription initiation from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
GTF2IRD2B	389524	broad.mit.edu	37	7	74550946	74550946	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:74550946delT	uc003ubt.2	+						GTF2IRD2B_uc011kfl.1_Intron|GTF2IRD2B_uc010lcd.2_Intron|GTF2IRD2B_uc003ubu.2_Intron	NM_001003795	NP_001003795			GTF2I repeat domain containing 2B						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	7	79453277	79453278	+	IGR	INS	-	TG	TG	rs142106734	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:79453277_79453278insTG								MAGI2 (370387 upstream) : GNAI1 (310862 downstream)																																			---	---	---	---
SLC25A40	55972	broad.mit.edu	37	7	87485473	87485473	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87485473delA	uc003uje.2	-							NM_018843	NP_061331			mitochondrial carrier family protein						transmembrane transport	integral to membrane|mitochondrial inner membrane	binding			haematopoietic_and_lymphoid_tissue(1)	1	Esophageal squamous(14;0.00202)																	---	---	---	---
CDK14	5218	broad.mit.edu	37	7	90747307	90747308	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:90747307_90747308insT	uc003uky.2	+						CDK14_uc003ukz.1_Intron|CDK14_uc010les.1_Intron|CDK14_uc011khl.1_Intron	NM_012395	NP_036527			PFTAIRE protein kinase 1						cell division|G2/M transition of mitotic cell cycle|regulation of canonical Wnt receptor signaling pathway|Wnt receptor signaling pathway	cytoplasmic cyclin-dependent protein kinase holoenzyme complex|nucleus|plasma membrane	ATP binding|cyclin binding|cyclin-dependent protein kinase activity			lung(3)|ovary(1)	4																		---	---	---	---
COL1A2	1278	broad.mit.edu	37	7	94037076	94037077	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:94037076_94037077insA	uc003ung.1	+						COL1A2_uc011kib.1_Intron|COL1A2_uc010lfh.1_Intron	NM_000089	NP_000080			alpha 2 type I collagen precursor						axon guidance|blood vessel development|collagen fibril organization|leukocyte migration|odontogenesis|platelet activation|regulation of blood pressure|Rho protein signal transduction|skeletal system development|skin morphogenesis|transforming growth factor beta receptor signaling pathway	collagen type I|extracellular space|plasma membrane	extracellular matrix structural constituent|identical protein binding|platelet-derived growth factor binding|protein binding, bridging		COL1A2/PLAG1(3)	soft_tissue(3)|central_nervous_system(3)|ovary(2)|skin(1)	9	all_cancers(62;2.46e-09)|all_epithelial(64;2.7e-08)		STAD - Stomach adenocarcinoma(171;0.0031)		Collagenase(DB00048)										HNSCC(75;0.22)			---	---	---	---
CASD1	64921	broad.mit.edu	37	7	94176572	94176572	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:94176572delT	uc003uni.3	+						CASD1_uc003unj.3_Intron	NM_022900	NP_075051			CAS1 domain containing 1 precursor							integral to membrane				ovary(2)	2	all_cancers(62;6.71e-10)|all_epithelial(64;5e-09)|Lung NSC(181;0.188)|all_lung(186;0.215)		STAD - Stomach adenocarcinoma(171;0.0031)															---	---	---	---
Unknown	0	broad.mit.edu	37	7	98108146	98108152	+	IGR	DEL	CTGTCAC	-	-	rs112906827		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98108146_98108152delCTGTCAC								BAIAP2L1 (77719 upstream) : NPTX2 (138445 downstream)																																			---	---	---	---
PDAP1	11333	broad.mit.edu	37	7	98994127	98994128	+	3'UTR	DEL	CC	-	-	rs113663373		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98994127_98994128delCC	uc003uqe.2	-	6						NM_014891	NP_055706			PDGFA associated protein 1						cell proliferation|signal transduction						0	all_cancers(62;3.49e-09)|all_epithelial(64;2.57e-10)|Lung NSC(181;0.0053)|all_lung(186;0.00895)|Esophageal squamous(72;0.0166)		STAD - Stomach adenocarcinoma(171;0.215)		Becaplermin(DB00102)													---	---	---	---
PILRB	29990	broad.mit.edu	37	7	99943553	99943553	+	5'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99943553delT	uc003uuk.2	+	4					PILRB_uc003uul.2_5'UTR	NM_013440	NP_038468			paired immunoglobulin-like type 2 receptor beta						activation of transmembrane receptor protein tyrosine kinase activity	integral to plasma membrane	protein binding|receptor activity				0	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)																	---	---	---	---
ZAN	7455	broad.mit.edu	37	7	100383984	100383984	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100383984delA	uc003uwj.2	+						ZAN_uc003uwk.2_Intron|ZAN_uc003uwl.2_Intron|ZAN_uc010lhh.2_Intron|ZAN_uc010lhi.2_Intron|ZAN_uc011kke.1_Intron	NM_003386	NP_003377			zonadhesin isoform 3						binding of sperm to zona pellucida|cell-cell adhesion	integral to membrane|plasma membrane				ovary(4)|large_intestine(3)|central_nervous_system(2)|pancreas(2)	11	Lung NSC(181;0.041)|all_lung(186;0.0581)		STAD - Stomach adenocarcinoma(171;0.19)															---	---	---	---
DNAJC2	27000	broad.mit.edu	37	7	102978263	102978263	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:102978263delA	uc003vbo.2	-						DNAJC2_uc003vbn.2_Intron|DNAJC2_uc010lix.2_Intron|DNAJC2_uc003vbp.2_Intron|DNAJC2_uc003vbq.1_Intron|DNAJC2_uc003vbr.1_Intron	NM_014377	NP_055192			DnaJ (Hsp40) homolog, subfamily C, member 2						'de novo' cotranslational protein folding|chromatin modification|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|nuclear membrane	chromatin binding|DNA binding|histone binding|Hsp70 protein binding|ubiquitin binding			kidney(1)	1																		---	---	---	---
SLC26A3	1811	broad.mit.edu	37	7	107406419	107406419	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:107406419delT	uc003ver.2	-						SLC26A3_uc003ves.2_Intron	NM_000111	NP_000102			solute carrier family 26, member 3						excretion	integral to membrane|membrane fraction	inorganic anion exchanger activity|secondary active sulfate transmembrane transporter activity|sequence-specific DNA binding transcription factor activity|transcription cofactor activity			ovary(3)|skin(1)	4																		---	---	---	---
CTTNBP2	83992	broad.mit.edu	37	7	117400810	117400810	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117400810delA	uc003vjf.2	-							NM_033427	NP_219499			cortactin binding protein 2											ovary(4)|central_nervous_system(1)	5	Lung NSC(10;0.0018)|all_lung(10;0.002)			LUSC - Lung squamous cell carcinoma(290;0.133)														---	---	---	---
CADPS2	93664	broad.mit.edu	37	7	122194752	122194752	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:122194752delA	uc010lkp.2	-						CADPS2_uc003vkg.3_Intron|CADPS2_uc010lkq.2_Intron	NM_017954	NP_060424			Ca2+-dependent activator protein for secretion 2						exocytosis|protein transport	cell junction|cytoplasmic vesicle membrane|synapse	lipid binding|metal ion binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	7	128249447	128249447	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128249447delT								METTL2B (106470 upstream) : FLJ45340 (31848 downstream)																																			---	---	---	---
FAM71F2	346653	broad.mit.edu	37	7	128309607	128309608	+	5'Flank	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128309607_128309608delTT	uc003vnk.3	+						FAM71F2_uc010llm.1_5'Flank|FAM71F2_uc003vnl.2_5'Flank|FAM71F2_uc010lln.1_5'Flank	NM_001012454	NP_001012457			hypothetical protein LOC346653 isoform a												0																		---	---	---	---
FLNC	2318	broad.mit.edu	37	7	128470674	128470674	+	5'UTR	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128470674delC	uc003vnz.3	+	1					FLNC_uc003voa.3_5'UTR	NM_001458	NP_001449			gamma filamin isoform a						cell junction assembly	cytoskeleton|cytosol|plasma membrane|sarcomere	actin binding			breast(5)|large_intestine(3)|ovary(2)|central_nervous_system(1)|skin(1)	12																		---	---	---	---
COPG2	26958	broad.mit.edu	37	7	130147428	130147428	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:130147428delT	uc003vqh.1	-							NM_012133	NP_036265			coatomer protein complex, subunit gamma 2						intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat	protein binding|structural molecule activity				0	Melanoma(18;0.0435)																	---	---	---	---
AKR1B15	441282	broad.mit.edu	37	7	134252866	134252866	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:134252866delA	uc011kpr.1	+						AKR1B15_uc003vrt.2_Intron|AKR1B15_uc011kps.1_Intron	NM_001080538	NP_001074007			aldo-keto reductase family 1, member B15								oxidoreductase activity			ovary(1)	1																		---	---	---	---
UBN2	254048	broad.mit.edu	37	7	138953992	138953993	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138953992_138953993insT	uc011kqr.1	+						UBN2_uc003vuv.2_Intron	NM_173569	NP_775840			ubinuclein 2											ovary(1)|skin(1)	2																		---	---	---	---
JHDM1D	80853	broad.mit.edu	37	7	139878082	139878089	+	5'Flank	DEL	TCCCTCCC	-	-	rs142303955		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:139878082_139878089delTCCCTCCC	uc003vvm.2	-						LOC100134229_uc011kqy.1_RNA	NM_030647	NP_085150			jumonji C domain containing histone demethylase						midbrain development|transcription, DNA-dependent	nucleolus	histone demethylase activity (H3-K27 specific)|histone demethylase activity (H3-K36 specific)|histone demethylase activity (H3-K9 specific)|histone demethylase activity (H4-K20 specific)|iron ion binding|methylated histone residue binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|zinc ion binding			ovary(1)	1	Melanoma(164;0.0142)																	---	---	---	---
CSMD1	64478	broad.mit.edu	37	8	2799865	2799865	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:2799865delA	uc011kwk.1	-						CSMD1_uc011kwj.1_Intron|CSMD1_uc010lrg.2_Intron	NM_033225	NP_150094			CUB and Sushi multiple domains 1 precursor							integral to membrane				breast(20)|large_intestine(5)	25		all_cancers(1;5.7e-41)|all_epithelial(1;2.54e-36)|Lung NSC(1;7.54e-11)|all_lung(1;3.2e-10)|Hepatocellular(1;3.78e-05)|Breast(1;0.000196)|Myeloproliferative disorder(4;0.000374)|Esophageal squamous(1;0.0157)|Ovarian(12;0.091)|Renal(68;0.144)|Colorectal(14;0.234)		all cancers(1;5.03e-41)|Epithelial(1;4.78e-31)|Lung(1;1.14e-14)|LUSC - Lung squamous cell carcinoma(1;2.34e-14)|GBM - Glioblastoma multiforme(1;4.49e-10)|Colorectal(4;1.18e-07)|OV - Ovarian serous cystadenocarcinoma(1;3.2e-07)|BRCA - Breast invasive adenocarcinoma(1;6.17e-07)|COAD - Colon adenocarcinoma(4;0.000539)|READ - Rectum adenocarcinoma(4;0.00896)|Kidney(5;0.00957)|KIRC - Kidney renal clear cell carcinoma(5;0.0689)														---	---	---	---
Unknown	0	broad.mit.edu	37	8	9204989	9204992	+	IGR	DEL	GGAG	-	-	rs113896424	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:9204989_9204992delGGAG								PPP1R3B (195905 upstream) : TNKS (208453 downstream)																																			---	---	---	---
LONRF1	91694	broad.mit.edu	37	8	12598317	12598317	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:12598317delT	uc003wwd.1	-						LONRF1_uc010lsp.1_Intron	NM_152271	NP_689484			LON peptidase N-terminal domain and ring finger						proteolysis		ATP-dependent peptidase activity|zinc ion binding			ovary(1)	1				READ - Rectum adenocarcinoma(644;0.236)														---	---	---	---
MTUS1	57509	broad.mit.edu	37	8	17503685	17503686	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:17503685_17503686delAA	uc003wxv.2	-						MTUS1_uc003wxt.2_Intron|MTUS1_uc011kyg.1_Intron|MTUS1_uc010lsy.2_Intron|MTUS1_uc003wxw.2_Intron|MTUS1_uc003wxs.2_Intron	NM_001001924	NP_001001924			mitochondrial tumor suppressor 1 isoform 1							Golgi apparatus|microtubule|microtubule organizing center|mitochondrion|nucleus|plasma membrane|spindle				ovary(1)|skin(1)	2				Colorectal(111;0.0778)														---	---	---	---
DOK2	9046	broad.mit.edu	37	8	21771310	21771310	+	5'Flank	DEL	T	-	-	rs71544840		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:21771310delT	uc003wzy.1	-						DOK2_uc003wzx.1_5'Flank|DOK2_uc003wzz.1_5'Flank|DOK2_uc010lth.1_5'Flank	NM_003974	NP_003965			docking protein 2						blood coagulation|leukocyte migration	cytosol	identical protein binding|insulin receptor binding				0				Colorectal(74;0.0145)|COAD - Colon adenocarcinoma(73;0.0608)														---	---	---	---
ADAMDEC1	27299	broad.mit.edu	37	8	24242175	24242175	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:24242175delA	uc003xdz.2	+						ADAMDEC1_uc010lub.2_Intron|ADAMDEC1_uc011lab.1_Intron	NM_014479	NP_055294			ADAM-like, decysin 1 isoform 1						integrin-mediated signaling pathway|negative regulation of cell adhesion|proteolysis	extracellular region|integral to membrane	integrin binding|metalloendopeptidase activity|zinc ion binding			skin(2)	2		Prostate(55;0.0181)		Colorectal(74;0.016)|COAD - Colon adenocarcinoma(73;0.0646)|BRCA - Breast invasive adenocarcinoma(99;0.168)														---	---	---	---
PBK	55872	broad.mit.edu	37	8	27697882	27697882	+	5'Flank	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27697882delA	uc003xgi.2	-						PBK_uc011lap.1_5'Flank	NM_018492	NP_060962			PDZ binding kinase						mitosis		ATP binding|protein binding|protein serine/threonine kinase activity				0		Ovarian(32;0.000953)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0213)|KIRC - Kidney renal clear cell carcinoma(542;0.101)|Kidney(114;0.121)|Colorectal(74;0.141)														---	---	---	---
KIF13B	23303	broad.mit.edu	37	8	28950414	28950414	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:28950414delA	uc003xhh.3	-						KIF13B_uc011laz.1_Intron	NM_015254	NP_056069			kinesin family member 13B						microtubule-based movement|protein targeting|signal transduction|T cell activation	cytoplasm|microtubule	ATP binding|microtubule motor activity|protein kinase binding				0		Ovarian(32;0.000536)		KIRC - Kidney renal clear cell carcinoma(542;0.152)|Kidney(114;0.181)														---	---	---	---
NRG1	3084	broad.mit.edu	37	8	32620721	32620721	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:32620721delT	uc003xiv.2	+						NRG1_uc010lvo.2_Intron|NRG1_uc003xiu.2_Intron|NRG1_uc003xiw.2_Intron|NRG1_uc003xit.2_Intron|NRG1_uc010lvr.2_Intron|NRG1_uc010lvs.2_Intron|NRG1_uc010lvp.2_Intron|NRG1_uc010lvq.2_Intron|NRG1_uc011lbg.1_Intron|NRG1_uc011lbh.1_Intron|NRG1_uc003xja.2_Intron	NM_013964	NP_039258			neuregulin 1 isoform HRG-alpha						activation of transmembrane receptor protein tyrosine kinase activity|anti-apoptosis|cardiac muscle cell differentiation|cell communication|cell proliferation|cellular protein complex disassembly|embryo development|mammary gland development|negative regulation of cardiac muscle cell apoptosis|negative regulation of secretion|negative regulation of transcription, DNA-dependent|nervous system development|neural crest cell development|Notch signaling pathway|positive regulation of cardiac muscle cell proliferation|positive regulation of cell adhesion|positive regulation of cell growth|positive regulation of striated muscle cell differentiation|regulation of protein heterodimerization activity|regulation of protein homodimerization activity|transmembrane receptor protein tyrosine kinase signaling pathway|ventricular cardiac muscle cell differentiation|wound healing|wound healing	apical plasma membrane|extracellular region|extracellular space|integral to membrane|nucleus|plasma membrane	cytokine activity|ErbB-3 class receptor binding|growth factor activity|growth factor activity|protein binding|protein tyrosine kinase activator activity|receptor tyrosine kinase binding|transcription cofactor activity|transmembrane receptor protein tyrosine kinase activator activity				0		Breast(100;0.203)		KIRC - Kidney renal clear cell carcinoma(67;0.0768)|Kidney(114;0.0943)														---	---	---	---
WHSC1L1	54904	broad.mit.edu	37	8	38153187	38153188	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:38153187_38153188delTT	uc003xli.2	-						WHSC1L1_uc011lbm.1_Intron|WHSC1L1_uc010lwe.2_Intron	NM_023034	NP_075447			WHSC1L1 protein isoform long						cell differentiation|cell growth|regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome	histone-lysine N-methyltransferase activity|zinc ion binding			breast(1)	1	Colorectal(12;0.000442)|Esophageal squamous(3;0.0725)	all_lung(54;0.00787)|Lung NSC(58;0.0295)|Hepatocellular(245;0.065)	Epithelial(3;3.12e-43)|all cancers(3;1.72e-38)|BRCA - Breast invasive adenocarcinoma(5;2.84e-27)|LUSC - Lung squamous cell carcinoma(2;2.79e-25)|Lung(2;5.03e-23)|COAD - Colon adenocarcinoma(9;0.0511)					T	NUP98	AML								---	---	---	---
ADAM18	8749	broad.mit.edu	37	8	39525369	39525370	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:39525369_39525370insT	uc003xni.2	+						ADAM18_uc010lww.2_Intron|ADAM18_uc010lwx.2_Intron	NM_014237	NP_055052			a disintegrin and metalloprotease domain 18						cell differentiation|multicellular organismal development|proteolysis|spermatogenesis	integral to membrane|membrane fraction	metalloendopeptidase activity|zinc ion binding			central_nervous_system(2)|upper_aerodigestive_tract(1)|ovary(1)|kidney(1)|skin(1)	6		all_cancers(7;1.32e-05)|all_epithelial(6;3.08e-10)|all_lung(54;0.00187)|Hepatocellular(245;0.00745)|Lung NSC(58;0.00769)|Breast(189;0.0112)	LUSC - Lung squamous cell carcinoma(45;0.000199)															---	---	---	---
PRKDC	5591	broad.mit.edu	37	8	48849187	48849187	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:48849187delT	uc003xqi.2	-						PRKDC_uc003xqj.2_Intron|PRKDC_uc011ldh.1_Intron	NM_006904	NP_008835			protein kinase, DNA-activated, catalytic						cellular response to insulin stimulus|double-strand break repair via nonhomologous end joining|peptidyl-serine phosphorylation|positive regulation of transcription from RNA polymerase II promoter	DNA-dependent protein kinase-DNA ligase 4 complex|transcription factor complex	ATP binding|DNA binding|DNA-dependent protein kinase activity|transcription factor binding			lung(12)|central_nervous_system(9)|ovary(6)|skin(4)|large_intestine(3)	34		all_cancers(86;0.0336)|all_epithelial(80;0.00111)|Lung NSC(129;0.00363)|all_lung(136;0.00391)											NHEJ					---	---	---	---
TOX	9760	broad.mit.edu	37	8	59751015	59751015	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:59751015delT	uc003xtw.1	-							NM_014729	NP_055544			thymus high mobility group box protein TOX							nucleus	DNA binding			kidney(2)|lung(1)|skin(1)	4		all_cancers(86;0.165)|Myeloproliferative disorder(644;0.00452)|all_lung(136;0.036)|Lung NSC(129;0.0464)|all_epithelial(80;0.0607)																---	---	---	---
CHD7	55636	broad.mit.edu	37	8	61720893	61720893	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:61720893delT	uc003xue.2	+							NM_017780	NP_060250			chromodomain helicase DNA binding protein 7						central nervous system development|chromatin modification|cognition|cranial nerve development|face development|heart morphogenesis|in utero embryonic development|inner ear morphogenesis|nose development|palate development|regulation of growth hormone secretion|regulation of transcription, DNA-dependent|retina development in camera-type eye|skeletal system development|T cell differentiation|transcription, DNA-dependent	nucleus	ATP binding|chromatin binding|DNA binding|helicase activity	p.556_871dup(1)		ovary(4)|large_intestine(1)|central_nervous_system(1)|lung(1)|breast(1)|pancreas(1)	9		all_cancers(86;0.2)|all_lung(136;0.0402)|Lung NSC(129;0.0459)|all_epithelial(80;0.0477)	BRCA - Breast invasive adenocarcinoma(89;0.143)															---	---	---	---
ASPH	444	broad.mit.edu	37	8	62557196	62557196	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:62557196delA	uc003xuj.2	-						ASPH_uc011leg.1_Intron|ASPH_uc003xuo.2_Intron|ASPH_uc011leh.1_Intron|ASPH_uc003xul.2_Intron|ASPH_uc011lei.1_Intron|ASPH_uc011lej.1_Intron|ASPH_uc003xun.2_Intron|ASPH_uc011lek.1_Intron|ASPH_uc003xum.2_Intron	NM_004318	NP_004309			aspartate beta-hydroxylase isoform a						muscle contraction	integral to endoplasmic reticulum membrane	calcium ion binding|electron carrier activity|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|peptide-aspartate beta-dioxygenase activity|structural constituent of muscle			ovary(3)	3	Lung SC(2;0.153)	Lung NSC(129;0.0358)|all_lung(136;0.0654)|all_epithelial(80;0.101)			L-Aspartic Acid(DB00128)|Succinic acid(DB00139)													---	---	---	---
CSPP1	79848	broad.mit.edu	37	8	68066152	68066152	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:68066152delT	uc003xxi.2	+						CSPP1_uc003xxg.1_Intron|CSPP1_uc003xxh.1_Intron|CSPP1_uc003xxj.2_Intron|CSPP1_uc003xxk.2_Intron	NM_001077204	NP_001070672			centrosome spindle pole associated protein 1							centrosome|microtubule|spindle				ovary(3)|breast(2)	5	Breast(64;0.214)	Lung NSC(129;0.0908)|all_lung(136;0.152)	Epithelial(68;0.00145)|OV - Ovarian serous cystadenocarcinoma(28;0.00589)|all cancers(69;0.0069)|BRCA - Breast invasive adenocarcinoma(89;0.153)															---	---	---	---
TRAM1	23471	broad.mit.edu	37	8	71520608	71520609	+	5'Flank	DEL	GA	-	-	rs112550133		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:71520608_71520609delGA	uc003xyo.1	-						TRAM1_uc011lfc.1_5'UTR	NM_014294	NP_055109			translocation associated membrane protein 1						cotranslational protein targeting to membrane|transmembrane transport	endoplasmic reticulum membrane|integral to membrane	protein binding|receptor activity			ovary(1)	1			Epithelial(68;0.00679)|all cancers(69;0.0324)|OV - Ovarian serous cystadenocarcinoma(28;0.0509)															---	---	---	---
EYA1	2138	broad.mit.edu	37	8	72268761	72268761	+	5'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:72268761delA	uc003xys.3	-	1					EYA1_uc003xyr.3_5'UTR|EYA1_uc003xyt.3_5'UTR|EYA1_uc010lzf.2_5'UTR|EYA1_uc003xyu.2_Intron|EYA1_uc011lfe.1_Intron|EYA1_uc003xyv.2_Intron	NM_172058	NP_742055			eyes absent 1 isoform b						double-strand break repair|histone dephosphorylation|positive regulation of DNA repair|protein sumoylation|regulation of transcription, DNA-dependent|response to ionizing radiation|sensory perception of sound|transcription, DNA-dependent	cytoplasm|nucleus	metal ion binding|protein tyrosine phosphatase activity			ovary(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)	5	Breast(64;0.046)		Epithelial(68;0.0837)|all cancers(69;0.247)															---	---	---	---
FABP5	2171	broad.mit.edu	37	8	82196888	82196888	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:82196888delT	uc003yca.1	+	4						NM_001444	NP_001435			fatty acid binding protein 5						epidermis development	cytoplasm	fatty acid binding|protein binding|transporter activity				0	Lung NSC(7;3.57e-05)|all_lung(9;0.00011)		Epithelial(68;0.102)															---	---	---	---
CNGB3	54714	broad.mit.edu	37	8	87660266	87660266	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:87660266delT	uc003ydx.2	-						CNGB3_uc010maj.2_Intron	NM_019098	NP_061971			cyclic nucleotide gated channel beta 3						signal transduction|visual perception	integral to membrane	cGMP binding			ovary(2)|pancreas(1)	3																		---	---	---	---
OSGIN2	734	broad.mit.edu	37	8	90921779	90921780	+	Intron	DEL	TT	-	-	rs73696834	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:90921779_90921780delTT	uc003yeg.2	+						OSGIN2_uc003yeh.2_Intron	NM_004337	NP_004328			oxidative stress induced growth inhibitor family						germ cell development|meiosis						0			BRCA - Breast invasive adenocarcinoma(11;0.0344)															---	---	---	---
DECR1	1666	broad.mit.edu	37	8	91056917	91056917	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:91056917delT	uc003yek.1	+						DECR1_uc011lgc.1_Intron|DECR1_uc011lgd.1_Intron	NM_001359	NP_001350			2,4-dienoyl CoA reductase 1 precursor						fatty acid beta-oxidation|protein homotetramerization	mitochondrial matrix|nucleus|plasma membrane	2,4-dienoyl-CoA reductase (NADPH) activity|NADPH binding|oxidoreductase activity, acting on NADH or NADPH				0			BRCA - Breast invasive adenocarcinoma(11;0.00953)															---	---	---	---
RAD54B	25788	broad.mit.edu	37	8	95479469	95479469	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95479469delA	uc003ygk.2	-						RAD54B_uc003ygl.1_Intron|RAD54B_uc003ygn.1_Intron	NM_012415	NP_036547			RAD54 homolog B						double-strand break repair via homologous recombination|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA translocase activity|protein binding			kidney(2)|lung(1)|skin(1)	4	Breast(36;4.5e-05)		BRCA - Breast invasive adenocarcinoma(8;0.00217)										Direct_reversal_of_damage|Homologous_recombination					---	---	---	---
NCALD	83988	broad.mit.edu	37	8	102859464	102859464	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:102859464delT	uc003ykf.2	-						NCALD_uc003ykg.2_Intron|NCALD_uc003ykh.2_Intron|NCALD_uc003yki.2_Intron|NCALD_uc003ykj.2_Intron|NCALD_uc003ykk.2_Intron|NCALD_uc003ykl.2_Intron	NM_001040628	NP_001035718			neurocalcin delta						synaptic transmission|vesicle-mediated transport	clathrin coat of trans-Golgi network vesicle|cytosol	actin binding|calcium ion binding|clathrin binding|tubulin binding				0	all_cancers(14;8.94e-08)|all_epithelial(15;7.03e-10)|Lung NSC(17;1.36e-05)|all_lung(17;2.7e-05)		all cancers(13;1.09e-06)|OV - Ovarian serous cystadenocarcinoma(57;0.000699)															---	---	---	---
EIF3E	3646	broad.mit.edu	37	8	109240379	109240379	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:109240379delA	uc003ymu.2	-						EIF3E_uc003ymt.2_Intron|EIF3E_uc003ymv.2_Intron|EIF3E_uc010mci.1_Intron	NM_001568	NP_001559			eukaryotic translation initiation factor 3,						negative regulation of translational initiation|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	cytosol|eukaryotic translation initiation factor 3 complex|PML body	protein N-terminus binding			ovary(2)|kidney(1)	3			OV - Ovarian serous cystadenocarcinoma(57;6.84e-10)															---	---	---	---
CSMD3	114788	broad.mit.edu	37	8	113395738	113395738	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113395738delT	uc003ynu.2	-						CSMD3_uc003yns.2_Intron|CSMD3_uc003ynt.2_Intron|CSMD3_uc011lhx.1_Intron	NM_198123	NP_937756			CUB and Sushi multiple domains 3 isoform 1							integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---
SNTB1	6641	broad.mit.edu	37	8	121823372	121823373	+	Intron	DEL	CC	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:121823372_121823373delCC	uc010mdg.2	-						SNTB1_uc003ype.2_Intron	NM_021021	NP_066301			basic beta 1 syntrophin						muscle contraction	cell junction|cytoplasm|cytoskeleton|dystrophin-associated glycoprotein complex|sarcolemma	actin binding|calmodulin binding			skin(5)	5	Lung NSC(37;4.46e-09)|Ovarian(258;0.0254)|Hepatocellular(40;0.0997)		STAD - Stomach adenocarcinoma(47;0.00503)															---	---	---	---
TMEM65	157378	broad.mit.edu	37	8	125384084	125384085	+	Intron	INS	-	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:125384084_125384085insC	uc010mdl.2	-							NM_194291	NP_919267			transmembrane protein 65							integral to membrane					0	Lung NSC(37;1.18e-11)|Ovarian(258;0.00438)|all_neural(195;0.0779)|Hepatocellular(40;0.108)		STAD - Stomach adenocarcinoma(47;0.00288)															---	---	---	---
Unknown	0	broad.mit.edu	37	8	128098496	128098497	+	IGR	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:128098496_128098497delAA								FAM84B (528030 upstream) : LOC727677 (203565 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	8	144138674	144138674	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144138674delT								C8orf31 (2954 upstream) : LY6H (100658 downstream)																																			---	---	---	---
GLIS3	169792	broad.mit.edu	37	9	4126054	4126055	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:4126054_4126055delTT	uc003zhw.1	-						GLIS3_uc003zhx.1_Intron|GLIS3_uc003zic.1_Intron|GLIS3_uc003zie.1_Intron|GLIS3_uc010mhh.1_Intron|GLIS3_uc003zid.1_Intron|GLIS3_uc010mhi.1_Intron|GLIS3_uc003zif.1_Intron|GLIS3_uc003zig.1_Intron|GLIS3_uc003zih.1_Intron|GLIS3_uc003zib.1_Intron|GLIS3_uc010mhg.1_Intron	NM_152629	NP_689842			GLIS family zinc finger 3 isoform b						negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter		DNA binding|zinc ion binding			ovary(1)	1		Acute lymphoblastic leukemia(2;0.00464)|Breast(48;0.148)		Lung(2;0.00163)|GBM - Glioblastoma multiforme(50;0.00301)|LUSC - Lung squamous cell carcinoma(2;0.0148)														---	---	---	---
MPDZ	8777	broad.mit.edu	37	9	13193321	13193321	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:13193321delA	uc010mia.1	-						MPDZ_uc010mhy.2_Intron|MPDZ_uc010mhz.2_Intron|MPDZ_uc011lmn.1_Intron|MPDZ_uc003zlb.3_Intron	NM_003829	NP_003820			multiple PDZ domain protein						interspecies interaction between organisms	apical plasma membrane|dendrite|postsynaptic density|postsynaptic membrane|synaptosome|tight junction	protein C-terminus binding			ovary(5)|central_nervous_system(1)	6				GBM - Glioblastoma multiforme(50;2.03e-06)														---	---	---	---
C9orf93	203238	broad.mit.edu	37	9	15657002	15657002	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:15657002delA	uc003zmd.2	+						C9orf93_uc010mih.1_Intron|C9orf93_uc003zme.2_Intron|C9orf93_uc011lmu.1_Intron|C9orf93_uc003zmc.2_Intron	NM_173550	NP_775821			hypothetical protein LOC203238												0				GBM - Glioblastoma multiforme(50;4.84e-07)														---	---	---	---
CNTLN	54875	broad.mit.edu	37	9	17135271	17135271	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:17135271delG	uc003zmz.2	+	1	234	c.208delG	c.(208-210)GGGfs	p.G70fs	CNTLN_uc003zmx.3_Frame_Shift_Del_p.G70fs|CNTLN_uc003zmy.2_Frame_Shift_Del_p.G70fs|CNTLN_uc003zmw.1_Frame_Shift_Del_p.G70fs	NM_017738	NP_060208	Q9NXG0	CNTLN_HUMAN	centlein isoform 1	70						centriole|membrane	two-component sensor activity			pancreas(1)	1				GBM - Glioblastoma multiforme(50;6.14e-10)														---	---	---	---
HAUS6	54801	broad.mit.edu	37	9	19078117	19078118	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:19078117_19078118delAA	uc003znk.2	-						HAUS6_uc011lmz.1_Intron|HAUS6_uc003znl.1_Intron|HAUS6_uc003znm.1_Intron	NM_017645	NP_060115			HAUS augmin-like complex, subunit 6						cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|nucleus|spindle				ovary(2)	2																		---	---	---	---
HAUS6	54801	broad.mit.edu	37	9	19094440	19094440	+	Intron	DEL	A	-	-	rs112198354		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:19094440delA	uc003znk.2	-						HAUS6_uc003znl.1_5'Flank	NM_017645	NP_060115			HAUS augmin-like complex, subunit 6						cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|nucleus|spindle				ovary(2)	2																		---	---	---	---
DENND4C	55667	broad.mit.edu	37	9	19305701	19305701	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:19305701delA	uc003znq.2	+						DENND4C_uc011lnc.1_Intron	NM_017925	NP_060395			DENN/MADD domain containing 4C							integral to membrane				ovary(1)|skin(1)	2																		---	---	---	---
KIAA1797	54914	broad.mit.edu	37	9	20789722	20789724	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:20789722_20789724delTTT	uc003zog.1	+							NM_017794	NP_060264			hypothetical protein LOC54914							integral to membrane	binding			ovary(8)|breast(1)|kidney(1)	10				GBM - Glioblastoma multiforme(3;2.1e-125)|Lung(42;2.76e-14)|LUSC - Lung squamous cell carcinoma(42;1.99e-11)														---	---	---	---
C9orf82	79886	broad.mit.edu	37	9	26885073	26885077	+	Intron	DEL	TTTTT	-	-	rs72425534		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:26885073_26885077delTTTTT	uc003zqc.2	-						C9orf82_uc003zqb.2_Intron	NM_024828	NP_079104			hypothetical protein LOC79886												0		all_neural(3;3.53e-10)|Glioma(3;2.71e-09)		Lung(42;1.39e-05)|LUSC - Lung squamous cell carcinoma(38;0.000114)														---	---	---	---
PTENP1	11191	broad.mit.edu	37	9	33675365	33675365	+	3'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33675365delA	uc003zth.3	-	1						NR_023917				SubName: Full=Phosphatase and tensin homolog 2; Flags: Fragment;												0																		---	---	---	---
RNF38	152006	broad.mit.edu	37	9	36353341	36353341	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:36353341delA	uc003zzh.2	-						RNF38_uc003zzi.2_Intron|RNF38_uc003zzj.2_Intron|RNF38_uc003zzk.2_Intron|RNF38_uc003zzl.2_Intron|RNF38_uc003zzm.2_Intron	NM_022781	NP_073618			ring finger protein 38 isoform 1								zinc ion binding			central_nervous_system(1)	1			STAD - Stomach adenocarcinoma(86;0.228)															---	---	---	---
FBXO10	26267	broad.mit.edu	37	9	37541097	37541097	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:37541097delA	uc004aab.2	-						FBXO10_uc004aac.2_Intron|FBXO10_uc004aad.2_Intron	NM_012166	NP_036298			F-box protein 10							ubiquitin ligase complex	ubiquitin-protein ligase activity			lung(5)	5				GBM - Glioblastoma multiforme(29;0.0107)														---	---	---	---
ZNF658	26149	broad.mit.edu	37	9	40771888	40771888	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:40771888delT	uc004abs.2	-	5					ZNF658_uc010mmm.1_Intron|ZNF658_uc010mmn.1_3'UTR	NM_033160	NP_149350			zinc finger protein 658						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1				GBM - Glioblastoma multiforme(29;0.02)|Lung(182;0.0681)														---	---	---	---
KGFLP2	654466	broad.mit.edu	37	9	41962753	41962756	+	Intron	DEL	GAAA	-	-	rs138206184	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:41962753_41962756delGAAA	uc004aca.3	-							NR_003670				Homo sapiens cDNA FLJ76381 complete cds.												0																		---	---	---	---
AQP7P1	375719	broad.mit.edu	37	9	67273773	67273774	+	Intron	INS	-	A	A	rs149463181	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:67273773_67273774insA	uc004aem.1	-						AQP7P1_uc004aen.1_Intron|AQP7P1_uc004aeo.1_Intron|AQP7P1_uc004aep.1_Intron					Homo sapiens aquaporin 7 pseudogene 1, mRNA (cDNA clone IMAGE:6191443).												0																		---	---	---	---
ALDH1A1	216	broad.mit.edu	37	9	75533865	75533865	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:75533865delT	uc004ajd.2	-						ALDH1A1_uc011lsh.1_Intron|ALDH1A1_uc011lsg.1_Intron	NM_000689	NP_000680			aldehyde dehydrogenase 1A1						cellular aldehyde metabolic process|ethanol oxidation|xenobiotic metabolic process	cytosol	aldehyde dehydrogenase (NAD) activity|androgen binding|Ras GTPase activator activity|retinal dehydrogenase activity			ovary(3)|lung(1)	4					NADH(DB00157)|Tretinoin(DB00755)|Vitamin A(DB00162)													---	---	---	---
C9orf103	414328	broad.mit.edu	37	9	86258320	86258320	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:86258320delT	uc004amu.1	+						C9orf103_uc004amt.1_Intron|C9orf103_uc010mpv.1_Intron	NM_001001551	NP_001001551			gluconokinase-like protein						carbohydrate metabolic process	cytoplasm	ATP binding|gluconokinase activity|shikimate kinase activity				0																		---	---	---	---
HNRNPK	3190	broad.mit.edu	37	9	86587903	86587903	+	Intron	DEL	A	-	-	rs80180335		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:86587903delA	uc004ang.3	-						HNRNPK_uc011lsw.1_Intron|HNRNPK_uc004and.3_Intron|HNRNPK_uc004ank.3_Intron|HNRNPK_uc004anf.3_Intron|HNRNPK_uc004anh.3_Intron|HNRNPK_uc011lsx.1_Intron|HNRNPK_uc004ani.3_Intron|HNRNPK_uc004anj.3_Intron|HNRNPK_uc004ann.3_Intron|HNRNPK_uc004anl.3_Intron|HNRNPK_uc004anm.3_Intron	NM_031262	NP_112552			heterogeneous nuclear ribonucleoprotein K						interspecies interaction between organisms|positive regulation of low-density lipoprotein particle receptor biosynthetic process|positive regulation of receptor-mediated endocytosis|regulation of lipid transport by positive regulation of transcription from an RNA polymerase II promoter|regulation of low-density lipoprotein particle clearance|signal transduction	catalytic step 2 spliceosome|cytoplasm|heterogeneous nuclear ribonucleoprotein complex|nuclear chromatin|nucleoplasm	protein binding|RNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|single-stranded DNA binding			skin(1)	1																		---	---	---	---
HNRNPK	3190	broad.mit.edu	37	9	86589414	86589414	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:86589414delA	uc004ang.3	-						HNRNPK_uc011lsw.1_Intron|HNRNPK_uc004and.3_Intron|HNRNPK_uc004ank.3_Intron|HNRNPK_uc004anf.3_Intron|HNRNPK_uc004anh.3_Intron|HNRNPK_uc011lsx.1_Intron|HNRNPK_uc004ani.3_Intron|HNRNPK_uc004anj.3_Intron|HNRNPK_uc004ann.3_Intron|HNRNPK_uc004anl.3_Intron|HNRNPK_uc004anm.3_Intron	NM_031262	NP_112552			heterogeneous nuclear ribonucleoprotein K						interspecies interaction between organisms|positive regulation of low-density lipoprotein particle receptor biosynthetic process|positive regulation of receptor-mediated endocytosis|regulation of lipid transport by positive regulation of transcription from an RNA polymerase II promoter|regulation of low-density lipoprotein particle clearance|signal transduction	catalytic step 2 spliceosome|cytoplasm|heterogeneous nuclear ribonucleoprotein complex|nuclear chromatin|nucleoplasm	protein binding|RNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|single-stranded DNA binding			skin(1)	1																		---	---	---	---
ZCCHC6	79670	broad.mit.edu	37	9	88919729	88919729	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88919729delT	uc004aoq.2	-						ZCCHC6_uc010mqe.2_Intron|ZCCHC6_uc011ltf.1_Intron|ZCCHC6_uc004aor.2_Intron|ZCCHC6_uc004aos.2_Intron|ZCCHC6_uc004aot.2_Intron|ZCCHC6_uc004aou.2_Intron	NM_024617	NP_078893			zinc finger, CCHC domain containing 6						RNA 3'-end processing		nucleic acid binding|RNA uridylyltransferase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
ZCCHC6	79670	broad.mit.edu	37	9	88957837	88957837	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88957837delA	uc004aoq.2	-						ZCCHC6_uc011ltf.1_Intron|ZCCHC6_uc004aor.2_Intron|ZCCHC6_uc004aos.2_Intron|ZCCHC6_uc004aot.2_Intron|ZCCHC6_uc004aou.2_Intron|ZCCHC6_uc004aov.2_Intron|ZCCHC6_uc004aow.2_Intron	NM_024617	NP_078893			zinc finger, CCHC domain containing 6						RNA 3'-end processing		nucleic acid binding|RNA uridylyltransferase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	9	90460973	90460973	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:90460973delA								CTSL3 (59174 upstream) : C9orf79 (36768 downstream)																																			---	---	---	---
SECISBP2	79048	broad.mit.edu	37	9	91954659	91954659	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:91954659delT	uc004aqj.1	+						SECISBP2_uc011ltk.1_Intron|SECISBP2_uc004aqk.1_Intron|SECISBP2_uc010mqo.1_Intron|SECISBP2_uc011ltl.1_Intron	NM_024077	NP_076982			SECIS binding protein 2						translation	nucleus	mRNA 3'-UTR binding			ovary(2)|skin(1)	3																		---	---	---	---
CTSL2	1515	broad.mit.edu	37	9	99799402	99799402	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:99799402delA	uc004awt.2	-						CTSL2_uc010msi.2_Intron|CTSL2_uc004awu.2_Intron|CTSL2_uc010msj.1_Intron|CTSL2_uc010msk.2_Intron	NM_001333	NP_001324			cathepsin L2 preproprotein							lysosome	cysteine-type endopeptidase activity				0		Acute lymphoblastic leukemia(62;0.0559)																---	---	---	---
TMEFF1	8577	broad.mit.edu	37	9	103279165	103279165	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:103279165delT	uc004baz.1	+						TMEFF1_uc004bay.1_Intron	NM_003692	NP_003683			transmembrane protein with EGF-like and two						multicellular organismal development	integral to membrane|plasma membrane					0		Acute lymphoblastic leukemia(62;0.0452)																---	---	---	---
ZNF462	58499	broad.mit.edu	37	9	109736291	109736291	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:109736291delT	uc004bcz.2	+						ZNF462_uc010mto.2_Intron|ZNF462_uc004bda.2_Intron|ZNF462_uc011lvz.1_Intron|ZNF462_uc004bdb.1_Intron	NM_021224	NP_067047			zinc finger protein 462						transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(5)	5																		---	---	---	---
SVEP1	79987	broad.mit.edu	37	9	113241708	113241708	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:113241708delT	uc010mtz.2	-						SVEP1_uc010mua.1_Intron|SVEP1_uc004beu.2_Intron	NM_153366	NP_699197			polydom						cell adhesion	cytoplasm|extracellular region|membrane	calcium ion binding			ovary(7)	7																		---	---	---	---
KIAA0368	23392	broad.mit.edu	37	9	114124538	114124538	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:114124538delA	uc004bfe.1	-							NM_001080398	NP_001073867			KIAA0368 protein												0																		---	---	---	---
HSDL2	84263	broad.mit.edu	37	9	115179055	115179056	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:115179055_115179056delAA	uc004bga.1	+						HSDL2_uc011lwv.1_Intron|HSDL2_uc004bgb.1_Intron|HSDL2_uc004bgc.1_Intron|HSDL2_uc011lww.1_Intron|HSDL2_uc004bgd.2_RNA	NM_032303	NP_115679			hydroxysteroid dehydrogenase like 2							peroxisome	oxidoreductase activity|sterol binding				0																		---	---	---	---
C9orf43	257169	broad.mit.edu	37	9	116186801	116186803	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:116186801_116186803delTTT	uc004bho.3	+						C9orf43_uc004bhp.2_Intron	NM_152786	NP_689999			hypothetical protein LOC257169												0																		---	---	---	---
GSN	2934	broad.mit.edu	37	9	124095004	124095004	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:124095004delT	uc004blf.1	+	17					GSN_uc004bld.1_3'UTR|GSN_uc010mvq.1_3'UTR|GSN_uc010mvr.1_3'UTR|GSN_uc010mvu.1_3'UTR|GSN_uc010mvt.1_3'UTR|GSN_uc010mvs.1_3'UTR|GSN_uc004ble.1_3'UTR|GSN_uc010mvv.1_3'UTR|GSN_uc011lyh.1_3'UTR|GSN_uc011lyi.1_3'UTR|GSN_uc011lyj.1_3'UTR	NM_000177	NP_000168			gelsolin isoform a precursor						actin filament polymerization|actin filament severing|barbed-end actin filament capping|cellular component disassembly involved in apoptosis|cilium morphogenesis	actin cytoskeleton|cytosol	actin binding|calcium ion binding|protein binding			breast(2)|ovary(1)	3																		---	---	---	---
NR6A1	2649	broad.mit.edu	37	9	127288844	127288844	+	Intron	DEL	A	-	-	rs111378093		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:127288844delA	uc004bor.1	-						NR6A1_uc004boq.1_Intron|NR6A1_uc010mwq.1_Intron	NM_033334	NP_201591			nuclear receptor subfamily 6, group A, member 1						cell proliferation|negative regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|spermatogenesis	transcription factor complex	protein homodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(3)	3																		---	---	---	---
WDR34	89891	broad.mit.edu	37	9	131397627	131397627	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131397627delA	uc004bvq.1	-						WDR34_uc004bvs.1_Intron|WDR34_uc004bvr.1_Intron	NM_052844	NP_443076			WD repeat domain 34							cytoplasm				central_nervous_system(2)|skin(1)	3																OREG0019522	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
FAM73B	84895	broad.mit.edu	37	9	131803156	131803156	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131803156delT	uc004bxa.2	+						FAM73B_uc004bwy.2_Intron|FAM73B_uc004bwz.2_Intron|FAM73B_uc011mbn.1_Intron	NM_032809	NP_116198			hypothetical protein LOC84895							integral to membrane				skin(1)	1																		---	---	---	---
PPP2R4	5524	broad.mit.edu	37	9	131882706	131882706	+	Intron	DEL	G	-	-	rs3124504		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131882706delG	uc004bxm.1	+						PPP2R4_uc004bxl.1_Intron|PPP2R4_uc011mbo.1_Intron|PPP2R4_uc010myr.1_Intron|PPP2R4_uc004bxn.1_Intron|PPP2R4_uc004bxo.1_Intron|PPP2R4_uc011mbp.1_Intron|PPP2R4_uc011mbq.1_Intron|PPP2R4_uc010mys.1_Intron	NM_178001	NP_821068			protein phosphatase 2A, regulatory subunit B'						ATP catabolic process|negative regulation of phosphoprotein phosphatase activity|negative regulation of protein dephosphorylation|positive regulation of apoptosis|positive regulation of phosphoprotein phosphatase activity|positive regulation of protein dephosphorylation	calcium channel complex|cytoplasm|nucleus|protein phosphatase type 2A complex|soluble fraction	ATP binding|peptidyl-prolyl cis-trans isomerase activity|protein heterodimerization activity|protein homodimerization activity|protein phosphatase 2A binding|protein phosphatase type 2A regulator activity|protein tyrosine phosphatase activator activity|receptor binding			ovary(1)|lung(1)|pancreas(1)	3		Medulloblastoma(224;0.235)		UCEC - Uterine corpus endometrioid carcinoma (4;0.0178)														---	---	---	---
MED27	9442	broad.mit.edu	37	9	134953129	134953129	+	Intron	DEL	A	-	-	rs76460072		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134953129delA	uc004cbe.1	-						MED27_uc004cbf.1_Intron|MED27_uc011mco.1_Intron|MED27_uc004cbg.3_Intron	NM_004269	NP_004260			mediator complex subunit 27						regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	cytoplasm|nucleolus|transcription factor complex	protein binding|transcription coactivator activity			skin(1)	1		Myeloproliferative disorder(178;0.206)		OV - Ovarian serous cystadenocarcinoma(145;6.82e-06)|Epithelial(140;0.000193)														---	---	---	---
TTF1	7270	broad.mit.edu	37	9	135263730	135263730	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135263730delT	uc004cbl.2	-						TTF1_uc011mcp.1_Intron|TTF1_uc004cbm.2_Intron	NM_007344	NP_031370			transcription termination factor, RNA polymerase						negative regulation of DNA replication|regulation of transcription, DNA-dependent|termination of RNA polymerase I transcription	nucleolus|nucleoplasm	DNA binding			ovary(2)|upper_aerodigestive_tract(1)|pancreas(1)	4		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;4.25e-06)|Epithelial(140;9.09e-05)														---	---	---	---
C9orf171	389799	broad.mit.edu	37	9	135357575	135357575	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135357575delT	uc004cbn.2	+						C9orf171_uc004cbo.2_Intron	NM_207417	NP_997300			hypothetical protein LOC389799											ovary(4)|large_intestine(1)	5																		---	---	---	---
COL5A1	1289	broad.mit.edu	37	9	137716712	137716712	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:137716712delG	uc004cfe.2	+						uc004cff.2_Intron	NM_000093	NP_000084			alpha 1 type V collagen preproprotein						axon guidance|cell adhesion|collagen biosynthetic process|collagen fibril organization|eye morphogenesis|fibril organization|integrin biosynthetic process|skin development|wound healing, spreading of epidermal cells	collagen type V	heparin binding|integrin binding|platelet-derived growth factor binding|proteoglycan binding			skin(4)|ovary(3)|pancreas(2)|central_nervous_system(1)|kidney(1)	11		Myeloproliferative disorder(178;0.0341)		all cancers(34;2.28e-08)|OV - Ovarian serous cystadenocarcinoma(145;6.03e-08)|Epithelial(140;6.4e-08)|GBM - Glioblastoma multiforme(294;0.131)														---	---	---	---
PMPCA	23203	broad.mit.edu	37	9	139312224	139312226	+	Intron	DEL	TTT	-	-	rs112295054		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139312224_139312226delTTT	uc004chl.2	+						PMPCA_uc010nbl.2_Intron|PMPCA_uc011mdz.1_Intron|PMPCA_uc004chm.1_Intron|PMPCA_uc004chn.1_5'Flank	NM_015160	NP_055975			peptidase (mitochondrial processing) alpha						proteolysis	mitochondrial inner membrane|mitochondrial matrix	metalloendopeptidase activity|zinc ion binding				0		Myeloproliferative disorder(178;0.0821)		OV - Ovarian serous cystadenocarcinoma(145;9.3e-06)|Epithelial(140;1.15e-05)														---	---	---	---
FAM188A	80013	broad.mit.edu	37	10	15828686	15828686	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:15828686delA	uc001iod.1	-						FAM188A_uc001ioe.1_Intron	NM_024948	NP_079224			chromosome 10 open reading frame 97						apoptosis	nucleus	calcium ion binding			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	10	26607459	26607460	+	IGR	INS	-	AGGGAGGC	AGGGAGGC	rs140640852	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:26607459_26607460insAGGGAGGC								GAD2 (13968 upstream) : APBB1IP (119806 downstream)																																			---	---	---	---
MAP3K8	1326	broad.mit.edu	37	10	30728362	30728362	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:30728362delA	uc001ivi.1	+						MAP3K8_uc009xlf.1_Intron|MAP3K8_uc001ivj.1_Intron	NM_005204	NP_005195			mitogen-activated protein kinase kinase kinase						cell cycle|T cell costimulation	cytosol	ATP binding|magnesium ion binding|MAP kinase kinase kinase activity|protein binding			breast(3)|central_nervous_system(1)	4		Prostate(175;0.151)																---	---	---	---
Unknown	0	broad.mit.edu	37	10	35254677	35254677	+	IGR	DEL	T	-	-	rs150201909		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:35254677delT								PARD3 (150754 upstream) : CUL2 (44131 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	10	45687313	45687313	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:45687313delT								LOC100133308 (37269 upstream) : OR13A1 (110789 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	10	48980053	48980053	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:48980053delA	uc001jgc.1	+											full-length cDNA clone CS0DI009YC01 of Placenta Cot 25-normalized of Homo sapiens (human).																														---	---	---	---
Unknown	0	broad.mit.edu	37	10	52024834	52024834	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:52024834delA								ASAH2 (16464 upstream) : SGMS1 (40512 downstream)																																			---	---	---	---
ANK3	288	broad.mit.edu	37	10	61815229	61815229	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:61815229delT	uc001jky.2	-						ANK3_uc001jkw.2_Intron|ANK3_uc009xpa.2_Intron|ANK3_uc001jkx.2_Intron|ANK3_uc010qih.1_Intron|ANK3_uc001jkz.3_Intron|ANK3_uc001jkv.2_Intron	NM_020987	NP_066267			ankyrin 3 isoform 1						establishment of protein localization|signal transduction	basolateral plasma membrane|cytoplasm|cytoskeleton	protein binding			skin(9)|ovary(6)|pancreas(2)|central_nervous_system(2)	19																		---	---	---	---
RTKN2	219790	broad.mit.edu	37	10	64022583	64022583	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64022583delA	uc001jlw.2	-						ZNF365_uc001jly.3_Intron|RTKN2_uc001jlx.2_Intron	NM_145307	NP_660350			rhotekin 2						signal transduction	intracellular					0	Prostate(12;0.0297)|all_hematologic(501;0.215)																	---	---	---	---
RUFY2	55680	broad.mit.edu	37	10	70140858	70140858	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70140858delA	uc001job.2	-						RUFY2_uc001jnz.1_Intron|RUFY2_uc001joc.2_Intron|RUFY2_uc010qiw.1_Intron|RUFY2_uc001jod.1_Intron	NM_017987	NP_060457			RUN and FYVE domain-containing 2 isoform a							nucleus	metal ion binding			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	10	72397905	72397906	+	IGR	INS	-	TCCT	TCCT	rs143397937	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72397905_72397906insTCCT								PRF1 (35374 upstream) : ADAMTS14 (34653 downstream)																																			---	---	---	---
SGPL1	8879	broad.mit.edu	37	10	72610760	72610760	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72610760delT	uc001jrm.2	+							NM_003901	NP_003892			sphingosine-1-phosphate lyase 1						apoptosis|carboxylic acid metabolic process|ceramide metabolic process|sphingolipid catabolic process	integral to endoplasmic reticulum membrane	carboxy-lyase activity|pyridoxal phosphate binding|sphinganine-1-phosphate aldolase activity				0					Pyridoxal Phosphate(DB00114)													---	---	---	---
ASCC1	51008	broad.mit.edu	37	10	73887716	73887716	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:73887716delA	uc001jst.1	-						ASCC1_uc001jsr.1_Intron|ASCC1_uc001jss.1_Intron|ASCC1_uc001jsu.1_Intron|ASCC1_uc010qju.1_Intron					RecName: Full=Activating signal cointegrator 1 complex subunit 1; AltName: Full=ASC-1 complex subunit p50; AltName: Full=Trip4 complex subunit p50;						regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|transcription factor complex	RNA binding				0																		---	---	---	---
OIT3	170392	broad.mit.edu	37	10	74653469	74653469	+	5'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:74653469delA	uc001jte.1	+	1					OIT3_uc009xqs.1_RNA	NM_152635	NP_689848			oncoprotein-induced transcript 3 precursor							nuclear envelope	calcium ion binding			ovary(2)	2	Prostate(51;0.0198)																	---	---	---	---
Unknown	0	broad.mit.edu	37	10	82095804	82095804	+	IGR	DEL	A	-	-	rs72815321	byFrequency;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:82095804delA								MAT1A (46370 upstream) : DYDC1 (60 downstream)																																			---	---	---	---
GLUD1	2746	broad.mit.edu	37	10	88820205	88820205	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:88820205delT	uc001keh.2	-						GLUD1_uc001keg.2_Intron|GLUD1_uc010qmp.1_Intron	NM_005271	NP_005262			glutamate dehydrogenase 1 precursor						glutamate biosynthetic process|glutamate catabolic process|positive regulation of insulin secretion	mitochondrial matrix	ADP binding|ATP binding|glutamate dehydrogenase|glutamate dehydrogenase activity|GTP binding|identical protein binding|leucine binding|NAD+ binding				0					L-Glutamic Acid(DB00142)|NADH(DB00157)													---	---	---	---
GLUD1	2746	broad.mit.edu	37	10	88836153	88836153	+	Intron	DEL	A	-	-	rs5786757		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:88836153delA	uc001keh.2	-						GLUD1_uc001keg.2_Intron|GLUD1_uc010qmp.1_Intron	NM_005271	NP_005262			glutamate dehydrogenase 1 precursor						glutamate biosynthetic process|glutamate catabolic process|positive regulation of insulin secretion	mitochondrial matrix	ADP binding|ATP binding|glutamate dehydrogenase|glutamate dehydrogenase activity|GTP binding|identical protein binding|leucine binding|NAD+ binding				0					L-Glutamic Acid(DB00142)|NADH(DB00157)													---	---	---	---
KIF20B	9585	broad.mit.edu	37	10	91497021	91497021	+	Intron	DEL	T	-	-	rs72076248		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:91497021delT	uc001kgs.1	+						KIF20B_uc001kgr.1_Intron|KIF20B_uc001kgt.1_Intron|KIF20B_uc009xtw.1_5'Flank	NM_016195	NP_057279			M-phase phosphoprotein 1						cell cycle arrest|cell division|microtubule-based movement|mitosis|regulation of mitosis	centrosome|microtubule|nucleolus|nucleoplasm|spindle	ATP binding|ATPase activity|microtubule motor activity|WW domain binding			ovary(1)|pancreas(1)|skin(1)	3																		---	---	---	---
Unknown	0	broad.mit.edu	37	10	94985788	94985789	+	IGR	INS	-	T	T	rs140557797	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:94985788_94985789insT								CYP26A1 (148147 upstream) : MYOF (80398 downstream)																																			---	---	---	---
C10orf4	118924	broad.mit.edu	37	10	95429632	95429633	+	Intron	DEL	AA	-	-	rs79307310		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95429632_95429633delAA	uc001kiz.1	-						C10orf4_uc001kiv.1_Intron|C10orf4_uc001kja.1_Intron	NM_145246	NP_660289			FRA10AC1 protein							nucleus	protein binding				0		Colorectal(252;0.122)																---	---	---	---
PLCE1	51196	broad.mit.edu	37	10	95995659	95995659	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95995659delT	uc001kjk.2	+						PLCE1_uc010qnx.1_Intron|PLCE1_uc001kjm.2_Intron	NM_016341	NP_057425			phospholipase C, epsilon 1 isoform 1						activation of MAPK activity|activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|calcium-mediated signaling|cell proliferation|cytoskeleton organization|diacylglycerol biosynthetic process|elevation of cytosolic calcium ion concentration|epidermal growth factor receptor signaling pathway|glomerulus development|heart development|lipid catabolic process|Ras protein signal transduction|regulation of cell growth|regulation of G-protein coupled receptor protein signaling pathway|regulation of Ras protein signal transduction|regulation of smooth muscle contraction	cytosol|Golgi membrane|membrane fraction|plasma membrane	calcium ion binding|guanyl-nucleotide exchange factor activity|phosphatidylinositol phospholipase C activity|Ras GTPase binding|receptor signaling protein activity			ovary(2)|skin(1)	3		Colorectal(252;0.0458)																---	---	---	---
TCTN3	26123	broad.mit.edu	37	10	97442251	97442251	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97442251delA	uc001klb.3	-						TCTN3_uc001kla.3_Intron|TCTN3_uc010qoi.1_Intron	NM_015631	NP_056446			tectonic 3 isoform a precursor						apoptosis	integral to membrane					0		Colorectal(252;0.0815)		Epithelial(162;1.69e-07)|all cancers(201;5.63e-06)														---	---	---	---
TM9SF3	56889	broad.mit.edu	37	10	98312908	98312908	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:98312908delA	uc001kmm.3	-						TM9SF3_uc010qot.1_Intron|TM9SF3_uc001kmn.1_5'Flank	NM_020123	NP_064508			transmembrane 9 superfamily member 3 precursor							integral to membrane	binding				0		Colorectal(252;0.158)		Epithelial(162;1.84e-09)|all cancers(201;2.84e-08)														---	---	---	---
HPSE2	60495	broad.mit.edu	37	10	100401359	100401359	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:100401359delA	uc001kpn.1	-						HPSE2_uc009xwc.1_Intron|HPSE2_uc001kpo.1_Intron|HPSE2_uc009xwd.1_Intron	NM_021828	NP_068600			heparanase 2						carbohydrate metabolic process	intracellular|membrane	cation binding|heparanase activity			ovary(1)	1				Epithelial(162;1.8e-09)|all cancers(201;4.72e-07)														---	---	---	---
HPSE2	60495	broad.mit.edu	37	10	100995677	100995677	+	5'Flank	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:100995677delC	uc001kpn.1	-						HPSE2_uc009xwc.1_5'Flank|HPSE2_uc001kpo.1_5'Flank|HPSE2_uc009xwd.1_5'Flank	NM_021828	NP_068600			heparanase 2						carbohydrate metabolic process	intracellular|membrane	cation binding|heparanase activity			ovary(1)	1				Epithelial(162;1.8e-09)|all cancers(201;4.72e-07)														---	---	---	---
NOLC1	9221	broad.mit.edu	37	10	103920996	103920998	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:103920996_103920998delTTT	uc001kuo.2	+						NOLC1_uc001kup.2_Intron|NOLC1_uc001kuq.2_Intron|NOLC1_uc009xxb.1_Intron|NOLC1_uc001kur.2_Intron	NM_004741	NP_004732			nucleolar and coiled-body phosphoprotein 1						mitosis|rRNA processing	cytoplasm|nucleolus	ATP binding|GTP binding|protein binding			ovary(1)	1		Colorectal(252;0.122)		Epithelial(162;5.19e-08)|all cancers(201;9.43e-07)														---	---	---	---
CALHM2	51063	broad.mit.edu	37	10	105208932	105208932	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105208932delA	uc001kwz.2	-						CALHM2_uc001kxa.2_Intron|CALHM2_uc001kxc.2_Intron|CALHM2_uc001kxb.2_Intron|CALHM2_uc001kxd.1_3'UTR	NM_015916	NP_057000			calcium homeostasis modulator 2							integral to membrane				skin(1)	1																		---	---	---	---
NEURL	9148	broad.mit.edu	37	10	105266322	105266322	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105266322delT	uc001kxh.2	+							NM_004210	NP_004201			neuralized-like						nervous system development	perinuclear region of cytoplasm	zinc ion binding				0				Epithelial(162;2.12e-09)|all cancers(201;6.99e-08)|BRCA - Breast invasive adenocarcinoma(275;0.125)														---	---	---	---
SLK	9748	broad.mit.edu	37	10	105767759	105767759	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105767759delT	uc001kxo.1	+						SLK_uc001kxp.1_Intron	NM_014720	NP_055535			serine/threonine kinase 2						apoptosis|nucleotide-excision repair	cytoplasm|plasma membrane	ATP binding|DNA binding|nuclease activity|protein serine/threonine kinase activity			ovary(2)|stomach(2)|skin(2)|lung(1)|kidney(1)	8		Colorectal(252;0.178)		Epithelial(162;5.81e-10)|all cancers(201;2.35e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0165)														---	---	---	---
ADD3	120	broad.mit.edu	37	10	111876988	111876988	+	Intron	DEL	T	-	-	rs79771841		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:111876988delT	uc001kyt.3	+						ADD3_uc001kys.3_Intron|ADD3_uc001kyu.2_Intron|ADD3_uc001kyv.2_Intron|ADD3_uc001kyw.2_Intron	NM_016824	NP_058432			adducin 3 (gamma) isoform a							cytoskeleton	actin binding|calmodulin binding|metal ion binding|structural constituent of cytoskeleton			ovary(2)|skin(2)|large_intestine(1)	5		Breast(234;0.052)|Lung NSC(174;0.223)		Epithelial(162;4.15e-05)|all cancers(201;0.000587)|BRCA - Breast invasive adenocarcinoma(275;0.0742)														---	---	---	---
SHOC2	8036	broad.mit.edu	37	10	112767149	112767149	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:112767149delT	uc001kzl.3	+						SHOC2_uc009xxx.2_Intron|SHOC2_uc010qrg.1_Intron|SHOC2_uc001kzn.2_Intron	NM_007373	NP_031399			soc-2 suppressor of clear homolog						fibroblast growth factor receptor signaling pathway|positive regulation of Ras protein signal transduction|Ras protein signal transduction	nucleus|protein phosphatase type 1 complex	protein phosphatase binding|protein phosphatase regulator activity			ovary(1)|skin(1)	2				Epithelial(162;0.000796)|all cancers(201;0.011)|BRCA - Breast invasive adenocarcinoma(275;0.126)														---	---	---	---
Unknown	0	broad.mit.edu	37	10	125406656	125406663	+	IGR	DEL	AAGGAAGG	-	-	rs68112984		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:125406656_125406663delAAGGAAGG								BUB3 (481770 upstream) : GPR26 (19208 downstream)																																			---	---	---	---
C10orf125	282969	broad.mit.edu	37	10	135169074	135169074	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:135169074delC	uc001lmt.2	-						C10orf125_uc001lms.2_Intron	NM_001098483	NP_001091953			hypothetical protein LOC282969 isoform 1						fucose metabolic process		fucose binding|racemase and epimerase activity, acting on carbohydrates and derivatives				0		all_cancers(35;1.14e-09)|all_epithelial(44;5.79e-08)|Lung NSC(174;0.00263)|all_lung(145;0.0039)|all_neural(114;0.0299)|Melanoma(40;0.123)|Colorectal(31;0.172)|Glioma(114;0.203)		all cancers(32;6.94e-06)|OV - Ovarian serous cystadenocarcinoma(35;7.8e-06)|Epithelial(32;9.31e-06)														---	---	---	---
ZNF143	7702	broad.mit.edu	37	11	9493100	9493100	+	Intron	DEL	G	-	-	rs7119680	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:9493100delG	uc001mhr.2	+						ZNF143_uc009yfu.2_Intron|ZNF143_uc010rby.1_Intron	NM_003442	NP_003433			zinc finger protein 143						regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase III promoter|transcription from RNA polymerase II promoter|transcription from RNA polymerase III promoter	nucleoplasm	DNA binding|zinc ion binding				0				all cancers(16;4.12e-09)|Epithelial(150;2.29e-08)|BRCA - Breast invasive adenocarcinoma(625;0.0212)														---	---	---	---
USP47	55031	broad.mit.edu	37	11	11958114	11958114	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:11958114delT	uc001mjq.1	+						USP47_uc001mjr.2_Intron|USP47_uc001mjs.2_Intron|USP47_uc001mjt.1_5'Flank	NM_017944	NP_060414			ubiquitin specific protease 47						base-excision repair|cellular response to UV|monoubiquitinated protein deubiquitination|negative regulation of apoptosis|negative regulation of caspase activity|negative regulation of G2/M transition of mitotic cell cycle|negative regulation of transcription, DNA-dependent|positive regulation of cell growth|response to drug|ubiquitin-dependent protein catabolic process	cytoplasm|SCF ubiquitin ligase complex	ubiquitin thiolesterase activity|ubiquitin-specific protease activity|WD40-repeat domain binding			ovary(1)|skin(1)	2				Epithelial(150;0.000339)														---	---	---	---
SPON1	10418	broad.mit.edu	37	11	14264953	14264954	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:14264953_14264954insA	uc001mle.2	+							NM_006108	NP_006099			spondin 1, extracellular matrix protein						cell adhesion	extracellular space|proteinaceous extracellular matrix	protein binding				0				Epithelial(150;0.00898)														---	---	---	---
ZDHHC13	54503	broad.mit.edu	37	11	19197720	19197720	+	3'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:19197720delA	uc001mpi.2	+	17					ZDHHC13_uc001mpj.2_3'UTR	NM_019028	NP_061901			zinc finger, DHHC domain containing 13 isoform						positive regulation of I-kappaB kinase/NF-kappaB cascade	Golgi-associated vesicle membrane|integral to membrane	magnesium ion transmembrane transporter activity|palmitoyltransferase activity|signal transducer activity|zinc ion binding				0																		---	---	---	---
ANO5	203859	broad.mit.edu	37	11	22283656	22283656	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22283656delT	uc001mqi.2	+						ANO5_uc001mqj.2_Intron	NM_213599	NP_998764			anoctamin 5 isoform a							chloride channel complex|endoplasmic reticulum membrane	chloride channel activity			central_nervous_system(3)|ovary(1)	4																		---	---	---	---
SLC17A6	57084	broad.mit.edu	37	11	22360299	22360299	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22360299delG	uc001mqk.2	+							NM_020346	NP_065079			solute carrier family 17 (sodium-dependent						sodium ion transport	cell junction|integral to membrane|synaptic vesicle membrane|synaptosome	L-glutamate transmembrane transporter activity|symporter activity			ovary(3)|breast(1)	4																		---	---	---	---
KIF18A	81930	broad.mit.edu	37	11	28116025	28116028	+	Intron	DEL	AAAA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:28116025_28116028delAAAA	uc001msc.2	-							NM_031217	NP_112494			kinesin family member 18A						blood coagulation|microtubule depolymerization|microtubule-based movement|mitotic metaphase plate congression|mitotic prometaphase|protein transport	caveola|cytosol|kinetochore microtubule|microtubule organizing center|nucleus|ruffle	actin binding|ATP binding|microtubule plus-end binding|plus-end-directed microtubule motor activity|tubulin-dependent ATPase activity|ubiquitin binding			ovary(2)	2																		---	---	---	---
CAPRIN1	4076	broad.mit.edu	37	11	34093111	34093111	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:34093111delA	uc001mvh.1	+						CAPRIN1_uc001mvg.2_Intron|CAPRIN1_uc001mvi.2_Intron|CAPRIN1_uc001mvj.1_Intron	NM_005898	NP_005889			membrane component chromosome 11 surface marker						negative regulation of translation|positive regulation of dendrite morphogenesis|positive regulation of dendritic spine morphogenesis	cytoplasmic mRNA processing body|cytosol|dendrite|integral to plasma membrane|stress granule	protein binding|RNA binding			ovary(1)	1		Acute lymphoblastic leukemia(5;0.00045)|all_hematologic(20;0.0016)																---	---	---	---
Unknown	0	broad.mit.edu	37	11	42010406	42010407	+	IGR	INS	-	AAAG	AAAG	rs71868073		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:42010406_42010407insAAAG								LRRC4C (529083 upstream) : None (None downstream)																																			---	---	---	---
KIAA0652	9776	broad.mit.edu	37	11	46671494	46671495	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46671494_46671495delAA	uc009yld.2	+						KIAA0652_uc001nda.2_Intron|KIAA0652_uc001ndb.2_Intron|KIAA0652_uc001ncz.2_Intron|KIAA0652_uc001ndc.2_Intron|KIAA0652_uc010rgv.1_Intron	NM_001142673	NP_001136145			autophagy-related protein 13 isoform 1						autophagic vacuole assembly	cytosol|pre-autophagosomal structure|ULK1-ATG13-FIP200 complex	protein binding				0				GBM - Glioblastoma multiforme(35;0.226)														---	---	---	---
FNBP4	23360	broad.mit.edu	37	11	47768072	47768072	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47768072delT	uc009ylv.2	-						FNBP4_uc001ngj.2_Intron|FNBP4_uc001ngl.2_Intron	NM_015308	NP_056123			formin binding protein 4											ovary(1)	1																		---	---	---	---
NUP160	23279	broad.mit.edu	37	11	47804929	47804929	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47804929delA	uc001ngm.2	-						NUP160_uc009ylw.2_Intron	NM_015231	NP_056046			nucleoporin 160kDa						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			ovary(4)|lung(1)|central_nervous_system(1)|skin(1)	7																		---	---	---	---
NUP160	23279	broad.mit.edu	37	11	47843814	47843814	+	Intron	DEL	T	-	-	rs71875671		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47843814delT	uc001ngm.2	-						NUP160_uc009ylw.2_Intron	NM_015231	NP_056046			nucleoporin 160kDa						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			ovary(4)|lung(1)|central_nervous_system(1)|skin(1)	7																		---	---	---	---
Unknown	0	broad.mit.edu	37	11	48347622	48347622	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48347622delT								OR4C3 (142 upstream) : OR4C45 (19280 downstream)																																			---	---	---	---
TRIM48	79097	broad.mit.edu	37	11	55035952	55035952	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55035952delT	uc010rid.1	+							NM_024114	NP_077019			tripartite motif-containing 48							intracellular	zinc ion binding				0																		---	---	---	---
SPRYD5	84767	broad.mit.edu	37	11	55653610	55653610	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55653610delA	uc010rip.1	+	3	515	c.423delA	c.(421-423)CTAfs	p.L141fs	SPRYD5_uc010riq.1_5'UTR	NM_032681	NP_116070	Q9BSJ1	SPRY5_HUMAN	SPRY domain containing 5	141						intracellular	zinc ion binding				0		all_epithelial(135;0.226)																---	---	---	---
CTNND1	1500	broad.mit.edu	37	11	57571337	57571339	+	Intron	DEL	AAA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57571337_57571339delAAA	uc001nmc.3	+						CTNND1_uc001nlh.1_Intron|CTNND1_uc001nlu.3_Intron|CTNND1_uc001nlt.3_Intron|CTNND1_uc001nls.3_Intron|CTNND1_uc001nlw.3_Intron|CTNND1_uc001nmf.3_Intron|CTNND1_uc001nmd.3_Intron|CTNND1_uc001nlk.3_Intron|CTNND1_uc001nme.3_Intron|CTNND1_uc001nll.3_Intron|CTNND1_uc001nmg.3_Intron|CTNND1_uc001nlj.3_Intron|CTNND1_uc001nlr.3_Intron|CTNND1_uc001nlp.3_Intron|CTNND1_uc001nlx.3_Intron|CTNND1_uc001nlz.3_Intron|CTNND1_uc009ymn.2_Intron|CTNND1_uc001nlm.3_Intron|CTNND1_uc001nly.3_Intron|CTNND1_uc001nmb.3_Intron|CTNND1_uc001nma.3_Intron|CTNND1_uc001nmi.3_Intron|CTNND1_uc001nmh.3_Intron|CTNND1_uc001nlq.3_Intron|CTNND1_uc001nln.3_Intron|CTNND1_uc001nli.3_Intron|CTNND1_uc001nlo.3_Intron|CTNND1_uc001nlv.3_Intron	NM_001085458	NP_001078927			catenin, delta 1 isoform 1ABC						adherens junction organization|cell junction assembly|negative regulation of canonical Wnt receptor signaling pathway|regulation of transcription, DNA-dependent|transcription, DNA-dependent|Wnt receptor signaling pathway	cytosol|midbody|nucleus	cadherin binding|protein binding|receptor binding			breast(4)|ovary(1)|kidney(1)	6		all_epithelial(135;0.155)																---	---	---	---
SLC15A3	51296	broad.mit.edu	37	11	60707264	60707264	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60707264delG	uc001nqn.2	-						SLC15A3_uc001nqo.2_Intron	NM_016582	NP_057666			solute carrier family 15, member 3						oligopeptide transport|protein transport	integral to membrane|lysosomal membrane	peptide:hydrogen symporter activity				0																		---	---	---	---
BEST1	7439	broad.mit.edu	37	11	61725444	61725445	+	Intron	INS	-	CAAA	CAAA	rs149120080	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61725444_61725445insCAAA	uc001nss.2	+						BEST1_uc010rlp.1_Intron|BEST1_uc001nsq.2_Intron|BEST1_uc010rlq.1_Intron|BEST1_uc010rlr.1_Intron|BEST1_uc010rls.1_Intron|BEST1_uc001nsr.2_Intron|BEST1_uc009ynt.2_Intron|BEST1_uc010rlt.1_Intron|BEST1_uc001nst.2_Intron|BEST1_uc010rlu.1_Intron|BEST1_uc010rlv.1_Intron	NM_004183	NP_004174			bestrophin 1 isoform 1						response to stimulus|transepithelial chloride transport|visual perception	basolateral plasma membrane|chloride channel complex|cytosol|membrane fraction	chloride channel activity			central_nervous_system(1)	1																		---	---	---	---
METTL12	751071	broad.mit.edu	37	11	62433199	62433200	+	5'UTR	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62433199_62433200insT	uc001nug.1	+	2					C11orf48_uc001nue.2_Intron|C11orf48_uc001nuf.2_Intron|METTL12_uc001nuh.2_5'UTR|METTL12_uc010rmc.1_RNA	NM_001043229	NP_001036694			methyltransferase like 12 precursor							mitochondrion	methyltransferase activity				0																		---	---	---	---
LRP5	4041	broad.mit.edu	37	11	68183662	68183662	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68183662delC	uc001ont.2	+						LRP5_uc009ysg.2_Intron	NM_002335	NP_002326			low density lipoprotein receptor-related protein						adipose tissue development|bone marrow development|bone morphogenesis|canonical Wnt receptor signaling pathway|cholesterol homeostasis|endocytosis|glucose catabolic process|negative regulation of osteoblast differentiation|negative regulation of protein serine/threonine kinase activity|positive regulation of fat cell differentiation|positive regulation of mesenchymal cell proliferation|positive regulation of mitosis|positive regulation of transcription from RNA polymerase II promoter|regulation of blood pressure|regulation of canonical Wnt receptor signaling pathway|retina morphogenesis in camera-type eye|retinal blood vessel morphogenesis|Wnt receptor signaling pathway involved in dorsal/ventral axis specification	endoplasmic reticulum|integral to membrane|plasma membrane|receptor complex	protein binding|receptor activity			lung(2)|skin(2)|ovary(1)|pancreas(1)|breast(1)	7																		---	---	---	---
SLCO2B1	11309	broad.mit.edu	37	11	74877125	74877125	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:74877125delC	uc001owb.2	+						SLCO2B1_uc010rrq.1_Intron|SLCO2B1_uc010rrr.1_Intron|SLCO2B1_uc010rrs.1_Intron|SLCO2B1_uc001owc.2_Intron|SLCO2B1_uc001owd.2_Intron	NM_007256	NP_009187			solute carrier organic anion transporter family,						sodium-independent organic anion transport	integral to membrane	sodium-independent organic anion transmembrane transporter activity			ovary(1)|breast(1)	2					Ergoloid mesylate(DB01049)													---	---	---	---
FAT3	120114	broad.mit.edu	37	11	92498316	92498316	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92498316delA	uc001pdj.3	+							NM_001008781	NP_001008781			FAT tumor suppressor homolog 3						homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|pancreas(1)	5		Acute lymphoblastic leukemia(157;3.01e-05)|all_hematologic(158;0.00858)													TCGA Ovarian(4;0.039)			---	---	---	---
CNTN5	53942	broad.mit.edu	37	11	100143273	100143273	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:100143273delA	uc001pga.2	+						CNTN5_uc001pfz.2_Intron|CNTN5_uc001pgb.2_Intron|CNTN5_uc010ruk.1_Intron	NM_014361	NP_055176			contactin 5 isoform long						cell adhesion	anchored to membrane|plasma membrane	protein binding			skin(3)|ovary(2)|pancreas(2)|breast(1)	8		all_hematologic(158;1.22e-05)|Acute lymphoblastic leukemia(157;3.81e-05)|Melanoma(852;0.219)		BRCA - Breast invasive adenocarcinoma(274;0.00146)|KIRC - Kidney renal clear cell carcinoma(183;0.156)|Kidney(183;0.196)														---	---	---	---
PGR	5241	broad.mit.edu	37	11	100912944	100912944	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:100912944delA	uc001pgh.2	-						PGR_uc001pgg.2_Intron|PGR_uc001pgi.2_Intron|PGR_uc009yww.1_Intron|PGR_uc001pgj.2_Intron|PGR_uc009ywx.1_Intron	NM_000926	NP_000917			progesterone receptor						cell-cell signaling|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	cytoplasm|nucleoplasm	enzyme binding|receptor binding|sequence-specific DNA binding transcription factor activity|steroid binding|steroid hormone receptor activity|zinc ion binding			lung(1)|liver(1)|central_nervous_system(1)|pancreas(1)	4		Acute lymphoblastic leukemia(157;0.000885)|all_hematologic(158;0.014)		LUSC - Lung squamous cell carcinoma(1;0.0387)|BRCA - Breast invasive adenocarcinoma(274;0.124)|OV - Ovarian serous cystadenocarcinoma(223;0.148)|Lung(307;0.164)	Desogestrel(DB00304)|Drospirenone(DB01395)|Dydrogesterone(DB00378)|Ethynodiol Diacetate(DB00823)|Etonogestrel(DB00294)|Levonorgestrel(DB00367)|Medroxyprogesterone(DB00603)|Megestrol(DB00351)|Mifepristone(DB00834)|Norethindrone(DB00717)|Norgestimate(DB00957)|Norgestrel(DB00506)|Progesterone(DB00396)													---	---	---	---
DYNC2H1	79659	broad.mit.edu	37	11	103092697	103092697	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:103092697delT	uc001pho.2	+						DYNC2H1_uc001phn.1_Intron|DYNC2H1_uc009yxe.1_Intron	NM_001080463	NP_001073932			dynein, cytoplasmic 2, heavy chain 1						cell projection organization|Golgi organization|microtubule-based movement|multicellular organismal development	cilium axoneme|dynein complex|Golgi apparatus|microtubule|plasma membrane	ATP binding|ATPase activity|microtubule motor activity				0		Acute lymphoblastic leukemia(157;0.000966)|all_hematologic(158;0.00348)		BRCA - Breast invasive adenocarcinoma(274;0.000177)|Epithelial(105;0.0785)														---	---	---	---
SLC35F2	54733	broad.mit.edu	37	11	107686334	107686334	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:107686334delT	uc001pjq.2	-						SLC35F2_uc010rvu.1_Intron|SLC35F2_uc001pjs.2_Intron	NM_017515	NP_059985			solute carrier family 35, member F2						transport	integral to membrane				central_nervous_system(1)	1		all_cancers(61;9.46e-06)|Acute lymphoblastic leukemia(157;3.97e-05)|Melanoma(852;0.000111)|all_hematologic(158;0.000315)|all_epithelial(67;0.00197)|Breast(348;0.104)		BRCA - Breast invasive adenocarcinoma(274;3.28e-05)|Epithelial(105;0.000105)|all cancers(92;0.00217)														---	---	---	---
NPAT	4863	broad.mit.edu	37	11	108031565	108031565	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:108031565delA	uc001pjz.3	-						NPAT_uc010rvv.1_Intron	NM_002519	NP_002510			nuclear protein,  ataxia-telangiectasia locus						positive regulation of transcription, DNA-dependent|regulation of transcription involved in G1/S phase of mitotic cell cycle	Cajal body	protein C-terminus binding|protein N-terminus binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription corepressor activity			ovary(2)	2		all_cancers(61;2.31e-10)|all_epithelial(67;1.11e-06)|Melanoma(852;2.55e-06)|Acute lymphoblastic leukemia(157;3.95e-05)|all_hematologic(158;0.00014)|Breast(348;0.0258)|all_neural(303;0.072)		BRCA - Breast invasive adenocarcinoma(274;1.05e-05)|Epithelial(105;3.01e-05)|all cancers(92;0.000816)|Colorectal(284;0.116)														---	---	---	---
NCAM1	4684	broad.mit.edu	37	11	112832392	112832392	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:112832392delT	uc009yyq.1	+						NCAM1_uc001pno.2_Intron|uc001pnn.2_Intron	NM_001076682	NP_001070150			neural cell adhesion molecule 1 isoform 3						axon guidance|interferon-gamma-mediated signaling pathway	anchored to membrane|extracellular region|Golgi membrane|integral to membrane				ovary(1)	1		all_cancers(61;5.82e-19)|all_epithelial(67;6.87e-12)|Melanoma(852;1.99e-05)|all_hematologic(158;3.66e-05)|Acute lymphoblastic leukemia(157;0.00119)|Breast(348;0.0109)|all_neural(223;0.0299)|Medulloblastoma(222;0.0458)|Renal(330;0.198)|Prostate(24;0.207)		BRCA - Breast invasive adenocarcinoma(274;1.78e-05)|Epithelial(105;0.000114)|all cancers(92;0.000467)|OV - Ovarian serous cystadenocarcinoma(223;0.212)														---	---	---	---
SIK3	23387	broad.mit.edu	37	11	116906807	116906807	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:116906807delT	uc001ppy.2	-						SIK3_uc001ppz.2_Intron|SIK3_uc001pqa.2_Intron	NM_025164	NP_079440			serine/threonine-protein kinase QSK							cytoplasm	ATP binding|magnesium ion binding|protein binding|protein serine/threonine kinase activity			ovary(4)|breast(3)|stomach(2)|lung(1)|skin(1)|kidney(1)	12																		---	---	---	---
MFRP	83552	broad.mit.edu	37	11	119213688	119213688	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:119213688delG	uc001pwj.2	-	10	1310	c.1150delC	c.(1150-1152)CACfs	p.H384fs	MFRP_uc010rzf.1_RNA|MFRP_uc010rzg.1_Frame_Shift_Del_p.P308fs	NM_031433	NP_113621	Q9BXJ0	C1QT5_HUMAN	membrane frizzled-related protein	Error:Variant_position_missing_in_Q9BXJ0_after_alignment						collagen					0		Medulloblastoma(222;0.0523)|Breast(348;0.174)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;3.84e-05)														---	---	---	---
Unknown	0	broad.mit.edu	37	11	124109088	124109088	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124109088delT								OR8G2 (12778 upstream) : OR8D1 (70649 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	11	129902698	129902699	+	IGR	DEL	TT	-	-	rs71985644		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:129902698_129902699delTT								NCRNA00167 (27317 upstream) : APLP2 (37017 downstream)																																			---	---	---	---
NCAPD3	23310	broad.mit.edu	37	11	134090261	134090261	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:134090261delA	uc001qhd.1	-						NCAPD3_uc010scm.1_Intron|NCAPD3_uc009zda.1_Intron	NM_015261	NP_056076			non-SMC condensin II complex, subunit D3						cell division|mitotic chromosome condensation	nuclear centromeric heterochromatin|nuclear condensin complex	methylated histone residue binding			ovary(2)|upper_aerodigestive_tract(1)|lung(1)|kidney(1)	5	all_hematologic(175;0.127)	all_cancers(12;1.68e-21)|all_epithelial(12;5.86e-16)|all_lung(97;1.19e-05)|Lung NSC(97;2.76e-05)|Breast(109;0.000182)|Medulloblastoma(222;0.0245)|all_neural(223;0.0505)|Esophageal squamous(93;0.0559)		Epithelial(10;8.74e-10)|BRCA - Breast invasive adenocarcinoma(10;1e-08)|all cancers(11;1.46e-08)|OV - Ovarian serous cystadenocarcinoma(99;0.00345)|Lung(977;0.227)														---	---	---	---
KDM5A	5927	broad.mit.edu	37	12	415910	415911	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:415910_415911delAA	uc001qif.1	-						KDM5A_uc001qie.1_Intron	NM_001042603	NP_001036068			retinoblastoma binding protein 2 isoform 1						chromatin modification|multicellular organismal development|positive regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	cytoplasm|nucleolus	DNA binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(2)|ovary(1)	3								T 	NUP98	AML								---	---	---	---
TULP3	7289	broad.mit.edu	37	12	3046966	3046966	+	Intron	DEL	A	-	-	rs3742080	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:3046966delA	uc010seh.1	+						TULP3_uc009zec.1_Intron|TULP3_uc010seg.1_Intron|TULP3_uc001qlj.2_Intron|TULP3_uc010sei.1_Intron	NM_003324	NP_003315			tubby like protein 3 isoform 1						G-protein coupled receptor protein signaling pathway|regulation of transcription, DNA-dependent	cytoplasm|extracellular region|nucleus|plasma membrane	phosphatidylinositol-4,5-bisphosphate binding				0			OV - Ovarian serous cystadenocarcinoma(31;0.000818)															---	---	---	---
Unknown	0	broad.mit.edu	37	12	3416842	3416842	+	IGR	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:3416842delC								TSPAN9 (21113 upstream) : PRMT8 (73673 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	12	5141557	5141557	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:5141557delT								KCNA1 (114137 upstream) : KCNA5 (11528 downstream)																																			---	---	---	---
CHD4	1108	broad.mit.edu	37	12	6682042	6682043	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6682042_6682043delAA	uc001qpo.2	-						CHD4_uc001qpn.2_Intron|CHD4_uc001qpp.2_Intron	NM_001273	NP_001264			chromodomain helicase DNA binding protein 4						chromatin modification|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	microtubule organizing center|NuRD complex	ATP binding|ATP-dependent DNA helicase activity|DNA binding|zinc ion binding			central_nervous_system(2)	2																		---	---	---	---
SLC2A3	6515	broad.mit.edu	37	12	8084184	8084184	+	Intron	DEL	T	-	-	rs76797177		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:8084184delT	uc001qtr.2	-						SLC2A3_uc001qts.2_Intron	NM_006931	NP_008862			solute carrier family 2 (facilitated glucose						carbohydrate metabolic process|water-soluble vitamin metabolic process	integral to membrane|plasma membrane	D-glucose transmembrane transporter activity|dehydroascorbic acid transporter activity			ovary(3)|pancreas(1)	4				Kidney(36;0.0866)														---	---	---	---
Unknown	0	broad.mit.edu	37	12	9122131	9122131	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9122131delA								M6PR (19879 upstream) : KLRG1 (20090 downstream)																																			---	---	---	---
PZP	5858	broad.mit.edu	37	12	9313517	9313518	+	Intron	DEL	AT	-	-	rs7972015	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9313517_9313518delAT	uc001qvl.2	-						PZP_uc009zgl.2_Intron|PZP_uc010sgo.1_Intron	NM_002864	NP_002855			pregnancy-zone protein precursor											ovary(3)|upper_aerodigestive_tract(1)|large_intestine(1)	5																		---	---	---	---
STYK1	55359	broad.mit.edu	37	12	10783476	10783476	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10783476delA	uc001qys.2	-							NM_018423	NP_060893			serine/threonine/tyrosine kinase 1							integral to membrane|plasma membrane	ATP binding|non-membrane spanning protein tyrosine kinase activity			central_nervous_system(3)|ovary(2)|lung(2)|breast(1)	8															HNSCC(73;0.22)			---	---	---	---
ATF7IP	55729	broad.mit.edu	37	12	14619444	14619444	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14619444delT	uc001rbw.2	+						ATF7IP_uc001rbu.2_Intron|ATF7IP_uc001rbv.1_Intron|ATF7IP_uc001rbx.2_Intron|ATF7IP_uc001rby.3_Intron|ATF7IP_uc001rca.2_Intron	NM_018179	NP_060649			activating transcription factor 7 interacting						DNA methylation|interspecies interaction between organisms|positive regulation of transcription, DNA-dependent|regulation of RNA polymerase II transcriptional preinitiation complex assembly|transcription, DNA-dependent		protein binding			lung(3)|ovary(1)|skin(1)	5																		---	---	---	---
OVCH1	341350	broad.mit.edu	37	12	29648092	29648093	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:29648092_29648093insT	uc001rix.1	-							NM_183378	NP_899234			ovochymase 1 precursor						proteolysis	extracellular region	metal ion binding|serine-type endopeptidase activity			ovary(3)|central_nervous_system(3)|pancreas(3)|large_intestine(1)	10	Lung NSC(12;1.84e-09)|Acute lymphoblastic leukemia(23;0.00885)|all_hematologic(23;0.0155)																	---	---	---	---
Unknown	0	broad.mit.edu	37	12	31269805	31269806	+	Intron	INS	-	AAG	AAG	rs10650892		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31269805_31269806insAAG	uc010sjy.1	-						uc001rjy.2_Intron|uc001rjz.2_Intron					RecName: Full=Ovostatin homolog 1; Flags: Precursor;																														---	---	---	---
DENND5B	160518	broad.mit.edu	37	12	31545073	31545074	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31545073_31545074delAA	uc001rki.1	-						DENND5B_uc001rkh.1_Intron|DENND5B_uc009zjq.1_Intron	NM_144973	NP_659410			DENN/MADD domain containing 5B							integral to membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
DENND5B	160518	broad.mit.edu	37	12	31633203	31633203	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31633203delA	uc001rki.1	-						DENND5B_uc001rkh.1_Intron|DENND5B_uc009zjq.1_5'Flank|DENND5B_uc001rkj.2_Intron|DENND5B_uc001rkk.1_Intron	NM_144973	NP_659410			DENN/MADD domain containing 5B							integral to membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
AMN1	196394	broad.mit.edu	37	12	31862108	31862108	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31862108delA	uc001rkq.3	-						AMN1_uc001rko.3_Intron|AMN1_uc010skc.1_Intron|AMN1_uc001rkp.3_Intron|AMN1_uc009zjs.2_Intron|AMN1_uc009zjt.1_Intron	NM_001113402	NP_001106873			antagonist of mitotic exit network 1 homolog												0	all_cancers(9;7.41e-12)|all_epithelial(9;1.18e-11)|all_lung(12;1.14e-10)|Acute lymphoblastic leukemia(23;0.0122)|Lung SC(12;0.0336)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.162)		OV - Ovarian serous cystadenocarcinoma(6;0.0014)															---	---	---	---
YARS2	51067	broad.mit.edu	37	12	32903145	32903145	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32903145delT	uc001rli.2	-							NM_001040436	NP_001035526			tyrosyl-tRNA synthetase 2, mitochondrial						tyrosyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|protein binding|RNA binding|tyrosine-tRNA ligase activity				0	Lung NSC(5;2.43e-07)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.239)				L-Tyrosine(DB00135)													---	---	---	---
ARID2	196528	broad.mit.edu	37	12	46240571	46240571	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46240571delA	uc001ros.1	+						ARID2_uc001ror.2_Intron|ARID2_uc009zkg.1_Intron|ARID2_uc009zkh.1_Intron	NM_152641	NP_689854			AT rich interactive domain 2 (ARID, RFX-like)						chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(6)|skin(3)|upper_aerodigestive_tract(1)	10	Lung SC(27;0.192)|Renal(347;0.236)	Lung NSC(34;0.106)|all_lung(34;0.22)	OV - Ovarian serous cystadenocarcinoma(5;0.00691)	GBM - Glioblastoma multiforme(48;0.0153)														---	---	---	---
HIGD1C	613227	broad.mit.edu	37	12	51347971	51347971	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51347971delT	uc010smw.1	+							NM_001109619	NP_001103089			HIG1 domain family, member 1C							integral to membrane					0																		---	---	---	---
SCN8A	6334	broad.mit.edu	37	12	52139670	52139671	+	Intron	DEL	TT	-	-	rs77181043		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52139670_52139671delTT	uc001ryw.2	+						SCN8A_uc010snl.1_Intron|SCN8A_uc001ryx.1_Intron|SCN8A_uc001ryz.1_Intron|SCN8A_uc001ryy.2_Intron	NM_014191	NP_055006			sodium channel, voltage gated, type VIII, alpha						axon guidance|myelination|peripheral nervous system development	cytoplasmic membrane-bounded vesicle|node of Ranvier	ATP binding|voltage-gated sodium channel activity			ovary(7)	7				BRCA - Breast invasive adenocarcinoma(357;0.181)	Lamotrigine(DB00555)													---	---	---	---
KRT79	338785	broad.mit.edu	37	12	53223675	53223675	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53223675delA	uc001sbb.2	-						KRT79_uc001sba.2_Intron	NM_175834	NP_787028			keratin 6L							keratin filament	structural molecule activity			ovary(2)|skin(2)	4																		---	---	---	---
TIMELESS	8914	broad.mit.edu	37	12	56824461	56824462	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56824461_56824462delTT	uc001slf.2	-						TIMELESS_uc001slg.2_Intron	NM_003920	NP_003911			timeless homolog						cell division|circadian rhythm|detection of abiotic stimulus|mitosis|morphogenesis of an epithelium|negative regulation of transcription, DNA-dependent|regulation of S phase|response to DNA damage stimulus|transcription, DNA-dependent	nuclear chromatin				ovary(5)|breast(2)|pancreas(1)	8																		---	---	---	---
GLS2	27165	broad.mit.edu	37	12	56873870	56873870	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56873870delT	uc001slj.2	-						GLS2_uc009zos.2_Intron|GLS2_uc001slk.2_Intron|GLS2_uc009zot.2_Intron	NM_013267	NP_037399			glutaminase 2 precursor						cellular amino acid biosynthetic process|glutamate secretion|glutamine metabolic process|neurotransmitter secretion	mitochondrial matrix	glutaminase activity|protein binding			ovary(1)|central_nervous_system(1)	2					L-Glutamic Acid(DB00142)|L-Glutamine(DB00130)													---	---	---	---
LRP1	4035	broad.mit.edu	37	12	57537706	57537706	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57537706delG	uc001snd.2	+						LRP1_uc010sre.1_Intron|LRP1_uc001snb.2_Intron|LRP1_uc001snc.1_Intron	NM_002332	NP_002323			low density lipoprotein-related protein 1						aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)													---	---	---	---
CDK4	1019	broad.mit.edu	37	12	58145599	58145599	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:58145599delA	uc001spv.2	-						CDK4_uc010ssb.1_Intron|CDK4_uc001spw.2_Intron	NM_000075	NP_000066			cyclin-dependent kinase 4						cell division|G1 phase of mitotic cell cycle|G1/S transition of mitotic cell cycle|positive regulation of fibroblast proliferation|regulation of gene expression|response to drug|S phase of mitotic cell cycle	cyclin-dependent protein kinase holoenzyme complex|cytosol|membrane	ATP binding|cyclin-dependent protein kinase activity|protein binding			lung(1)|breast(1)|central_nervous_system(1)	3	all_cancers(7;4.96e-69)|Lung NSC(6;5.5e-25)|all_lung(6;3.87e-23)|all_epithelial(6;1.66e-15)|Glioma(12;6.95e-05)|all_neural(12;0.00016)|Melanoma(17;0.122)		GBM - Glioblastoma multiforme(5;4.21e-120)|all cancers(5;3.75e-83)|BRCA - Breast invasive adenocarcinoma(9;0.0294)					Mis			melanoma 			Hereditary_Melanoma				---	---	---	---
XRCC6BP1	91419	broad.mit.edu	37	12	58339650	58339651	+	Intron	DEL	TT	-	-	rs34127224		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:58339650_58339651delTT	uc001sqp.2	+							NM_033276	NP_150592			XRCC6 binding protein 1						double-strand break repair via nonhomologous end joining	DNA-dependent protein kinase-DNA ligase 4 complex	DNA-dependent protein kinase activity|metal ion binding|metalloendopeptidase activity			ovary(1)	1																		---	---	---	---
C12orf56	115749	broad.mit.edu	37	12	64746630	64746630	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:64746630delT	uc001ssa.3	-						uc001srx.2_Intron	NM_001099676	NP_001093146			hypothetical protein LOC115749												0			GBM - Glioblastoma multiforme(3;0.000582)	GBM - Glioblastoma multiforme(28;0.0259)														---	---	---	---
GNS	2799	broad.mit.edu	37	12	65133419	65133419	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:65133419delA	uc001ssg.3	-						GNS_uc001ssf.2_Intron|GNS_uc010ssq.1_Intron|GNS_uc010ssr.1_Intron	NM_002076	NP_002067			glucosamine (N-acetyl)-6-sulfatase precursor							lysosome	metal ion binding|N-acetylglucosamine-6-sulfatase activity|protein binding			central_nervous_system(1)	1	Lung NSC(1;7.25e-14)|all_lung(1;1.25e-12)		LUAD - Lung adenocarcinoma(6;0.115)	GBM - Glioblastoma multiforme(28;0.0435)														---	---	---	---
NUP107	57122	broad.mit.edu	37	12	69126366	69126366	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:69126366delA	uc001suf.2	+						NUP107_uc001sug.2_Intron|NUP107_uc010stj.1_Intron	NM_020401	NP_065134			nucleoporin 107kDa						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			skin(1)	1	Breast(13;6.25e-06)		Lung(24;0.000131)|LUAD - Lung adenocarcinoma(15;0.00107)|STAD - Stomach adenocarcinoma(21;0.00694)															---	---	---	---
RAB3IP	117177	broad.mit.edu	37	12	70195377	70195377	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:70195377delT	uc001svp.2	+						RAB3IP_uc001svm.2_Intron|RAB3IP_uc001svn.2_Intron|RAB3IP_uc001svo.2_Intron|RAB3IP_uc001svq.2_Intron|RAB3IP_uc001svr.2_Intron|RAB3IP_uc001svs.2_Intron|RAB3IP_uc001svt.2_Intron	NM_175623	NP_783322			RAB3A interacting protein isoform alpha 2						cilium assembly|Golgi to plasma membrane transport|protein localization to organelle|protein transport	actin cortical patch|centrosome|cytosol|lamellipodium|microtubule basal body|nucleus	guanyl-nucleotide exchange factor activity|protein binding			ovary(1)	1	Esophageal squamous(21;0.187)		Lung(24;0.000381)|OV - Ovarian serous cystadenocarcinoma(12;0.00168)|STAD - Stomach adenocarcinoma(21;0.00694)															---	---	---	---
Unknown	0	broad.mit.edu	37	12	74151336	74151337	+	IGR	INS	-	GAAG	GAAG	rs143357657	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:74151336_74151337insGAAG								None (None upstream) : ATXN7L3B (780214 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	12	77054687	77054687	+	IGR	DEL	T	-	-	rs2369296	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:77054687delT								OSBPL8 (101098 upstream) : ZDHHC17 (103167 downstream)																																			---	---	---	---
PPP1R12A	4659	broad.mit.edu	37	12	80328745	80328745	+	5'UTR	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:80328745delG	uc001syz.2	-	1					PPP1R12A_uc001sza.2_5'Flank|PPP1R12A_uc010sud.1_Intron|PPP1R12A_uc001szb.2_Intron|PPP1R12A_uc001szc.2_5'UTR	NM_002480	NP_002471			protein phosphatase 1, regulatory (inhibitor)							contractile fiber	protein binding|signal transducer activity			ovary(2)|breast(2)|large_intestine(1)|central_nervous_system(1)|skin(1)	7																		---	---	---	---
Unknown	0	broad.mit.edu	37	12	80658629	80658629	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:80658629delA								PPP1R12A (329394 upstream) : PTPRQ (179497 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	12	88214376	88214376	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:88214376delA								MGAT4C (981695 upstream) : C12orf50 (159440 downstream)																																			---	---	---	---
C12orf29	91298	broad.mit.edu	37	12	88441883	88441883	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:88441883delA	uc001tao.2	+						C12orf29_uc001tap.2_Intron|C12orf29_uc009zsk.2_Intron	NM_001009894	NP_001009894			hypothetical protein LOC91298												0																		---	---	---	---
PLXNC1	10154	broad.mit.edu	37	12	94620800	94620800	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:94620800delA	uc001tdc.2	+							NM_005761	NP_005752			plexin C1 precursor						axon guidance|cell adhesion	integral to membrane|intracellular|plasma membrane	receptor activity|receptor binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
ACTR6	64431	broad.mit.edu	37	12	100606439	100606439	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100606439delA	uc001thb.1	+						ACTR6_uc001thc.1_Intron|ACTR6_uc001thd.1_Intron|ACTR6_uc009ztu.1_Intron|ACTR6_uc001the.1_Intron|ACTR6_uc001thf.1_Intron|uc001thg.1_Intron	NM_022496	NP_071941			ARP6 actin-related protein 6 homolog							cytoplasm|cytoskeleton				ovary(1)	1																		---	---	---	---
ACTR6	64431	broad.mit.edu	37	12	100617458	100617458	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100617458delA	uc001thb.1	+						ACTR6_uc001thc.1_Intron|ACTR6_uc001thd.1_Intron|ACTR6_uc009ztu.1_Intron|ACTR6_uc001the.1_Intron|ACTR6_uc001thf.1_Intron|uc001thg.1_5'Flank	NM_022496	NP_071941			ARP6 actin-related protein 6 homolog							cytoplasm|cytoskeleton				ovary(1)	1																		---	---	---	---
STAB2	55576	broad.mit.edu	37	12	104102403	104102403	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104102403delT	uc001tjw.2	+							NM_017564	NP_060034			stabilin 2 precursor						angiogenesis|cell adhesion|defense response to bacterium|receptor-mediated endocytosis	cytoplasm|external side of plasma membrane|integral to plasma membrane	Gram-negative bacterial cell surface binding|hyaluronic acid binding|low-density lipoprotein receptor activity|protein disulfide oxidoreductase activity|scavenger receptor activity			ovary(9)|skin(5)	14																		---	---	---	---
TXNRD1	7296	broad.mit.edu	37	12	104725255	104725255	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104725255delT	uc010swk.1	+						TXNRD1_uc010swl.1_Intron|TXNRD1_uc010swm.1_Intron|TXNRD1_uc010swn.1_Intron|TXNRD1_uc010swo.1_Intron|TXNRD1_uc010swp.1_Intron|TXNRD1_uc010swq.1_Intron|TXNRD1_uc001tku.2_Intron|TXNRD1_uc009zun.2_Intron	NM_001093771	NP_001087240			thioredoxin reductase 1 isoform 3						cell redox homeostasis|cellular lipid metabolic process|electron transport chain|nucleobase, nucleoside and nucleotide interconversion|signal transduction|transport	cytosol|nucleolus	electron carrier activity|flavin adenine dinucleotide binding|NADP binding|protein disulfide oxidoreductase activity|thioredoxin-disulfide reductase activity				0																		---	---	---	---
GPN3	51184	broad.mit.edu	37	12	110895261	110895274	+	Intron	DEL	ACAAAAAAAAAAAA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:110895261_110895274delACAAAAAAAAAAAA	uc001tqr.2	-						GPN3_uc001tqs.2_Intron	NM_016301	NP_057385			GPN-loop GTPase 3 isoform 1							protein complex	GTP binding				0																		---	---	---	---
VPS29	51699	broad.mit.edu	37	12	110937392	110937392	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:110937392delA	uc001tqy.2	-						VPS29_uc001tqw.2_5'Flank|VPS29_uc001tqx.2_Intron|VPS29_uc001tqz.2_Intron|RAD9B_uc001trc.1_5'Flank|RAD9B_uc001trf.3_5'Flank|RAD9B_uc001trg.3_5'Flank|RAD9B_uc010sya.1_5'Flank|RAD9B_uc001tre.3_5'Flank|RAD9B_uc001trd.3_5'Flank	NM_016226	NP_057310			vacuolar protein sorting 29 isoform 1						protein transport	endosome membrane	metal ion binding|phosphoserine phosphatase activity				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	12	115324448	115324448	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:115324448delT								TBX3 (202479 upstream) : None (None downstream)																																			---	---	---	---
GCN1L1	10985	broad.mit.edu	37	12	120588741	120588743	+	Intron	DEL	AAA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:120588741_120588743delAAA	uc001txo.2	-							NM_006836	NP_006827			GCN1 general control of amino-acid synthesis						regulation of translation	ribosome	protein binding|translation factor activity, nucleic acid binding			ovary(4)	4	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---
HNF1A	6927	broad.mit.edu	37	12	121432117	121432118	+	Frame_Shift_Del	DEL	GC	-	-	rs56348580	byFrequency;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:121432117_121432118delGC	uc001tzg.2	+	4	887_888	c.864_865delGC	c.(862-867)GGGCCCfs	p.G288fs	HNF1A_uc001tze.1_Frame_Shift_Del_p.G288fs|HNF1A_uc001tzf.2_Frame_Shift_Del_p.G288fs|HNF1A_uc010szn.1_Frame_Shift_Del_p.G288fs	NM_000545	NP_000536	P20823	HNF1A_HUMAN	hepatic nuclear factor-1-alpha	288_289					glucose homeostasis|glucose import|insulin secretion|positive regulation of transcription initiation from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|renal glucose absorption	cytoplasm|nucleus|protein complex	DNA binding|protein dimerization activity|protein heterodimerization activity|protein homodimerization activity|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			liver(92)|large_intestine(15)|endometrium(6)|breast(2)|lung(1)	116	all_neural(191;0.0684)|Medulloblastoma(191;0.0922)													Hepatic_Adenoma_Familial_Clustering_of				---	---	---	---
KDM2B	84678	broad.mit.edu	37	12	122018158	122018158	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:122018158delG	uc001uat.2	-						KDM2B_uc001uas.2_5'UTR|KDM2B_uc001uau.2_Intron|KDM2B_uc001uav.3_Intron	NM_032590	NP_115979			F-box and leucine-rich repeat protein 10 isoform						embryonic camera-type eye morphogenesis|fourth ventricle development|histone H2A monoubiquitination|initiation of neural tube closure|lateral ventricle development|midbrain development|midbrain-hindbrain boundary morphogenesis|negative regulation of neural precursor cell proliferation|negative regulation of neuron apoptosis|negative regulation of transcription from RNA polymerase II promoter|spermatogenesis|third ventricle development|transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-K36 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|rRNA binding|zinc ion binding			ovary(1)|skin(1)	2																		---	---	---	---
KNTC1	9735	broad.mit.edu	37	12	123031923	123031923	+	Intron	DEL	A	-	-	rs74554972		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123031923delA	uc001ucv.2	+						KNTC1_uc010taf.1_Intron	NM_014708	NP_055523			Rough Deal homolog, centromere/kinetochore						cell division|mitotic cell cycle checkpoint|mitotic prometaphase|protein complex assembly|regulation of exit from mitosis	condensed chromosome kinetochore|cytosol|kinetochore microtubule|nucleus|spindle pole	protein binding			ovary(5)|kidney(3)|lung(1)|central_nervous_system(1)	10	all_neural(191;0.0837)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;7.21e-05)|Epithelial(86;0.000178)|BRCA - Breast invasive adenocarcinoma(302;0.217)														---	---	---	---
RILPL2	196383	broad.mit.edu	37	12	123900707	123900707	+	Intron	DEL	A	-	-	rs35289744		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123900707delA	uc001uey.1	-							NM_145058	NP_659495			Rab interacting lysosomal protein-like 2							cytosol|plasma membrane	identical protein binding				0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000546)|Epithelial(86;0.00179)|all cancers(50;0.0168)														---	---	---	---
PGAM5	192111	broad.mit.edu	37	12	133294826	133294827	+	Intron	INS	-	C	C	rs149250932	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:133294826_133294827insC	uc009zyv.2	+						PGAM5_uc010tbr.1_Intron|PGAM5_uc001uku.2_Intron	NM_138575	NP_612642			phosphoglycerate mutase family member 5							integral to membrane|mitochondrial outer membrane	phosphoprotein phosphatase activity				0	all_neural(191;0.0982)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;1.89e-08)|Epithelial(86;1.14e-07)|all cancers(50;3.57e-06)														---	---	---	---
GOLGA3	2802	broad.mit.edu	37	12	133363543	133363545	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:133363543_133363545delTTT	uc001ukz.1	-						GOLGA3_uc001ula.1_Intron|GOLGA3_uc001ulb.2_Intron	NM_005895	NP_005886			Golgi autoantigen, golgin subfamily a, 3						intra-Golgi vesicle-mediated transport	Golgi cisterna membrane|Golgi transport complex	protein binding|transporter activity			ovary(3)|central_nervous_system(2)|pancreas(1)	6	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0176)|Lung NSC(355;0.204)		OV - Ovarian serous cystadenocarcinoma(86;2.27e-08)|Epithelial(86;3.34e-07)|all cancers(50;9.4e-06)														---	---	---	---
Unknown	0	broad.mit.edu	37	13	19532389	19532389	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:19532389delT								LOC284232 (86280 upstream) : LOC348021 (50010 downstream)																																			---	---	---	---
RNF17	56163	broad.mit.edu	37	13	25362211	25362211	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25362211delA	uc001upr.2	+	7	738	c.697delA	c.(697-699)AAAfs	p.K233fs	RNF17_uc010tdd.1_Frame_Shift_Del_p.K92fs|RNF17_uc010aab.2_RNA|RNF17_uc010tde.1_Frame_Shift_Del_p.K233fs|RNF17_uc001ups.2_Frame_Shift_Del_p.K172fs|RNF17_uc001upq.1_Frame_Shift_Del_p.K233fs	NM_031277	NP_112567	Q9BXT8	RNF17_HUMAN	ring finger protein 17	233					multicellular organismal development	cytoplasm|nucleus	hydrolase activity, acting on ester bonds|nucleic acid binding|zinc ion binding			ovary(1)|skin(1)	2		Lung SC(185;0.0225)|Breast(139;0.077)		all cancers(112;0.0114)|OV - Ovarian serous cystadenocarcinoma(117;0.0311)|Epithelial(112;0.0524)														---	---	---	---
Unknown	0	broad.mit.edu	37	13	25761052	25761052	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25761052delT								FAM123A (14747 upstream) : MTMR6 (41255 downstream)																																			---	---	---	---
FRY	10129	broad.mit.edu	37	13	32805139	32805139	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:32805139delT	uc001utx.2	+						FRY_uc010tdw.1_Intron	NM_023037	NP_075463			furry homolog						regulation of transcription, DNA-dependent|transcription, DNA-dependent	integral to membrane				ovary(5)|large_intestine(1)|skin(1)	7		Lung SC(185;0.0271)		all cancers(112;4.81e-05)|Epithelial(112;0.000656)|OV - Ovarian serous cystadenocarcinoma(117;0.0123)|BRCA - Breast invasive adenocarcinoma(63;0.0295)|GBM - Glioblastoma multiforme(144;0.104)														---	---	---	---
BRCA2	675	broad.mit.edu	37	13	32950658	32950659	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:32950658_32950659insA	uc001uub.1	+							NM_000059	NP_000050			breast cancer 2, early onset						cell cycle cytokinesis|centrosome duplication|double-strand break repair via homologous recombination|negative regulation of mammary gland epithelial cell proliferation|nucleotide-excision repair|positive regulation of transcription, DNA-dependent|regulation of S phase of mitotic cell cycle	BRCA2-MAGE-D1 complex|centrosome|nucleoplasm|stored secretory granule	gamma-tubulin binding|H3 histone acetyltransferase activity|H4 histone acetyltransferase activity|protease binding|single-stranded DNA binding			ovary(20)|endometrium(8)|lung(7)|breast(7)|oesophagus(5)|large_intestine(4)|central_nervous_system(3)|pancreas(3)|skin(2)|upper_aerodigestive_tract(1)|cervix(1)|salivary_gland(1)|liver(1)|kidney(1)	64		Lung SC(185;0.0262)		all cancers(112;7.13e-07)|Epithelial(112;1.59e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.000732)|BRCA - Breast invasive adenocarcinoma(63;0.0291)|GBM - Glioblastoma multiforme(144;0.0704)				D|Mis|N|F|S		breast|ovarian|pancreatic	breast|ovarian|pancreatic|leukemia  (FANCB|FANCD1)		Direct_reversal_of_damage|Homologous_recombination	Fanconi_Anemia_type_D1_bi-allelic_BRCA2_mutations|Fanconi_Anemia|Pancreatic_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_BRCA2_type|Hereditary_Prostate_Cancer|Li-Fraumeni_syndrome	TCGA Ovarian(8;0.087)			---	---	---	---
C13orf36	400120	broad.mit.edu	37	13	37269030	37269030	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:37269030delT	uc001uvt.3	+							NM_203451	NP_982276			hypothetical protein LOC400120							integral to membrane				skin(1)	1																		---	---	---	---
COG6	57511	broad.mit.edu	37	13	40325365	40325365	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:40325365delT	uc001uxh.2	+	19					COG6_uc001uxi.2_3'UTR|COG6_uc010acb.2_Intron	NM_020751	NP_065802			component of oligomeric golgi complex 6 isoform						protein transport	Golgi membrane|Golgi transport complex				kidney(1)|skin(1)	2		Lung NSC(96;0.000124)|Breast(139;0.0199)|Prostate(109;0.0233)|Lung SC(185;0.0367)		all cancers(112;6.03e-09)|Epithelial(112;7e-07)|OV - Ovarian serous cystadenocarcinoma(117;0.00015)|BRCA - Breast invasive adenocarcinoma(63;0.00438)|GBM - Glioblastoma multiforme(144;0.0168)														---	---	---	---
MTRF1	9617	broad.mit.edu	37	13	41826691	41826691	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:41826691delA	uc001uxx.2	-						MTRF1_uc001uxy.2_Intron|MTRF1_uc001uxz.2_Intron|MTRF1_uc010tff.1_Intron|MTRF1_uc001uyc.1_Intron	NM_004294	NP_004285			mitochondrial translational release factor 1						regulation of translational termination	mitochondrion	translation release factor activity, codon specific				0		Lung NSC(96;4.52e-06)|Breast(139;0.00123)|Prostate(109;0.0181)|Lung SC(185;0.0262)|Hepatocellular(98;0.114)|Ovarian(182;0.125)		OV - Ovarian serous cystadenocarcinoma(117;4.24e-10)|all cancers(112;2.05e-09)|Epithelial(112;2.48e-09)|GBM - Glioblastoma multiforme(144;0.00115)|BRCA - Breast invasive adenocarcinoma(63;0.0721)|KIRC - Kidney renal clear cell carcinoma(186;0.248)														---	---	---	---
C13orf18	80183	broad.mit.edu	37	13	46919832	46919832	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:46919832delT	uc010acl.2	-						C13orf18_uc010tfy.1_Intron|C13orf18_uc001vbf.3_Intron|C13orf18_uc001vbg.3_Intron|C13orf18_uc010tfz.1_Intron|C13orf18_uc010acm.2_Intron|C13orf18_uc010acn.2_Intron|C13orf18_uc001vbe.3_Intron|C13orf18_uc001vbh.3_Intron|C13orf18_uc001vbi.3_Intron	NM_025113	NP_079389			hypothetical protein LOC80183												0		Lung NSC(96;2.31e-05)|Breast(56;8.04e-05)|Prostate(109;0.00217)|Hepatocellular(98;0.0207)|Lung SC(185;0.0262)	KIRC - Kidney renal clear cell carcinoma(16;0.234)	GBM - Glioblastoma multiforme(144;2.19e-05)														---	---	---	---
C13orf18	80183	broad.mit.edu	37	13	46942022	46942022	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:46942022delA	uc010acl.2	-						C13orf18_uc001vbf.3_Intron|C13orf18_uc001vbg.3_Intron|C13orf18_uc010tfz.1_Intron|C13orf18_uc010acm.2_Intron|C13orf18_uc010acn.2_Intron|C13orf18_uc001vbe.3_Intron|C13orf18_uc001vbh.3_Intron|C13orf18_uc001vbi.3_Intron|C13orf18_uc010aco.1_Intron	NM_025113	NP_079389			hypothetical protein LOC80183												0		Lung NSC(96;2.31e-05)|Breast(56;8.04e-05)|Prostate(109;0.00217)|Hepatocellular(98;0.0207)|Lung SC(185;0.0262)	KIRC - Kidney renal clear cell carcinoma(16;0.234)	GBM - Glioblastoma multiforme(144;2.19e-05)														---	---	---	---
RB1	5925	broad.mit.edu	37	13	48955364	48955364	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:48955364delT	uc001vcb.2	+							NM_000321	NP_000312			retinoblastoma 1						androgen receptor signaling pathway|cell cycle arrest|chromatin remodeling|G1 phase of mitotic cell cycle|interspecies interaction between organisms|maintenance of mitotic sister chromatid cohesion|mitotic cell cycle G1/S transition checkpoint|myoblast differentiation|negative regulation of cell growth|negative regulation of protein kinase activity|negative regulation of S phase of mitotic cell cycle|negative regulation of sequence-specific DNA binding transcription factor activity|positive regulation of mitotic metaphase/anaphase transition|protein localization to chromosome, centromeric region|Ras protein signal transduction|regulation of centromere complex assembly|regulation of cohesin localization to chromatin|regulation of lipid kinase activity|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle|sister chromatid biorientation	chromatin|PML body|Rb-E2F complex|SWI/SNF complex	androgen receptor binding|DNA binding|kinase binding|phosphoprotein binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription factor binding|ubiquitin protein ligase binding	p.?(7)		lung(94)|eye(89)|central_nervous_system(47)|bone(22)|breast(21)|urinary_tract(17)|haematopoietic_and_lymphoid_tissue(14)|ovary(10)|prostate(9)|soft_tissue(8)|skin(7)|endometrium(5)|cervix(3)|liver(3)|salivary_gland(2)|stomach(2)|oesophagus(1)|adrenal_gland(1)|kidney(1)|gastrointestinal_tract_(site_indeterminate)(1)|pituitary(1)	358		all_cancers(8;6.9e-71)|all_epithelial(8;4.61e-22)|Acute lymphoblastic leukemia(8;1.1e-21)|all_hematologic(8;2.3e-21)|all_lung(13;1.51e-09)|Lung NSC(96;7.03e-07)|Breast(56;1.53e-05)|Prostate(109;0.000493)|Myeloproliferative disorder(33;0.0179)|Hepatocellular(98;0.0207)|all_neural(104;0.0227)|Glioma(44;0.0286)|Lung SC(185;0.0301)		GBM - Glioblastoma multiforme(2;9.98e-18)|LUSC - Lung squamous cell carcinoma(3;0.013)	Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)		6	D|Mis|N|F|S		retinoblastoma|sarcoma|breast|small cell lung	retinoblastoma|sarcoma|breast|small cell lung			Hereditary_Retinoblastoma	TCGA GBM(7;6.82e-08)|TSP Lung(12;0.097)|TCGA Ovarian(6;0.080)			---	---	---	---
Unknown	0	broad.mit.edu	37	13	54615316	54615316	+	IGR	DEL	A	-	-	rs149312827		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:54615316delA								OLFM4 (989130 upstream) : MIR1297 (270791 downstream)																																			---	---	---	---
C13orf34	79866	broad.mit.edu	37	13	73317873	73317873	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:73317873delT	uc001viv.1	+						C13orf34_uc010thq.1_Intron|C13orf34_uc010aen.1_Intron|C13orf34_uc010thr.1_Intron|C13orf34_uc001viw.1_Intron	NM_024808	NP_079084			aurora borealis						cell division|mitosis|regulation of mitosis|regulation of mitotic spindle organization|regulation of protein localization		protein kinase binding				0		Breast(118;0.0735)		GBM - Glioblastoma multiforme(99;0.000227)														---	---	---	---
Unknown	0	broad.mit.edu	37	13	75588839	75588840	+	IGR	INS	-	CTTCCTTC	CTTCCTTC	rs9543833		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:75588839_75588840insCTTCCTTC								KLF12 (880445 upstream) : LOC647288 (223050 downstream)																																			---	---	---	---
MYCBP2	23077	broad.mit.edu	37	13	77780725	77780725	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:77780725delA	uc001vkf.2	-						MYCBP2_uc010aev.2_Intron	NM_015057	NP_055872			MYC binding protein 2						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ligase activity|protein binding|zinc ion binding			ovary(4)|breast(4)|skin(3)|lung(2)|pancreas(1)	14		Breast(118;0.212)|Acute lymphoblastic leukemia(28;0.22)		GBM - Glioblastoma multiforme(99;0.109)														---	---	---	---
DNAJC3	5611	broad.mit.edu	37	13	96375824	96375824	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:96375824delT	uc001vmq.2	+						DNAJC3_uc001vmp.2_Intron|DNAJC3_uc001vmr.2_Intron	NM_006260	NP_006251			DnaJ (Hsp40) homolog, subfamily C, member 3						protein folding|response to unfolded protein|response to virus		heat shock protein binding|protein kinase inhibitor activity|unfolded protein binding				0	all_neural(89;0.0878)|Breast(111;0.148)|Medulloblastoma(90;0.163)		BRCA - Breast invasive adenocarcinoma(86;0.126)															---	---	---	---
IPO5	3843	broad.mit.edu	37	13	98658181	98658181	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:98658181delA	uc001vnf.1	+						IPO5_uc001vne.2_Intron|IPO5_uc010tik.1_Intron|IPO5_uc010til.1_Intron|IPO5_uc001vng.1_Intron	NM_002271	NP_002262			importin 5						interspecies interaction between organisms|NLS-bearing substrate import into nucleus|ribosomal protein import into nucleus	cytoplasm|nuclear pore|nucleolus	GTPase inhibitor activity|protein transporter activity|Ran GTPase binding			ovary(1)|lung(1)|skin(1)	3																		---	---	---	---
CLYBL	171425	broad.mit.edu	37	13	100543380	100543380	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:100543380delT	uc001vok.2	+							NM_206808	NP_996531			citrate lyase beta like precursor						cellular aromatic compound metabolic process	citrate lyase complex|mitochondrion	citrate (pro-3S)-lyase activity|metal ion binding				0	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)																	---	---	---	---
TPP2	7174	broad.mit.edu	37	13	103257477	103257478	+	Intron	INS	-	CAGTAGTTCA	CAGTAGTTCA	rs145083043	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:103257477_103257478insCAGTAGTTCA	uc001vpi.3	+							NM_003291	NP_003282			tripeptidyl peptidase II						proteolysis	cytoplasm|nucleus	aminopeptidase activity|serine-type endopeptidase activity|tripeptidyl-peptidase activity			upper_aerodigestive_tract(1)|ovary(1)	2	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---
Unknown	0	broad.mit.edu	37	13	110078785	110078788	+	IGR	DEL	TCCT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:110078785_110078788delTCCT								MYO16 (218430 upstream) : IRS2 (327398 downstream)																																			---	---	---	---
CUL4A	8451	broad.mit.edu	37	13	113907562	113907562	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:113907562delT	uc010tjy.1	+						CUL4A_uc010tjx.1_Intron|CUL4A_uc010agu.2_Intron|CUL4A_uc010tjz.1_Intron	NM_001008895	NP_001008895			cullin 4A isoform 1						cell cycle arrest|DNA repair|G1/S transition of mitotic cell cycle|induction of apoptosis by intracellular signals|interspecies interaction between organisms|negative regulation of cell proliferation|ubiquitin-dependent protein catabolic process	Cul4A-RING ubiquitin ligase complex	ubiquitin protein ligase binding			central_nervous_system(2)|skin(1)	3	Lung NSC(43;0.0161)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)|Lung SC(71;0.218)	all_cancers(25;0.0482)|all_epithelial(44;0.0148)|all_lung(25;0.0271)|Lung NSC(25;0.0977)|Breast(118;0.188)	all cancers(43;0.112)															---	---	---	---
CCNB1IP1	57820	broad.mit.edu	37	14	20779552	20779552	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20779552delT	uc001vwv.2	-	7					CCNB1IP1_uc001vww.2_3'UTR|CCNB1IP1_uc001vwx.2_3'UTR|CCNB1IP1_uc001vwy.2_3'UTR|CCNB1IP1_uc001vwz.2_3'UTR	NM_182851	NP_878271			cyclin B1 interacting protein 1 isoform 3							chromosome|nucleus	ligase activity|metal ion binding|protein binding		HMGA2/CCNB1IP1(2)	soft_tissue(2)|ovary(1)	3	all_cancers(95;0.00092)	all_lung(585;0.235)	Epithelial(56;8.86e-07)|all cancers(55;4.98e-06)	GBM - Glioblastoma multiforme(265;0.0164)				T	HMGA2	leiomyoma								---	---	---	---
G2E3	55632	broad.mit.edu	37	14	31085902	31085902	+	3'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31085902delA	uc001wqk.2	+	15					G2E3_uc010tpf.1_3'UTR|G2E3_uc001wql.1_3'UTR	NM_017769	NP_060239			G2/M-phase specific E3 ubiquitin ligase						apoptosis|multicellular organismal development|protein modification process	Golgi apparatus|nucleolus	acid-amino acid ligase activity|protein binding|zinc ion binding			ovary(2)|skin(1)	3																		---	---	---	---
AP4S1	11154	broad.mit.edu	37	14	31553965	31553965	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31553965delT	uc001wqy.3	+						AP4S1_uc001wqw.3_Intron|AP4S1_uc001wqx.3_Intron|AP4S1_uc010amh.2_Intron|AP4S1_uc001wqz.3_Intron	NM_001128126	NP_001121598			adaptor-related protein complex 4, sigma 1							coated pit|Golgi apparatus	protein transporter activity				0	Hepatocellular(127;0.0877)|Breast(36;0.176)		LUAD - Lung adenocarcinoma(48;0.00292)|Lung(238;0.0164)|BRCA - Breast invasive adenocarcinoma(188;0.221)	GBM - Glioblastoma multiforme(265;0.00553)														---	---	---	---
HECTD1	25831	broad.mit.edu	37	14	31618434	31618434	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31618434delA	uc001wrc.1	-						HECTD1_uc001wrd.1_Intron	NM_015382	NP_056197			HECT domain containing 1						protein ubiquitination involved in ubiquitin-dependent protein catabolic process	intracellular	metal ion binding|protein binding|ubiquitin-protein ligase activity			ovary(3)|large_intestine(1)|lung(1)	5	Hepatocellular(127;0.0877)|Breast(36;0.176)		LUAD - Lung adenocarcinoma(48;0.00292)|Lung(238;0.0164)|BRCA - Breast invasive adenocarcinoma(188;0.111)|STAD - Stomach adenocarcinoma(7;0.173)	GBM - Glioblastoma multiforme(265;0.00617)														---	---	---	---
Unknown	0	broad.mit.edu	37	14	35390044	35390045	+	IGR	DEL	CT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:35390044_35390045delCT								BAZ1A (45191 upstream) : C14orf19 (19083 downstream)																																			---	---	---	---
PPP2R3C	55012	broad.mit.edu	37	14	35564160	35564160	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:35564160delA	uc001wss.2	-						PPP2R3C_uc001wst.2_Intron|PPP2R3C_uc010tpr.1_Intron|PPP2R3C_uc001wsu.2_Intron	NM_017917	NP_060387			serine/threonine-protein phosphatase 2A							centrosome|nucleus	calcium ion binding			ovary(1)	1	Breast(36;0.0545)|Hepatocellular(127;0.158)|Prostate(35;0.184)		Lung(238;8.62e-06)|LUAD - Lung adenocarcinoma(48;1.42e-05)|Epithelial(34;0.0177)|all cancers(34;0.0491)	GBM - Glioblastoma multiforme(112;0.0803)														---	---	---	---
FRMD6	122786	broad.mit.edu	37	14	52167757	52167757	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52167757delT	uc001wzd.2	+						FRMD6_uc001wzb.2_Intron|FRMD6_uc001wzc.2_Intron|FRMD6_uc001wze.2_Intron	NM_152330	NP_689543			FERM domain containing 6							cytoskeleton|mitochondrion|plasma membrane	binding			ovary(1)|breast(1)|central_nervous_system(1)	3	all_epithelial(31;0.0163)|Breast(41;0.089)																	---	---	---	---
PSMC6	5706	broad.mit.edu	37	14	53178422	53178422	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:53178422delT	uc010tqx.1	+						PSMC6_uc010tqw.1_Intron	NM_002806	NP_002797			proteasome 26S ATPase subunit 6						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	cytoplasm|nucleus|proteasome complex	ATP binding|ATPase activity|protein binding, bridging			lung(1)	1	Breast(41;0.176)																	---	---	---	---
DDHD1	80821	broad.mit.edu	37	14	53539436	53539436	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:53539436delA	uc001xai.2	-						DDHD1_uc001xaj.2_Intron|DDHD1_uc001xah.2_Intron|DDHD1_uc001xag.2_Intron	NM_001160148	NP_001153620			DDHD domain containing 1 isoform c						lipid catabolic process	cytoplasm	hydrolase activity|metal ion binding			ovary(2)	2	Breast(41;0.037)																	---	---	---	---
HIF1A	3091	broad.mit.edu	37	14	62194113	62194113	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:62194113delT	uc001xfq.2	+						HIF1A_uc001xfr.2_Intron|HIF1A_uc001xfs.2_Intron	NM_001530	NP_001521			hypoxia-inducible factor 1, alpha subunit						cellular response to hypoxia|collagen metabolic process|connective tissue replacement involved in inflammatory response wound healing|elastin metabolic process|epithelial to mesenchymal transition|oxygen homeostasis|positive regulation of chemokine production|positive regulation of epithelial cell migration|positive regulation of hormone biosynthetic process|positive regulation of nitric-oxide synthase activity|positive regulation of transcription from RNA polymerase II promoter|positive regulation vascular endothelial growth factor production|regulation of transcription from RNA polymerase II promoter in response to oxidative stress|regulation of transforming growth factor-beta2 production	cytoplasm|nucleolus|transcription factor complex	histone acetyltransferase binding|Hsp90 protein binding|protein heterodimerization activity|sequence-specific enhancer binding RNA polymerase II transcription factor activity|signal transducer activity|transcription factor binding|transcription regulatory region DNA binding			kidney(3)|lung(1)	4				OV - Ovarian serous cystadenocarcinoma(108;1.62e-09)|BRCA - Breast invasive adenocarcinoma(234;0.189)														---	---	---	---
SYNE2	23224	broad.mit.edu	37	14	64691081	64691081	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64691081delA	uc001xgm.2	+						SYNE2_uc001xgl.2_Intron|SYNE2_uc010apy.2_Intron|SYNE2_uc001xgn.2_Intron|SYNE2_uc001xgo.2_Intron|SYNE2_uc010aqa.2_Intron|SYNE2_uc001xgq.2_Intron|SYNE2_uc001xgr.2_Intron|SYNE2_uc010tsi.1_Intron|SYNE2_uc001xgs.2_Intron|SYNE2_uc001xgt.2_Intron	NM_015180	NP_055995			spectrin repeat containing, nuclear envelope 2						centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)														---	---	---	---
Unknown	0	broad.mit.edu	37	14	68082888	68082888	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:68082888delA								PIGH (15871 upstream) : ARG2 (3691 downstream)																																			---	---	---	---
PROX2	283571	broad.mit.edu	37	14	75323826	75323826	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75323826delA	uc001xqr.1	-						uc001xqp.1_5'Flank|PROX2_uc001xqq.1_Intron	NM_001080408	NP_001073877			prospero homeobox 2						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding				0			KIRC - Kidney renal clear cell carcinoma(43;0.238)	BRCA - Breast invasive adenocarcinoma(234;0.00652)														---	---	---	---
FLRT2	23768	broad.mit.edu	37	14	86090075	86090076	+	3'UTR	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:86090075_86090076delAA	uc001xvr.2	+	2					FLRT2_uc010atd.2_3'UTR	NM_013231	NP_037363			fibronectin leucine rich transmembrane protein 2						cell adhesion	integral to plasma membrane|proteinaceous extracellular matrix	protein binding, bridging|receptor signaling protein activity			ovary(3)|haematopoietic_and_lymphoid_tissue(1)	4				BRCA - Breast invasive adenocarcinoma(234;0.0319)														---	---	---	---
TTC7B	145567	broad.mit.edu	37	14	91252775	91252775	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:91252775delC	uc001xyp.2	-							NM_001010854	NP_001010854			tetratricopeptide repeat domain 7B								binding			ovary(2)	2		Melanoma(154;0.222)																---	---	---	---
UBR7	55148	broad.mit.edu	37	14	93685401	93685401	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:93685401delA	uc001ybm.3	+						UBR7_uc001ybn.3_Intron|UBR7_uc010auq.2_Intron	NM_175748	NP_786924			ubiquitin protein ligase E3 component n-recognin								ubiquitin-protein ligase activity|zinc ion binding				0																		---	---	---	---
AK7	122481	broad.mit.edu	37	14	96938100	96938100	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:96938100delT	uc001yfn.2	+							NM_152327	NP_689540			adenylate kinase 7						cell projection organization	cytosol	adenylate kinase activity|ATP binding|cytidylate kinase activity			ovary(1)	1		all_cancers(154;0.0482)|all_epithelial(191;0.128)|Melanoma(154;0.155)		Epithelial(152;0.134)|COAD - Colon adenocarcinoma(157;0.228)														---	---	---	---
DYNC1H1	1778	broad.mit.edu	37	14	102450010	102450010	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:102450010delT	uc001yks.2	+							NM_001376	NP_001367			cytoplasmic dynein 1 heavy chain 1						cytoplasmic mRNA processing body assembly|G2/M transition of mitotic cell cycle|microtubule-based movement|mitotic spindle organization|stress granule assembly|transport	centrosome|cytoplasmic dynein complex|cytosol|Golgi apparatus|microtubule	ATP binding|ATPase activity, coupled|microtubule motor activity|protein binding			ovary(7)|central_nervous_system(2)|pancreas(1)	10																		---	---	---	---
TECPR2	9895	broad.mit.edu	37	14	102891807	102891807	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:102891807delA	uc001ylw.1	+						TECPR2_uc010awl.2_Intron|TECPR2_uc010txx.1_Intron	NM_014844	NP_055659			tectonin beta-propeller repeat containing 2								protein binding			lung(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
Unknown	0	broad.mit.edu	37	14	103031010	103031011	+	IGR	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103031010_103031011insT								ANKRD9 (54882 upstream) : RCOR1 (28222 downstream)																																			---	---	---	---
BRF1	2972	broad.mit.edu	37	14	105694881	105694881	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:105694881delA	uc001yqp.2	-						BRF1_uc010tyo.1_Intron|BRF1_uc010typ.1_Intron|BRF1_uc001yql.2_Intron|BRF1_uc001yqo.2_Intron|BRF1_uc010axg.1_Intron|BRF1_uc001yqn.2_Intron|BRF1_uc010axh.1_Intron|BRF1_uc010axj.1_Intron	NM_001519	NP_001510			transcription initiation factor IIIB isoform 1						positive regulation of transcription, DNA-dependent|rRNA transcription|transcription initiation from RNA polymerase III promoter|tRNA transcription	transcription factor TFIIIB complex	translation initiation factor activity|zinc ion binding			large_intestine(1)|ovary(1)|central_nervous_system(1)|skin(1)	4		all_cancers(154;0.0231)|all_epithelial(191;0.0694)|Melanoma(154;0.155)	OV - Ovarian serous cystadenocarcinoma(23;0.00753)|all cancers(16;0.00925)|Epithelial(46;0.0221)	Epithelial(152;0.14)														---	---	---	---
SNORD116-4	100033416	broad.mit.edu	37	15	25319393	25319393	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25319393delG	uc001yxh.1	+						SNORD116-4_uc001yxm.1_Intron|IPW_uc001yxn.3_Intron|SNORD116-11_uc001yxu.2_5'Flank|SNORD116-12_uc001yxv.1_5'Flank					Homo sapiens clone kid4 SNURF-SNRPN mRNA, downstream untranslated exons, alternatively spliced.												0																		---	---	---	---
TRPM1	4308	broad.mit.edu	37	15	31293996	31293996	+	3'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:31293996delA	uc001zfm.2	-	27					TRPM1_uc010azy.2_3'UTR|TRPM1_uc001zfl.2_RNA	NM_002420	NP_002411			transient receptor potential cation channel,						cellular response to light stimulus|visual perception	integral to plasma membrane	calcium channel activity|receptor activity			ovary(2)|pancreas(1)|skin(1)	4		all_lung(180;1.92e-11)		all cancers(64;3.52e-16)|Epithelial(43;1.65e-11)|GBM - Glioblastoma multiforme(186;3.57e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00533)|COAD - Colon adenocarcinoma(236;0.0609)|Lung(196;0.199)														---	---	---	---
Unknown	0	broad.mit.edu	37	15	32635922	32635923	+	5'Flank	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:32635922_32635923delTT	uc001zfv.1	-						uc001zfw.1_5'Flank					Homo sapiens cDNA FLJ43588 fis, clone SKNSH2009991.																														---	---	---	---
ARHGAP11A	9824	broad.mit.edu	37	15	32908709	32908710	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:32908709_32908710delTT	uc001zgy.1	+						ARHGAP11A_uc010ubw.1_Intron|ARHGAP11A_uc001zgw.2_Intron|ARHGAP11A_uc001zgx.2_Intron|ARHGAP11A_uc010ubx.1_Intron	NM_014783	NP_055598			Rho GTPase activating protein 11A isoform 1						regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			skin(3)|breast(2)|urinary_tract(1)	6		all_lung(180;1.3e-11)		all cancers(64;3.34e-21)|Epithelial(43;2.64e-15)|GBM - Glioblastoma multiforme(186;5.17e-06)|BRCA - Breast invasive adenocarcinoma(123;0.00112)|Lung(196;0.227)														---	---	---	---
RASGRP1	10125	broad.mit.edu	37	15	38792548	38792549	+	Intron	DEL	TG	-	-	rs12904148	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:38792548_38792549delTG	uc001zke.3	-						RASGRP1_uc010bbe.2_Intron|RASGRP1_uc010bbf.2_Intron|RASGRP1_uc010bbg.2_Intron|RASGRP1_uc001zkd.3_Intron	NM_005739	NP_005730			RAS guanyl releasing protein 1 isoform a						cell differentiation|platelet activation|Ras protein signal transduction|regulation of small GTPase mediated signal transduction	cytosol|endoplasmic reticulum membrane|Golgi membrane|membrane fraction|plasma membrane	calcium ion binding|guanyl-nucleotide exchange factor activity|lipid binding|protein binding			large_intestine(1)|ovary(1)	2		all_cancers(109;6.38e-17)|all_epithelial(112;5.51e-15)|Lung NSC(122;2.12e-11)|all_lung(180;5.63e-10)|Melanoma(134;0.0574)		GBM - Glioblastoma multiforme(113;1.97e-07)|BRCA - Breast invasive adenocarcinoma(123;0.00248)														---	---	---	---
RASGRP1	10125	broad.mit.edu	37	15	38804888	38804889	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:38804888_38804889insA	uc001zke.3	-						RASGRP1_uc010bbe.2_Intron|RASGRP1_uc010bbf.2_Intron|RASGRP1_uc010bbg.2_Intron|RASGRP1_uc001zkd.3_Intron	NM_005739	NP_005730			RAS guanyl releasing protein 1 isoform a						cell differentiation|platelet activation|Ras protein signal transduction|regulation of small GTPase mediated signal transduction	cytosol|endoplasmic reticulum membrane|Golgi membrane|membrane fraction|plasma membrane	calcium ion binding|guanyl-nucleotide exchange factor activity|lipid binding|protein binding			large_intestine(1)|ovary(1)	2		all_cancers(109;6.38e-17)|all_epithelial(112;5.51e-15)|Lung NSC(122;2.12e-11)|all_lung(180;5.63e-10)|Melanoma(134;0.0574)		GBM - Glioblastoma multiforme(113;1.97e-07)|BRCA - Breast invasive adenocarcinoma(123;0.00248)														---	---	---	---
NUSAP1	51203	broad.mit.edu	37	15	41657842	41657842	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41657842delA	uc001zns.3	+						NUSAP1_uc001znq.3_Intron|NUSAP1_uc001znr.3_Intron|NUSAP1_uc010bce.2_Intron|NUSAP1_uc001znt.3_Intron|NUSAP1_uc001znv.3_Intron|NUSAP1_uc001znu.3_Intron|NUSAP1_uc010ucw.1_Intron|NUSAP1_uc001znw.3_Intron	NM_016359	NP_057443			nucleolar and spindle associated protein 1						cytokinesis after mitosis|establishment of mitotic spindle localization|mitotic chromosome condensation|positive regulation of mitosis	chromosome|cytoplasm|nucleolus	DNA binding				0		all_cancers(109;5.07e-19)|all_epithelial(112;2.43e-16)|Lung NSC(122;1.81e-11)|all_lung(180;4.81e-10)|Melanoma(134;0.0179)|Colorectal(260;0.0946)|Ovarian(310;0.143)		OV - Ovarian serous cystadenocarcinoma(18;9.63e-17)|GBM - Glioblastoma multiforme(113;1.59e-06)|BRCA - Breast invasive adenocarcinoma(123;0.168)														---	---	---	---
SPTBN5	51332	broad.mit.edu	37	15	42168855	42168855	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42168855delG	uc001zos.2	-							NM_016642	NP_057726			spectrin, beta, non-erythrocytic 5						actin cytoskeleton organization|actin filament capping|axon guidance	cytosol|membrane|spectrin				ovary(1)|central_nervous_system(1)	2		all_cancers(109;1.84e-17)|all_epithelial(112;1.12e-15)|Lung NSC(122;7.6e-10)|all_lung(180;4.15e-09)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.173)		all cancers(2;4.33e-34)|Epithelial(2;1.72e-25)|OV - Ovarian serous cystadenocarcinoma(18;8.32e-20)|GBM - Glioblastoma multiforme(94;4.69e-07)|Colorectal(2;0.00104)|COAD - Colon adenocarcinoma(120;0.0405)|READ - Rectum adenocarcinoma(92;0.0908)														---	---	---	---
Unknown	0	broad.mit.edu	37	15	43993324	43993324	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43993324delA								CKMT1A (1905 upstream) : CATSPER2P1 (34824 downstream)																																			---	---	---	---
PDIA3	2923	broad.mit.edu	37	15	44060896	44060896	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:44060896delT	uc001zsu.2	+						PDIA3_uc010bdp.2_Intron|PDIA3_uc010ued.1_Intron	NM_005313	NP_005304			protein disulfide-isomerase A3 precursor						cell redox homeostasis|glycerol ether metabolic process|post-translational protein modification|protein folding|protein import into nucleus|protein N-linked glycosylation via asparagine|protein retention in ER lumen|signal transduction	endoplasmic reticulum lumen|melanosome	cysteine-type endopeptidase activity|electron carrier activity|phospholipase C activity|protein binding|protein disulfide isomerase activity|protein disulfide oxidoreductase activity			ovary(1)|skin(1)	2		all_cancers(109;2.61e-15)|all_epithelial(112;1.12e-12)|Lung NSC(122;2.17e-08)|all_lung(180;2.45e-07)|Melanoma(134;0.027)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;9.48e-07)														---	---	---	---
SPG11	80208	broad.mit.edu	37	15	44925881	44925881	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:44925881delA	uc001ztx.2	-						SPG11_uc010ueh.1_Intron|SPG11_uc010uei.1_Intron|SPG11_uc001zua.1_Intron	NM_025137	NP_079413			spatacsin isoform 1						cell death	cytosol|integral to membrane|nucleus	protein binding			ovary(4)|skin(1)	5		all_cancers(109;1.29e-14)|all_epithelial(112;1.26e-12)|Lung NSC(122;1.34e-07)|all_lung(180;1.21e-06)|Melanoma(134;0.0122)		all cancers(107;2.93e-22)|GBM - Glioblastoma multiforme(94;1.55e-06)|COAD - Colon adenocarcinoma(120;0.0432)|Colorectal(105;0.0484)|Lung(196;0.104)|LUSC - Lung squamous cell carcinoma(244;0.214)														---	---	---	---
TRPM7	54822	broad.mit.edu	37	15	50862222	50862222	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:50862222delA	uc001zyt.3	-						TRPM7_uc001zyr.2_Intron	NM_017672	NP_060142			transient receptor potential cation channel,						cell death	integral to membrane	ATP binding|calcium channel activity|metal ion binding|protein serine/threonine kinase activity			ovary(4)|stomach(3)|breast(1)|central_nervous_system(1)|skin(1)	10				all cancers(107;0.000819)|GBM - Glioblastoma multiforme(94;0.0045)														---	---	---	---
AP4E1	23431	broad.mit.edu	37	15	51276506	51276506	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:51276506delT	uc001zyx.1	+							NM_007347	NP_031373			adaptor-related protein complex 4, epsilon 1						intracellular protein transport|vesicle-mediated transport	COPI vesicle coat	binding|structural molecule activity				0				all cancers(107;0.000893)|GBM - Glioblastoma multiforme(94;0.00364)														---	---	---	---
NEDD4	4734	broad.mit.edu	37	15	56144502	56144503	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:56144502_56144503delAA	uc002adj.2	-						NEDD4_uc002adl.2_Intron|NEDD4_uc002adi.2_Intron|NEDD4_uc010ugj.1_Intron|NEDD4_uc010bfm.2_Intron|NEDD4_uc002adk.2_Intron	NM_198400	NP_006145			neural precursor cell expressed, developmentally						development involved in symbiotic interaction|glucocorticoid receptor signaling pathway|negative regulation of sodium ion transport|negative regulation of transcription from RNA polymerase II promoter in response to UV-induced DNA damage|negative regulation of vascular endothelial growth factor receptor signaling pathway|neuron projection development|positive regulation of nucleocytoplasmic transport|positive regulation of phosphatidylinositol 3-kinase cascade|positive regulation of protein catabolic process|progesterone receptor signaling pathway|protein K63-linked ubiquitination|protein targeting to lysosome|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|receptor catabolic process|receptor internalization|regulation of dendrite morphogenesis|response to calcium ion|transmission of virus	apicolateral plasma membrane|cell cortex|chromatin|cytosol|perinuclear region of cytoplasm|ubiquitin ligase complex	beta-2 adrenergic receptor binding|phosphoserine binding|phosphothreonine binding|proline-rich region binding|protein domain specific binding|RNA polymerase binding|sodium channel inhibitor activity|ubiquitin binding|ubiquitin-protein ligase activity			skin(2)|ovary(1)|breast(1)	4				all cancers(107;0.0299)|GBM - Glioblastoma multiforme(80;0.113)														---	---	---	---
RNF111	54778	broad.mit.edu	37	15	59359441	59359441	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59359441delT	uc002afv.2	+						RNF111_uc002afs.2_Intron|RNF111_uc002aft.2_Intron|RNF111_uc002afu.2_Intron|RNF111_uc002afw.2_Intron|RNF111_uc002afx.2_Intron	NM_017610	NP_060080			ring finger protein 111						multicellular organismal development|positive regulation of transcription, DNA-dependent	cytoplasm|nucleus	protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(2)	2				all cancers(107;0.194)														---	---	---	---
Unknown	0	broad.mit.edu	37	15	60257613	60257613	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:60257613delA								BNIP2 (275971 upstream) : FOXB1 (38808 downstream)																																			---	---	---	---
TLN2	83660	broad.mit.edu	37	15	62999154	62999154	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:62999154delA	uc002alb.3	+							NM_015059	NP_055874			talin 2						cell adhesion|cell-cell junction assembly|cytoskeletal anchoring at plasma membrane	actin cytoskeleton|cytoplasm|focal adhesion|ruffle|synapse	actin binding|insulin receptor binding|structural constituent of cytoskeleton			ovary(5)|upper_aerodigestive_tract(2)|lung(2)|breast(2)	11																		---	---	---	---
SPG21	51324	broad.mit.edu	37	15	65268770	65268770	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65268770delA	uc002aod.2	-						SPG21_uc002aoe.2_Intron|SPG21_uc010bhb.2_Intron|SPG21_uc010bhc.2_Intron	NM_001127889	NP_001121361			spastic paraplegia 21 isoform a						cell death	cytosol|endosome membrane|trans-Golgi network transport vesicle	CD4 receptor binding				0																		---	---	---	---
PDCD7	10081	broad.mit.edu	37	15	65412483	65412483	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65412483delT	uc002aol.2	-							NM_005707	NP_005698			programmed cell death 7						apoptosis|induction of apoptosis|response to glucocorticoid stimulus	U12-type spliceosomal complex					0																		---	---	---	---
RPL4	6124	broad.mit.edu	37	15	66795292	66795292	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:66795292delA	uc002apv.2	-						RPL4_uc010bhr.2_Intron|RPL4_uc002apw.2_Intron|RPL4_uc002apx.2_Intron|RPL4_uc010ujq.1_Intron|SNORD18C_uc010bhs.1_5'Flank|SNORD18B_uc002apy.1_5'Flank|SNORD16_uc010bht.2_5'Flank|ZWILCH_uc010bhu.1_5'Flank|ZWILCH_uc002aqb.2_5'Flank|ZWILCH_uc002aqa.2_5'Flank|ZWILCH_uc010bhv.2_5'Flank	NM_000968	NP_000959			ribosomal protein L4						endocrine pancreas development|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit|nucleolus	protein binding|RNA binding|structural constituent of ribosome				0																		---	---	---	---
ZWILCH	55055	broad.mit.edu	37	15	66828148	66828148	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:66828148delT	uc002aqb.2	+						ZWILCH_uc010bhu.1_Intron|ZWILCH_uc002aqa.2_Intron|ZWILCH_uc010bhv.2_Intron	NM_017975	NP_060445			Zwilch						cell division|mitotic cell cycle checkpoint|mitotic prometaphase	condensed chromosome kinetochore|cytosol	protein binding			ovary(1)	1																		---	---	---	---
AAGAB	79719	broad.mit.edu	37	15	67496224	67496224	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:67496224delT	uc002aqk.3	-						AAGAB_uc002aql.2_Intron|AAGAB_uc010uju.1_Intron	NM_024666	NP_078942			alpha- and gamma-adaptin-binding protein p34						protein transport	cytoplasm					0																		---	---	---	---
NEO1	4756	broad.mit.edu	37	15	73541648	73541648	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:73541648delA	uc002avm.3	+						NEO1_uc010ukx.1_Intron|NEO1_uc010uky.1_Intron|NEO1_uc010ukz.1_Intron|NEO1_uc002avn.3_Intron	NM_002499	NP_002490			neogenin homolog 1 precursor						axon guidance|cell adhesion|positive regulation of muscle cell differentiation	Golgi apparatus|integral to plasma membrane|nucleus				pancreas(1)	1																		---	---	---	---
SCAMP2	10066	broad.mit.edu	37	15	75137221	75137221	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75137221delT	uc002azb.1	-	9					ULK3_uc010ulp.1_5'Flank|ULK3_uc010ulq.1_5'Flank|ULK3_uc010ulr.1_5'Flank|ULK3_uc010bkf.1_5'Flank|ULK3_uc002ayv.2_5'Flank|ULK3_uc010uls.1_5'Flank|ULK3_uc010ult.1_5'Flank|ULK3_uc010ulu.1_5'Flank|SCAMP2_uc002aza.1_3'UTR|SCAMP2_uc010bkg.1_RNA	NM_005697	NP_005688			secretory carrier membrane protein 2						post-Golgi vesicle-mediated transport|protein transport	integral to membrane|nucleus|recycling endosome membrane|trans-Golgi network membrane	protein binding			ovary(1)	1																		---	---	---	---
SIN3A	25942	broad.mit.edu	37	15	75676395	75676395	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75676395delT	uc002bai.2	-						SIN3A_uc002baj.2_Intron|SIN3A_uc010uml.1_Intron	NM_015477	NP_056292			transcriptional co-repressor Sin3A						blood coagulation|cellular lipid metabolic process|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus|Sin3 complex	protein binding			skin(3)|ovary(1)|lung(1)	5																		---	---	---	---
ETFA	2108	broad.mit.edu	37	15	76576183	76576183	+	Intron	DEL	A	-	-	rs144403864		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:76576183delA	uc002bbt.2	-						ETFA_uc010bkq.1_Intron|ETFA_uc002bbu.1_Intron	NM_000126	NP_000117			electron transfer flavoprotein, alpha						respiratory electron transport chain|transport	mitochondrial matrix	electron carrier activity|flavin adenine dinucleotide binding|oxidoreductase activity				0																		---	---	---	---
ETFA	2108	broad.mit.edu	37	15	76577920	76577920	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:76577920delA	uc002bbt.2	-						ETFA_uc010bkq.1_Intron|ETFA_uc002bbu.1_Intron	NM_000126	NP_000117			electron transfer flavoprotein, alpha						respiratory electron transport chain|transport	mitochondrial matrix	electron carrier activity|flavin adenine dinucleotide binding|oxidoreductase activity				0																		---	---	---	---
IREB2	3658	broad.mit.edu	37	15	78758544	78758544	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:78758544delT	uc002bdr.2	+						IREB2_uc010unb.1_Intron|IREB2_uc002bdq.2_Intron	NM_004136	NP_004127			iron-responsive element binding protein 2								4 iron, 4 sulfur cluster binding|metal ion binding|protein binding				0				UCEC - Uterine corpus endometrioid carcinoma (272;0.232)														---	---	---	---
MTHFS	10588	broad.mit.edu	37	15	80181816	80181817	+	Intron	DEL	AG	-	-	rs74835341		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:80181816_80181817delAG	uc002bex.3	-							NM_006441	NP_006432			5,10-methenyltetrahydrofolate synthetase						folic acid-containing compound biosynthetic process|formate metabolic process|tetrahydrofolate metabolic process	cytosol|Golgi apparatus|plasma membrane	5-formyltetrahydrofolate cyclo-ligase activity|ATP binding|folic acid binding				0				all cancers(203;0.00467)														---	---	---	---
C15orf26	161502	broad.mit.edu	37	15	81436282	81436282	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:81436282delT	uc002bgb.2	+							NM_173528	NP_775799			hypothetical protein LOC161502												0																		---	---	---	---
Unknown	0	broad.mit.edu	37	15	85070266	85070267	+	IGR	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:85070266_85070267insA								GOLGA6L5 (10188 upstream) : UBE2Q2P1 (160 downstream)																																			---	---	---	---
SLC28A1	9154	broad.mit.edu	37	15	85478939	85478939	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:85478939delT	uc002blg.2	+						SLC28A1_uc010bnb.2_Intron|SLC28A1_uc010upe.1_Intron|SLC28A1_uc010upf.1_Intron|SLC28A1_uc010upg.1_Intron	NM_004213	NP_004204			solute carrier family 28, member 1 isoform 1						nucleobase, nucleoside and nucleotide metabolic process	integral to plasma membrane|membrane fraction	nucleoside binding			skin(2)|ovary(1)	3			BRCA - Breast invasive adenocarcinoma(143;0.0587)															---	---	---	---
Unknown	0	broad.mit.edu	37	15	85785266	85785266	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:85785266delT	uc010upj.1	+							NM_198181	NP_937824			golgi autoantigen, golgin subfamily a, 6D-like																														---	---	---	---
BLM	641	broad.mit.edu	37	15	91308328	91308328	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91308328delT	uc002bpr.2	+						BLM_uc010uqh.1_Intron|BLM_uc010uqi.1_Intron|BLM_uc010bnx.2_Intron|BLM_uc002bps.1_Intron	NM_000057	NP_000048			Bloom syndrome protein						double-strand break repair via homologous recombination|G2 phase of mitotic cell cycle|G2/M transition DNA damage checkpoint|negative regulation of cell division|positive regulation of transcription, DNA-dependent|protein oligomerization|regulation of cyclin-dependent protein kinase activity|replication fork processing|replication fork protection|response to X-ray	cytoplasm|lateral element|nuclear matrix|nucleolus|PML body	ATP binding|bubble DNA binding|DNA strand annealing activity|four-way junction helicase activity|G-quadruplex DNA binding|p53 binding			ovary(3)|skin(2)|breast(1)	6	Lung NSC(78;0.0875)|all_lung(78;0.109)		Lung(145;0.189)					Mis|N|F			leukemia|lymphoma|skin squamous cell |other cancers		Genes_defective_in_diseases_associated_with_sensitivity_to_DNA_damaging_agents	Bloom_syndrome				---	---	---	---
Unknown	0	broad.mit.edu	37	15	95310819	95310826	+	IGR	DEL	AGGAAGGA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:95310819_95310826delAGGAAGGA								MCTP2 (283639 upstream) : LOC145820 (665496 downstream)																																			---	---	---	---
LRRC28	123355	broad.mit.edu	37	15	99903128	99903128	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:99903128delA	uc002bva.1	+						LRRC28_uc010urs.1_Intron|LRRC28_uc002bvb.1_Intron|LRRC28_uc010urt.1_Intron|LRRC28_uc002bvc.1_Intron|LRRC28_uc010uru.1_Intron|LRRC28_uc002bvd.1_Intron	NM_144598	NP_653199			leucine rich repeat containing 28												0	Lung NSC(78;0.00175)|all_lung(78;0.00351)|Melanoma(26;0.00778)|Medulloblastoma(229;0.163)		OV - Ovarian serous cystadenocarcinoma(32;0.00106)															---	---	---	---
LRRC28	123355	broad.mit.edu	37	15	99925952	99925952	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:99925952delT	uc002bva.1	+						LRRC28_uc002bvb.1_Intron|LRRC28_uc010urt.1_Intron|LRRC28_uc002bvc.1_Intron|LRRC28_uc010uru.1_Intron|LRRC28_uc002bvd.1_Intron	NM_144598	NP_653199			leucine rich repeat containing 28												0	Lung NSC(78;0.00175)|all_lung(78;0.00351)|Melanoma(26;0.00778)|Medulloblastoma(229;0.163)		OV - Ovarian serous cystadenocarcinoma(32;0.00106)															---	---	---	---
ADCY9	115	broad.mit.edu	37	16	4027728	4027728	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:4027728delT	uc002cvx.2	-							NM_001116	NP_001107			adenylate cyclase 9						activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|synaptic transmission|transmembrane transport|water transport	integral to plasma membrane	adenylate cyclase activity|ATP binding|metal ion binding			ovary(4)|large_intestine(1)|central_nervous_system(1)	6																		---	---	---	---
C16orf68	79091	broad.mit.edu	37	16	8729323	8729323	+	Intron	DEL	A	-	-	rs1731043	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:8729323delA	uc002cyz.2	+						C16orf68_uc002cza.2_Intron	NM_024109	NP_077014			hypothetical protein LOC79091								methyltransferase activity				0																OREG0023592	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
USP7	7874	broad.mit.edu	37	16	8994680	8994680	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:8994680delA	uc002czl.2	-						USP7_uc010uyk.1_Intron|USP7_uc002czj.2_Intron|USP7_uc010uyj.1_Intron|USP7_uc002czk.2_Intron	NM_003470	NP_003461			ubiquitin specific peptidase 7						interspecies interaction between organisms|multicellular organismal development|protein deubiquitination|regulation of sequence-specific DNA binding transcription factor activity|ubiquitin-dependent protein catabolic process	cytoplasm|PML body	cysteine-type endopeptidase activity|p53 binding|protein C-terminus binding|transcription factor binding|ubiquitin protein ligase binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(3)	3																		---	---	---	---
FAM18A	780776	broad.mit.edu	37	16	10867203	10867203	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:10867203delA	uc010buo.1	-	5	691	c.420delT	c.(418-420)TTTfs	p.F140fs	FAM18A_uc010uyr.1_RNA|FAM18A_uc010uys.1_RNA|FAM18A_uc010uyt.1_RNA|FAM18A_uc010bun.2_RNA|FAM18A_uc010uyu.1_RNA|FAM18A_uc002dad.3_RNA|FAM18A_uc002daf.1_RNA|FAM18A_uc002dae.1_Frame_Shift_Del_p.F76fs	NM_001079512	NP_001072980	A6NH52	FA18A_HUMAN	hypothetical protein LOC780776	140	Helical; (Potential).					integral to membrane					0																		---	---	---	---
RUNDC2A	84127	broad.mit.edu	37	16	12142009	12142009	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:12142009delT	uc002dbw.1	+							NM_032167	NP_115543			RUN domain containing 2A											ovary(1)	1								T	CIITA	PMBL|Hodgkin Lymphona|								---	---	---	---
MKL2	57496	broad.mit.edu	37	16	14312901	14312901	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:14312901delT	uc010uza.1	+						MKL2_uc002dcg.2_Intron|MKL2_uc002dch.2_Intron|MKL2_uc010uzb.1_Intron	NM_014048	NP_054767			megakaryoblastic leukemia 2 protein						cell differentiation|muscle organ development|positive regulation of striated muscle tissue development|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		identical protein binding|nucleic acid binding|transcription coactivator activity			ovary(3)|kidney(1)|pancreas(1)	5																		---	---	---	---
Unknown	0	broad.mit.edu	37	16	16724659	16724659	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:16724659delT								LOC339047 (280222 upstream) : XYLT1 (471524 downstream)																																			---	---	---	---
TMC7	79905	broad.mit.edu	37	16	19032820	19032820	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19032820delA	uc002dfq.2	+						TMC7_uc010vao.1_Intron|TMC7_uc002dfp.2_Intron|TMC7_uc010vap.1_Intron	NM_024847	NP_079123			transmembrane channel-like 7 isoform a							integral to membrane				skin(2)|ovary(1)	3																		---	---	---	---
OTOA	146183	broad.mit.edu	37	16	21763602	21763603	+	Intron	INS	-	TG	TG			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21763602_21763603insTG	uc002djh.2	+						uc002diq.3_Intron|OTOA_uc010vbj.1_Intron|OTOA_uc002dji.2_Intron|OTOA_uc010vbk.1_Intron	NM_144672	NP_653273			otoancorin isoform 1						sensory perception of sound	anchored to membrane|apical plasma membrane|proteinaceous extracellular matrix				ovary(1)|central_nervous_system(1)|skin(1)	3				GBM - Glioblastoma multiforme(48;0.0414)														---	---	---	---
SCNN1G	6340	broad.mit.edu	37	16	23208793	23208793	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23208793delT	uc002dlm.1	+							NM_001039	NP_001030			sodium channel, nonvoltage-gated 1, gamma						excretion|sensory perception of taste	apical plasma membrane|integral to plasma membrane	ligand-gated sodium channel activity|WW domain binding			ovary(2)|skin(2)|large_intestine(1)|pancreas(1)	6				GBM - Glioblastoma multiforme(48;0.0366)	Amiloride(DB00594)|Triamterene(DB00384)													---	---	---	---
AQP8	343	broad.mit.edu	37	16	25239587	25239588	+	Intron	INS	-	A	A	rs73551053	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:25239587_25239588insA	uc002doc.2	+							NM_001169	NP_001160			aquaporin 8						cellular response to cAMP	integral to plasma membrane	water channel activity			upper_aerodigestive_tract(1)|breast(1)|pancreas(1)	3				GBM - Glioblastoma multiforme(48;0.044)														---	---	---	---
GTF3C1	2975	broad.mit.edu	37	16	27497662	27497662	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:27497662delT	uc002dov.1	-						GTF3C1_uc002dou.2_Intron	NM_001520	NP_001511			general transcription factor IIIC, polypeptide							transcription factor TFIIIC complex	DNA binding|protein binding			ovary(2)|pancreas(1)|breast(1)|skin(1)	5																		---	---	---	---
BOLA2	552900	broad.mit.edu	37	16	29565637	29565638	+	Intron	DEL	AA	-	-	rs79600187		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29565637_29565638delAA	uc010bzb.1	-						LOC440354_uc002dsp.3_Intron|uc002dtf.2_Intron|LOC440354_uc010bza.1_Intron|LOC440354_uc002dtj.2_Intron|LOC440354_uc010vds.1_Intron					SubName: Full=Putative uncharacterized protein ENSP00000369970; Flags: Fragment;												0																		---	---	---	---
ORAI3	93129	broad.mit.edu	37	16	30960896	30960896	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30960896delG	uc002eac.2	+							NM_152288	NP_689501			ORAI calcium release-activated calcium modulator							integral to membrane	protein binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	16	32198251	32198252	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:32198251_32198252delAA	uc010vfv.1	-											Homo sapiens cDNA FLJ60890 complete cds, moderately similar to HECT domain and RCC1-like domain-containing protein 2.																														---	---	---	---
Unknown	0	broad.mit.edu	37	16	34335946	34335946	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:34335946delT								MIR1826 (370354 upstream) : UBE2MP1 (67856 downstream)																																			---	---	---	---
VPS35	55737	broad.mit.edu	37	16	46708575	46708577	+	Intron	DEL	AAA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:46708575_46708577delAAA	uc002eef.3	-						VPS35_uc002eed.2_Intron|VPS35_uc002eee.2_Intron	NM_018206	NP_060676			vacuolar protein sorting 35						protein transport|retrograde transport, endosome to Golgi	cytosol|endosome|membrane	protein binding				0		all_cancers(37;7.65e-05)|all_epithelial(9;0.000154)|all_lung(18;0.00585)|Lung NSC(13;0.0496)|Breast(268;0.116)																---	---	---	---
CNOT1	23019	broad.mit.edu	37	16	58581332	58581332	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:58581332delA	uc002env.2	-						CNOT1_uc002enw.2_Intron|CNOT1_uc002enu.3_Intron|CNOT1_uc002enx.2_Intron|CNOT1_uc010vik.1_Intron	NM_016284	NP_057368			CCR4-NOT transcription complex, subunit 1						nuclear-transcribed mRNA poly(A) tail shortening|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol				ovary(4)|central_nervous_system(2)	6				Kidney(780;0.0722)|OV - Ovarian serous cystadenocarcinoma(108;0.173)|Epithelial(162;0.239)														---	---	---	---
CNOT1	23019	broad.mit.edu	37	16	58587613	58587613	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:58587613delA	uc002env.2	-						CNOT1_uc002enw.2_Intron|CNOT1_uc002enu.3_Intron|CNOT1_uc002enx.2_Intron|CNOT1_uc002enz.1_Intron|CNOT1_uc010vik.1_5'Flank	NM_016284	NP_057368			CCR4-NOT transcription complex, subunit 1						nuclear-transcribed mRNA poly(A) tail shortening|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol				ovary(4)|central_nervous_system(2)	6				Kidney(780;0.0722)|OV - Ovarian serous cystadenocarcinoma(108;0.173)|Epithelial(162;0.239)														---	---	---	---
DUS2L	54920	broad.mit.edu	37	16	68094751	68094751	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68094751delA	uc002evi.2	+						DUS2L_uc002evj.2_Intron|DUS2L_uc010vkk.1_Intron|DUS2L_uc010cez.2_Intron	NM_017803	NP_060273			dihydrouridine synthase 2-like, SMM1 homolog						tRNA processing	endoplasmic reticulum	double-stranded RNA binding|flavin adenine dinucleotide binding|tRNA dihydrouridine synthase activity				0		Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0131)|Epithelial(162;0.0564)														---	---	---	---
TMCO7	79613	broad.mit.edu	37	16	69059840	69059840	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:69059840delA	uc002ewi.3	+							NM_024562	NP_078838			transmembrane and coiled-coil domains 7							integral to membrane	binding				0		Ovarian(137;0.0568)		OV - Ovarian serous cystadenocarcinoma(108;0.0446)|Epithelial(162;0.198)														---	---	---	---
NOB1	28987	broad.mit.edu	37	16	69785968	69785969	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:69785968_69785969delAA	uc002exs.2	-							NM_014062	NP_054781			nin one binding protein							nucleus	metal ion binding|protein binding				0																		---	---	---	---
IL34	146433	broad.mit.edu	37	16	70690422	70690422	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70690422delA	uc002ezh.1	+						IL34_uc002ezi.1_Intron	NM_152456	NP_689669			interleukin 34 precursor						positive regulation of cell proliferation|positive regulation of protein phosphorylation	extracellular space	cytokine activity|growth factor activity|macrophage colony-stimulating factor receptor binding			central_nervous_system(1)|skin(1)	2																		---	---	---	---
DHX38	9785	broad.mit.edu	37	16	72141912	72141912	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72141912delT	uc002fcb.2	+						DHX38_uc010vmp.1_Intron	NM_014003	NP_054722			DEAH (Asp-Glu-Ala-His) box polypeptide 38						mRNA 3'-end processing|mRNA export from nucleus|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	catalytic step 2 spliceosome|nucleoplasm	ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding			skin(1)	1		Ovarian(137;0.125)																---	---	---	---
Unknown	0	broad.mit.edu	37	16	88620066	88620068	+	IGR	DEL	CCC	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88620066_88620068delCCC								ZFPM1 (18493 upstream) : ZC3H18 (16721 downstream)																																			---	---	---	---
TSR1	55720	broad.mit.edu	37	17	2232242	2232242	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:2232242delC	uc002fuj.2	-							NM_018128	NP_060598			TSR1, 20S rRNA accumulation						ribosome assembly	nucleolus	protein binding			ovary(1)	1																		---	---	---	---
MNT	4335	broad.mit.edu	37	17	2298413	2298413	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:2298413delG	uc002fur.2	-	2	661	c.409delC	c.(409-411)CTGfs	p.L137fs		NM_020310	NP_064706	Q99583	MNT_HUMAN	MAX binding protein	137					multicellular organismal development|negative regulation of cell proliferation|transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription corepressor activity			skin(1)	1				Colorectal(2;1.37e-05)|READ - Rectum adenocarcinoma(2;8.68e-05)														---	---	---	---
RAP1GAP2	23108	broad.mit.edu	37	17	2888574	2888576	+	Intron	DEL	TTT	-	-	rs71377564		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:2888574_2888576delTTT	uc010ckd.2	+						RAP1GAP2_uc010cke.2_Intron	NM_015085	NP_055900			RAP1 GTPase activating protein 2 isoform 1						regulation of small GTPase mediated signal transduction	centrosome|cytosol|perinuclear region of cytoplasm	GTPase activator activity			ovary(1)	1																		---	---	---	---
ZZEF1	23140	broad.mit.edu	37	17	3967494	3967495	+	Intron	DEL	AA	-	-	rs112787658		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3967494_3967495delAA	uc002fxe.2	-						ZZEF1_uc002fxh.2_5'Flank|ZZEF1_uc002fxi.2_Intron|ZZEF1_uc002fxj.1_Intron	NM_015113	NP_055928			zinc finger, ZZ type with EF hand domain 1								calcium ion binding|zinc ion binding			ovary(2)|central_nervous_system(1)|pancreas(1)	4																		---	---	---	---
FAM64A	54478	broad.mit.edu	37	17	6350599	6350599	+	Intron	DEL	T	-	-	rs113827676		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:6350599delT	uc002gcw.1	+						FAM64A_uc002gct.1_Intron|FAM64A_uc002gcu.1_Intron|FAM64A_uc002gcv.1_Intron|FAM64A_uc002gcx.1_Intron|FAM64A_uc002gcy.1_Intron|FAM64A_uc002gcz.1_Intron|FAM64A_uc002gda.1_Intron|FAM64A_uc002gdb.1_Intron	NM_019013	NP_061886			family with sequence similarity 64, member A							nucleolus	protein binding				0				COAD - Colon adenocarcinoma(228;0.141)														---	---	---	---
CLDN7	1366	broad.mit.edu	37	17	7163530	7163530	+	3'UTR	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7163530delC	uc002gfm.3	-	4					CLDN7_uc010cmc.2_3'UTR|CLDN7_uc002gfn.3_3'UTR	NM_001307	NP_001298			claudin 7						calcium-independent cell-cell adhesion	integral to membrane|lateral plasma membrane|tight junction	identical protein binding|structural molecule activity			ovary(1)	1																		---	---	---	---
WRAP53	55135	broad.mit.edu	37	17	7603866	7603866	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7603866delA	uc010vuh.1	+						WRAP53_uc010vui.1_Intron|WRAP53_uc002gip.2_Intron|WRAP53_uc002gir.2_Intron|WRAP53_uc002giq.2_Intron|WRAP53_uc010cnl.2_Intron|WRAP53_uc010vuj.1_5'Flank	NM_001143990	NP_001137462			WD repeat domain 79 isoform 2						positive regulation of telomerase activity|telomere formation via telomerase	Cajal body|cytoplasm|telomerase holoenzyme complex	protein binding|RNA binding				0																		---	---	---	---
DNAH2	146754	broad.mit.edu	37	17	7643385	7643385	+	Intron	DEL	G	-	-	rs68069001		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7643385delG	uc002giu.1	+						DNAH2_uc002git.2_Intron|DNAH2_uc010vuk.1_Intron	NM_020877	NP_065928			dynein heavy chain domain 3						ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(6)|skin(6)|central_nervous_system(1)	13		all_cancers(10;4.66e-07)|Prostate(122;0.081)																---	---	---	---
TMEM220	388335	broad.mit.edu	37	17	10619317	10619318	+	Intron	INS	-	GATA	GATA	rs146093202	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10619317_10619318insGATA	uc002gmx.2	-						TMEM220_uc002gmy.2_Intron	NM_001004313	NP_001004313			transmembrane protein 220							integral to membrane					0																		---	---	---	---
NCOR1	9611	broad.mit.edu	37	17	15961519	15961519	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:15961519delA	uc002gpo.2	-						NCOR1_uc002gpn.2_Intron|NCOR1_uc002gpl.2_5'UTR|NCOR1_uc002gpm.2_Intron|NCOR1_uc010vwb.1_Intron|NCOR1_uc010coy.2_Intron|NCOR1_uc010vwc.1_Intron	NM_006311	NP_006302			nuclear receptor co-repressor 1						cellular lipid metabolic process|chromatin modification|negative regulation of JNK cascade|regulation of glycolysis by negative regulation of transcription from an RNA polymerase II promoter|regulation of lipid transport by negative regulation of transcription from an RNA polymerase II promoter|spindle assembly|transcription from RNA polymerase II promoter	nuclear chromatin|spindle microtubule|transcriptional repressor complex	histone deacetylase binding|transcription corepressor activity|transcription regulatory region DNA binding			upper_aerodigestive_tract(2)|ovary(1)|central_nervous_system(1)|kidney(1)	5				UCEC - Uterine corpus endometrioid carcinoma (92;0.101)														---	---	---	---
FBXW10	10517	broad.mit.edu	37	17	18661954	18661954	+	Intron	DEL	T	-	-	rs67590584		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18661954delT	uc002guk.2	+						FBXW10_uc002guj.2_Intron|FBXW10_uc002gul.2_Intron|FBXW10_uc010cqh.1_Intron	NM_031456	NP_113644			F-box and WD-40 domain protein 10											ovary(1)	1																		---	---	---	---
ULK2	9706	broad.mit.edu	37	17	19744938	19744938	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:19744938delT	uc002gwm.3	-						ULK2_uc002gwn.2_Intron	NM_001142610	NP_001136082			unc-51-like kinase 2						signal transduction		ATP binding|protein binding|protein serine/threonine kinase activity			skin(2)|large_intestine(1)|stomach(1)	4	all_cancers(12;4.97e-05)|all_epithelial(12;0.00362)|Breast(13;0.186)																	---	---	---	---
POLDIP2	26073	broad.mit.edu	37	17	26684390	26684391	+	Splice_Site	INS	-	C	C	rs148075904	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26684390_26684391insC	uc002haz.2	-	3	211	c.79_splice	c.e3+0	p.P27_splice	POLDIP2_uc010wag.1_RNA|TMEM199_uc002hba.2_5'Flank|SARM1_uc010wah.1_5'Flank	NM_015584	NP_056399			DNA polymerase delta interacting protein 2							mitochondrial nucleoid|nucleus					0	all_lung(13;0.000354)|Lung NSC(42;0.00115)			UCEC - Uterine corpus endometrioid carcinoma (53;0.154)														---	---	---	---
Unknown	0	broad.mit.edu	37	17	26795576	26795576	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26795576delA								SLC46A1 (62348 upstream) : SLC13A2 (5088 downstream)																																			---	---	---	---
KIAA0100	9703	broad.mit.edu	37	17	26961600	26961600	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26961600delG	uc002hbu.2	-	16	3104	c.3005delC	c.(3004-3006)CCTfs	p.P1002fs		NM_014680	NP_055495	Q14667	K0100_HUMAN	hypothetical protein LOC9703 precursor	1002						extracellular region				ovary(2)|breast(1)|skin(1)	4	Lung NSC(42;0.00431)																	---	---	---	---
GOSR1	9527	broad.mit.edu	37	17	28811835	28811836	+	Intron	DEL	TT	-	-	rs75515486		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:28811835_28811836delTT	uc002hfe.2	+						GOSR1_uc002hfd.2_Intron|GOSR1_uc002hff.2_Intron|GOSR1_uc002hfc.1_Frame_Shift_Del_p.V132fs	NM_004871	NP_004862			golgi SNAP receptor complex member 1 isoform 1						intra-Golgi vesicle-mediated transport|protein transport|retrograde transport, endosome to Golgi	Golgi membrane|integral to membrane|SNARE complex	SNAP receptor activity				0																		---	---	---	---
NF1	4763	broad.mit.edu	37	17	29575850	29575852	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:29575850_29575852delTTT	uc002hgg.2	+						NF1_uc002hgh.2_Intron|NF1_uc010csn.1_Intron|NF1_uc002hgi.1_Intron	NM_001042492	NP_001035957			neurofibromin isoform 1						actin cytoskeleton organization|adrenal gland development|artery morphogenesis|camera-type eye morphogenesis|cerebral cortex development|collagen fibril organization|forebrain astrocyte development|forebrain morphogenesis|heart development|liver development|MAPKKK cascade|metanephros development|myelination in peripheral nervous system|negative regulation of cell migration|negative regulation of endothelial cell proliferation|negative regulation of MAP kinase activity|negative regulation of MAPKKK cascade|negative regulation of neuroblast proliferation|negative regulation of oligodendrocyte differentiation|negative regulation of transcription factor import into nucleus|osteoblast differentiation|phosphatidylinositol 3-kinase cascade|pigmentation|positive regulation of adenylate cyclase activity|positive regulation of neuron apoptosis|Ras protein signal transduction|regulation of blood vessel endothelial cell migration|regulation of bone resorption|response to hypoxia|smooth muscle tissue development|spinal cord development|sympathetic nervous system development|visual learning|wound healing	axon|cytoplasm|dendrite|intrinsic to internal side of plasma membrane|nucleus	protein binding|Ras GTPase activator activity	p.?(2)		soft_tissue(159)|central_nervous_system(56)|lung(28)|large_intestine(27)|haematopoietic_and_lymphoid_tissue(18)|ovary(18)|autonomic_ganglia(12)|breast(3)|skin(3)|stomach(2)|thyroid(1)|prostate(1)|kidney(1)|pancreas(1)	330		all_cancers(10;1.29e-12)|all_epithelial(10;0.00347)|all_hematologic(16;0.00556)|Acute lymphoblastic leukemia(14;0.00593)|Breast(31;0.014)|Myeloproliferative disorder(56;0.0255)|all_lung(9;0.0321)|Lung NSC(157;0.0659)		UCEC - Uterine corpus endometrioid carcinoma (4;4.38e-05)|all cancers(4;1.64e-26)|Epithelial(4;9.15e-23)|OV - Ovarian serous cystadenocarcinoma(4;3.58e-21)|GBM - Glioblastoma multiforme(4;0.00146)				D|Mis|N|F|S|O		neurofibroma|glioma	neurofibroma|glioma			Neurofibromatosis_type_1	TCGA GBM(6;<1E-08)|TSP Lung(7;0.0071)|TCGA Ovarian(3;0.0088)			---	---	---	---
SUZ12	23512	broad.mit.edu	37	17	30267580	30267580	+	Intron	DEL	A	-	-	rs67854327		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30267580delA	uc002hgs.2	+						SUZ12_uc002hgt.2_Intron	NM_015355	NP_056170			joined to JAZF1						negative regulation of cell differentiation|transcription, DNA-dependent	ESC/E(Z) complex	histone methyltransferase activity|methylated histone residue binding|zinc ion binding		JAZF1/SUZ12(131)	soft_tissue(98)|endometrium(33)	131		Myeloproliferative disorder(56;0.0255)|all_hematologic(16;0.041)|Ovarian(249;0.182)|Breast(31;0.231)						T	JAZF1	endometrial stromal tumours								---	---	---	---
Unknown	0	broad.mit.edu	37	17	30330032	30330033	+	IGR	DEL	AT	-	-	rs71142100		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30330032_30330033delAT								SUZ12 (1975 upstream) : LRRC37B (5004 downstream)																																			---	---	---	---
RHOT1	55288	broad.mit.edu	37	17	30500730	30500730	+	Intron	DEL	A	-	-	rs79743579		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30500730delA	uc002hgz.2	+						RHOT1_uc002hgw.2_Intron|RHOT1_uc002hgy.2_Intron|RHOT1_uc002hha.2_Intron|RHOT1_uc010csv.2_Intron|RHOT1_uc002hgx.2_Intron|RHOT1_uc010wby.1_Intron|RHOT1_uc002hhb.2_Intron|RHOT1_uc002hgv.2_Intron	NM_018307	NP_060777			ras homolog gene family, member T1 isoform 3						apoptosis|cellular homeostasis|mitochondrion transport along microtubule|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|integral to mitochondrial outer membrane|plasma membrane	calcium ion binding|GTP binding|GTPase activity|protein binding			ovary(3)|central_nervous_system(1)	4		Myeloproliferative disorder(56;0.0255)|Breast(31;0.116)|Ovarian(249;0.182)																---	---	---	---
CCL13	6357	broad.mit.edu	37	17	32683704	32683704	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:32683704delT	uc002hic.2	+							NM_005408	NP_005399			small inducible cytokine A13 precursor						cell-cell signaling|cellular calcium ion homeostasis|chemotaxis|immune response|inflammatory response	extracellular space	chemokine activity|signal transducer activity				0		Ovarian(249;0.0443)|Breast(31;0.151)																---	---	---	---
SNORD7	692076	broad.mit.edu	37	17	33900515	33900515	+	5'Flank	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:33900515delA	uc002hjo.1	+							NR_003037				Homo sapiens small nucleolar RNA, C/D box 7 (SNORD7), non-coding RNA.												0																		---	---	---	---
C17orf98	388381	broad.mit.edu	37	17	36993202	36993202	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:36993202delA	uc002hqv.2	-							NM_001080465	NP_001073934			hypothetical protein LOC388381												0																		---	---	---	---
TOP2A	7153	broad.mit.edu	37	17	38562532	38562532	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38562532delT	uc002huq.2	-							NM_001067	NP_001058			DNA topoisomerase II, alpha isozyme						apoptotic chromosome condensation|DNA ligation|DNA repair|DNA topological change|DNA-dependent DNA replication|mitotic cell cycle G2/M transition decatenation checkpoint|mitotic recombination|phosphatidylinositol-mediated signaling|positive regulation of apoptosis|positive regulation of retroviral genome replication|resolution of meiotic recombination intermediates|sister chromatid segregation	cytoplasm|DNA topoisomerase complex (ATP-hydrolyzing)|nucleolus|nucleoplasm|synaptonemal complex	ATP binding|chromatin binding|DNA topoisomerase (ATP-hydrolyzing) activity|DNA-dependent ATPase activity|drug binding|histone deacetylase binding|protein C-terminus binding|protein heterodimerization activity|protein homodimerization activity|protein kinase C binding|sequence-specific DNA binding transcription factor activity|ubiquitin binding			ovary(4)|large_intestine(1)|central_nervous_system(1)|skin(1)	7		Breast(137;0.00328)	STAD - Stomach adenocarcinoma(5;0.00183)		Amsacrine(DB00276)|Ciprofloxacin(DB00537)|Dexrazoxane(DB00380)|Doxorubicin(DB00997)|Enoxacin(DB00467)|Epirubicin(DB00445)|Etoposide(DB00773)|Fleroxacin(DB04576)|Gatifloxacin(DB01044)|Idarubicin(DB01177)|Levofloxacin(DB01137)|Lomefloxacin(DB00978)|Lucanthone(DB04967)|Mitoxantrone(DB01204)|Moxifloxacin(DB00218)|Norfloxacin(DB01059)|Ofloxacin(DB01165)|Pefloxacin(DB00487)|Podofilox(DB01179)|Sparfloxacin(DB01208)|Teniposide(DB00444)|Trovafloxacin(DB00685)|Valrubicin(DB00385)													---	---	---	---
HDAC5	10014	broad.mit.edu	37	17	42165217	42165217	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42165217delT	uc002ifd.1	-						HDAC5_uc002ife.1_Intron|HDAC5_uc002iff.1_Intron|HDAC5_uc010czp.1_Intron|HDAC5_uc002ifg.1_5'Flank|HDAC5_uc002ifh.2_Intron	NM_005474	NP_005465			histone deacetylase 5 isoform 1						B cell differentiation|cellular response to insulin stimulus|chromatin remodeling|chromatin silencing|inflammatory response|negative regulation of cell migration involved in sprouting angiogenesis|negative regulation of myotube differentiation|negative regulation of transcription from RNA polymerase II promoter|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|regulation of protein binding|transcription, DNA-dependent	cytoplasm|histone deacetylase complex	histone deacetylase activity (H3-K16 specific)|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|protein kinase C binding|repressing transcription factor binding			ovary(1)	1		Breast(137;0.00637)|Prostate(33;0.0313)		BRCA - Breast invasive adenocarcinoma(366;0.118)														---	---	---	---
C17orf53	78995	broad.mit.edu	37	17	42229796	42229796	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42229796delA	uc002ifi.1	+						C17orf53_uc010czq.1_Intron|C17orf53_uc002ifj.1_Intron|C17orf53_uc002ifk.1_Intron	NM_024032	NP_076937			hypothetical protein LOC78995												0		Breast(137;0.0364)|Prostate(33;0.0376)		BRCA - Breast invasive adenocarcinoma(366;0.114)														---	---	---	---
CRHR1	1394	broad.mit.edu	37	17	43912267	43912268	+	3'UTR	INS	-	G	G	rs140399885	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43912267_43912268insG	uc010dap.2	+	14					CRHR1_uc010wjx.1_3'UTR|CRHR1_uc002ijp.2_3'UTR|CRHR1_uc002ijm.2_3'UTR|CRHR1_uc002ijn.2_3'UTR|CRHR1_uc010dar.2_3'UTR|CRHR1_uc010dao.2_3'UTR|CRHR1_uc010daq.2_3'UTR	NM_001145146	NP_001138618			corticotropin releasing hormone receptor 1						female pregnancy|immune response|parturition	integral to plasma membrane	corticotrophin-releasing factor receptor activity|protein binding			lung(3)	3	Colorectal(2;0.0416)			BRCA - Breast invasive adenocarcinoma(366;0.161)														---	---	---	---
CDC27	996	broad.mit.edu	37	17	45249513	45249513	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45249513delA	uc002ild.3	-						CDC27_uc002ile.3_Intron|CDC27_uc002ilf.3_Intron|CDC27_uc010wkp.1_Intron|CDC27_uc010wkq.1_Intron	NM_001256	NP_001247			cell division cycle protein 27 isoform 2						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell proliferation|mitotic cell cycle spindle assembly checkpoint|mitotic metaphase/anaphase transition|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|centrosome|cytosol|nucleoplasm|spindle microtubule	protein phosphatase binding			lung(2)|breast(2)|ovary(1)	5																		---	---	---	---
ITGB3	3690	broad.mit.edu	37	17	45370099	45370099	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45370099delA	uc002ilj.2	+						ITGB3_uc010wkr.1_Intron	NM_000212	NP_000203			integrin beta chain, beta 3 precursor						activation of protein kinase activity|angiogenesis involved in wound healing|axon guidance|cell-matrix adhesion|integrin-mediated signaling pathway|interspecies interaction between organisms|leukocyte migration|negative regulation of lipid storage|negative regulation of lipid transport|negative regulation of lipoprotein metabolic process|negative regulation of low-density lipoprotein particle receptor biosynthetic process|negative regulation of macrophage derived foam cell differentiation|platelet activation|platelet degranulation|positive regulation of endothelial cell migration|positive regulation of endothelial cell proliferation|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of vascular endothelial growth factor receptor signaling pathway|regulation of bone resorption|smooth muscle cell migration|tube development	alphav-beta3 integrin-vitronectin complex|integrin complex|platelet alpha granule membrane	cell adhesion molecule binding|identical protein binding|platelet-derived growth factor receptor binding|receptor activity|vascular endothelial growth factor receptor 2 binding			central_nervous_system(5)|large_intestine(1)	6					Abciximab(DB00054)|Tirofiban(DB00775)													---	---	---	---
NFE2L1	4779	broad.mit.edu	37	17	46133539	46133539	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:46133539delT	uc002imz.3	+						NFE2L1_uc002ina.3_Intron|NFE2L1_uc002inb.3_Intron|NFE2L1_uc010wle.1_Intron|NFE2L1_uc010wlf.1_Intron|NFE2L1_uc002inc.1_Intron	NM_003204	NP_003195			nuclear factor erythroid 2-like 1						anatomical structure morphogenesis|heme biosynthetic process|inflammatory response|transcription from RNA polymerase II promoter	nucleus	protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription cofactor activity			skin(1)	1																		---	---	---	---
RPS6KB1	6198	broad.mit.edu	37	17	57970683	57970683	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57970683delG	uc002ixy.2	+	1	241	c.138delG	c.(136-138)GAGfs	p.E46fs	TUBD1_uc010ddf.1_5'Flank|TUBD1_uc002ixw.1_5'Flank|TUBD1_uc010ddg.1_5'Flank|TUBD1_uc010ddh.1_5'Flank|TUBD1_uc010wok.1_5'Flank|TUBD1_uc002ixx.1_5'Flank|TUBD1_uc010wol.1_5'Flank|TUBD1_uc010ddi.1_5'Flank|RPS6KB1_uc010ddj.1_Frame_Shift_Del_p.E46fs|RPS6KB1_uc010wom.1_5'UTR|RPS6KB1_uc010won.1_Frame_Shift_Del_p.E46fs	NM_003161	NP_003152	P23443	KS6B1_HUMAN	ribosomal protein S6 kinase, 70kDa, polypeptide	46					apoptosis|G1/S transition of mitotic cell cycle|insulin receptor signaling pathway|negative regulation of apoptosis|phosphatidylinositol-mediated signaling|positive regulation of mitotic cell cycle|positive regulation of translational initiation|TOR signaling cascade	cell junction|cytoplasm|cytosol|mitochondrial outer membrane|nucleus|nucleus|synapse|synaptosome	ATP binding|protein binding|protein kinase activity			large_intestine(1)	1	all_cancers(5;1.63e-13)|Breast(5;2.91e-25)|all_neural(34;0.0878)|Medulloblastoma(34;0.0922)		Epithelial(12;3.57e-12)|all cancers(12;6.41e-11)															---	---	---	---
CCDC47	57003	broad.mit.edu	37	17	61824398	61824398	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61824398delA	uc002jbs.3	-						CCDC47_uc010ddx.2_Intron	NM_020198	NP_064583			coiled-coil domain containing 47 precursor							integral to membrane	protein binding				0																		---	---	---	---
CCDC47	57003	broad.mit.edu	37	17	61838392	61838392	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61838392delA	uc002jbs.3	-						CCDC47_uc010ddx.2_Intron|CCDC47_uc002jbt.2_Intron	NM_020198	NP_064583			coiled-coil domain containing 47 precursor							integral to membrane	protein binding				0																		---	---	---	---
HELZ	9931	broad.mit.edu	37	17	65156546	65156546	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:65156546delA	uc010wqk.1	-						HELZ_uc002jfv.3_Intron|HELZ_uc002jfx.3_Intron	NM_014877	NP_055692			helicase with zinc finger domain											ovary(1)|pancreas(1)	2	all_cancers(12;1.24e-11)|Breast(2;1.05e-17)|all_epithelial(3;3.87e-13)																	---	---	---	---
HELZ	9931	broad.mit.edu	37	17	65199355	65199355	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:65199355delT	uc010wqk.1	-						HELZ_uc002jfv.3_Intron|HELZ_uc002jfx.3_Intron|HELZ_uc010des.1_Intron	NM_014877	NP_055692			helicase with zinc finger domain											ovary(1)|pancreas(1)	2	all_cancers(12;1.24e-11)|Breast(2;1.05e-17)|all_epithelial(3;3.87e-13)																	---	---	---	---
MRPS7	51081	broad.mit.edu	37	17	73259796	73259797	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73259796_73259797insA	uc002jnm.3	+						GGA3_uc002jni.1_5'Flank|GGA3_uc002jnj.1_5'Flank|GGA3_uc010wrw.1_5'Flank|GGA3_uc002jnk.1_5'Flank|GGA3_uc010wrx.1_5'Flank|GGA3_uc010wry.1_5'Flank|GGA3_uc010wrz.1_5'Flank|MRPS7_uc002jnl.2_3'UTR|MRPS7_uc002jnn.3_Intron	NM_015971	NP_057055			mitochondrial ribosomal protein S7 precursor						translation	cytosolic small ribosomal subunit|mitochondrion	protein binding|RNA binding|structural constituent of ribosome			central_nervous_system(1)	1	all_cancers(13;1.25e-07)|all_epithelial(9;2.63e-08)|Breast(9;1.06e-07)		all cancers(21;3.02e-07)|Epithelial(20;2.92e-06)															---	---	---	---
LLGL2	3993	broad.mit.edu	37	17	73568906	73568907	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73568906_73568907delAA	uc002joh.2	+						LLGL2_uc002joi.2_Intron|LLGL2_uc010dgg.1_Intron|LLGL2_uc002joj.2_Intron|LLGL2_uc010wsd.1_Intron	NM_001031803	NP_001026973			lethal giant larvae homolog 2 isoform c						cell cycle|cell division|exocytosis|regulation of establishment or maintenance of cell polarity	cytoplasm|intracellular membrane-bounded organelle	PDZ domain binding			ovary(2)	2	all_cancers(13;3.15e-09)|all_epithelial(9;5.78e-10)|Breast(9;5.8e-10)|all_lung(278;0.246)		all cancers(21;1.8e-07)|Epithelial(20;1.38e-06)|Lung(188;0.0696)|LUSC - Lung squamous cell carcinoma(166;0.112)															---	---	---	---
C17orf99	100141515	broad.mit.edu	37	17	76154382	76154382	+	Intron	DEL	T	-	-	rs6501181	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:76154382delT	uc002jus.3	+						C17orf99_uc010wts.1_5'Flank	NM_001163075	NP_001156547			hypothetical protein LOC100141515 precursor							extracellular region					0																		---	---	---	---
RNF213	57674	broad.mit.edu	37	17	78345610	78345610	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78345610delT	uc002jyh.1	+						uc002jyi.1_Intron|RNF213_uc010dhw.1_Intron	NM_020914	NP_065965			ring finger protein 213											ovary(8)|lung(6)|breast(3)|large_intestine(2)|central_nervous_system(1)|pancreas(1)	21	all_neural(118;0.0538)		BRCA - Breast invasive adenocarcinoma(99;0.0252)|OV - Ovarian serous cystadenocarcinoma(97;0.057)															---	---	---	---
FOXK2	3607	broad.mit.edu	37	17	80525803	80525807	+	Intron	DEL	TTTTT	-	-	rs5822539		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80525803_80525807delTTTTT	uc002kfn.2	+						FOXK2_uc002kfm.1_Intron|FOXK2_uc010diu.2_Intron	NM_004514	NP_004505			forkhead box K2						embryo development|pattern specification process|regulation of sequence-specific DNA binding transcription factor activity|regulation of transcription from RNA polymerase II promoter|tissue development	transcription factor complex	DNA bending activity|double-stranded DNA binding|magnesium ion binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding				0	Breast(20;0.00106)|all_neural(118;0.0952)		OV - Ovarian serous cystadenocarcinoma(97;0.0371)|BRCA - Breast invasive adenocarcinoma(99;0.0415)															---	---	---	---
FAM38B	63895	broad.mit.edu	37	18	10680134	10680134	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:10680134delC	uc002kor.3	-						FAM38B_uc002koq.2_Intron	NM_022068	NP_071351			family with sequence similarity 38, member B							integral to membrane	ion channel activity			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	18	14225639	14225639	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:14225639delA								ZNF519 (93210 upstream) : LOC284233 (111783 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	18	22328645	22328646	+	IGR	INS	-	T	T	rs146299092	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:22328645_22328646insT								HRH4 (268725 upstream) : ZNF521 (313242 downstream)																																			---	---	---	---
CDH2	1000	broad.mit.edu	37	18	25591733	25591734	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:25591733_25591734insA	uc002kwg.2	-						CDH2_uc010xbn.1_Intron	NM_001792	NP_001783			cadherin 2, type 1 preproprotein						adherens junction organization|cell junction assembly|positive regulation of muscle cell differentiation	catenin complex|integral to membrane	alpha-catenin binding|beta-catenin binding|calcium ion binding|gamma-catenin binding			ovary(3)|lung(1)	4																		---	---	---	---
MEP1B	4225	broad.mit.edu	37	18	29796832	29796832	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29796832delA	uc002kxj.3	+							NM_005925	NP_005916			meprin A beta precursor						digestion|proteolysis	extracellular space|integral to plasma membrane	metalloendopeptidase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
KIAA1328	57536	broad.mit.edu	37	18	34465687	34465687	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:34465687delT	uc002kzz.2	+							NM_020776	NP_065827			hypothetical protein LOC57536											central_nervous_system(1)	1				COAD - Colon adenocarcinoma(74;0.195)														---	---	---	---
MBD1	4152	broad.mit.edu	37	18	47803053	47803053	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:47803053delT	uc010dow.1	-	5	891	c.454delA	c.(454-456)ACGfs	p.T152fs	MBD1_uc002lef.2_5'UTR|MBD1_uc002leg.2_Frame_Shift_Del_p.T152fs|MBD1_uc010xdi.1_Frame_Shift_Del_p.T178fs|MBD1_uc002leh.3_Frame_Shift_Del_p.T152fs|MBD1_uc002len.2_Frame_Shift_Del_p.T152fs|MBD1_uc002lei.3_Frame_Shift_Del_p.T152fs|MBD1_uc002lej.3_Frame_Shift_Del_p.T152fs|MBD1_uc002lek.3_Frame_Shift_Del_p.T152fs|MBD1_uc002lel.3_Frame_Shift_Del_p.T152fs|MBD1_uc002lem.3_Frame_Shift_Del_p.T152fs|MBD1_uc010xdj.1_Frame_Shift_Del_p.T152fs|MBD1_uc010xdk.1_Frame_Shift_Del_p.T152fs|MBD1_uc010dox.1_Frame_Shift_Del_p.T152fs|MBD1_uc002leo.2_Frame_Shift_Del_p.T152fs	NM_015846	NP_056671	Q9UIS9	MBD1_HUMAN	methyl-CpG binding domain protein 1 isoform 1	152					negative regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	chromosome|nuclear speck	methyl-CpG binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
ME2	4200	broad.mit.edu	37	18	48439041	48439041	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:48439041delT	uc002ley.2	+						ME2_uc010dpd.2_Intron	NM_002396	NP_002387			malic enzyme 2, NAD(+)-dependent, mitochondrial						malate metabolic process	mitochondrial matrix	electron carrier activity|malate dehydrogenase (decarboxylating) activity|malate dehydrogenase (oxaloacetate-decarboxylating) activity|metal ion binding|NAD binding				0		Colorectal(6;0.0273)|all_epithelial(6;0.118)		Colorectal(21;0.0313)|READ - Rectum adenocarcinoma(32;0.105)|STAD - Stomach adenocarcinoma(97;0.184)	NADH(DB00157)													---	---	---	---
DCC	1630	broad.mit.edu	37	18	50961746	50961746	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:50961746delA	uc002lfe.1	+						DCC_uc010dpf.1_Intron	NM_005215	NP_005206			netrin receptor DCC precursor						apoptosis|induction of apoptosis|negative regulation of collateral sprouting|negative regulation of dendrite development	cytosol|integral to membrane				skin(8)|ovary(6)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	17		all_cancers(7;0.11)|all_epithelial(6;0.00126)		Colorectal(16;0.0251)|COAD - Colon adenocarcinoma(17;0.0942)														---	---	---	---
C18orf54	162681	broad.mit.edu	37	18	51899102	51899102	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:51899102delT	uc002lfn.3	+						C18orf54_uc002lfo.3_Intron	NM_173529	NP_775800			hypothetical protein LOC162681 precursor							extracellular region				ovary(1)|skin(1)	2				Colorectal(16;0.0206)|READ - Rectum adenocarcinoma(59;0.186)														---	---	---	---
Unknown	0	broad.mit.edu	37	18	56835677	56835678	+	IGR	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:56835677_56835678delTT								SEC11C (9616 upstream) : GRP (51722 downstream)																																			---	---	---	---
KIAA1468	57614	broad.mit.edu	37	18	59922625	59922625	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:59922625delT	uc002lil.2	+						KIAA1468_uc002lik.1_Intron|KIAA1468_uc010xel.1_Intron|KIAA1468_uc002lim.2_Intron	NM_020854	NP_065905			hypothetical protein LOC57614								binding			ovary(2)|breast(2)|upper_aerodigestive_tract(1)|large_intestine(1)	6		Colorectal(73;0.186)																---	---	---	---
RTTN	25914	broad.mit.edu	37	18	67721312	67721312	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:67721312delT	uc002lkp.2	-						RTTN_uc002lko.2_Intron|RTTN_uc010xfb.1_Intron|RTTN_uc010dqp.2_Intron	NM_173630	NP_775901			rotatin								binding			ovary(3)|pancreas(2)|skin(1)|breast(1)|central_nervous_system(1)	8		Esophageal squamous(42;0.129)																---	---	---	---
NETO1	81832	broad.mit.edu	37	18	70526037	70526037	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:70526037delT	uc002lkw.2	-						NETO1_uc002lkx.1_Intron|NETO1_uc002lky.1_Intron|NETO1_uc002lkz.2_Intron	NM_138966	NP_620416			neuropilin- and tolloid-like protein 1 isoform 3						memory|regulation of long-term neuronal synaptic plasticity|visual learning	cell junction|excitatory synapse|extracellular region|integral to membrane|postsynaptic density|postsynaptic membrane	receptor activity			ovary(2)|skin(2)	4		Esophageal squamous(42;0.129)		READ - Rectum adenocarcinoma(1;0.0487)														---	---	---	---
Unknown	0	broad.mit.edu	37	18	72057055	72057056	+	IGR	DEL	TA	-	-	rs142828698		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:72057055_72057056delTA								CYB5A (97834 upstream) : FAM69C (45908 downstream)																																			---	---	---	---
ZNF236	7776	broad.mit.edu	37	18	74617099	74617099	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74617099delT	uc002lmi.2	+						ZNF236_uc002lmj.2_Intron	NM_007345	NP_031371			zinc finger protein 236						cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)														---	---	---	---
C18orf22	79863	broad.mit.edu	37	18	77796872	77796872	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77796872delA	uc002lns.2	+						TXNL4A_uc010drg.2_5'Flank|C18orf22_uc010drh.2_Intron|C18orf22_uc010dri.1_Intron	NM_024805	NP_079081			hypothetical protein LOC79863 precursor						rRNA processing	mitochondrion					0		all_cancers(4;3.21e-14)|all_epithelial(4;7.11e-09)|all_lung(4;0.00366)|Lung NSC(4;0.00683)|Esophageal squamous(42;0.0212)|Ovarian(4;0.0545)|all_hematologic(56;0.15)|Melanoma(33;0.2)		OV - Ovarian serous cystadenocarcinoma(15;6.46e-08)|BRCA - Breast invasive adenocarcinoma(31;0.00376)														---	---	---	---
HCN2	610	broad.mit.edu	37	19	603065	603066	+	Intron	INS	-	C	C	rs35502309		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:603065_603066insC	uc002lpe.2	+							NM_001194	NP_001185			hyperpolarization activated cyclic						cell-cell signaling|muscle contraction	voltage-gated potassium channel complex	cAMP binding|protein binding|sodium channel activity|voltage-gated potassium channel activity				0		all_epithelial(18;2.78e-22)|Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;3.55e-06)|all_lung(49;5.41e-06)|Breast(49;4.08e-05)|Hepatocellular(1079;0.137)|Renal(1328;0.228)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
FGF22	27006	broad.mit.edu	37	19	643528	643528	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:643528delG	uc010xfq.1	+	3	437	c.437delG	c.(436-438)AGGfs	p.R146fs	FGF22_uc010xfr.1_Frame_Shift_Del_p.E138fs	NM_020637	NP_065688	Q9HCT0	FGF22_HUMAN	fibroblast growth factor 22 precursor	146					cell differentiation|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway	extracellular space	growth factor activity				0		all_epithelial(18;2.78e-22)|Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;3.55e-06)|all_lung(49;5.41e-06)|Breast(49;4.08e-05)|Hepatocellular(1079;0.137)|Renal(1328;0.228)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
PRSSL1	400668	broad.mit.edu	37	19	691844	691844	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:691844delC	uc002lpl.1	-						PRSSL1_uc010xfs.1_Intron	NM_214710	NP_999875			protease, serine-like 1 precursor						proteolysis	extracellular region	serine-type endopeptidase activity				0		all_epithelial(18;2.19e-21)|Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;3.55e-06)|all_lung(49;5.41e-06)|Breast(49;4.08e-05)|Hepatocellular(1079;0.137)|Renal(1328;0.228)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
MED16	10025	broad.mit.edu	37	19	873770	873770	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:873770delC	uc002lqd.1	-						MED16_uc010drw.1_Intron|MED16_uc002lqe.2_Intron|MED16_uc002lqf.2_Intron|MED16_uc010xfv.1_Intron|MED16_uc010xfw.1_Intron|MED16_uc010xfx.1_Intron|MED16_uc010xfy.1_Intron|MED16_uc010xfz.1_RNA	NM_005481	NP_005472			mediator complex subunit 16						androgen receptor signaling pathway|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	receptor activity|thyroid hormone receptor binding|thyroid hormone receptor coactivator activity|vitamin D receptor binding				0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;6.59e-06)|all_lung(49;9.97e-06)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
ARID3A	1820	broad.mit.edu	37	19	968371	968371	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:968371delA	uc002lql.2	+							NM_005224	NP_005215			AT rich interactive domain 3A (BRIGHT- like)							cytoplasm|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.04e-05)|all_lung(49;1.53e-05)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
GRIN3B	116444	broad.mit.edu	37	19	1004499	1004499	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1004499delC	uc002lqo.1	+							NM_138690	NP_619635			glutamate receptor, ionotropic,						ionotropic glutamate receptor signaling pathway|protein insertion into membrane|regulation of calcium ion transport	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|neuronal cell body|outer membrane-bounded periplasmic space|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|glycine binding|ionotropic glutamate receptor activity|neurotransmitter receptor activity				0		Acute lymphoblastic leukemia(61;4.36e-14)|all_hematologic(61;4.84e-09)|Lung NSC(49;0.000226)|all_lung(49;0.000353)|Breast(49;0.00066)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)	Glycine(DB00145)|L-Glutamic Acid(DB00142)|Orphenadrine(DB01173)													---	---	---	---
ABCA7	10347	broad.mit.edu	37	19	1055848	1055849	+	Intron	INS	-	TC	TC			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1055848_1055849insTC	uc002lqw.3	+						ABCA7_uc010dsb.1_Intron|ABCA7_uc002lqy.2_5'Flank|ABCA7_uc010dsc.2_5'Flank	NM_019112	NP_061985			ATP-binding cassette, sub-family A, member 7						phagocytosis|transmembrane transport	ATP-binding cassette (ABC) transporter complex|endosome membrane|Golgi membrane|integral to membrane|plasma membrane	ATP binding|ATPase activity|transporter activity			pancreas(7)|ovary(1)|central_nervous_system(1)	9		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.04e-05)|all_lung(49;1.53e-05)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
ZNF556	80032	broad.mit.edu	37	19	2873789	2873789	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2873789delA	uc002lwp.1	+						ZNF556_uc002lwq.2_Intron	NM_024967	NP_079243			zinc finger protein 556						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(3)	3				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
Unknown	0	broad.mit.edu	37	19	3131446	3131446	+	IGR	DEL	C	-	-	rs66993077		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3131446delC								GNA11 (9994 upstream) : GNA15 (4745 downstream)																																			---	---	---	---
ATCAY	85300	broad.mit.edu	37	19	3905691	3905692	+	Intron	INS	-	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3905691_3905692insC	uc002lyy.3	+						ATCAY_uc010xhz.1_Intron	NM_033064	NP_149053			caytaxin						transport		protein binding			breast(1)	1		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.00485)|STAD - Stomach adenocarcinoma(1328;0.183)														---	---	---	---
CREB3L3	84699	broad.mit.edu	37	19	4155660	4155660	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4155660delT	uc002lzl.2	+						CREB3L3_uc002lzm.2_Intron|CREB3L3_uc010xib.1_Intron|CREB3L3_uc010xic.1_Intron	NM_032607	NP_115996			cAMP responsive element binding protein 3-like						response to unfolded protein	endoplasmic reticulum membrane|integral to membrane|nucleus	protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|skin(1)	2				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0232)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
DPP9	91039	broad.mit.edu	37	19	4697751	4697752	+	Intron	INS	-	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4697751_4697752insC	uc002mba.2	-						DPP9_uc002mbb.2_Intron|DPP9_uc002mbc.2_Intron	NM_139159	NP_631898			dipeptidylpeptidase 9						proteolysis	cytosol|membrane	aminopeptidase activity|serine-type peptidase activity			skin(1)	1		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.00884)														---	---	---	---
Unknown	0	broad.mit.edu	37	19	4778457	4778457	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4778457delT								C19orf30 (5890 upstream) : FEM1A (13271 downstream)																																			---	---	---	---
UHRF1	29128	broad.mit.edu	37	19	4911139	4911139	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4911139delC	uc002mbo.2	+						uc002mbn.1_5'Flank|UHRF1_uc010xik.1_Intron|UHRF1_uc010duf.2_Intron|UHRF1_uc002mbp.2_Intron	NM_001048201	NP_001041666			ubiquitin-like with PHD and ring finger domains						cell cycle|cell proliferation|DNA repair|regulation of transcription from RNA polymerase II promoter	nucleus	acid-amino acid ligase activity|methyl-CpG binding|methylated histone residue binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(2)	2				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0276)												OREG0025176	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PTPRS	5802	broad.mit.edu	37	19	5212311	5212311	+	Intron	DEL	G	-	-	rs45439595	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5212311delG	uc002mbv.2	-						PTPRS_uc002mbu.1_Intron|PTPRS_uc010xin.1_Intron|PTPRS_uc002mbw.2_Intron|PTPRS_uc002mbx.2_Intron|PTPRS_uc002mby.2_Intron	NM_002850	NP_002841			protein tyrosine phosphatase, receptor type,						cell adhesion	integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			large_intestine(2)|ovary(1)|central_nervous_system(1)	4				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0321)|Lung(535;0.182)														---	---	---	---
TMEM146	257062	broad.mit.edu	37	19	5744622	5744623	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5744622_5744623delTT	uc002mda.2	+						TMEM146_uc010duj.1_Intron	NM_152784	NP_689997			transmembrane protein 146 precursor							integral to membrane				ovary(1)|central_nervous_system(1)|pancreas(1)	3																		---	---	---	---
FUT3	2525	broad.mit.edu	37	19	5845001	5845001	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5845001delA	uc002mdk.2	-						FUT3_uc002mdm.2_Intron|FUT3_uc002mdj.2_Intron|FUT3_uc002mdl.2_Intron|uc002mdn.2_5'Flank	NM_001097641	NP_001091110			fucosyltransferase 3						protein glycosylation	Golgi cisterna membrane|integral to membrane|membrane fraction	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity				0																		---	---	---	---
INSR	3643	broad.mit.edu	37	19	7121012	7121013	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7121012_7121013delTT	uc002mgd.1	-						INSR_uc002mge.1_Intron	NM_000208	NP_000199			insulin receptor isoform Long precursor						activation of MAPK activity|activation of protein kinase B activity|carbohydrate metabolic process|fibroblast growth factor receptor signaling pathway|G-protein coupled receptor protein signaling pathway|glucose homeostasis|heart morphogenesis|peptidyl-tyrosine phosphorylation|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of developmental growth|positive regulation of DNA replication|positive regulation of glucose import|positive regulation of glycogen biosynthetic process|positive regulation of glycolysis|positive regulation of MAPKKK cascade|positive regulation of mitosis|positive regulation of nitric oxide biosynthetic process|positive regulation of protein kinase B signaling cascade|positive regulation of protein phosphorylation|positive regulation of respiratory burst|protein autophosphorylation|protein heterotetramerization|regulation of embryonic development|regulation of transcription, DNA-dependent|transformation of host cell by virus	caveola|endosome membrane|insulin receptor complex|microsome	ATP binding|GTP binding|insulin binding|insulin receptor activity|insulin receptor substrate binding|insulin-like growth factor I binding|insulin-like growth factor II binding|insulin-like growth factor receptor binding|metal ion binding|phosphatidylinositol 3-kinase binding|PTB domain binding|receptor signaling protein tyrosine kinase activity|SH2 domain binding			ovary(4)|lung(3)|central_nervous_system(2)|large_intestine(1)|stomach(1)|skin(1)	12					Insulin Glargine recombinant(DB00047)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)													---	---	---	---
KIAA1543	57662	broad.mit.edu	37	19	7675917	7675917	+	Intron	DEL	C	-	-	rs747569	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7675917delC	uc002mgv.3	+						KIAA1543_uc002mgu.3_Intron	NM_020902	NP_065953			NEZHA isoform 2						epithelial cell-cell adhesion|microtubule anchoring|regulation of microtubule cytoskeleton organization|zonula adherens maintenance	cytoplasm|microtubule|zonula adherens	microtubule minus-end binding			pancreas(1)	1																		---	---	---	---
LRRC8E	80131	broad.mit.edu	37	19	7965904	7965905	+	3'UTR	INS	-	G	G	rs147400269	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7965904_7965905insG	uc002mir.2	+	3					MAP2K7_uc002mis.1_5'Flank|MAP2K7_uc002miv.2_5'Flank|MAP2K7_uc010xka.1_5'Flank|MAP2K7_uc002mit.2_5'Flank|MAP2K7_uc010xkb.1_5'Flank|MAP2K7_uc010dvv.2_5'Flank	NM_025061	NP_079337			leucine rich repeat containing 8 family, member							integral to membrane				lung(1)|pancreas(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	19	8414734	8414735	+	IGR	DEL	AA	-	-	rs113380593		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8414734_8414735delAA								KANK3 (6588 upstream) : ANGPTL4 (14276 downstream)																																			---	---	---	---
HNRNPM	4670	broad.mit.edu	37	19	8520610	8520611	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8520610_8520611delTT	uc010dwe.2	+						HNRNPM_uc010dwc.1_Intron|HNRNPM_uc010xke.1_Intron|HNRNPM_uc010dwd.2_Intron	NM_005968	NP_005959			heterogeneous nuclear ribonucleoprotein M						alternative nuclear mRNA splicing, via spliceosome	catalytic step 2 spliceosome|integral to plasma membrane|nuclear matrix|nucleolus|paraspeckles	nucleotide binding|protein domain specific binding|RNA binding				0																		---	---	---	---
HNRNPM	4670	broad.mit.edu	37	19	8548123	8548123	+	Intron	DEL	T	-	-	rs142155944		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8548123delT	uc010dwe.2	+						HNRNPM_uc010xke.1_Intron|HNRNPM_uc010dwd.2_Intron|HNRNPM_uc002mka.2_Intron	NM_005968	NP_005959			heterogeneous nuclear ribonucleoprotein M						alternative nuclear mRNA splicing, via spliceosome	catalytic step 2 spliceosome|integral to plasma membrane|nuclear matrix|nucleolus|paraspeckles	nucleotide binding|protein domain specific binding|RNA binding				0																		---	---	---	---
MUC16	94025	broad.mit.edu	37	19	9025777	9025777	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9025777delT	uc002mkp.2	-							NM_024690	NP_078966			mucin 16						cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---
ZNF560	147741	broad.mit.edu	37	19	9580937	9580937	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9580937delA	uc002mlp.1	-						ZNF560_uc010dwr.1_Intron	NM_152476	NP_689689			zinc finger protein 560						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(2)|ovary(1)|large_intestine(1)|pancreas(1)|liver(1)	6																		---	---	---	---
COL5A3	50509	broad.mit.edu	37	19	10071664	10071664	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10071664delC	uc002mmq.1	-							NM_015719	NP_056534			collagen, type V, alpha 3 preproprotein						collagen fibril organization|skin development	collagen type V	collagen binding|extracellular matrix structural constituent			ovary(7)|lung(1)|central_nervous_system(1)|skin(1)	10			Epithelial(33;7.11e-05)															---	---	---	---
PDE4A	5141	broad.mit.edu	37	19	10572804	10572804	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10572804delT	uc002moj.2	+						PDE4A_uc002mok.2_Intron|PDE4A_uc002mol.2_Intron|PDE4A_uc002mom.2_Intron|PDE4A_uc002mon.2_Intron|PDE4A_uc002moo.2_Intron	NM_001111307	NP_001104777			phosphodiesterase 4A isoform 1						signal transduction	cytosol|membrane fraction|perinuclear region of cytoplasm|ruffle membrane|soluble fraction	3',5'-cyclic-AMP phosphodiesterase activity|metal ion binding|protein binding			ovary(1)|breast(1)|central_nervous_system(1)	3			OV - Ovarian serous cystadenocarcinoma(20;5.8e-10)|Epithelial(33;7.58e-07)|all cancers(31;3.91e-06)		Cilostazol(DB01166)|Dipyridamole(DB00975)|Dyphylline(DB00651)|Enprofylline(DB00824)|Iloprost(DB01088)|Milrinone(DB00235)|Pentoxifylline(DB00806)|Phentolamine(DB00692)|Tadalafil(DB00820)|Theophylline(DB00277)													---	---	---	---
QTRT1	81890	broad.mit.edu	37	19	10824023	10824023	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10824023delT	uc002mpr.2	+	10					DNM2_uc010dxk.2_Intron	NM_031209	NP_112486			queuine tRNA-ribosyltransferase 1						queuosine biosynthetic process	mitochondrion|nucleus|ribosome	metal ion binding|queuine tRNA-ribosyltransferase activity			skin(1)	1			Epithelial(33;1.55e-05)|all cancers(31;3.42e-05)															---	---	---	---
DNM2	1785	broad.mit.edu	37	19	10870400	10870401	+	Intron	INS	-	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10870400_10870401insC	uc002mps.1	+						DNM2_uc010dxk.2_Intron|DNM2_uc002mpt.1_Intron|DNM2_uc002mpv.1_Intron|DNM2_uc002mpu.1_Intron|DNM2_uc010dxl.1_Intron	NM_001005361	NP_001005361			dynamin 2 isoform 2						G2/M transition of mitotic cell cycle|positive regulation of apoptosis|positive regulation of transcription, DNA-dependent|post-Golgi vesicle-mediated transport|receptor internalization|signal transduction|synaptic vesicle transport|transferrin transport	cell junction|cytosol|Golgi membrane|microtubule|postsynaptic density|postsynaptic membrane	GTP binding|GTPase activity|microtubule binding			central_nervous_system(2)|skin(2)|ovary(1)|breast(1)	6			Epithelial(33;4.17e-05)|all cancers(31;8.48e-05)															---	---	---	---
DNM2	1785	broad.mit.edu	37	19	10935483	10935483	+	Intron	DEL	A	-	-	rs74891021		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10935483delA	uc002mps.1	+						DNM2_uc010dxk.2_Intron|DNM2_uc002mpt.1_Intron|DNM2_uc002mpv.1_Intron|DNM2_uc002mpu.1_Intron|DNM2_uc010dxl.1_Intron|DNM2_uc002mpw.2_Intron|DNM2_uc002mpx.1_Intron	NM_001005361	NP_001005361			dynamin 2 isoform 2						G2/M transition of mitotic cell cycle|positive regulation of apoptosis|positive regulation of transcription, DNA-dependent|post-Golgi vesicle-mediated transport|receptor internalization|signal transduction|synaptic vesicle transport|transferrin transport	cell junction|cytosol|Golgi membrane|microtubule|postsynaptic density|postsynaptic membrane	GTP binding|GTPase activity|microtubule binding			central_nervous_system(2)|skin(2)|ovary(1)|breast(1)	6			Epithelial(33;4.17e-05)|all cancers(31;8.48e-05)															---	---	---	---
SMARCA4	6597	broad.mit.edu	37	19	11144368	11144368	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11144368delT	uc002mqf.3	+						SMARCA4_uc010dxp.2_Intron|SMARCA4_uc010dxo.2_Intron|SMARCA4_uc010dxq.2_Intron|SMARCA4_uc010dxr.2_Intron|SMARCA4_uc002mqj.3_Intron|SMARCA4_uc010dxs.2_Intron|SMARCA4_uc010dxt.1_Intron|SMARCA4_uc002mqh.3_Intron|SMARCA4_uc002mqi.1_Intron	NM_003072	NP_003063			SWI/SNF-related matrix-associated						chromatin remodeling|negative regulation of androgen receptor signaling pathway|negative regulation of cell growth|negative regulation of S phase of mitotic cell cycle|negative regulation of transcription from RNA polymerase II promoter|nervous system development|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nBAF complex|npBAF complex|nuclear chromatin|SWI/SNF complex|WINAC complex	androgen receptor binding|ATP binding|DNA binding|DNA-dependent ATPase activity|helicase activity|histone acetyl-lysine binding|identical protein binding|p53 binding|protein N-terminus binding|transcription corepressor activity			lung(29)|ovary(8)|pancreas(7)|large_intestine(5)|central_nervous_system(5)|skin(3)|prostate(3)|breast(2)|adrenal_gland(1)|stomach(1)|liver(1)|autonomic_ganglia(1)|kidney(1)	67		all_lung(6;0.0512)|Lung NSC(9;0.0568)						F|N|Mis		NSCLC				Rhabdoid_Predisposition_syndrome				---	---	---	---
TMEM205	374882	broad.mit.edu	37	19	11455832	11455833	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11455832_11455833delTT	uc002mrb.2	-						TMEM205_uc002mra.2_Intron|TMEM205_uc002mqz.2_Intron|TMEM205_uc002mrc.2_Intron|CCDC159_uc010xlr.1_5'Flank|CCDC159_uc010xls.1_5'Flank|CCDC159_uc010xlt.1_5'Flank|CCDC159_uc010xlu.1_5'Flank|CCDC159_uc010xlv.1_5'Flank	NM_001145416	NP_001138888			transmembrane protein 205							integral to membrane					0																		---	---	---	---
LPPR2	64748	broad.mit.edu	37	19	11470601	11470601	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11470601delC	uc002mre.1	+	5	697	c.360delC	c.(358-360)AGCfs	p.S120fs	LPPR2_uc002mrf.1_Frame_Shift_Del_p.S95fs|LPPR2_uc010dxy.1_5'UTR	NM_022737	NP_073574	Q96GM1	LPPR2_HUMAN	lipid phosphate phosphatase-related protein type	120						integral to membrane	phosphatidate phosphatase activity			large_intestine(1)	1																		---	---	---	---
ELAVL3	1995	broad.mit.edu	37	19	11577605	11577605	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11577605delC	uc002mry.1	-	2	427	c.47delG	c.(46-48)GGCfs	p.G16fs	ELAVL3_uc002mrx.1_Frame_Shift_Del_p.G16fs	NM_001420	NP_001411	Q14576	ELAV3_HUMAN	ELAV-like protein 3 isoform 1	16					cell differentiation|nervous system development		AU-rich element binding|nucleotide binding			ovary(1)|breast(1)|skin(1)	3																		---	---	---	---
ZNF44	51710	broad.mit.edu	37	19	12384448	12384448	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12384448delA	uc010xmj.1	-	5	971	c.766delT	c.(766-768)TGGfs	p.W256fs	ZNF44_uc002mtl.2_Intron|ZNF44_uc010dyr.1_Intron|ZNF44_uc010xmi.1_RNA|ZNF44_uc002mtn.3_RNA|ZNF44_uc010dys.2_Frame_Shift_Del_p.W208fs	NM_001164276	NP_001157748	P15621	ZNF44_HUMAN	zinc finger protein 44 isoform 1	256	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|microtubule cytoskeleton|nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)	1		Renal(1328;0.157)		GBM - Glioblastoma multiforme(1328;0.0164)|Lung(535;0.179)														---	---	---	---
ZNF709	163051	broad.mit.edu	37	19	12597357	12597358	+	5'Flank	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12597357_12597358delAA	uc002mtv.3	-						ZNF709_uc002mtw.3_Intron|ZNF709_uc002mtx.3_Intron	NM_152601	NP_689814			zinc finger protein 709 isoform a						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
ZNF490	57474	broad.mit.edu	37	19	12693860	12693863	+	Intron	DEL	TTTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12693860_12693863delTTTT	uc002mtz.2	-							NM_020714	NP_065765			zinc finger protein 490						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
RNASEH2A	10535	broad.mit.edu	37	19	12923822	12923822	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12923822delA	uc002mvg.1	+						RNASEH2A_uc002mvf.1_Intron	NM_006397	NP_006388			ribonuclease H2, large subunit						DNA replication|RNA catabolic process	nucleus|ribonuclease H2 complex	metal ion binding|ribonuclease H activity|RNA binding			breast(2)|central_nervous_system(1)	3																		---	---	---	---
STX10	8677	broad.mit.edu	37	19	13255557	13255557	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:13255557delC	uc010xnb.1	-						STX10_uc002mwn.2_Intron|STX10_uc002mwo.2_Intron|STX10_uc010xna.1_Intron|STX10_uc010xnc.1_Intron	NM_003765	NP_003756			syntaxin 10						Golgi vesicle transport|intracellular protein transport|retrograde transport, endosome to Golgi	Golgi membrane|integral to membrane	SNAP receptor activity				0			OV - Ovarian serous cystadenocarcinoma(19;3.41e-21)															---	---	---	---
CACNA1A	773	broad.mit.edu	37	19	13318095	13318095	+	3'UTR	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:13318095delG	uc010dze.2	-	47					CACNA1A_uc010xnd.1_3'UTR|CACNA1A_uc002mwx.3_3'UTR|CACNA1A_uc010dzc.2_3'UTR|CACNA1A_uc002mwy.3_3'UTR|CACNA1A_uc002mwv.3_3'UTR	NM_001127221	NP_001120693			calcium channel, alpha 1A subunit isoform 3						cell death|elevation of cytosolic calcium ion concentration|energy reserve metabolic process|membrane depolarization|regulation of insulin secretion	cytoplasm|nucleus	syntaxin binding			large_intestine(2)	2			OV - Ovarian serous cystadenocarcinoma(19;5.07e-21)		Bepridil(DB01244)|Cinnarizine(DB00568)|Loperamide(DB00836)|Nisoldipine(DB00401)|Pregabalin(DB00230)													---	---	---	---
EMR3	84658	broad.mit.edu	37	19	14762192	14762192	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:14762192delA	uc002mzi.3	-						EMR3_uc010dzp.2_Intron|EMR3_uc010xnv.1_Intron	NM_032571	NP_115960			egf-like module-containing mucin-like receptor						neuropeptide signaling pathway	extracellular space|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(5)|skin(1)	6																		---	---	---	---
ZNF333	84449	broad.mit.edu	37	19	14810278	14810279	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:14810278_14810279delTT	uc002mzn.2	+						ZNF333_uc010dzq.2_Intron|ZNF333_uc002mzk.3_Intron|ZNF333_uc002mzl.3_Intron|ZNF333_uc002mzm.2_Intron|ZNF333_uc010dzr.1_Intron	NM_032433	NP_115809			zinc finger protein 333						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3																		---	---	---	---
CALR3	125972	broad.mit.edu	37	19	16593035	16593035	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16593035delA	uc002ned.2	-						MED26_uc002nee.2_Intron	NM_145046	NP_659483			calreticulin 3 precursor						protein folding	endoplasmic reticulum lumen	calcium ion binding|sugar binding|unfolded protein binding				0																		---	---	---	---
C19orf44	84167	broad.mit.edu	37	19	16617646	16617647	+	Intron	INS	-	A	A	rs28716321	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16617646_16617647insA	uc002neh.1	+						MED26_uc002nee.2_Intron|C19orf44_uc002nef.1_Intron|C19orf44_uc002neg.2_Intron|C19orf44_uc010eai.1_Intron	NM_032207	NP_115583			hypothetical protein LOC84167												0																		---	---	---	---
CPAMD8	27151	broad.mit.edu	37	19	17113040	17113040	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17113040delC	uc002nfb.2	-							NM_015692	NP_056507			C3 and PZP-like, alpha-2-macroglobulin domain							extracellular space|plasma membrane	serine-type endopeptidase inhibitor activity			ovary(4)|breast(4)|large_intestine(3)|pancreas(1)|skin(1)	13																		---	---	---	---
MYO9B	4650	broad.mit.edu	37	19	17263374	17263375	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17263374_17263375delAA	uc010eak.2	+						MYO9B_uc002nfi.2_Intron|MYO9B_uc002nfj.1_Intron	NM_004145	NP_004136			myosin IXB isoform 1						actin filament-based movement	cell cortex|cytosol|filamentous actin|myosin complex|perinuclear region of cytoplasm	actin binding|ADP binding|ATP binding|ATPase activity|calmodulin binding|metal ion binding|microfilament motor activity|Rho GTPase activator activity			breast(1)	1																		---	---	---	---
MYO9B	4650	broad.mit.edu	37	19	17315960	17315960	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17315960delA	uc010eak.2	+						MYO9B_uc002nfi.2_Intron|MYO9B_uc002nfj.1_Intron|MYO9B_uc002nfl.1_Intron|MYO9B_uc002nfm.1_5'Flank	NM_004145	NP_004136			myosin IXB isoform 1						actin filament-based movement	cell cortex|cytosol|filamentous actin|myosin complex|perinuclear region of cytoplasm	actin binding|ADP binding|ATP binding|ATPase activity|calmodulin binding|metal ion binding|microfilament motor activity|Rho GTPase activator activity			breast(1)	1																		---	---	---	---
MYO9B	4650	broad.mit.edu	37	19	17322569	17322569	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17322569delG	uc010eak.2	+	39	6196	c.6044delG	c.(6043-6045)CGGfs	p.R2015fs	MYO9B_uc002nfi.2_Frame_Shift_Del_p.R2015fs|MYO9B_uc002nfm.1_Frame_Shift_Del_p.R175fs	NM_004145	NP_004136	Q13459	MYO9B_HUMAN	myosin IXB isoform 1	2015	Tail.				actin filament-based movement	cell cortex|cytosol|filamentous actin|myosin complex|perinuclear region of cytoplasm	actin binding|ADP binding|ATP binding|ATPase activity|calmodulin binding|metal ion binding|microfilament motor activity|Rho GTPase activator activity			breast(1)	1																		---	---	---	---
C19orf62	29086	broad.mit.edu	37	19	17389949	17389949	+	3'UTR	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17389949delG	uc002nfu.2	+	9					C19orf62_uc002nfv.2_3'UTR|C19orf62_uc010ean.2_Intron|C19orf62_uc002nfw.2_3'UTR|ANKLE1_uc010xpm.1_5'Flank|ANKLE1_uc002nga.2_5'Flank|ANKLE1_uc010eao.1_5'Flank|ANKLE1_uc010xpn.1_5'Flank|ANKLE1_uc002nfy.2_5'Flank|ANKLE1_uc002nfz.2_5'Flank	NM_014173	NP_054892			mediator of Rap80 interactions and targeting 40						chromatin modification|double-strand break repair|G2/M transition DNA damage checkpoint|positive regulation of DNA repair|protein K63-linked deubiquitination|response to ionizing radiation	BRCA1-A complex|BRISC complex|cytoplasm	protein binding			ovary(1)|haematopoietic_and_lymphoid_tissue(1)	2																		---	---	---	---
MAST3	23031	broad.mit.edu	37	19	18248193	18248193	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:18248193delG	uc002nhz.3	+							NM_015016	NP_055831			microtubule associated serine/threonine kinase								ATP binding|magnesium ion binding|protein binding|protein serine/threonine kinase activity			large_intestine(2)|ovary(2)|stomach(1)	5																		---	---	---	---
PIK3R2	5296	broad.mit.edu	37	19	18273703	18273703	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:18273703delA	uc002nia.1	+						PIK3R2_uc002nib.1_Intron|PIK3R2_uc010ebi.1_Intron	NM_005027	NP_005018			phosphoinositide-3-kinase, regulatory subunit 2						fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|leukocyte migration|negative regulation of anti-apoptosis|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|platelet activation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction|T cell costimulation|T cell receptor signaling pathway	phosphatidylinositol 3-kinase complex	GTPase activator activity|phosphatidylinositol 3-kinase regulator activity|protein binding			lung(2)|stomach(1)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|pancreas(1)	6																		---	---	---	---
Unknown	0	broad.mit.edu	37	19	19959565	19959565	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19959565delT								ZNF506 (27005 upstream) : ZNF253 (17149 downstream)																																			---	---	---	---
ZNF93	81931	broad.mit.edu	37	19	20044270	20044270	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:20044270delA	uc002non.2	+	4	617	c.506delA	c.(505-507)GAAfs	p.E169fs		NM_031218	NP_112495	P35789	ZNF93_HUMAN	zinc finger protein 93	169						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			pancreas(1)	1																		---	---	---	---
ZNF90	7643	broad.mit.edu	37	19	20215228	20215229	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:20215228_20215229insT	uc002nor.2	+						ZNF90_uc002nos.1_Intron|ZNF90_uc002not.1_Intron	NM_007138	NP_009069			zinc finger protein 90							Golgi apparatus|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|skin(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	19	35128512	35128512	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35128512delA	uc002nvo.1	-											Homo sapiens cDNA FLJ36176 fis, clone TESTI2026491.																														---	---	---	---
HPN	3249	broad.mit.edu	37	19	35556034	35556034	+	Intron	DEL	T	-	-	rs113406953		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35556034delT	uc002nxq.1	+						HPN_uc002nxr.1_Intron|HPN_uc002nxs.1_Intron|HPN_uc010xsh.1_Intron|HPN_uc002nxt.1_Intron|LOC100128675_uc010xsi.1_Intron	NM_002151	NP_002142			hepsin						cell growth|proteolysis	cytoplasm|integral to plasma membrane	scavenger receptor activity|serine-type endopeptidase activity			ovary(1)|central_nervous_system(1)	2	all_lung(56;5.38e-08)|Lung NSC(56;8.61e-08)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0849)		Coagulation factor VIIa(DB00036)													---	---	---	---
ZNF829	374899	broad.mit.edu	37	19	37393061	37393061	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37393061delA	uc002ofa.1	-						ZNF345_uc002oez.2_Intron	NM_001037232	NP_001032309			zinc finger protein 829						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	Esophageal squamous(110;0.183)		COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)															---	---	---	---
SPTBN4	57731	broad.mit.edu	37	19	41062840	41062840	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41062840delA	uc002ony.2	+						SPTBN4_uc002onx.2_Intron|SPTBN4_uc002onz.2_Intron|SPTBN4_uc010egx.2_Intron|SPTBN4_uc002ooa.2_Intron	NM_020971	NP_066022			spectrin, beta, non-erythrocytic 4 isoform						actin filament capping|axon guidance|cytoskeletal anchoring at plasma membrane|vesicle-mediated transport	cytosol|nuclear matrix|PML body|spectrin	actin binding|ankyrin binding|structural constituent of cytoskeleton			ovary(3)|central_nervous_system(1)|skin(1)	5			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)															---	---	---	---
PSG3	5671	broad.mit.edu	37	19	43228338	43228338	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43228338delT	uc002oue.2	-						PSG3_uc002ouf.2_Intron|PSG3_uc010eil.2_Intron	NM_021016	NP_066296			pregnancy specific beta-1-glycoprotein 3						defense response|female pregnancy	extracellular region				ovary(1)|skin(1)	2		Prostate(69;0.00682)																---	---	---	---
KCNN4	3783	broad.mit.edu	37	19	44272893	44272893	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44272893delT	uc002oxl.2	-						KCNN4_uc010eiz.2_Intron	NM_002250	NP_002241			intermediate conductance calcium-activated						defense response	voltage-gated potassium channel complex	calcium-activated potassium channel activity|calmodulin binding			ovary(2)	2		Prostate(69;0.0352)			Clotrimazole(DB00257)|Halothane(DB01159)|Quinine(DB00468)													---	---	---	---
MARK4	57787	broad.mit.edu	37	19	45767748	45767749	+	Intron	INS	-	A	A	rs79255924		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45767748_45767749insA	uc002pbb.1	+						MARK4_uc002paz.1_Intron|MARK4_uc002pba.1_Intron|MARK4_uc002pbc.1_5'Flank					RecName: Full=MAP/microtubule affinity-regulating kinase 4;          EC=2.7.11.1; AltName: Full=MAP/microtubule affinity-regulating kinase-like 1;						microtubule bundle formation|nervous system development|positive regulation of programmed cell death	centrosome|neuron projection	ATP binding|gamma-tubulin binding|microtubule binding|protein serine/threonine kinase activity|tau-protein kinase activity|ubiquitin binding			central_nervous_system(2)|large_intestine(1)	3		all_neural(266;0.224)|Ovarian(192;0.231)		OV - Ovarian serous cystadenocarcinoma(262;0.0102)														---	---	---	---
CKM	1158	broad.mit.edu	37	19	45822685	45822685	+	Intron	DEL	C	-	-	rs68016783		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45822685delC	uc002pbd.2	-							NM_001824	NP_001815			muscle creatine kinase						creatine metabolic process	cytosol	ATP binding|creatine kinase activity			skin(1)	1		Ovarian(192;0.0336)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;2.29e-44)|Epithelial(262;1.05e-38)|GBM - Glioblastoma multiforme(486;3.56e-07)	Creatine(DB00148)													---	---	---	---
RPL18	6141	broad.mit.edu	37	19	49120253	49120253	+	Intron	DEL	A	-	-	rs72324905		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49120253delA	uc002pjq.1	-						RPL18_uc002pjp.1_Intron|RPL18_uc010xzs.1_Intron|SPHK2_uc002pjr.2_5'Flank|SPHK2_uc010xzt.1_5'Flank|SPHK2_uc002pjs.2_5'Flank	NM_000979	NP_000970			ribosomal protein L18						endocrine pancreas development|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit	RNA binding|structural constituent of ribosome				0		all_epithelial(76;2.38e-06)|all_lung(116;4.89e-06)|Lung NSC(112;9.34e-06)|all_neural(266;0.0189)|Ovarian(192;0.0261)		OV - Ovarian serous cystadenocarcinoma(262;9.89e-05)|all cancers(93;0.00011)|GBM - Glioblastoma multiforme(486;0.0061)|Epithelial(262;0.0154)														---	---	---	---
TBC1D17	79735	broad.mit.edu	37	19	50385972	50385972	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50385972delC	uc002pqo.2	+						TBC1D17_uc010enn.1_Intron|TBC1D17_uc010ybg.1_Intron|TBC1D17_uc002pqp.2_Intron|TBC1D17_uc002pqq.1_Intron|TBC1D17_uc002pqr.2_Intron|TBC1D17_uc002pqs.2_Intron	NM_024682	NP_078958			TBC1 domain family, member 17							intracellular	Rab GTPase activator activity				0		all_lung(116;0.000338)|Lung NSC(112;0.000446)|all_neural(266;0.107)|Ovarian(192;0.231)		GBM - Glioblastoma multiforme(134;0.0116)|OV - Ovarian serous cystadenocarcinoma(262;0.017)														---	---	---	---
PPP2R1A	5518	broad.mit.edu	37	19	52724056	52724056	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52724056delA	uc002pyp.2	+						PPP2R1A_uc010ydk.1_Intron|PPP2R1A_uc002pyq.2_Intron	NM_014225	NP_055040			alpha isoform of regulatory subunit A, protein						ceramide metabolic process|chromosome segregation|G2/M transition of mitotic cell cycle|inactivation of MAPK activity|induction of apoptosis|negative regulation of cell growth|negative regulation of tyrosine phosphorylation of Stat3 protein|protein complex assembly|protein dephosphorylation|regulation of cell adhesion|regulation of cell differentiation|regulation of DNA replication|regulation of transcription, DNA-dependent|regulation of Wnt receptor signaling pathway|response to organic substance|RNA splicing|second-messenger-mediated signaling	chromosome, centromeric region|cytosol|membrane|microtubule cytoskeleton|mitochondrion|nucleus|protein phosphatase type 2A complex|soluble fraction	antigen binding|protein heterodimerization activity|protein phosphatase type 2A regulator activity			endometrium(31)|ovary(28)|lung(2)|breast(2)|skin(1)|kidney(1)|pancreas(1)	66				GBM - Glioblastoma multiforme(134;0.00456)|OV - Ovarian serous cystadenocarcinoma(262;0.015)				Mis		clear cell ovarian carcinoma								---	---	---	---
Unknown	0	broad.mit.edu	37	19	53715862	53715862	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53715862delT								ZNF665 (19243 upstream) : ZNF677 (22776 downstream)																																			---	---	---	---
ZNF765	91661	broad.mit.edu	37	19	53879377	53879377	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53879377delT	uc010ydx.1	+						ZNF525_uc010eqn.2_Intron|ZNF525_uc002qbl.2_Intron	NM_001040185	NP_001035275			zinc finger protein 765						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.00379)														---	---	---	---
KIR2DL4	3805	broad.mit.edu	37	19	55324675	55324675	+	Splice_Site	DEL	A	-	-	rs66505238		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55324675delA	uc010yfm.1	+	6	841	c.801_splice	c.e6+1	p.S267_splice	KIR2DS4_uc010yfj.1_Intron|KIR2DS4_uc010yfk.1_Intron|KIR2DL4_uc010yfl.1_Frame_Shift_Del_p.K263fs|KIR2DL4_uc002qhg.2_Intron|KIR2DL4_uc002qhi.2_Frame_Shift_Del_p.K251fs|KIR2DL4_uc002qhh.2_Intron|KIR2DL4_uc002qhj.2_Intron|KIR2DL4_uc002qhf.2_Intron|KIR2DL4_uc010esd.2_Intron|KIR2DL4_uc010ese.2_RNA	NM_002255	NP_002246			killer cell immunoglobulin-like receptor, two						cellular defense response|regulation of immune response	integral to plasma membrane	protein binding|transmembrane receptor activity			ovary(1)	1				GBM - Glioblastoma multiforme(193;0.0192)														---	---	---	---
NLRP2	55655	broad.mit.edu	37	19	55505987	55505987	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55505987delT	uc002qij.2	+						NLRP2_uc010yfp.1_Intron|NLRP2_uc010esn.2_Intron|NLRP2_uc010eso.2_Intron|NLRP2_uc010esp.2_Intron	NM_017852	NP_060322			NLR family, pyrin domain containing 2						apoptosis|positive regulation of caspase activity|positive regulation of interleukin-1 beta secretion	cytoplasm	ATP binding|Pyrin domain binding			ovary(1)|skin(1)	2			BRCA - Breast invasive adenocarcinoma(297;0.163)	GBM - Glioblastoma multiforme(193;0.028)														---	---	---	---
ZNF580	51157	broad.mit.edu	37	19	56153990	56153992	+	In_Frame_Del	DEL	CTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56153990_56153992delCTT	uc002qlo.2	+	2	286_288	c.116_118delCTT	c.(115-120)CCTTCC>CCC	p.S41del	ZNF580_uc002qlm.2_In_Frame_Del_p.S54del|ZNF581_uc002qln.2_Intron|ZNF580_uc002qlp.2_In_Frame_Del_p.S41del|ZNF580_uc010ygd.1_In_Frame_Del_p.S41del|ZNF581_uc002qlq.2_5'Flank	NM_207115	NP_996998	Q9UK33	ZN580_HUMAN	zinc finger protein 580	41	Pro-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0			BRCA - Breast invasive adenocarcinoma(297;0.18)	GBM - Glioblastoma multiforme(193;0.105)														---	---	---	---
ZSCAN5A	79149	broad.mit.edu	37	19	56853697	56853697	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56853697delT	uc002qmr.2	-							NM_024303	NP_077279			zinc finger and SCAN domain containing 5A						viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			large_intestine(1)|ovary(1)|skin(1)	3																		---	---	---	---
PANK2	80025	broad.mit.edu	37	20	3897857	3897858	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3897857_3897858delTT	uc002wkc.2	+						PANK2_uc002wkb.2_Intron|PANK2_uc002wkd.2_Intron|PANK2_uc002wke.2_Intron|PANK2_uc002wkf.2_Intron|uc002wkg.2_5'Flank|MIR103-2_hsa-mir-103-2|MI0000108_5'Flank	NM_153638	NP_705902			pantothenate kinase 2 isoform 1 preproprotein						cell death|coenzyme A biosynthetic process|pantothenate metabolic process	mitochondrial intermembrane space|nucleus	ATP binding|pantothenate kinase activity|protein binding				0																		---	---	---	---
TRMT6	51605	broad.mit.edu	37	20	5919492	5919492	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:5919492delT	uc002wmh.1	-						TRMT6_uc010zra.1_Intron	NM_015939	NP_057023			tRNA methyltransferase 6						regulation of translational initiation|tRNA processing	nucleus	protein binding|translation initiation factor activity			pancreas(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	20	29930733	29930733	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:29930733delT								DEFB116 (34345 upstream) : DEFB118 (25695 downstream)																																			---	---	---	---
DEFB118	117285	broad.mit.edu	37	20	29960672	29960672	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:29960672delA	uc002wvr.2	+	2	97	c.71delA	c.(70-72)GAAfs	p.E24fs		NM_054112	NP_473453	Q96PH6	DB118_HUMAN	beta-defensin 118 precursor	24					cell-matrix adhesion|defense response to bacterium|innate immune response|spermatogenesis	extracellular region				ovary(3)|pancreas(1)	4	all_hematologic(12;0.158)		Colorectal(19;0.00254)|COAD - Colon adenocarcinoma(19;0.0347)															---	---	---	---
ZNF341	84905	broad.mit.edu	37	20	32332845	32332845	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:32332845delT	uc002wzy.2	+						ZNF341_uc002wzx.2_Intron|ZNF341_uc010geq.2_Intron|ZNF341_uc010ger.2_Intron	NM_032819	NP_116208			zinc finger protein 341						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2																		---	---	---	---
CEP250	11190	broad.mit.edu	37	20	34096147	34096147	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34096147delT	uc002xcm.2	+						CEP250_uc010zve.1_Intron	NM_007186	NP_009117			centrosomal protein 2						centriole-centriole cohesion|G2/M transition of mitotic cell cycle|protein localization|regulation of centriole-centriole cohesion	centriole|cilium|cytosol|microtubule basal body|perinuclear region of cytoplasm|protein complex	protein C-terminus binding|protein kinase binding			ovary(4)|central_nervous_system(1)	5	Lung NSC(9;0.00156)|all_lung(11;0.00243)		BRCA - Breast invasive adenocarcinoma(18;0.0106)															---	---	---	---
RPN2	6185	broad.mit.edu	37	20	35835477	35835477	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35835477delA	uc002xgp.2	+						RPN2_uc002xgo.3_Intron|RPN2_uc010gfw.2_Intron|RPN2_uc002xgq.2_Intron	NM_002951	NP_002942			ribophorin II isoform 1 precursor						post-translational protein modification|protein N-linked glycosylation via asparagine	integral to membrane|nucleus|oligosaccharyltransferase complex	dolichyl-diphosphooligosaccharide-protein glycotransferase activity|protein binding			ovary(2)|skin(1)	3		Myeloproliferative disorder(115;0.00878)																---	---	---	---
EMILIN3	90187	broad.mit.edu	37	20	39991784	39991786	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:39991784_39991786delTTT	uc002xjy.1	-							NM_052846	NP_443078			elastin microfibril interfacer 3							proteinaceous extracellular matrix				ovary(1)	1		Myeloproliferative disorder(115;0.00425)																---	---	---	---
WISP2	8839	broad.mit.edu	37	20	43343900	43343905	+	Intron	DEL	GTGAGC	-	-	rs35834362	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43343900_43343905delGTGAGC	uc002xmn.2	+						uc002xml.1_Intron|uc002xmm.1_Intron|WISP2_uc002xmo.1_5'UTR|WISP2_uc002xmp.2_5'UTR|WISP2_uc002xmq.2_5'UTR	NM_003881	NP_003872			WNT1 inducible signaling pathway protein 2						cell adhesion|cell-cell signaling|signal transduction	extracellular region|soluble fraction	insulin-like growth factor binding			skin(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---
SEMG2	6407	broad.mit.edu	37	20	43837376	43837376	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43837376delT	uc010ggz.2	+						SEMG1_uc002xni.2_Intron|SEMG1_uc002xnj.2_Intron|SEMG1_uc002xnh.2_Intron	NM_003008	NP_002999			semenogelin II precursor						sexual reproduction	extracellular space|stored secretory granule	structural molecule activity			skin(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---
WFDC11	259239	broad.mit.edu	37	20	44277540	44277540	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44277540delA	uc002xpa.2	-							NM_147197	NP_671730			WAP four-disulfide core domain 11 precursor							extracellular region					0		Myeloproliferative disorder(115;0.0122)																---	---	---	---
Unknown	0	broad.mit.edu	37	20	44728843	44728843	+	IGR	DEL	A	-	-	rs112043390		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44728843delA								NCOA5 (10263 upstream) : CD40 (18063 downstream)																																			---	---	---	---
ELMO2	63916	broad.mit.edu	37	20	45053239	45053240	+	Intron	INS	-	GG	GG			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:45053239_45053240insGG	uc010zxs.1	-						uc002xry.2_Intron					SubName: Full=ELMO2 protein; SubName: Full=Engulfment and cell motility 2;						apoptosis|cell chemotaxis|phagocytosis	cytoskeleton|cytosol|membrane	lyase activity|receptor tyrosine kinase binding|SH3 domain binding			ovary(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---
PREX1	57580	broad.mit.edu	37	20	47275800	47275801	+	Intron	INS	-	AGGAAGGAAGGG	AGGAAGGAAGGG	rs143111463	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47275800_47275801insAGGAAGGAAGGG	uc002xtw.1	-						PREX1_uc002xtv.1_5'Flank	NM_020820	NP_065871			phosphatidylinositol-3,4,						actin filament polymerization|apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|neutrophil activation|small GTPase mediated signal transduction|superoxide metabolic process	cytosol|plasma membrane	enzyme binding|phospholipid binding|Rho GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			lung(3)|ovary(2)|pancreas(1)	6			BRCA - Breast invasive adenocarcinoma(12;0.0135)|Colorectal(8;0.198)															---	---	---	---
SPO11	23626	broad.mit.edu	37	20	55903947	55903947	+	5'Flank	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:55903947delA	uc002xye.2	+						SPO11_uc002xyf.2_5'Flank	NM_012444	NP_036576			meiotic recombination protein SPO11 isoform a						female gamete generation|reciprocal meiotic recombination	chromosome|nucleus	ATP binding|DNA binding|hydrolase activity			breast(2)|skin(1)	3	Lung NSC(12;0.0066)|all_lung(29;0.0188)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(4;1.73e-14)|Epithelial(14;9.02e-10)|all cancers(14;9.31e-09)										Editing_and_processing_nucleases					---	---	---	---
YTHDF1	54915	broad.mit.edu	37	20	61827842	61827842	+	3'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61827842delA	uc002yeh.2	-	5					YTHDF1_uc011aaq.1_3'UTR	NM_017798	NP_060268			YTH domain family, member 1											ovary(2)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	21	20229947	20229948	+	IGR	INS	-	T	T	rs140136910	by1000genomes;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:20229947_20229948insT								TMPRSS15 (453977 upstream) : None (None downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	21	20230803	20230803	+	IGR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:20230803delA								TMPRSS15 (454833 upstream) : None (None downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	21	21112407	21112408	+	IGR	DEL	GA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:21112407_21112408delGA								None (None upstream) : None (None downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	21	21797194	21797194	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:21797194delT								None (None upstream) : C21orf131 (317720 downstream)																																			---	---	---	---
APP	351	broad.mit.edu	37	21	27394038	27394038	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:27394038delA	uc002ylz.2	-						APP_uc010glk.2_Intron|APP_uc002yma.2_Intron|APP_uc011ach.1_Intron|APP_uc002ymb.2_Intron|APP_uc010glj.2_Intron|APP_uc011aci.1_Intron|APP_uc011acj.1_Intron	NM_000484	NP_000475			amyloid beta A4 protein isoform a precursor						adult locomotory behavior|axon cargo transport|axon midline choice point recognition|cell adhesion|cellular copper ion homeostasis|collateral sprouting in absence of injury|dendrite development|endocytosis|extracellular matrix organization|G2 phase of mitotic cell cycle|innate immune response|ionotropic glutamate receptor signaling pathway|mating behavior|mRNA polyadenylation|neuron apoptosis|neuron remodeling|Notch signaling pathway|platelet activation|platelet degranulation|positive regulation of mitotic cell cycle|protein phosphorylation|regulation of epidermal growth factor receptor activity|regulation of multicellular organism growth|regulation of synapse structure and activity|regulation of translation|visual learning	axon|cell surface|coated pit|dendritic shaft|dendritic spine|extracellular region|Golgi apparatus|integral to plasma membrane|platelet alpha granule lumen	acetylcholine receptor binding|DNA binding|heparin binding|identical protein binding|metal ion binding|protein binding|protein binding|PTB domain binding|serine-type endopeptidase inhibitor activity			ovary(1)	1		Breast(209;0.00295)																---	---	---	---
Unknown	0	broad.mit.edu	37	21	27992483	27992486	+	IGR	DEL	TCCT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:27992483_27992486delTCCT								CYYR1 (46902 upstream) : ADAMTS1 (216122 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	21	30369866	30369867	+	IGR	INS	-	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:30369866_30369867insG								RNF160 (4589 upstream) : RWDD2B (8215 downstream)																																			---	---	---	---
IFNAR1	3454	broad.mit.edu	37	21	34707236	34707236	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:34707236delG	uc002yrn.2	+						IFNAR1_uc011adv.1_Intron	NM_000629	NP_000620			interferon-alpha receptor 1 precursor						JAK-STAT cascade|regulation of type I interferon-mediated signaling pathway|response to virus|type I interferon-mediated signaling pathway	integral to plasma membrane	type I interferon receptor activity			central_nervous_system(1)|skin(1)	2					Interferon Alfa-2a, Recombinant(DB00034)|Interferon Alfa-2b, Recombinant(DB00105)|Interferon alfa-n1(DB00011)|Interferon alfa-n3(DB00018)|Interferon alfacon-1(DB00069)|Interferon beta-1b(DB00068)|Peginterferon alfa-2a(DB00008)|Peginterferon alfa-2b(DB00022)													---	---	---	---
Unknown	0	broad.mit.edu	37	21	37518894	37518894	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:37518894delT	uc002yvc.1	-						uc002yvd.1_Intron|uc002yvf.1_Intron					Homo sapiens mRNA expressed in placenta, clone IMAGE:139776.																														---	---	---	---
Unknown	0	broad.mit.edu	37	21	38694291	38694292	+	IGR	DEL	GT	-	-	rs71328579		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:38694291_38694292delGT								DSCR3 (54458 upstream) : DYRK1A (45567 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	21	40499424	40499424	+	IGR	DEL	G	-	-	rs2410102		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:40499424delG								ETS2 (302548 upstream) : PSMG1 (47966 downstream)																																			---	---	---	---
MX2	4600	broad.mit.edu	37	21	42773700	42773700	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:42773700delT	uc002yzf.1	+						MX2_uc002yzg.1_Intron|MX2_uc010gop.1_Intron	NM_002463	NP_002454			myxovirus resistance protein 2						response to virus|type I interferon-mediated signaling pathway	cytoplasm|nucleus	GTP binding|GTPase activity			ovary(2)	2		Prostate(19;1.57e-07)|all_epithelial(19;0.0222)																---	---	---	---
U2AF1	7307	broad.mit.edu	37	21	44514504	44514504	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44514504delT	uc002zda.1	-						U2AF1_uc002zcy.1_Intron|U2AF1_uc002zcz.1_Intron|U2AF1_uc002zdb.1_Intron|U2AF1_uc010gpi.1_3'UTR	NM_001025203	NP_001020374			U2 small nuclear RNA auxillary factor 1 isoform						mRNA 3'-end processing|mRNA export from nucleus|termination of RNA polymerase II transcription	Cajal body|catalytic step 2 spliceosome|nuclear speck	nucleotide binding|RNA binding|zinc ion binding				0																		---	---	---	---
C21orf29	54084	broad.mit.edu	37	21	45959044	45959045	+	Intron	INS	-	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45959044_45959045insG	uc002zfe.1	-						C21orf29_uc010gpv.1_Intron	NM_144991	NP_659428			chromosome 21 open reading frame 29 precursor						cell adhesion	extracellular region	structural molecule activity				0																		---	---	---	---
psiTPTE22	387590	broad.mit.edu	37	22	17178336	17178336	+	Intron	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:17178336delG	uc002zls.1	+											Homo sapiens cDNA FLJ10437 fis, clone NT2RP1000581.												0																		---	---	---	---
CDC45	8318	broad.mit.edu	37	22	19492873	19492873	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19492873delT	uc002zpr.2	+						CDC45_uc011agz.1_Intron|CDC45_uc011aha.1_Intron|CDC45_uc002zps.2_Intron|CDC45_uc002zpt.2_Intron	NM_003504	NP_003495			CDC45-like						DNA replication checkpoint|DNA strand elongation involved in DNA replication|DNA-dependent DNA replication initiation|M/G1 transition of mitotic cell cycle|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle	centrosome|nucleoplasm	protein binding			lung(1)	1																		---	---	---	---
LOC96610	96610	broad.mit.edu	37	22	23081754	23081755	+	Intron	INS	-	AGCAGGACTG	AGCAGGACTG			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:23081754_23081755insAGCAGGACTG	uc011aim.1	+											Parts of antibodies, mostly variable regions.												0																		---	---	---	---
SLC2A11	66035	broad.mit.edu	37	22	24199261	24199262	+	Intron	DEL	GG	-	-	rs71184919		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:24199261_24199262delGG	uc002zyn.3	+						SLC2A11_uc002zyl.1_Intron|SLC2A11_uc002zym.3_Intron|SLC2A11_uc002zyo.3_Intron|SLC2A11_uc011ajc.1_5'UTR|SLC2A11_uc011ajd.1_5'Flank|SLC2A11_uc002zyp.3_5'Flank	NM_001024938	NP_001020109			glucose transporter protein 10 isoform c							integral to membrane|plasma membrane	sugar transmembrane transporter activity			ovary(1)	1																		---	---	---	---
GGT1	2678	broad.mit.edu	37	22	25016159	25016159	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:25016159delA	uc003aan.1	+						GGT1_uc003aas.1_Intron|GGT1_uc003aat.1_Intron|GGT1_uc003aau.1_Intron|GGT1_uc003aav.1_Intron|GGT1_uc003aaw.1_Intron|GGT1_uc003aax.1_Intron	NM_013430	NP_038347			gamma-glutamyltransferase 1 precursor						glutathione biosynthetic process	integral to membrane	acyltransferase activity|gamma-glutamyltransferase activity|protein binding				0					Glutathione(DB00143)													---	---	---	---
NIPSNAP1	8508	broad.mit.edu	37	22	29965979	29965979	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:29965979delA	uc003afx.3	-						NIPSNAP1_uc011akp.1_Intron	NM_003634	NP_003625			nipsnap homolog 1									p.?(1)		skin(1)	1																		---	---	---	---
C22orf28	51493	broad.mit.edu	37	22	32790102	32790103	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:32790102_32790103delTT	uc003amm.2	-							NM_014306	NP_055121			hypothetical protein LOC51493						cell-matrix adhesion|substrate adhesion-dependent cell spreading|tRNA splicing, via endonucleolytic cleavage and ligation	cytoplasm|tRNA-splicing ligase complex	ATP binding|metal ion binding|RNA ligase (ATP) activity|vinculin binding				0																		---	---	---	---
LARGE	9215	broad.mit.edu	37	22	33742294	33742294	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:33742294delT	uc003and.3	-						LARGE_uc011amd.1_Intron|LARGE_uc003ane.3_Intron|LARGE_uc010gwp.2_Intron|LARGE_uc011ame.1_Intron|LARGE_uc011amf.1_Intron|LARGE_uc010gwq.1_Intron	NM_004737	NP_004728			like-glycosyltransferase						glycosphingolipid biosynthetic process|muscle cell homeostasis|N-acetylglucosamine metabolic process|protein glycosylation	integral to Golgi membrane	acetylglucosaminyltransferase activity			ovary(1)|central_nervous_system(1)|skin(1)	3		Lung NSC(1;0.219)																---	---	---	---
GGA1	26088	broad.mit.edu	37	22	38012810	38012810	+	Intron	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38012810delC	uc003atc.2	+						GGA1_uc003atb.2_Intron|GGA1_uc003atd.2_Intron|GGA1_uc003ate.2_Intron|GGA1_uc003atf.2_Intron	NM_013365	NP_037497			golgi associated, gamma adaptin ear containing,						intracellular protein transport|vesicle-mediated transport	clathrin adaptor complex|endosome membrane|Golgi apparatus part	protein binding			breast(2)|ovary(1)	3	Melanoma(58;0.0574)																	---	---	---	---
C22orf23	84645	broad.mit.edu	37	22	38347218	38347219	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38347218_38347219insA	uc003auj.1	-						C22orf23_uc003auk.1_Intron|POLR2F_uc010gxi.2_5'Flank|POLR2F_uc003aul.2_5'Flank|POLR2F_uc003aum.2_5'Flank	NM_032561	NP_115950			hypothetical protein LOC84645												0	Melanoma(58;0.045)																	---	---	---	---
DDX17	10521	broad.mit.edu	37	22	38891724	38891724	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38891724delT	uc003avy.3	-						DDX17_uc003avx.3_Intron|DDX17_uc011anu.1_Intron	NM_001098504	NP_001091974			DEAD box polypeptide 17 isoform 3						RNA processing	nucleus	ATP binding|ATP-dependent helicase activity|RNA binding|RNA helicase activity|RNA-dependent ATPase activity			skin(3)|upper_aerodigestive_tract(1)	4	Melanoma(58;0.0286)																	---	---	---	---
TNRC6B	23112	broad.mit.edu	37	22	40708460	40708460	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:40708460delT	uc011aor.1	+						TNRC6B_uc003aym.2_Intron|TNRC6B_uc003ayn.3_Intron|TNRC6B_uc003ayo.2_Intron	NM_001162501	NP_001155973			trinucleotide repeat containing 6B isoform 1						gene silencing by RNA|regulation of translation	cytoplasmic mRNA processing body	nucleotide binding|RNA binding				0																		---	---	---	---
SLC25A17	10478	broad.mit.edu	37	22	41195058	41195058	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41195058delA	uc003azc.2	-	2	224	c.84delT	c.(82-84)TTTfs	p.F28fs	SLC25A17_uc010gyg.2_RNA|SLC25A17_uc011aou.1_5'UTR|SLC25A17_uc003azd.2_RNA|SLC25A17_uc011aov.1_Frame_Shift_Del_p.F28fs	NM_006358	NP_006349	O43808	PM34_HUMAN	solute carrier family 25 (mitochondrial carrier;	28	Solcar 1.|Helical; Name=1; (Potential).				fatty acid alpha-oxidation	integral to plasma membrane|mitochondrial inner membrane|peroxisomal membrane	adenine nucleotide transmembrane transporter activity|protein binding				0																		---	---	---	---
TTLL1	25809	broad.mit.edu	37	22	43435576	43435576	+	3'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43435576delA	uc003bdi.2	-	11					TTLL1_uc010gzh.2_3'UTR|TTLL1_uc003bdj.2_3'UTR|TTLL1_uc003bdh.2_3'UTR	NM_012263	NP_036395			tubulin tyrosine ligase-like family, member 1						protein polyglutamylation	cytoplasm|microtubule	ATP binding|tubulin-glutamic acid ligase activity|tubulin-tyrosine ligase activity			skin(1)	1		Ovarian(80;0.0694)		BRCA - Breast invasive adenocarcinoma(115;0.00461)														---	---	---	---
TTLL1	25809	broad.mit.edu	37	22	43459641	43459641	+	Intron	DEL	T	-	-	rs77325620		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43459641delT	uc003bdi.2	-						TTLL1_uc010gzh.2_Intron|TTLL1_uc003bdj.2_Intron|TTLL1_uc003bdh.2_Intron	NM_012263	NP_036395			tubulin tyrosine ligase-like family, member 1						protein polyglutamylation	cytoplasm|microtubule	ATP binding|tubulin-glutamic acid ligase activity|tubulin-tyrosine ligase activity			skin(1)	1		Ovarian(80;0.0694)		BRCA - Breast invasive adenocarcinoma(115;0.00461)														---	---	---	---
ODF3B	440836	broad.mit.edu	37	22	50969507	50969508	+	Intron	INS	-	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50969507_50969508insG	uc003bmh.2	-						TYMP_uc003bmb.3_5'Flank|TYMP_uc003bmc.3_5'Flank|TYMP_uc003bmd.3_5'Flank|TYMP_uc010hbd.2_5'Flank|TYMP_uc003bme.3_5'Flank|TYMP_uc003bmf.3_5'Flank|TYMP_uc011arz.1_5'Flank|ODF3B_uc003bmg.2_Intron	NM_001014440	NP_001014440			outer dense fiber of sperm tails 3B												0																		---	---	---	---
CSF2RA	1438	broad.mit.edu	37	X	1419277	1419277	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1419277delA	uc010nct.2	+						CSF2RA_uc011mhb.1_Intron|CSF2RA_uc004cpq.2_Intron|CSF2RA_uc004cpn.2_Intron|CSF2RA_uc004cpo.2_Intron|CSF2RA_uc010ncu.2_Intron|CSF2RA_uc011mhc.1_Intron|CSF2RA_uc004cpp.2_Intron|CSF2RA_uc010ncv.2_Intron|CSF2RA_uc004cpr.2_Intron	NM_001161529	NP_001155001			colony stimulating factor 2 receptor alpha chain							extracellular region|integral to plasma membrane	cytokine receptor activity			ovary(2)	2		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)			Sargramostim(DB00020)													---	---	---	---
P2RY8	286530	broad.mit.edu	37	X	1585603	1585604	+	Intron	INS	-	CCTC	CCTC			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1585603_1585604insCCTC	uc004cpz.2	-							NM_178129	NP_835230			G-protein coupled purinergic receptor P2Y8							integral to membrane|plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			lung(5)	5		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)						T	CRLF2	B-ALL|Downs associated ALL								---	---	---	---
DHRSX	207063	broad.mit.edu	37	X	2209751	2209752	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:2209751_2209752delTT	uc004cqf.3	-							NM_145177	NP_660160			dehydrogenase/reductase (SDR family) X-linked								binding|oxidoreductase activity				0		all_cancers(21;9e-05)|all_epithelial(21;6.22e-06)|all_lung(23;0.000597)|Lung NSC(23;0.00901)|Lung SC(21;0.186)																---	---	---	---
ARHGAP6	395	broad.mit.edu	37	X	11682684	11682685	+	Frame_Shift_Ins	INS	-	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:11682684_11682685insG	uc004cup.1	-	1	1137_1138	c.264_265insC	c.(262-267)CCCAGGfs	p.P88fs	ARHGAP6_uc004cuo.1_RNA|ARHGAP6_uc004cur.1_Frame_Shift_Ins_p.P88fs	NM_013427	NP_038286	O43182	RHG06_HUMAN	Rho GTPase activating protein 6 isoform 1	88_89					actin filament polymerization|activation of phospholipase C activity|negative regulation of focal adhesion assembly|negative regulation of stress fiber assembly|Rho protein signal transduction	actin filament|cytosol	phospholipase activator activity|phospholipase binding|Rho GTPase activator activity|SH3 domain binding|SH3/SH2 adaptor activity			urinary_tract(1)|lung(1)	2																		---	---	---	---
FRMPD4	9758	broad.mit.edu	37	X	12704199	12704199	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:12704199delT	uc004cuz.1	+						FRMPD4_uc011mij.1_Intron	NM_014728	NP_055543			FERM and PDZ domain containing 4						positive regulation of synapse structural plasticity	cytoskeleton|dendritic spine	phosphatidylinositol-4,5-bisphosphate binding|protein binding			central_nervous_system(5)|ovary(3)|skin(2)|large_intestine(1)|lung(1)|pancreas(1)	13																		---	---	---	---
OFD1	8481	broad.mit.edu	37	X	13769300	13769301	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:13769300_13769301insT	uc004cvp.3	+						OFD1_uc004cvr.3_Intron|OFD1_uc011mil.1_Intron|OFD1_uc004cvq.3_Intron|OFD1_uc010nen.2_Intron|OFD1_uc004cvs.3_Intron|OFD1_uc004cvu.3_Intron|OFD1_uc004cvv.3_Intron|OFD1_uc010neo.1_Intron	NM_003611	NP_003602			oral-facial-digital syndrome 1						cilium movement involved in determination of left/right asymmetry|G2/M transition of mitotic cell cycle	centriole|cilium|cytosol|microtubule basal body|nuclear membrane	alpha-tubulin binding|gamma-tubulin binding				0																		---	---	---	---
OFD1	8481	broad.mit.edu	37	X	13787350	13787350	+	3'UTR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:13787350delT	uc004cvp.3	+	23					OFD1_uc004cvr.3_3'UTR|OFD1_uc011mil.1_3'UTR|OFD1_uc004cvq.3_3'UTR|OFD1_uc010nen.2_3'UTR|OFD1_uc004cvs.3_RNA|OFD1_uc004cvu.3_3'UTR|OFD1_uc004cvv.3_3'UTR	NM_003611	NP_003602			oral-facial-digital syndrome 1						cilium movement involved in determination of left/right asymmetry|G2/M transition of mitotic cell cycle	centriole|cilium|cytosol|microtubule basal body|nuclear membrane	alpha-tubulin binding|gamma-tubulin binding				0																		---	---	---	---
ASB11	140456	broad.mit.edu	37	X	15333660	15333660	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:15333660delA	uc004cwp.1	-	1	68	c.68delT	c.(67-69)TTCfs	p.F23fs	ASB11_uc004cwo.1_5'Flank|ASB11_uc010nes.1_RNA|ASB11_uc010net.1_Frame_Shift_Del_p.F23fs	NM_080873	NP_543149	Q8WXH4	ASB11_HUMAN	ankyrin repeat and SOCS box-containing protein	23					intracellular signal transduction					breast(2)|skin(1)	3	Hepatocellular(33;0.183)																	---	---	---	---
RBBP7	5931	broad.mit.edu	37	X	16871713	16871713	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:16871713delA	uc004cxt.2	-						RBBP7_uc004cxs.1_Intron|RBBP7_uc004cxu.2_Intron|RBBP7_uc010nez.2_3'UTR	NM_002893	NP_002884			retinoblastoma binding protein 7						cell proliferation|cellular heat acclimation|CenH3-containing nucleosome assembly at centromere|DNA replication|multicellular organismal development|negative regulation of cell growth|regulation of transcription, DNA-dependent|transcription, DNA-dependent	ESC/E(Z) complex|NuRD complex	protein binding			upper_aerodigestive_tract(1)|ovary(1)	2	Hepatocellular(33;0.0997)																	---	---	---	---
Unknown	0	broad.mit.edu	37	X	17301198	17301198	+	IGR	DEL	A	-	-	rs36005496		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:17301198delA								REPS2 (129795 upstream) : NHS (92345 downstream)																																			---	---	---	---
CDKL5	6792	broad.mit.edu	37	X	18643540	18643541	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:18643540_18643541insT	uc004cym.2	+						CDKL5_uc004cyn.2_Intron	NM_003159	NP_003150			cyclin-dependent kinase-like 5						neuron migration|positive regulation of axon extension|positive regulation of dendrite morphogenesis|positive regulation of Rac GTPase activity|protein autophosphorylation	dendrite cytoplasm|dendritic growth cone|nucleus	ATP binding|cyclin-dependent protein kinase activity|Rac GTPase binding			ovary(2)|large_intestine(1)|stomach(1)|central_nervous_system(1)|skin(1)	6	Hepatocellular(33;0.183)																	---	---	---	---
POLA1	5422	broad.mit.edu	37	X	24735994	24735995	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:24735994_24735995delTT	uc004dbl.2	+						POLA1_uc004dbm.2_Intron|POLA1_uc004dbn.2_Intron	NM_016937	NP_058633			DNA-directed DNA polymerase alpha 1						cell proliferation|DNA replication checkpoint|DNA replication, synthesis of RNA primer|DNA-dependent DNA replication initiation|double-strand break repair via nonhomologous end joining|interspecies interaction between organisms|lagging strand elongation|leading strand elongation|M/G1 transition of mitotic cell cycle|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication	alpha DNA polymerase:primase complex|cytoplasm|nuclear envelope|nuclear matrix|nucleolus|nucleoplasm	chromatin binding|DNA-directed DNA polymerase activity|metal ion binding|nucleoside binding			ovary(2)|skin(1)	3					Clofarabine(DB00631)|Fludarabine(DB01073)													---	---	---	---
GK	2710	broad.mit.edu	37	X	30714875	30714876	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:30714875_30714876insT	uc004dch.3	+						GK_uc010ngj.2_Intron|GK_uc004dci.3_Intron|GK_uc011mjz.1_Intron|GK_uc011mka.1_Intron|GK_uc010ngk.2_Intron	NM_203391	NP_976325			glycerol kinase isoform a						glycerol-3-phosphate metabolic process|triglyceride biosynthetic process	cytosol|mitochondrial outer membrane	ATP binding|glycerol kinase activity			central_nervous_system(1)	1																		---	---	---	---
GK	2710	broad.mit.edu	37	X	30726104	30726104	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:30726104delA	uc004dch.3	+						GK_uc010ngj.2_Intron|GK_uc004dci.3_Intron|GK_uc011mjz.1_Intron|GK_uc011mka.1_Intron|GK_uc010ngk.2_Intron	NM_203391	NP_976325			glycerol kinase isoform a						glycerol-3-phosphate metabolic process|triglyceride biosynthetic process	cytosol|mitochondrial outer membrane	ATP binding|glycerol kinase activity			central_nervous_system(1)	1																		---	---	---	---
DMD	1756	broad.mit.edu	37	X	31676297	31676297	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:31676297delT	uc004dda.1	-						DMD_uc004dcr.1_Intron|DMD_uc004dcs.1_Intron|DMD_uc004dct.1_Intron|DMD_uc004dcu.1_Intron|DMD_uc004dcv.1_Intron|DMD_uc004dcw.2_Intron|DMD_uc004dcx.2_Intron|DMD_uc004dcz.2_Intron|DMD_uc004dcy.1_Intron|DMD_uc004ddb.1_Intron	NM_004006	NP_003997			dystrophin Dp427m isoform						muscle filament sliding|peptide biosynthetic process	cell surface|costamere|cytoskeleton|cytosol|dystrophin-associated glycoprotein complex|sarcolemma	actin binding|dystroglycan binding|nitric-oxide synthase binding|protein binding|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(3)|pancreas(2)|large_intestine(1)	6		all_cancers(2;1.22e-16)|Acute lymphoblastic leukemia(2;4.65e-06)|all_hematologic(2;0.00108)|all_epithelial(3;0.00626)|all_neural(2;0.0189)|all_lung(315;0.182)|Glioma(3;0.203)																---	---	---	---
Unknown	0	broad.mit.edu	37	X	35077922	35077922	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:35077922delT								FAM47B (114888 upstream) : MAGEB16 (738537 downstream)																																			---	---	---	---
CXorf22	170063	broad.mit.edu	37	X	35984670	35984670	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:35984670delT	uc004ddj.2	+						CXorf22_uc010ngv.2_Intron	NM_152632	NP_689845			hypothetical protein LOC170063											large_intestine(1)|lung(1)|ovary(1)	3																		---	---	---	---
CYBB	1536	broad.mit.edu	37	X	37670023	37670023	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:37670023delT	uc004ddr.2	+						CYBB_uc011mkf.1_Intron|CYBB_uc011mkg.1_Intron	NM_000397	NP_000388			cytochrome b-245 beta polypeptide						electron transport chain|inflammatory response|innate immune response|respiratory burst|superoxide anion generation	NADPH oxidase complex	electron carrier activity|flavin adenine dinucleotide binding|heme binding|protein heterodimerization activity|superoxide-generating NADPH oxidase activity|voltage-gated ion channel activity			central_nervous_system(1)|skin(1)	2																		---	---	---	---
BCOR	54880	broad.mit.edu	37	X	39931787	39931788	+	Frame_Shift_Ins	INS	-	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:39931787_39931788insG	uc004den.3	-	4	3103_3104	c.2811_2812insC	c.(2809-2814)CCCACCfs	p.P937fs	BCOR_uc004dep.3_Frame_Shift_Ins_p.P937fs|BCOR_uc004deo.3_Frame_Shift_Ins_p.P937fs|BCOR_uc004dem.3_Frame_Shift_Ins_p.P937fs|BCOR_uc004deq.3_Frame_Shift_Ins_p.P937fs	NM_001123385	NP_001116857	Q6W2J9	BCOR_HUMAN	BCL-6 interacting corepressor isoform c	937_938					heart development|histone H2A monoubiquitination|negative regulation of bone mineralization|negative regulation of histone H3-K36 methylation|negative regulation of histone H3-K4 methylation|negative regulation of tooth mineralization|negative regulation of transcription from RNA polymerase II promoter|odontogenesis|palate development|specification of axis polarity|transcription, DNA-dependent	nucleus	heat shock protein binding|histone deacetylase binding|transcription corepressor activity|transcription factor binding|transcription regulatory region DNA binding			ovary(2)|kidney(1)|central_nervous_system(1)	4																		---	---	---	---
MED14	9282	broad.mit.edu	37	X	40552264	40552265	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:40552264_40552265delAA	uc004dex.3	-							NM_004229	NP_004220			mediator complex subunit 14						androgen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			breast(2)|kidney(1)|skin(1)	4																		---	---	---	---
CASK	8573	broad.mit.edu	37	X	41429005	41429005	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:41429005delA	uc004dfl.3	-						CASK_uc004dfj.3_Intron|CASK_uc004dfk.3_Intron|CASK_uc004dfm.3_Intron|CASK_uc004dfn.3_Intron	NM_003688	NP_003679			calcium/calmodulin-dependent serine protein						cell adhesion	actin cytoskeleton|cytoplasm|nucleus|plasma membrane	ATP binding|calmodulin binding|guanylate kinase activity|protein serine/threonine kinase activity			ovary(3)|lung(2)|stomach(1)	6																		---	---	---	---
EFHC2	80258	broad.mit.edu	37	X	44101570	44101570	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:44101570delT	uc004dgb.3	-							NM_025184	NP_079460			EF-hand domain (C-terminal) containing 2								calcium ion binding			breast(3)|ovary(2)|central_nervous_system(1)	6																		---	---	---	---
KDM6A	7403	broad.mit.edu	37	X	44922797	44922798	+	Frame_Shift_Del	DEL	TC	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:44922797_44922798delTC	uc004dge.3	+	16	2033_2034	c.1658_1659delTC	c.(1657-1659)GTCfs	p.V553fs	KDM6A_uc010nhk.2_Frame_Shift_Del_p.V519fs|KDM6A_uc011mkz.1_Frame_Shift_Del_p.V605fs|KDM6A_uc011mla.1_Frame_Shift_Del_p.V508fs|KDM6A_uc011mlb.1_Frame_Shift_Del_p.V560fs|KDM6A_uc011mlc.1_Frame_Shift_Del_p.V257fs|KDM6A_uc011mld.1_Frame_Shift_Del_p.V192fs	NM_021140	NP_066963	O15550	KDM6A_HUMAN	ubiquitously transcribed tetratricopeptide	553					histone H3-K4 methylation		metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			kidney(24)|haematopoietic_and_lymphoid_tissue(23)|oesophagus(11)|large_intestine(7)|lung(5)|breast(4)|central_nervous_system(3)|urinary_tract(3)|endometrium(2)|pancreas(2)	84								D|N|F|S		renal|oesophageal SCC|MM								---	---	---	---
DGKK	139189	broad.mit.edu	37	X	50136359	50136359	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:50136359delA	uc010njr.1	-							NM_001013742	NP_001013764			diacylglycerol kinase kappa						activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|diacylglycerol metabolic process|intracellular signal transduction|platelet activation|response to oxidative stress	cytoplasm|plasma membrane	ATP binding|diacylglycerol kinase activity|metal ion binding			ovary(1)|kidney(1)	2	Ovarian(276;0.236)																	---	---	---	---
Unknown	0	broad.mit.edu	37	X	53043961	53043962	+	IGR	DEL	AG	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53043961_53043962delAG								FAM156A (106378 upstream) : GPR173 (34544 downstream)																																			---	---	---	---
RRAGB	10325	broad.mit.edu	37	X	55753729	55753729	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:55753729delT	uc004dup.2	+						RRAGB_uc004duq.2_Intron	NM_016656	NP_057740			Ras-related GTP binding B long isoform						cellular protein localization|cellular response to amino acid stimulus|positive regulation of TOR signaling cascade|signal transduction	Golgi apparatus|lysosome|nucleus	GTP binding|protein binding				0																		---	---	---	---
ZC4H2	55906	broad.mit.edu	37	X	64139033	64139033	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:64139033delG	uc004dvu.2	-	4	538	c.450delC	c.(448-450)CCCfs	p.P150fs	ZC4H2_uc004dvv.2_Frame_Shift_Del_p.P127fs|ZC4H2_uc011mov.1_Frame_Shift_Del_p.P127fs|ZC4H2_uc011mow.1_Intron|ZC4H2_uc004dvw.1_3'UTR	NM_018684	NP_061154	Q9NQZ6	ZC4H2_HUMAN	zinc finger, C4H2 domain containing	150							metal ion binding|protein binding			ovary(1)	1																		---	---	---	---
TEX11	56159	broad.mit.edu	37	X	70127618	70127618	+	5'UTR	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70127618delA	uc004dyl.2	-	2					TEX11_uc004dym.2_Frame_Shift_Del_p.S8fs	NM_001003811	NP_001003811			testis expressed sequence 11 isoform 1								protein binding			ovary(3)|breast(1)|skin(1)	5	Renal(35;0.156)																	---	---	---	---
TAF1	6872	broad.mit.edu	37	X	70639873	70639873	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70639873delT	uc004dzu.3	+						BCYRN1_uc011mpt.1_Intron|TAF1_uc004dzt.3_Intron|TAF1_uc004dzv.3_Intron|TAF1_uc010nld.1_Intron|TAF1_uc010nle.1_Intron|TAF1_uc010nlf.1_Intron|TAF1_uc004dzx.2_Intron|TAF1_uc004dzy.2_Intron	NM_138923	NP_620278			TBP-associated factor 1 isoform 2						G1 phase of mitotic cell cycle|interspecies interaction between organisms|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription initiation from RNA polymerase II promoter|protein autophosphorylation|regulation of transcription involved in G2/M-phase of mitotic cell cycle|RNA polymerase II transcriptional preinitiation complex assembly|transcription elongation from RNA polymerase II promoter|viral reproduction	MLL1 complex|transcription factor TFIID complex	ATP binding|histone acetyl-lysine binding|histone acetyltransferase activity|p53 binding|protein binding|protein serine/threonine kinase activity|sequence-specific DNA binding|TBP-class protein binding|transcription coactivator activity			ovary(7)|breast(4)|large_intestine(2)|central_nervous_system(2)|lung(1)|skin(1)	17	Renal(35;0.156)	all_lung(315;0.000321)																---	---	---	---
OGT	8473	broad.mit.edu	37	X	70777012	70777013	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70777012_70777013insT	uc004eaa.1	+						BCYRN1_uc011mpt.1_Intron|OGT_uc004eab.1_Intron|OGT_uc004eac.2_Intron|OGT_uc004ead.2_Intron	NM_181672	NP_858058			O-linked GlcNAc transferase isoform 1						cellular response to retinoic acid|positive regulation of granulocyte differentiation|positive regulation of histone H3-K4 methylation|positive regulation of proteolysis|protein O-linked glycosylation|signal transduction	cytosol|MLL5-L complex	enzyme activator activity|protein binding|protein N-acetylglucosaminyltransferase activity			ovary(3)|kidney(1)|pancreas(1)	5	Renal(35;0.156)																	---	---	---	---
OGT	8473	broad.mit.edu	37	X	70782560	70782560	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70782560delT	uc004eaa.1	+						BCYRN1_uc011mpt.1_Intron|OGT_uc004eab.1_Intron|OGT_uc004eac.2_Intron|OGT_uc004ead.2_Intron	NM_181672	NP_858058			O-linked GlcNAc transferase isoform 1						cellular response to retinoic acid|positive regulation of granulocyte differentiation|positive regulation of histone H3-K4 methylation|positive regulation of proteolysis|protein O-linked glycosylation|signal transduction	cytosol|MLL5-L complex	enzyme activator activity|protein binding|protein N-acetylglucosaminyltransferase activity			ovary(3)|kidney(1)|pancreas(1)	5	Renal(35;0.156)																	---	---	---	---
ZCCHC13	389874	broad.mit.edu	37	X	73524621	73524621	+	3'UTR	DEL	C	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:73524621delC	uc004ebs.3	+	1						NM_203303	NP_976048			zinc finger, CCHC domain containing 13								nucleic acid binding|zinc ion binding				0																		---	---	---	---
ABCB7	22	broad.mit.edu	37	X	74280275	74280275	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:74280275delT	uc004eca.2	-						ABCB7_uc004ebz.2_Intron|ABCB7_uc011mqn.1_Intron|ABCB7_uc010nls.2_Intron|ABCB7_uc010nlt.2_Intron	NM_004299	NP_004290			ATP-binding cassette, sub-family B, member 7						cellular iron ion homeostasis	integral to membrane|mitochondrial inner membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances|heme transporter activity			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	X	74964980	74964981	+	IGR	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:74964980_74964981insT								ZDHHC15 (221643 upstream) : MAGEE2 (37842 downstream)																																			---	---	---	---
ATRX	546	broad.mit.edu	37	X	76972553	76972554	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:76972553_76972554insA	uc004ecp.3	-						ATRX_uc004ecq.3_Intron|ATRX_uc004eco.3_Intron|ATRX_uc004ecr.2_Intron|ATRX_uc010nlx.1_Intron|ATRX_uc010nly.1_Intron	NM_000489	NP_000480			transcriptional regulator ATRX isoform 1						DNA methylation|DNA recombination|DNA repair|regulation of transcription, DNA-dependent	nuclear heterochromatin	ATP binding|chromo shadow domain binding|DNA binding|DNA helicase activity|zinc ion binding			haematopoietic_and_lymphoid_tissue(14)|pancreas(12)|lung(1)|breast(1)|skin(1)|kidney(1)	30					Phosphatidylserine(DB00144)			Mis|F|N		Pancreatic neuroendocrine tumors		ATR-X (alpha thalassemia/mental retardation) syndrome						---	---	---	---
HMGN5	79366	broad.mit.edu	37	X	80373885	80373886	+	Intron	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:80373885_80373886insA	uc004eee.1	-							NM_030763	NP_110390			high-mobility group nucleosome binding domain 5						chromatin modification|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromatin|nucleolus	chromatin binding|DNA binding			lung(1)	1																		---	---	---	---
POF1B	79983	broad.mit.edu	37	X	84570751	84570751	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:84570751delA	uc004eer.2	-						POF1B_uc004ees.2_Intron	NM_024921	NP_079197			premature ovarian failure, 1B								actin binding				0																		---	---	---	---
DIAPH2	1730	broad.mit.edu	37	X	96684810	96684812	+	Intron	DEL	AAA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:96684810_96684812delAAA	uc004efu.3	+						DIAPH2_uc004eft.3_Intron	NM_006729	NP_006720			diaphanous 2 isoform 156						cell differentiation|cytokinesis|multicellular organismal development|oogenesis	cytosol|early endosome|Golgi apparatus|mitochondrion|nucleolus	receptor binding|Rho GTPase binding			ovary(3)|lung(1)	4																		---	---	---	---
Unknown	0	broad.mit.edu	37	X	100418145	100418145	+	IGR	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:100418145delT								CENPI (169 upstream) : DRP2 (56788 downstream)																																			---	---	---	---
CXorf57	55086	broad.mit.edu	37	X	105905170	105905170	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:105905170delT	uc004emi.3	+						CXorf57_uc004emj.3_Intron	NM_018015	NP_060485			hypothetical protein LOC55086											ovary(1)|lung(1)|breast(1)	3																		---	---	---	---
RBM41	55285	broad.mit.edu	37	X	106359067	106359068	+	Intron	INS	-	AA	AA			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:106359067_106359068insAA	uc004emz.2	-						RBM41_uc004emy.1_Intron	NM_018301	NP_060771			RNA binding motif protein 41								nucleotide binding|RNA binding			ovary(1)	1																		---	---	---	---
CXorf41	139212	broad.mit.edu	37	X	106486388	106486388	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:106486388delT	uc004enc.2	+						CXorf41_uc004end.2_Intron	NM_173494	NP_775765			hypothetical protein LOC139212												0																		---	---	---	---
COL4A6	1288	broad.mit.edu	37	X	107438186	107438186	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107438186delA	uc004enw.3	-						COL4A6_uc004env.3_Intron|COL4A6_uc011msn.1_Intron|COL4A6_uc010npk.2_Intron	NM_001847	NP_001838			type IV alpha 6 collagen isoform A precursor						cell adhesion|extracellular matrix organization	collagen type IV	extracellular matrix structural constituent|protein binding			ovary(6)|urinary_tract(1)|large_intestine(1)	8														Alport_syndrome_with_Diffuse_Leiomyomatosis				---	---	---	---
Unknown	0	broad.mit.edu	37	X	108812482	108812483	+	IGR	INS	-	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:108812482_108812483insA								NXT2 (24569 upstream) : KCNE1L (54448 downstream)																																			---	---	---	---
ACSL4	2182	broad.mit.edu	37	X	108906421	108906421	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:108906421delA	uc004eoi.2	-						ACSL4_uc004eoj.2_Intron|ACSL4_uc004eok.2_Intron	NM_022977	NP_075266			acyl-CoA synthetase long-chain family member 4						fatty acid metabolic process|learning or memory|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process	endoplasmic reticulum membrane|integral to membrane|microsome|mitochondrial outer membrane|peroxisomal membrane	ATP binding|long-chain fatty acid-CoA ligase activity			large_intestine(1)|lung(1)|ovary(1)	3					Icosapent(DB00159)|Troglitazone(DB00197)													---	---	---	---
Unknown	0	broad.mit.edu	37	X	110863751	110863751	+	IGR	DEL	G	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:110863751delG								DCX (208345 upstream) : ALG13 (60662 downstream)																																			---	---	---	---
PLS3	5358	broad.mit.edu	37	X	114868272	114868272	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:114868272delT	uc004eqd.2	+						PLS3_uc010nqg.2_Intron|PLS3_uc011mtf.1_Intron|PLS3_uc004eqe.2_Intron|PLS3_uc011mtg.1_Intron|PLS3_uc011mth.1_Intron	NM_005032	NP_005023			plastin 3							cytoplasm	actin binding|calcium ion binding			lung(1)|breast(1)	2																		---	---	---	---
WDR44	54521	broad.mit.edu	37	X	117527389	117527389	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:117527389delA	uc004eqn.2	+						WDR44_uc004eqo.2_Intron|WDR44_uc011mtr.1_Intron|WDR44_uc010nqi.2_Intron	NM_019045	NP_061918			WD repeat domain 44 protein							cytosol|endosome membrane|Golgi apparatus|perinuclear region of cytoplasm				lung(2)|upper_aerodigestive_tract(1)|ovary(1)|pancreas(1)	5																		---	---	---	---
IL13RA1	3597	broad.mit.edu	37	X	117883814	117883814	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:117883814delA	uc004eqs.2	+						IL13RA1_uc004eqr.1_Intron|IL13RA1_uc004eqt.1_Intron	NM_001560	NP_001551			interleukin 13 receptor, alpha 1 precursor							interleukin-13 receptor complex	cytokine receptor activity				0																		---	---	---	---
LAMP2	3920	broad.mit.edu	37	X	119580473	119580473	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:119580473delA	uc004est.3	-						LAMP2_uc004ess.3_Intron|LAMP2_uc011mtz.1_Intron|LAMP2_uc011mua.1_Intron|LAMP2_uc010nqp.1_Intron	NM_002294	NP_002285			lysosomal-associated membrane protein 2 isoform						platelet activation|platelet degranulation	endosome membrane|integral to membrane|late endosome|lysosomal membrane|membrane fraction|plasma membrane|platelet dense granule membrane				ovary(1)	1																		---	---	---	---
CUL4B	8450	broad.mit.edu	37	X	119668221	119668222	+	Intron	DEL	AG	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:119668221_119668222delAG	uc004esw.2	-						CUL4B_uc010nqq.2_Intron|CUL4B_uc004esv.2_Intron	NM_003588	NP_003579			cullin 4B isoform 1						cell cycle|DNA repair|ubiquitin-dependent protein catabolic process	Cul4B-RING ubiquitin ligase complex|nucleus	protein binding|ubiquitin protein ligase binding			lung(1)|central_nervous_system(1)|pancreas(1)	3																		---	---	---	---
STAG2	10735	broad.mit.edu	37	X	123176371	123176372	+	Intron	INS	-	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:123176371_123176372insT	uc004etz.3	+						STAG2_uc004eua.2_Intron|STAG2_uc004eub.2_Intron|STAG2_uc004euc.2_Intron|STAG2_uc004eud.2_Intron|STAG2_uc004eue.2_Intron	NM_006603	NP_006594			stromal antigen 2 isoform b						cell division|meiosis|mitotic metaphase/anaphase transition|mitotic prometaphase|negative regulation of DNA endoreduplication|sister chromatid cohesion	chromatin|chromosome, centromeric region|nucleoplasm	protein binding			ovary(4)|skin(1)	5																		---	---	---	---
ZDHHC9	51114	broad.mit.edu	37	X	128948898	128948900	+	Intron	DEL	TTT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:128948898_128948900delTTT	uc004euv.2	-						ZDHHC9_uc004euw.2_Intron|ZDHHC9_uc004eux.1_Intron|ZDHHC9_uc004euy.1_Intron	NM_001008222	NP_001008223			zinc finger, DHHC domain containing 9							endoplasmic reticulum membrane|Golgi membrane|integral to membrane	acyltransferase activity|zinc ion binding			ovary(1)	1																		---	---	---	---
AIFM1	9131	broad.mit.edu	37	X	129281916	129281916	+	Intron	DEL	A	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:129281916delA	uc004evg.2	-						AIFM1_uc011mus.1_Intron|AIFM1_uc004evh.2_Intron|AIFM1_uc004evi.2_Intron|AIFM1_uc004evk.2_Intron	NM_004208	NP_004199			programmed cell death 8 isoform 1						activation of caspase activity|apoptosis in response to endoplasmic reticulum stress|cell redox homeostasis|DNA damage response, signal transduction resulting in induction of apoptosis|DNA fragmentation involved in apoptotic nuclear change	cytosol|mitochondrial inner membrane|mitochondrial intermembrane space|nucleus|perinuclear region of cytoplasm	DNA binding|electron carrier activity|flavin adenine dinucleotide binding|oxidoreductase activity|protein binding			ovary(4)|central_nervous_system(1)	5																		---	---	---	---
SLC25A14	9016	broad.mit.edu	37	X	129483210	129483211	+	Intron	DEL	TT	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:129483210_129483211delTT	uc004evn.1	+						SLC25A14_uc011mut.1_Intron|SLC25A14_uc011muu.1_Intron|SLC25A14_uc010nrg.2_Intron|SLC25A14_uc004evo.1_Intron|SLC25A14_uc004evp.1_Intron|SLC25A14_uc004evq.1_Intron|SLC25A14_uc004evr.1_Intron	NM_003951	NP_003942			solute carrier family 25, member 14 isoform						aerobic respiration|mitochondrial transport	integral to plasma membrane|mitochondrial inner membrane	binding			ovary(1)	1																		---	---	---	---
PHF6	84295	broad.mit.edu	37	X	133512257	133512257	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:133512257delT	uc004exj.2	+						PHF6_uc004exk.2_Intron|PHF6_uc011mvk.1_Intron|PHF6_uc004exh.2_Intron|PHF6_uc010nrr.2_Intron|PHF6_uc004exi.2_Intron	NM_001015877	NP_001015877			PHD finger protein 6 isoform 1						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus	zinc ion binding			ovary(1)	1	Acute lymphoblastic leukemia(192;0.000127)																	---	---	---	---
FAM122B	159090	broad.mit.edu	37	X	133915842	133915842	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:133915842delT	uc004exr.2	-						FAM122B_uc004exq.2_Intron|FAM122B_uc004exs.2_Intron|FAM122B_uc004ext.2_Intron|FAM122B_uc004exu.2_Intron|FAM122B_uc011mvp.1_Intron|FAM122B_uc004exv.2_Intron	NM_145284	NP_660327			hypothetical protein LOC159090												0	Acute lymphoblastic leukemia(192;0.000127)																	---	---	---	---
MIR513A2	574510	broad.mit.edu	37	X	146307498	146307498	+	5'Flank	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:146307498delT	hsa-mir-513a-2|MI0003192	-																							0																		---	---	---	---
FMR1	2332	broad.mit.edu	37	X	147018181	147018181	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:147018181delT	uc010nst.2	+						FMR1_uc004fcj.2_Intron|FMR1_uc004fck.3_Intron|FMR1_uc004fcl.3_Intron|FMR1_uc011mxa.1_Intron	NM_002024	NP_002015			fragile X mental retardation 1						mRNA transport|negative regulation of translational initiation	cytoplasm|mRNA cap binding complex|nucleolus|nucleoplasm|soluble fraction	mRNA binding|protein binding			ovary(2)|pancreas(1)	3	Acute lymphoblastic leukemia(192;6.56e-05)													Fragile_X_syndrome				---	---	---	---
IDS	3423	broad.mit.edu	37	X	148582574	148582575	+	Intron	DEL	AA	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:148582574_148582575delAA	uc011mxe.1	-						IDS_uc011mxf.1_Intron|IDS_uc011mxg.1_Intron|IDS_uc010nsu.1_Intron|IDS_uc004fcw.3_Intron|IDS_uc011mxh.1_Intron|IDS_uc011mxi.1_Intron	NM_000202	NP_000193			iduronate-2-sulfatase isoform a precursor							lysosome	iduronate-2-sulfatase activity|metal ion binding				0	Acute lymphoblastic leukemia(192;6.56e-05)|Colorectal(9;0.0662)																	---	---	---	---
PASD1	139135	broad.mit.edu	37	X	150770186	150770186	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:150770186delT	uc004fev.3	+							NM_173493	NP_775764			PAS domain containing 1							nucleus	signal transducer activity			ovary(3)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
TKTL1	8277	broad.mit.edu	37	X	153551758	153551758	+	Intron	DEL	T	-	-			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153551758delT	uc004fkg.2	+						TKTL1_uc011mzl.1_Intron|TKTL1_uc011mzm.1_Intron|TKTL1_uc004fkh.2_Intron	NM_012253	NP_036385			transketolase-like 1 isoform a						glucose catabolic process|thiamine metabolic process	cytoplasm|nucleus	metal ion binding|transketolase activity			ovary(3)|skin(1)	4	all_cancers(53;5.05e-16)|all_epithelial(53;1.82e-10)|all_lung(58;1.84e-07)|Lung NSC(58;5.84e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)																	---	---	---	---
AGRN	375790	broad.mit.edu	37	1	989920	989920	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:989920C>T	uc001ack.1	+	35	6019	c.5969C>T	c.(5968-5970)GCC>GTC	p.A1990V		NM_198576	NP_940978	O00468	AGRIN_HUMAN	agrin precursor	1990	Laminin G-like 3.				axon guidance|clustering of voltage-gated sodium channels|muscarinic acetylcholine receptor signaling pathway|receptor clustering	basal lamina	laminin binding|structural constituent of cytoskeleton			central_nervous_system(2)|breast(1)	3	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;8.75e-19)|all_lung(118;2.3e-08)|Lung NSC(185;2.38e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Lung SC(97;0.128)		UCEC - Uterine corpus endometrioid carcinoma (11;0.00462)|Epithelial(90;5.98e-38)|OV - Ovarian serous cystadenocarcinoma(86;5.43e-23)|Colorectal(212;5.97e-05)|COAD - Colon adenocarcinoma(227;0.000201)|Kidney(185;0.0024)|BRCA - Breast invasive adenocarcinoma(365;0.00246)|STAD - Stomach adenocarcinoma(132;0.00645)|KIRC - Kidney renal clear cell carcinoma(229;0.0354)|Lung(427;0.201)														---	---	---	---
MXRA8	54587	broad.mit.edu	37	1	1290438	1290438	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1290438G>A	uc001aew.2	-	5	604	c.573C>T	c.(571-573)CAC>CAT	p.H191H	MXRA8_uc001aex.3_Silent_p.H191H|MXRA8_uc001aey.3_Silent_p.H191H|MXRA8_uc010nyl.1_Silent_p.H191H|MXRA8_uc001aez.2_Silent_p.H90H|MXRA8_uc001afa.2_Silent_p.H182H	NM_032348	NP_115724	Q9BRK3	MXRA8_HUMAN	matrix-remodelling associated 8 precursor	191	Ig-like V-type 2.|Extracellular (Potential).					integral to membrane					0	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;9.48e-15)|all_lung(118;9.67e-07)|Lung NSC(185;5.59e-05)|Renal(390;0.00571)|Breast(487;0.0183)|Hepatocellular(190;0.0268)|Myeloproliferative disorder(586;0.028)|Ovarian(437;0.127)|Lung SC(97;0.217)		Epithelial(90;2.83e-35)|OV - Ovarian serous cystadenocarcinoma(86;3.77e-21)|Colorectal(212;0.000155)|COAD - Colon adenocarcinoma(227;0.000193)|Kidney(185;0.00227)|BRCA - Breast invasive adenocarcinoma(365;0.0025)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0339)|Lung(427;0.145)														---	---	---	---
SSU72	29101	broad.mit.edu	37	1	1509849	1509849	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1509849C>A	uc001agd.2	-						SSU72_uc009vkg.1_Intron|SSU72_uc001age.1_Intron	NM_014188	NP_054907			Ssu72 RNA polymerase II CTD phosphatase homolog						mRNA processing	cytoplasm|nucleus	phosphoprotein phosphatase activity				0	all_cancers(77;0.00125)|all_epithelial(69;0.000703)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;5.03e-19)|all_lung(118;2.3e-08)|Lung NSC(185;2.38e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Lung SC(97;0.128)		Epithelial(90;5.04e-37)|OV - Ovarian serous cystadenocarcinoma(86;3.72e-23)|GBM - Glioblastoma multiforme(42;1.2e-07)|Colorectal(212;0.000188)|COAD - Colon adenocarcinoma(227;0.000214)|Kidney(185;0.00254)|STAD - Stomach adenocarcinoma(132;0.00645)|BRCA - Breast invasive adenocarcinoma(365;0.00837)|KIRC - Kidney renal clear cell carcinoma(229;0.037)|Lung(427;0.205)														---	---	---	---
MEGF6	1953	broad.mit.edu	37	1	3418428	3418428	+	Missense_Mutation	SNP	G	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:3418428G>C	uc001akl.2	-	18	2473	c.2246C>G	c.(2245-2247)GCC>GGC	p.A749G	MEGF6_uc001akk.2_Missense_Mutation_p.A644G	NM_001409	NP_001400	O75095	MEGF6_HUMAN	EGF-like-domain, multiple 3 precursor	749	EGF-like 12.					extracellular region	calcium ion binding			large_intestine(1)	1	all_cancers(77;0.00681)|all_epithelial(69;0.00301)|Ovarian(185;0.0634)|Lung NSC(156;0.0969)|all_lung(157;0.105)	all_epithelial(116;7.41e-22)|all_lung(118;8.3e-09)|Lung NSC(185;3.55e-06)|Breast(487;0.000659)|Renal(390;0.00121)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Lung SC(97;0.0262)|Ovarian(437;0.0308)|Medulloblastoma(700;0.211)		Epithelial(90;3.78e-37)|OV - Ovarian serous cystadenocarcinoma(86;6.86e-22)|GBM - Glioblastoma multiforme(42;1.96e-12)|Colorectal(212;6.15e-05)|COAD - Colon adenocarcinoma(227;0.000241)|Kidney(185;0.000448)|BRCA - Breast invasive adenocarcinoma(365;0.000779)|KIRC - Kidney renal clear cell carcinoma(229;0.00645)|STAD - Stomach adenocarcinoma(132;0.00669)|Lung(427;0.213)														---	---	---	---
NPHP4	261734	broad.mit.edu	37	1	6038351	6038351	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6038351C>T	uc001alq.1	-	3	524	c.258G>A	c.(256-258)CCG>CCA	p.P86P	NPHP4_uc001als.1_RNA|NPHP4_uc009vlt.1_RNA|NPHP4_uc001alt.1_Intron	NM_015102	NP_055917	O75161	NPHP4_HUMAN	nephroretinin	86					actin cytoskeleton organization|cell-cell adhesion|signal transduction|visual behavior	cell-cell junction|centrosome|cilium|microtubule basal body	protein binding|structural molecule activity			pancreas(1)	1	Ovarian(185;0.0634)	all_cancers(23;7.53e-41)|all_epithelial(116;3.96e-23)|all_lung(118;5.12e-09)|all_hematologic(16;5.45e-07)|Lung NSC(185;5.49e-07)|all_neural(13;3.21e-06)|Acute lymphoblastic leukemia(12;3.44e-05)|Breast(487;0.000601)|Renal(390;0.0007)|Colorectal(325;0.00113)|Hepatocellular(190;0.00213)|Glioma(11;0.00223)|Myeloproliferative disorder(586;0.0256)|Ovarian(437;0.04)|Lung SC(97;0.128)|Medulloblastoma(700;0.213)		Epithelial(90;1.69e-36)|GBM - Glioblastoma multiforme(13;5.07e-29)|OV - Ovarian serous cystadenocarcinoma(86;1.05e-19)|Colorectal(212;4.54e-07)|COAD - Colon adenocarcinoma(227;3.14e-05)|Kidney(185;0.00012)|BRCA - Breast invasive adenocarcinoma(365;0.00102)|KIRC - Kidney renal clear cell carcinoma(229;0.00179)|STAD - Stomach adenocarcinoma(132;0.00472)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
CHD5	26038	broad.mit.edu	37	1	6184676	6184676	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6184676C>T	uc001amb.1	-	30	4540	c.4440G>A	c.(4438-4440)GCG>GCA	p.A1480A	CHD5_uc001alz.1_Silent_p.A337A|CHD5_uc001ama.1_RNA|CHD5_uc001amc.1_RNA|CHD5_uc009vlx.1_Intron	NM_015557	NP_056372	Q8TDI0	CHD5_HUMAN	chromodomain helicase DNA binding protein 5	1480					chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ATP binding|ATP-dependent helicase activity|DNA binding|zinc ion binding			central_nervous_system(3)|breast(3)|ovary(2)|upper_aerodigestive_tract(1)|lung(1)|skin(1)|pancreas(1)	12	Ovarian(185;0.0634)	all_cancers(23;5.36e-32)|all_epithelial(116;2.32e-17)|all_neural(13;3.68e-06)|all_lung(118;3.94e-06)|all_hematologic(16;2.39e-05)|Lung NSC(185;5.33e-05)|Acute lymphoblastic leukemia(12;0.000372)|Glioma(11;0.00127)|Renal(390;0.00188)|Colorectal(325;0.00342)|Breast(487;0.00373)|Hepatocellular(190;0.0218)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.15)		Epithelial(90;3.08e-37)|GBM - Glioblastoma multiforme(13;1.36e-31)|OV - Ovarian serous cystadenocarcinoma(86;7.7e-19)|Colorectal(212;9.97e-08)|COAD - Colon adenocarcinoma(227;1.07e-05)|Kidney(185;6.16e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.00109)|BRCA - Breast invasive adenocarcinoma(365;0.0012)|STAD - Stomach adenocarcinoma(132;0.00346)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.193)														---	---	---	---
ACOT7	11332	broad.mit.edu	37	1	6387476	6387476	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6387476G>A	uc001ams.2	-						ACOT7_uc010nzq.1_Intron|ACOT7_uc001amt.2_Intron|ACOT7_uc001amu.2_Intron|ACOT7_uc001amv.2_Intron|ACOT7_uc001amq.2_Intron|ACOT7_uc001amr.2_Intron	NM_181864	NP_863654			acyl-CoA thioesterase 7 isoform hBACHb							mitochondrion|nucleus	carboxylesterase activity|fatty-acyl-CoA binding|palmitoyl-CoA hydrolase activity				0	Ovarian(185;0.0634)|all_lung(157;0.175)	all_cancers(23;1.42e-38)|all_epithelial(116;3.96e-23)|all_lung(118;3.69e-08)|Lung NSC(185;8.52e-07)|all_hematologic(16;6.92e-06)|Colorectal(325;4.53e-05)|Acute lymphoblastic leukemia(12;5e-05)|all_neural(13;0.000164)|Breast(487;0.000688)|Renal(390;0.0007)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0393)|Medulloblastoma(700;0.211)		Epithelial(90;9.16e-37)|GBM - Glioblastoma multiforme(13;5.89e-29)|OV - Ovarian serous cystadenocarcinoma(86;7.63e-19)|Colorectal(212;1.27e-07)|COAD - Colon adenocarcinoma(227;2.06e-05)|Kidney(185;7.74e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.00129)|BRCA - Breast invasive adenocarcinoma(365;0.00132)|STAD - Stomach adenocarcinoma(132;0.00195)|READ - Rectum adenocarcinoma(331;0.0481)														---	---	---	---
NOL9	79707	broad.mit.edu	37	1	6586028	6586028	+	Silent	SNP	C	T	T	rs146670350		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6586028C>T	uc001ans.2	-	12	2014	c.1995G>A	c.(1993-1995)ACG>ACA	p.T665T	NOL9_uc010nzs.1_RNA	NM_024654	NP_078930	Q5SY16	NOL9_HUMAN	nucleolar protein 9	665					maturation of 5.8S rRNA	nucleolus	ATP binding|polynucleotide 5'-hydroxyl-kinase activity|RNA binding			skin(1)	1	Ovarian(185;0.0212)|all_lung(157;0.154)	all_cancers(23;2.46e-35)|all_epithelial(116;1.41e-22)|all_lung(118;7.59e-07)|Lung NSC(185;4.28e-06)|Colorectal(325;4.52e-05)|Breast(487;0.000353)|Renal(390;0.0007)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0443)		Colorectal(212;1.47e-07)|COAD - Colon adenocarcinoma(227;1.47e-05)|Kidney(185;5.27e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000971)|BRCA - Breast invasive adenocarcinoma(365;0.00113)|STAD - Stomach adenocarcinoma(132;0.0017)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
CAMTA1	23261	broad.mit.edu	37	1	7725039	7725039	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:7725039G>A	uc001aoi.2	+	9	2639	c.2432G>A	c.(2431-2433)CGG>CAG	p.R811Q		NM_015215	NP_056030	Q9Y6Y1	CMTA1_HUMAN	calmodulin-binding transcription activator 1	811					regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	calmodulin binding			ovary(5)|central_nervous_system(2)|breast(1)|pancreas(1)	9	Ovarian(185;0.0634)	all_epithelial(116;8.38e-23)|all_lung(118;5.87e-07)|Lung NSC(185;3.43e-06)|Renal(390;0.000219)|Breast(487;0.000307)|Colorectal(325;0.000615)|Hepatocellular(190;0.0088)|Myeloproliferative disorder(586;0.0303)|Ovarian(437;0.0388)		UCEC - Uterine corpus endometrioid carcinoma (279;0.101)|Colorectal(212;1.33e-05)|COAD - Colon adenocarcinoma(227;0.000235)|BRCA - Breast invasive adenocarcinoma(304;0.000864)|Kidney(185;0.00244)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0179)|READ - Rectum adenocarcinoma(331;0.133)														---	---	---	---
RERE	473	broad.mit.edu	37	1	8420188	8420188	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:8420188C>T	uc001ape.2	-	19	4189	c.3379G>A	c.(3379-3381)GCC>ACC	p.A1127T	RERE_uc001apf.2_Missense_Mutation_p.A1127T|RERE_uc010nzx.1_Missense_Mutation_p.A859T|RERE_uc001apd.2_Missense_Mutation_p.A573T	NM_012102	NP_036234	Q9P2R6	RERE_HUMAN	atrophin-1 like protein isoform a	1127					multicellular organismal development|NLS-bearing substrate import into nucleus	mitochondrion	poly-glutamine tract binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2	Ovarian(185;0.0661)	all_epithelial(116;1.17e-21)|all_lung(118;1.4e-06)|Lung NSC(185;3.06e-06)|Renal(390;0.000147)|Breast(348;0.000206)|Colorectal(325;0.00187)|Hepatocellular(190;0.00825)|Ovarian(437;0.0253)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|all cancers(8;9.64e-67)|GBM - Glioblastoma multiforme(8;9.89e-33)|Colorectal(212;1.45e-07)|COAD - Colon adenocarcinoma(227;3.42e-05)|Kidney(185;6e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000533)|KIRC - Kidney renal clear cell carcinoma(229;0.00106)|STAD - Stomach adenocarcinoma(132;0.00118)|READ - Rectum adenocarcinoma(331;0.0419)|Lung(427;0.195)														---	---	---	---
PTCHD2	57540	broad.mit.edu	37	1	11595533	11595533	+	Splice_Site	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:11595533A>G	uc001ash.3	+	20	3788	c.3650_splice	c.e20-2	p.G1217_splice		NM_020780	NP_065831			patched domain containing 2						cholesterol homeostasis|regulation of lipid transport|smoothened signaling pathway	endoplasmic reticulum|integral to membrane|nuclear membrane	hedgehog receptor activity			skin(3)|ovary(2)|pancreas(1)|breast(1)	7	Ovarian(185;0.249)	Lung NSC(185;4.16e-05)|all_lung(284;4.76e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.00965)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;3.13e-07)|COAD - Colon adenocarcinoma(227;4.83e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000325)|Kidney(185;0.000877)|KIRC - Kidney renal clear cell carcinoma(229;0.00273)|STAD - Stomach adenocarcinoma(313;0.00766)|READ - Rectum adenocarcinoma(331;0.0549)														---	---	---	---
ZBTB17	7709	broad.mit.edu	37	1	16268632	16268632	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16268632C>T	uc001axl.3	-	16	2483	c.2244G>A	c.(2242-2244)CAG>CAA	p.Q748Q	ZBTB17_uc010obq.1_Silent_p.Q665Q|ZBTB17_uc010obr.1_Silent_p.Q755Q|ZBTB17_uc010obs.1_Silent_p.Q672Q	NM_003443	NP_003434	Q13105	ZBT17_HUMAN	zinc finger and BTB domain containing 17	748	Interaction with HCFC1.				negative regulation of cell cycle	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Colorectal(325;0.000257)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.000567)|Ovarian(437;0.0221)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0182)|Colorectal(212;4.12e-07)|COAD - Colon adenocarcinoma(227;2.43e-05)|BRCA - Breast invasive adenocarcinoma(304;9.97e-05)|Kidney(64;0.000182)|KIRC - Kidney renal clear cell carcinoma(64;0.00269)|STAD - Stomach adenocarcinoma(313;0.012)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
NBPF1	55672	broad.mit.edu	37	1	16893672	16893672	+	Splice_Site	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16893672A>G	uc009vos.1	-	26	3952	c.3064_splice	c.e26+1	p.R1022_splice	NBPF1_uc009vot.1_Splice_Site_p.E405_splice|NBPF1_uc001ayz.1_Splice_Site_p.E405_splice	NM_017940	NP_060410			hypothetical protein LOC55672							cytoplasm					0				UCEC - Uterine corpus endometrioid carcinoma (279;0.00459)|BRCA - Breast invasive adenocarcinoma(304;7.52e-06)|COAD - Colon adenocarcinoma(227;1.05e-05)|Kidney(64;0.00016)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.179)														---	---	---	---
CROCC	9696	broad.mit.edu	37	1	17281945	17281945	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17281945C>T	uc001azt.2	+	24	3673	c.3604C>T	c.(3604-3606)CGA>TGA	p.R1202*	CROCC_uc001azu.2_Nonsense_Mutation_p.R505*	NM_014675	NP_055490	Q5TZA2	CROCC_HUMAN	ciliary rootlet coiled-coil	1202	Potential.				cell cycle|cell projection organization|centrosome organization|protein localization	actin cytoskeleton|centriole|ciliary rootlet|plasma membrane	kinesin binding|structural molecule activity			ovary(2)|breast(2)|central_nervous_system(1)	5		Colorectal(325;3.46e-05)|Breast(348;0.000162)|Lung NSC(340;0.000174)|all_lung(284;0.000234)|Renal(390;0.000518)|Ovarian(437;0.00669)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00459)|BRCA - Breast invasive adenocarcinoma(304;7.63e-06)|COAD - Colon adenocarcinoma(227;1.07e-05)|Kidney(64;0.000163)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.181)														---	---	---	---
RCC2	55920	broad.mit.edu	37	1	17747226	17747226	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17747226A>G	uc001bal.2	-	6	890	c.843T>C	c.(841-843)CCT>CCC	p.P281P	RCC2_uc001bam.2_Silent_p.P281P	NM_001136204	NP_001129676	Q9P258	RCC2_HUMAN	regulator of chromosome condensation 2	281	RCC1 4.				cell division|mitotic prometaphase	chromosome, centromeric region|cytosol|microtubule|nucleolus|spindle					0		Colorectal(325;0.000147)|Breast(348;0.00122)|Renal(390;0.00145)|all_lung(284;0.0054)|Lung NSC(340;0.00566)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0439)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00492)|BRCA - Breast invasive adenocarcinoma(304;7.69e-06)|COAD - Colon adenocarcinoma(227;1.19e-05)|Kidney(64;0.000189)|KIRC - Kidney renal clear cell carcinoma(64;0.00273)|STAD - Stomach adenocarcinoma(196;0.0135)|READ - Rectum adenocarcinoma(331;0.0656)|Lung(427;0.19)														---	---	---	---
HSPG2	3339	broad.mit.edu	37	1	22174254	22174254	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:22174254G>A	uc001bfj.2	-	61	7993	c.7953C>T	c.(7951-7953)TGC>TGT	p.C2651C	HSPG2_uc009vqd.2_Silent_p.C2652C	NM_005529	NP_005520	P98160	PGBM_HUMAN	heparan sulfate proteoglycan 2 precursor	2651	Ig-like C2-type 12.				angiogenesis|cell adhesion|lipid metabolic process|lipoprotein metabolic process	basement membrane|extracellular space|plasma membrane	protein C-terminus binding			ovary(5)|large_intestine(2)|central_nervous_system(1)|skin(1)	9		Colorectal(325;3.46e-05)|all_lung(284;7.93e-05)|Lung NSC(340;8.71e-05)|Renal(390;0.000219)|Breast(348;0.00222)|Ovarian(437;0.00308)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0498)|OV - Ovarian serous cystadenocarcinoma(117;1.14e-26)|Colorectal(126;4.18e-07)|COAD - Colon adenocarcinoma(152;1.82e-05)|GBM - Glioblastoma multiforme(114;3.13e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000756)|STAD - Stomach adenocarcinoma(196;0.00656)|KIRC - Kidney renal clear cell carcinoma(1967;0.00942)|READ - Rectum adenocarcinoma(331;0.0721)|Lung(427;0.223)	Becaplermin(DB00102)|Palifermin(DB00039)													---	---	---	---
ZBTB40	9923	broad.mit.edu	37	1	22843935	22843935	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:22843935C>T	uc001bft.2	+	14	3322	c.2811C>T	c.(2809-2811)TCC>TCT	p.S937S	ZBTB40_uc001bfu.2_Silent_p.S937S|ZBTB40_uc009vqi.1_Silent_p.S825S	NM_001083621	NP_001077090	Q9NUA8	ZBT40_HUMAN	zinc finger and BTB domain containing 40	937	C2H2-type 5.				bone mineralization|regulation of transcription, DNA-dependent|response to DNA damage stimulus|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(325;3.46e-05)|Lung NSC(340;6.55e-05)|all_lung(284;9.87e-05)|Renal(390;0.000219)|Breast(348;0.00222)|Ovarian(437;0.00308)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;2.86e-26)|Colorectal(126;8.55e-08)|COAD - Colon adenocarcinoma(152;4.1e-06)|GBM - Glioblastoma multiforme(114;1.39e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000712)|KIRC - Kidney renal clear cell carcinoma(1967;0.00374)|STAD - Stomach adenocarcinoma(196;0.00645)|READ - Rectum adenocarcinoma(331;0.0693)|Lung(427;0.216)														---	---	---	---
GRHL3	57822	broad.mit.edu	37	1	24669458	24669458	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24669458G>A	uc001biy.2	+	11	1423	c.1377G>A	c.(1375-1377)ACG>ACA	p.T459T	GRHL3_uc001bix.2_Silent_p.T454T|GRHL3_uc001biz.2_Silent_p.T361T	NM_021180	NP_067003	Q8TE85	GRHL3_HUMAN	sister-of-mammalian grainyhead protein isoform	454					regulation of actin cytoskeleton organization|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1		Colorectal(325;3.46e-05)|Renal(390;0.0007)|Lung NSC(340;0.00171)|all_lung(284;0.00226)|Ovarian(437;0.00348)|Breast(348;0.0126)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.19)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;8.72e-25)|Colorectal(126;4.38e-08)|COAD - Colon adenocarcinoma(152;1.84e-06)|GBM - Glioblastoma multiforme(114;0.000132)|BRCA - Breast invasive adenocarcinoma(304;0.00105)|STAD - Stomach adenocarcinoma(196;0.00151)|KIRC - Kidney renal clear cell carcinoma(1967;0.00377)|READ - Rectum adenocarcinoma(331;0.0656)|Lung(427;0.143)														---	---	---	---
FGR	2268	broad.mit.edu	37	1	27949552	27949552	+	Splice_Site	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:27949552C>T	uc001boj.2	-	2	475	c.329_splice	c.e2+1	p.T110_splice	FGR_uc001bok.2_Splice_Site_p.T110_splice|FGR_uc001bol.2_Splice_Site_p.T110_splice|FGR_uc001bom.2_Splice_Site_p.T110_splice	NM_005248	NP_005239			proto-oncogene tyrosine-protein kinase FGR						platelet activation|response to virus	cytosol	ATP binding|non-membrane spanning protein tyrosine kinase activity			skin(2)	2		all_lung(284;2.05e-05)|Colorectal(325;3.46e-05)|Lung NSC(340;3.67e-05)|Renal(390;0.00121)|Breast(348;0.0021)|Ovarian(437;0.00503)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0381)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0416)|OV - Ovarian serous cystadenocarcinoma(117;1.25e-24)|Colorectal(126;1.24e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|BRCA - Breast invasive adenocarcinoma(304;0.00244)|KIRC - Kidney renal clear cell carcinoma(1967;0.0027)|STAD - Stomach adenocarcinoma(196;0.00303)|READ - Rectum adenocarcinoma(331;0.0419)														---	---	---	---
LAPTM5	7805	broad.mit.edu	37	1	31208095	31208095	+	Nonsense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:31208095G>T	uc001bsc.2	-	7	715	c.624C>A	c.(622-624)TGC>TGA	p.C208*		NM_006762	NP_006753	Q13571	LAPM5_HUMAN	lysosomal protein transmembrane 5	208					transport	integral to plasma membrane|lysosomal membrane					0		Colorectal(325;0.0199)|Myeloproliferative disorder(586;0.0393)|all_neural(195;0.0966)|Medulloblastoma(700;0.151)|Ovarian(437;0.192)		STAD - Stomach adenocarcinoma(196;0.0196)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
COL16A1	1307	broad.mit.edu	37	1	32145288	32145288	+	Splice_Site	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:32145288T>C	uc001btk.1	-	42	3084	c.2719_splice	c.e42-1	p.G907_splice	COL16A1_uc001btj.1_Splice_Site_p.G720_splice|COL16A1_uc001btl.3_Intron	NM_001856	NP_001847			alpha 1 type XVI collagen precursor						cell adhesion|female pregnancy|integrin-mediated signaling pathway	collagen type XVI	integrin binding|structural molecule activity			ovary(8)	8		Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0423)|all_neural(195;0.0837)|Breast(348;0.116)		STAD - Stomach adenocarcinoma(196;0.059)														---	---	---	---
CSMD2	114784	broad.mit.edu	37	1	34043061	34043061	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:34043061C>T	uc001bxn.1	-	50	7446	c.7417G>A	c.(7417-7419)GCT>ACT	p.A2473T	CSMD2_uc001bxm.1_Missense_Mutation_p.A2471T	NM_052896	NP_443128	Q7Z408	CSMD2_HUMAN	CUB and Sushi multiple domains 2	2473	Sushi 14.|Extracellular (Potential).					integral to membrane|plasma membrane	protein binding			ovary(6)|skin(5)|pancreas(1)	12		Myeloproliferative disorder(586;0.0294)|all_neural(195;0.249)																---	---	---	---
C1orf94	84970	broad.mit.edu	37	1	34663184	34663184	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:34663184C>T	uc001bxs.3	+	2	508	c.109C>T	c.(109-111)CGC>TGC	p.R37C	C1orf94_uc001bxt.2_Missense_Mutation_p.R227C	NM_032884	NP_116273	Q6P1W5	CA094_HUMAN	hypothetical protein LOC84970 isoform b	37							protein binding				0		Myeloproliferative disorder(586;0.0393)																---	---	---	---
NCDN	23154	broad.mit.edu	37	1	36024729	36024729	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36024729G>A	uc001bza.2	+	3	182	c.55G>A	c.(55-57)GCC>ACC	p.A19T	KIAA0319L_uc001byx.2_5'Flank|KIAA0319L_uc010ohw.1_5'Flank|KIAA0319L_uc001byz.2_5'Flank|KIAA0319L_uc010ohx.1_5'Flank|NCDN_uc001bzb.2_Missense_Mutation_p.A19T|NCDN_uc001bzc.2_Missense_Mutation_p.A2T	NM_001014839	NP_001014839	Q9UBB6	NCDN_HUMAN	neurochondrin isoform 1	19					neuron projection development	cytosol|dendrite|neuronal cell body				large_intestine(2)|pancreas(1)	3		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---
EIF2C4	192670	broad.mit.edu	37	1	36307280	36307280	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36307280C>T	uc001bzj.1	+	15	2294	c.2104C>T	c.(2104-2106)CCA>TCA	p.P702S		NM_017629	NP_060099	Q9HCK5	AGO4_HUMAN	eukaryotic translation initiation factor 2C, 4	702	Piwi.				mRNA catabolic process|negative regulation of translation involved in gene silencing by miRNA	cytoplasmic mRNA processing body|cytosol	protein binding|RNA binding			ovary(1)	1		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---
EIF2C1	26523	broad.mit.edu	37	1	36358210	36358210	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36358210C>T	uc001bzl.2	+	3	475	c.262C>T	c.(262-264)CGC>TGC	p.R88C	EIF2C1_uc001bzk.2_Missense_Mutation_p.R13C|EIF2C1_uc009vuy.2_5'Flank	NM_012199	NP_036331	Q9UL18	AGO1_HUMAN	eukaryotic translation initiation factor 2C, 1	88					negative regulation of translation involved in gene silencing by miRNA|nuclear-transcribed mRNA catabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol|micro-ribonucleoprotein complex|polysome	protein binding|RNA binding			ovary(2)|skin(1)	3		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---
EIF2C3	192669	broad.mit.edu	37	1	36432609	36432609	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36432609G>A	uc001bzp.2	+	3	501	c.245G>A	c.(244-246)CGT>CAT	p.R82H	EIF2C3_uc001bzn.1_Missense_Mutation_p.R82H|EIF2C3_uc001bzo.2_RNA|EIF2C3_uc001bzq.2_Intron	NM_024852	NP_079128	Q9H9G7	AGO3_HUMAN	eukaryotic translation initiation factor 2C, 3	82					mRNA catabolic process|negative regulation of translation involved in gene silencing by miRNA	cytoplasmic mRNA processing body|cytosol	protein binding|RNA binding				0		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---
TRAPPC3	27095	broad.mit.edu	37	1	36602891	36602891	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36602891C>A	uc001bzx.2	-	5	544	c.456G>T	c.(454-456)CAG>CAT	p.Q152H	TRAPPC3_uc001bzy.2_Missense_Mutation_p.Q106H	NM_014408	NP_055223	O43617	TPPC3_HUMAN	trafficking protein particle complex 3	152						endoplasmic reticulum	guanylate cyclase activity|heme binding			central_nervous_system(1)	1		Myeloproliferative disorder(586;0.0393)																---	---	---	---
MFSD2A	84879	broad.mit.edu	37	1	40433301	40433301	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40433301T>G	uc001cev.2	+	10	1233	c.1052T>G	c.(1051-1053)CTC>CGC	p.L351R	MFSD2A_uc010ojb.1_Missense_Mutation_p.L299R|MFSD2A_uc001ceu.2_Missense_Mutation_p.L338R|MFSD2A_uc010ojc.1_Missense_Mutation_p.L182R|MFSD2A_uc009vvy.2_Intron|MFSD2A_uc001cex.2_Missense_Mutation_p.L2R	NM_001136493	NP_001129965	Q8NA29	MFS2A_HUMAN	major facilitator superfamily domain containing	351	Helical; (Potential).				transmembrane transport	endoplasmic reticulum membrane|integral to membrane				ovary(1)|pancreas(1)	2																		---	---	---	---
COL9A2	1298	broad.mit.edu	37	1	40766913	40766913	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40766913C>T	uc001cfh.1	-	32	2081	c.2011G>A	c.(2011-2013)GGA>AGA	p.G671R	COL9A2_uc001cfi.1_Missense_Mutation_p.G490R	NM_001852	NP_001843	Q14055	CO9A2_HUMAN	alpha 2 type IX collagen precursor	671	Nonhelical region 1 (NC1).				axon guidance|skeletal system development	collagen type IX				ovary(2)	2	Lung NSC(20;4.38e-06)|Ovarian(52;0.00167)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;2.08e-17)															---	---	---	---
KIAA0467	23334	broad.mit.edu	37	1	43903494	43903494	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43903494C>T	uc001cjk.1	+	31	4194	c.3732C>T	c.(3730-3732)AGC>AGT	p.S1244S		NM_015284	NP_056099	Q5T011	SZT2_HUMAN	hypothetical protein LOC23334	2143						peroxisome					0	all_hematologic(146;0.0958)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0505)																---	---	---	---
B4GALT2	8704	broad.mit.edu	37	1	44447558	44447558	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44447558C>T	uc001clg.2	+	3	881	c.511C>T	c.(511-513)CGG>TGG	p.R171W	B4GALT2_uc001clh.2_Missense_Mutation_p.R105W|B4GALT2_uc010okl.1_Missense_Mutation_p.R200W|B4GALT2_uc001cli.2_Missense_Mutation_p.R171W	NM_003780	NP_003771	O60909	B4GT2_HUMAN	UDP-Gal:betaGlcNAc beta 1,4-	171	Lumenal (Potential).				post-translational protein modification|protein N-linked glycosylation via asparagine	Golgi cisterna membrane|integral to membrane	beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity|lactose synthase activity|metal ion binding|N-acetyllactosamine synthase activity			ovary(1)|skin(1)	2	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0511)			N-Acetyl-D-glucosamine(DB00141)													---	---	---	---
TMEM53	79639	broad.mit.edu	37	1	45120723	45120723	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45120723G>A	uc001cmc.2	-	3	378	c.342C>T	c.(340-342)AAC>AAT	p.N114N	TMEM53_uc001cmb.1_Intron|TMEM53_uc001cmd.2_Silent_p.N41N|TMEM53_uc009vxh.1_Translation_Start_Site|TMEM53_uc010ola.1_Translation_Start_Site	NM_024587	NP_078863	Q6P2H8	TMM53_HUMAN	transmembrane protein 53	114						integral to membrane				ovary(2)	2	Acute lymphoblastic leukemia(166;0.155)															OREG0013446	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
HPDL	84842	broad.mit.edu	37	1	45793721	45793721	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45793721G>T	uc001cne.2	+	1	1177	c.901G>T	c.(901-903)GGG>TGG	p.G301W		NM_032756	NP_116145	Q96IR7	HPDL_HUMAN	glyoxalase domain containing 1	301					aromatic amino acid family metabolic process		4-hydroxyphenylpyruvate dioxygenase activity|metal ion binding				0	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---
NASP	4678	broad.mit.edu	37	1	46073759	46073759	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:46073759T>C	uc001coi.1	+	6	1278	c.1176T>C	c.(1174-1176)ATT>ATC	p.I392I	NASP_uc010olq.1_Silent_p.I355I|NASP_uc001coh.1_Silent_p.I394I|NASP_uc001coj.1_Intron|NASP_uc010olr.1_Silent_p.I328I|NASP_uc001cok.1_Silent_p.I275I	NM_002482	NP_002473	P49321	NASP_HUMAN	nuclear autoantigenic sperm protein isoform 2	392	Glu-rich (acidic).				blastocyst development|cell cycle|cell proliferation|DNA replication|histone exchange|protein transport	cytoplasm|nucleus	Hsp90 protein binding			ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)|Lung SC(450;0.211)																	---	---	---	---
GPX7	2882	broad.mit.edu	37	1	53074041	53074041	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:53074041C>A	uc001cue.2	+	3	547	c.508C>A	c.(508-510)CCC>ACC	p.P170T		NM_015696	NP_056511	Q96SL4	GPX7_HUMAN	glutathione peroxidase 7 precursor	170					response to oxidative stress	extracellular region	glutathione peroxidase activity				0					Glutathione(DB00143)													---	---	---	---
FAM151A	338094	broad.mit.edu	37	1	55075579	55075579	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55075579C>T	uc001cxn.2	-	8	1252	c.1120G>A	c.(1120-1122)GAG>AAG	p.E374K	ACOT11_uc001cxj.1_3'UTR|ACOT11_uc001cxl.1_3'UTR|ACOT11_uc001cxm.1_Intron	NM_176782	NP_788954	Q8WW52	F151A_HUMAN	hypothetical protein LOC338094	374						integral to membrane					0																		---	---	---	---
TMEM61	199964	broad.mit.edu	37	1	55457540	55457540	+	Missense_Mutation	SNP	G	A	A	rs142872695		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55457540G>A	uc001cyd.2	+	3	671	c.397G>A	c.(397-399)GAG>AAG	p.E133K		NM_182532	NP_872338	Q8N0U2	TMM61_HUMAN	transmembrane protein 61	133						integral to membrane					0																		---	---	---	---
JAK1	3716	broad.mit.edu	37	1	65335080	65335080	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:65335080G>A	uc001dbu.1	-	6	810	c.561C>T	c.(559-561)AAC>AAT	p.N187N	JAK1_uc009wam.1_Silent_p.N175N	NM_002227	NP_002218	P23458	JAK1_HUMAN	janus kinase 1	187	FERM.				interferon-gamma-mediated signaling pathway|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|response to antibiotic|type I interferon-mediated signaling pathway	cytoskeleton|cytosol|endomembrane system|membrane|nucleus	ATP binding|growth hormone receptor binding|non-membrane spanning protein tyrosine kinase activity			haematopoietic_and_lymphoid_tissue(34)|prostate(7)|soft_tissue(6)|lung(4)|breast(3)|central_nervous_system(2)|liver(2)|large_intestine(1)|stomach(1)|ovary(1)	61				BRCA - Breast invasive adenocarcinoma(111;0.0485)				Mis		ALL								---	---	---	---
IL12RB2	3595	broad.mit.edu	37	1	67861543	67861543	+	Missense_Mutation	SNP	C	T	T	rs141507006		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67861543C>T	uc001ddu.2	+	16	3000	c.2360C>T	c.(2359-2361)ACG>ATG	p.T787M	IL12RB2_uc010oqi.1_3'UTR|IL12RB2_uc010oqj.1_3'UTR|IL12RB2_uc010oqk.1_RNA|IL12RB2_uc010oql.1_Missense_Mutation_p.T701M|IL12RB2_uc010oqm.1_3'UTR|IL12RB2_uc010oqn.1_RNA	NM_001559	NP_001550	Q99665	I12R2_HUMAN	interleukin 12 receptor, beta 2 precursor	787	Cytoplasmic (Potential).				positive regulation of cell proliferation|positive regulation of interferon-gamma production	integral to plasma membrane	cytokine receptor activity			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
SERBP1	26135	broad.mit.edu	37	1	67895978	67895978	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67895978A>G	uc001ddv.2	-	1	146	c.6T>C	c.(4-6)CCT>CCC	p.P2P	SERBP1_uc001ddx.2_Silent_p.P2P|SERBP1_uc001ddy.2_Silent_p.P2P|SERBP1_uc001ddw.2_Silent_p.P2P	NM_001018067	NP_001018077	Q8NC51	PAIRB_HUMAN	SERPINE1 mRNA binding protein 1 isoform 1	2					regulation of mRNA stability	nucleus|perinuclear region of cytoplasm	mRNA 3'-UTR binding|protein binding			skin(1)	1																		---	---	---	---
LRRC7	57554	broad.mit.edu	37	1	70504915	70504915	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70504915G>T	uc001dep.2	+	19	3324	c.3294G>T	c.(3292-3294)GTG>GTT	p.V1098V	LRRC7_uc009wbg.2_Silent_p.V382V|LRRC7_uc001deq.2_Silent_p.V339V	NM_020794	NP_065845	Q96NW7	LRRC7_HUMAN	leucine rich repeat containing 7	1098						centrosome|focal adhesion|nucleolus	protein binding			ovary(9)|breast(2)|central_nervous_system(2)|liver(1)	14																		---	---	---	---
LRRC40	55631	broad.mit.edu	37	1	70621361	70621361	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70621361A>G	uc001der.1	-							NM_017768	NP_060238			leucine rich repeat containing 40											ovary(1)	1																		---	---	---	---
CTH	1491	broad.mit.edu	37	1	70877194	70877194	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70877194G>A	uc001dfd.2	+	1	240	c.96G>A	c.(94-96)TGG>TGA	p.W32*	CTH_uc009wbl.1_RNA|CTH_uc001dfe.2_Nonsense_Mutation_p.W32*|CTH_uc010oqq.1_Nonsense_Mutation_p.W32*	NM_001902	NP_001893	P32929	CGL_HUMAN	cystathionase isoform 1	32					cysteine biosynthetic process|hydrogen sulfide biosynthetic process|protein homotetramerization|protein-pyridoxal-5-phosphate linkage via peptidyl-N6-pyridoxal phosphate-L-lysine	cytoplasm|nucleus	cystathionine gamma-lyase activity|L-cysteine desulfhydrase activity|pyridoxal phosphate binding			lung(1)	1					L-Cysteine(DB00151)|Pyridoxal Phosphate(DB00114)													---	---	---	---
NEXN	91624	broad.mit.edu	37	1	78395171	78395171	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:78395171T>C	uc001dic.3	+	9	1332	c.1035T>C	c.(1033-1035)GCT>GCC	p.A345A	NEXN_uc001dia.3_Silent_p.A331A|NEXN_uc009wcb.1_Silent_p.A267A|NEXN_uc001dib.3_Silent_p.A281A|NEXN_uc001did.1_Silent_p.A255A|NEXN_uc001dif.1_Silent_p.A237A	NM_144573	NP_653174	Q0ZGT2	NEXN_HUMAN	nexilin (F actin binding protein)	345	Glu-rich.				regulation of cell migration|regulation of cytoskeleton organization	cytoskeleton|Z disc	actin filament binding|structural constituent of muscle			ovary(2)	2				Colorectal(170;0.114)														---	---	---	---
FUBP1	8880	broad.mit.edu	37	1	78428529	78428529	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:78428529T>C	uc001dii.2	-	14	1359	c.1270A>G	c.(1270-1272)ATG>GTG	p.M424V	FUBP1_uc001dih.3_RNA|FUBP1_uc010orm.1_Missense_Mutation_p.M445V	NM_003902	NP_003893	Q96AE4	FUBP1_HUMAN	far upstream element-binding protein	424	KH 4.				transcription from RNA polymerase II promoter	nucleus	protein binding|RNA binding|sequence-specific DNA binding transcription factor activity|single-stranded DNA binding			central_nervous_system(2)|lung(1)	3																		---	---	---	---
PRKACB	5567	broad.mit.edu	37	1	84650786	84650786	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:84650786A>G	uc001djj.2	+	5	604	c.340A>G	c.(340-342)AAT>GAT	p.N114D	PRKACB_uc001djl.2_Missense_Mutation_p.N161D|PRKACB_uc010ort.1_Missense_Mutation_p.N121D|PRKACB_uc001djn.2_Missense_Mutation_p.N118D|PRKACB_uc010oru.1_Missense_Mutation_p.N102D|PRKACB_uc001djp.2_Missense_Mutation_p.N120D|PRKACB_uc001djq.2_Missense_Mutation_p.N84D|PRKACB_uc010orv.1_Missense_Mutation_p.N101D|PRKACB_uc001dji.2_Missense_Mutation_p.N114D|PRKACB_uc001djk.2_Missense_Mutation_p.N161D|PRKACB_uc009wcf.1_Missense_Mutation_p.N120D	NM_002731	NP_002722	P22694	KAPCB_HUMAN	cAMP-dependent protein kinase catalytic subunit	114	Protein kinase.				activation of phospholipase C activity|activation of protein kinase A activity|blood coagulation|cellular response to glucagon stimulus|energy reserve metabolic process|G-protein signaling, coupled to cAMP nucleotide second messenger|gluconeogenesis|intracellular protein kinase cascade|nerve growth factor receptor signaling pathway|regulation of insulin secretion|synaptic transmission|transmembrane transport|triglyceride catabolic process|water transport	cAMP-dependent protein kinase complex|centrosome|cytosol|nucleoplasm|plasma membrane	ATP binding|cAMP-dependent protein kinase activity|magnesium ion binding|protein binding			lung(2)|ovary(1)	3				all cancers(265;0.00536)|Epithelial(280;0.0161)|OV - Ovarian serous cystadenocarcinoma(397;0.141)														---	---	---	---
ZNHIT6	54680	broad.mit.edu	37	1	86173931	86173931	+	Nonsense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86173931C>A	uc001dlh.2	-	1	171	c.37G>T	c.(37-39)GGA>TGA	p.G13*	ZNHIT6_uc010osc.1_Nonsense_Mutation_p.G13*	NM_017953	NP_060423	Q9NWK9	BCD1_HUMAN	zinc finger, HIT type 6	13					box C/D snoRNP assembly|ribosome biogenesis	pre-snoRNP complex	identical protein binding|metal ion binding			large_intestine(1)	1																		---	---	---	---
GBP6	163351	broad.mit.edu	37	1	89847424	89847424	+	Missense_Mutation	SNP	C	T	T	rs141648455	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:89847424C>T	uc001dnf.2	+	7	1317	c.1043C>T	c.(1042-1044)ACG>ATG	p.T348M	GBP6_uc010ost.1_Missense_Mutation_p.T218M	NM_198460	NP_940862	Q6ZN66	GBP6_HUMAN	guanylate binding protein family, member 6	348							GTP binding|GTPase activity			ovary(2)	2		Lung NSC(277;0.0908)		all cancers(265;0.0108)|Epithelial(280;0.0398)														---	---	---	---
AGL	178	broad.mit.edu	37	1	100353617	100353617	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:100353617G>A	uc001dsi.1	+	21	3165	c.2765G>A	c.(2764-2766)TGC>TAC	p.C922Y	AGL_uc001dsj.1_Missense_Mutation_p.C922Y|AGL_uc001dsk.1_Missense_Mutation_p.C922Y|AGL_uc001dsl.1_Missense_Mutation_p.C922Y|AGL_uc001dsm.1_Missense_Mutation_p.C906Y|AGL_uc001dsn.1_Missense_Mutation_p.C905Y	NM_000642	NP_000633	P35573	GDE_HUMAN	amylo-1,6-glucosidase,	922	4-alpha-glucanotransferase.				glucose metabolic process|glycogen biosynthetic process|glycogen catabolic process	cytosol|isoamylase complex|nucleus	4-alpha-glucanotransferase activity|amylo-alpha-1,6-glucosidase activity|cation binding			ovary(1)|central_nervous_system(1)|skin(1)	3		all_epithelial(167;2.2e-06)|all_lung(203;0.000295)|Lung NSC(277;0.00131)		Epithelial(280;0.15)|COAD - Colon adenocarcinoma(174;0.151)|Lung(183;0.209)|all cancers(265;0.237)														---	---	---	---
SLC35A3	23443	broad.mit.edu	37	1	100480939	100480939	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:100480939G>A	uc001dsp.1	+	6	913	c.716G>A	c.(715-717)GGA>GAA	p.G239E	SLC35A3_uc001dsq.1_Missense_Mutation_p.G239E|SLC35A3_uc009wdy.1_Intron|SLC35A3_uc001dsr.1_Missense_Mutation_p.G281E|SLC35A3_uc001dss.1_Missense_Mutation_p.G158E	NM_012243	NP_036375	Q9Y2D2	S35A3_HUMAN	solute carrier family 35 member 3A	239					UDP-N-acetylglucosamine metabolic process	Golgi membrane|integral to membrane	sugar:hydrogen symporter activity|UDP-N-acetylglucosamine transmembrane transporter activity				0		all_epithelial(167;0.000686)|all_lung(203;0.0154)|Lung NSC(277;0.0155)		Epithelial(280;0.124)|all cancers(265;0.198)|Lung(183;0.199)														---	---	---	---
S1PR1	1901	broad.mit.edu	37	1	101705604	101705604	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:101705604C>T	uc001dud.2	+	2	1578	c.1064C>T	c.(1063-1065)TCG>TTG	p.S355L	S1PR1_uc009weg.2_Missense_Mutation_p.S355L	NM_001400	NP_001391	P21453	S1PR1_HUMAN	sphingosine-1-phosphate receptor 1	355	Cytoplasmic (By similarity).				cell adhesion	integral to membrane	lysosphingolipid and lysophosphatidic acid receptor activity			ovary(2)|lung(1)	3																		---	---	---	---
OLFM3	118427	broad.mit.edu	37	1	102270106	102270106	+	Silent	SNP	G	A	A	rs144970574	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:102270106G>A	uc001duf.2	-	6	1196	c.1125C>T	c.(1123-1125)AAC>AAT	p.N375N	OLFM3_uc001dug.2_Silent_p.N355N|OLFM3_uc001duh.2_RNA|OLFM3_uc001dui.2_RNA|OLFM3_uc001duj.2_Silent_p.N280N|OLFM3_uc001due.2_RNA	NM_058170	NP_477518	Q96PB7	NOE3_HUMAN	olfactomedin 3	375	Olfactomedin-like.					extracellular region				ovary(2)|skin(1)	3		all_epithelial(167;1.87e-06)|all_lung(203;8.12e-05)|Lung NSC(277;0.000189)		all cancers(265;0.0843)|Epithelial(280;0.0921)|COAD - Colon adenocarcinoma(174;0.145)														---	---	---	---
COL11A1	1301	broad.mit.edu	37	1	103345259	103345259	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103345259T>C	uc001dul.2	-	66	5572	c.5254A>G	c.(5254-5256)ACA>GCA	p.T1752A	COL11A1_uc001duk.2_Missense_Mutation_p.T948A|COL11A1_uc001dum.2_Missense_Mutation_p.T1764A|COL11A1_uc001dun.2_Missense_Mutation_p.T1713A|COL11A1_uc009weh.2_Missense_Mutation_p.T1636A	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	1752	Fibrillar collagen NC1.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)														---	---	---	---
SLC25A24	29957	broad.mit.edu	37	1	108681756	108681756	+	Silent	SNP	G	A	A	rs144919358		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:108681756G>A	uc001dvn.3	-	9	1387	c.1173C>T	c.(1171-1173)TGC>TGT	p.C391C	SLC25A24_uc001dvm.2_Silent_p.C372C	NM_013386	NP_037518	Q6NUK1	SCMC1_HUMAN	solute carrier family 25 member 24 isoform 1	391	Solcar 3.|Helical; Name=5; (Potential).				transmembrane transport	integral to membrane|mitochondrial inner membrane	calcium ion binding			ovary(1)	1		all_epithelial(167;3.72e-05)|all_lung(203;0.000567)|Lung NSC(277;0.0011)|Melanoma(281;0.211)		Colorectal(144;0.0345)|Lung(183;0.0971)|COAD - Colon adenocarcinoma(174;0.127)|Epithelial(280;0.134)														---	---	---	---
CELSR2	1952	broad.mit.edu	37	1	109814897	109814897	+	Intron	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109814897T>C	uc001dxa.3	+							NM_001408	NP_001399			cadherin EGF LAG seven-pass G-type receptor 2						dendrite morphogenesis|homophilic cell adhesion|neural plate anterior/posterior regionalization|neuropeptide signaling pathway|regulation of cell-cell adhesion|regulation of transcription, DNA-dependent|Wnt receptor signaling pathway	cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(4)|lung(3)|skin(1)	8		all_epithelial(167;0.000114)|all_lung(203;0.000321)|Lung NSC(277;0.000626)|Breast(1374;0.244)		Colorectal(144;0.0296)|Lung(183;0.067)|COAD - Colon adenocarcinoma(174;0.114)|Epithelial(280;0.193)|all cancers(265;0.219)														---	---	---	---
SORT1	6272	broad.mit.edu	37	1	109857386	109857386	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109857386A>C	uc001dxm.1	-	18	2314	c.2265T>G	c.(2263-2265)AAT>AAG	p.N755K	SORT1_uc010ovi.1_Missense_Mutation_p.N618K	NM_002959	NP_002950	Q99523	SORT_HUMAN	sortilin 1 preproprotein	755	Interactions with LRPAP1 and NGFB.|Extracellular (Potential).				endocytosis|endosome to lysosome transport|endosome transport via multivesicular body sorting pathway|glucose import|Golgi to endosome transport|induction of apoptosis by extracellular signals|myotube differentiation|negative regulation of apoptosis|negative regulation of lipoprotein lipase activity|neuropeptide signaling pathway|ossification|plasma membrane to endosome transport|regulation of gene expression|response to insulin stimulus|vesicle organization	cell surface|coated pit|early endosome|endoplasmic reticulum membrane|endosome membrane|Golgi cisterna membrane|integral to membrane|lysosomal membrane|microsome|nuclear membrane|perinuclear region of cytoplasm|plasma membrane	enzyme binding|nerve growth factor binding|nerve growth factor receptor activity|neurotensin receptor activity, non-G-protein coupled			ovary(1)	1		all_epithelial(167;4.69e-05)|all_lung(203;0.00016)|Lung NSC(277;0.000318)|Breast(1374;0.244)		Lung(183;0.0529)|Colorectal(144;0.142)|Epithelial(280;0.145)|Kidney(133;0.169)|all cancers(265;0.184)														---	---	---	---
FAM40A	85369	broad.mit.edu	37	1	110593694	110593694	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110593694A>G	uc001dza.1	+						FAM40A_uc001dyz.1_Intron|FAM40A_uc009wfp.1_Intron	NM_033088	NP_149079			hypothetical protein LOC85369							nucleus	protein binding			ovary(3)|large_intestine(1)	4		all_cancers(81;8.51e-05)|all_epithelial(167;3.58e-05)|all_lung(203;0.000116)|Lung NSC(277;0.000233)		Lung(183;0.0154)|all cancers(265;0.0732)|Epithelial(280;0.0781)|Colorectal(144;0.115)|LUSC - Lung squamous cell carcinoma(189;0.137)														---	---	---	---
RHOC	389	broad.mit.edu	37	1	113245673	113245673	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:113245673C>T	uc001ecp.1	-	4	525	c.225G>A	c.(223-225)CCG>CCA	p.P75P	RHOC_uc001ecq.1_Silent_p.P75P|RHOC_uc001ecr.1_Silent_p.P75P|RHOC_uc009wgk.1_Silent_p.P75P	NM_001042679	NP_001036144	P08134	RHOC_HUMAN	ras homolog gene family, member C precursor	75					axon guidance|positive regulation of I-kappaB kinase/NF-kappaB cascade|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|plasma membrane	GTP binding|GTPase activity|signal transducer activity			ovary(1)	1	Lung SC(450;0.246)	all_cancers(81;1.44e-07)|all_epithelial(167;7.64e-07)|all_lung(203;2.16e-05)|Lung NSC(69;3.86e-05)		Lung(183;0.0234)|all cancers(265;0.0246)|Epithelial(280;0.0342)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
AP4B1	10717	broad.mit.edu	37	1	114442814	114442814	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:114442814G>A	uc001eeb.2	-	5	969	c.826C>T	c.(826-828)CGG>TGG	p.R276W	uc001edv.1_RNA|AP4B1_uc001eec.2_Missense_Mutation_p.R108W|AP4B1_uc001eed.2_Missense_Mutation_p.R276W|AP4B1_uc010owp.1_Missense_Mutation_p.R177W|AP4B1_uc001eea.1_Missense_Mutation_p.R70W|AP4B1_uc010owq.1_Missense_Mutation_p.R183W	NM_006594	NP_006585	Q9Y6B7	AP4B1_HUMAN	adaptor-related protein complex 4, beta 1	276					intracellular protein transport|vesicle-mediated transport	clathrin adaptor complex|soluble fraction|trans-Golgi network	protein binding|protein transporter activity			ovary(3)|central_nervous_system(1)	4	Lung SC(450;0.184)	all_cancers(81;4.5e-08)|all_epithelial(167;1.1e-07)|all_lung(203;1.53e-05)|Lung NSC(69;2.76e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
AMPD1	270	broad.mit.edu	37	1	115217434	115217434	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:115217434G>A	uc001efe.1	-	13	1823	c.1739C>T	c.(1738-1740)ACC>ATC	p.T580I	AMPD1_uc001eff.1_Missense_Mutation_p.T576I	NM_000036	NP_000027	P23109	AMPD1_HUMAN	adenosine monophosphate deaminase 1 (isoform M)	580					purine base metabolic process|purine ribonucleoside monophosphate biosynthetic process|purine-containing compound salvage	cytosol	AMP deaminase activity|metal ion binding			ovary(2)|large_intestine(1)|skin(1)	4	all_epithelial(7;7.83e-05)|all_lung(7;0.000179)|Lung NSC(6;0.00195)|Lung SC(450;0.211)	all_cancers(81;4.64e-07)|all_epithelial(167;4.2e-07)|all_lung(203;9.97e-06)|Lung NSC(69;1.74e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|all cancers(265;0.112)|Epithelial(280;0.124)|LUSC - Lung squamous cell carcinoma(189;0.133)	Adenosine monophosphate(DB00131)													---	---	---	---
WARS2	10352	broad.mit.edu	37	1	119575735	119575735	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:119575735G>A	uc001ehn.2	-	6	910	c.882C>T	c.(880-882)AGC>AGT	p.S294S	WARS2_uc010oxf.1_Silent_p.S200S|WARS2_uc001ehm.2_3'UTR|WARS2_uc010oxg.1_Silent_p.S237S|WARS2_uc010oxh.1_3'UTR	NM_015836	NP_056651	Q9UGM6	SYWM_HUMAN	mitochondrial tryptophanyl tRNA synthetase 2	294					tryptophanyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|tryptophan-tRNA ligase activity				0	all_neural(166;0.187)	all_lung(203;2.48e-06)|Lung NSC(69;1.74e-05)|all_epithelial(167;0.000564)		Lung(183;0.0629)	L-Tryptophan(DB00150)													---	---	---	---
ANKRD35	148741	broad.mit.edu	37	1	145561338	145561338	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145561338G>A	uc001eob.1	+	10	1134	c.1026G>A	c.(1024-1026)CAG>CAA	p.Q342Q	NBPF10_uc001emp.3_Intron|ANKRD35_uc010oyx.1_Silent_p.Q185Q	NM_144698	NP_653299	Q8N283	ANR35_HUMAN	ankyrin repeat domain 35	342	Potential.									ovary(4)|skin(1)	5	all_hematologic(18;0.0187)|Acute lymphoblastic leukemia(18;0.0786)																	---	---	---	---
CHD1L	9557	broad.mit.edu	37	1	146757977	146757977	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:146757977T>C	uc001epm.3	+	18	2084	c.2021T>C	c.(2020-2022)ATG>ACG	p.M674T	uc001epp.2_Intron|CHD1L_uc001epn.3_Missense_Mutation_p.M561T|CHD1L_uc010ozo.1_RNA|CHD1L_uc009wjg.2_RNA|CHD1L_uc009wjh.2_Missense_Mutation_p.M580T|CHD1L_uc010ozp.1_Missense_Mutation_p.M393T|CHD1L_uc001epo.3_Missense_Mutation_p.M470T|CHD1L_uc009wji.2_Missense_Mutation_p.M393T	NM_004284	NP_004275	Q86WJ1	CHD1L_HUMAN	chromodomain helicase DNA binding protein	674	Potential.			M -> V (in Ref. 2; BAA91637).	chromatin remodeling|DNA repair	cytoplasm|nucleus|plasma membrane	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding			ovary(3)|lung(2)|upper_aerodigestive_tract(1)	6	all_hematologic(923;0.0487)																	---	---	---	---
GJA8	2703	broad.mit.edu	37	1	147380609	147380609	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:147380609G>A	uc001epu.1	+	2	590	c.527G>A	c.(526-528)CGG>CAG	p.R176Q		NM_005267	NP_005258	P48165	CXA8_HUMAN	connexin 50	176	Extracellular (Potential).				cell communication|visual perception	connexon complex|integral to plasma membrane	channel activity			ovary(2)|large_intestine(2)|breast(1)|skin(1)	6	all_hematologic(923;0.0276)																	---	---	---	---
SEMA6C	10500	broad.mit.edu	37	1	151108547	151108547	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151108547G>A	uc001ewu.2	-	13	1499	c.1199C>T	c.(1198-1200)CCG>CTG	p.P400L	SEMA6C_uc001ewv.2_Missense_Mutation_p.P400L|SEMA6C_uc001eww.2_Missense_Mutation_p.P360L|SEMA6C_uc010pcq.1_Missense_Mutation_p.P400L	NM_030913	NP_112175	Q9H3T2	SEM6C_HUMAN	semaphorin Y precursor	400	Extracellular (Potential).|Sema.					integral to membrane	receptor activity			ovary(1)|skin(1)	2	Lung SC(34;0.00471)|Ovarian(49;0.0147)|all_hematologic(923;0.0597)|Hepatocellular(266;0.0997)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0486)|LUSC - Lung squamous cell carcinoma(543;0.211)															---	---	---	---
ZNF687	57592	broad.mit.edu	37	1	151261166	151261166	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151261166C>T	uc001exq.2	+	3	2376	c.2278C>T	c.(2278-2280)CGC>TGC	p.R760C	ZNF687_uc009wmo.2_Missense_Mutation_p.R760C|ZNF687_uc009wmp.2_Missense_Mutation_p.R760C	NM_020832	NP_065883	Q8N1G0	ZN687_HUMAN	zinc finger protein 687	760					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus	DNA binding|zinc ion binding			central_nervous_system(3)|ovary(1)	4	Lung SC(34;0.00471)|Ovarian(49;0.0147)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.112)|LUSC - Lung squamous cell carcinoma(543;0.181)															---	---	---	---
ZNF687	57592	broad.mit.edu	37	1	151263250	151263250	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151263250G>A	uc001exq.2	+	9	3377	c.3279G>A	c.(3277-3279)ACG>ACA	p.T1093T	ZNF687_uc009wmo.2_Silent_p.T1093T|ZNF687_uc009wmp.2_3'UTR	NM_020832	NP_065883	Q8N1G0	ZN687_HUMAN	zinc finger protein 687	1093					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus	DNA binding|zinc ion binding			central_nervous_system(3)|ovary(1)	4	Lung SC(34;0.00471)|Ovarian(49;0.0147)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.112)|LUSC - Lung squamous cell carcinoma(543;0.181)															---	---	---	---
CGN	57530	broad.mit.edu	37	1	151491196	151491196	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151491196G>A	uc009wmw.2	+	2	345	c.201G>A	c.(199-201)GTG>GTA	p.V67V		NM_020770	NP_065821	Q9P2M7	CING_HUMAN	cingulin	61	Head.					myosin complex|tight junction	actin binding|motor activity			ovary(2)|pancreas(1)	3	Ovarian(49;0.0273)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		LUSC - Lung squamous cell carcinoma(543;0.181)															---	---	---	---
CGN	57530	broad.mit.edu	37	1	151508742	151508742	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151508742G>A	uc009wmw.2	+	19	3371	c.3227G>A	c.(3226-3228)CGA>CAA	p.R1076Q	CGN_uc010pde.1_Missense_Mutation_p.R70Q	NM_020770	NP_065821	Q9P2M7	CING_HUMAN	cingulin	1070	Potential.					myosin complex|tight junction	actin binding|motor activity			ovary(2)|pancreas(1)	3	Ovarian(49;0.0273)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		LUSC - Lung squamous cell carcinoma(543;0.181)															---	---	---	---
RORC	6097	broad.mit.edu	37	1	151785741	151785741	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151785741C>T	uc001ezh.2	-	8	1256	c.1148G>A	c.(1147-1149)GGT>GAT	p.G383D	RORC_uc001ezg.2_Missense_Mutation_p.G362D|RORC_uc010pdo.1_Missense_Mutation_p.G437D|RORC_uc010pdp.1_Intron	NM_005060	NP_005051	P51449	RORG_HUMAN	RAR-related orphan receptor C isoform a	383	Ligand-binding.				regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)|skin(1)	2	Hepatocellular(266;0.0877)|all_hematologic(923;0.127)|Melanoma(130;0.14)		LUSC - Lung squamous cell carcinoma(543;0.181)															---	---	---	---
TCHHL1	126637	broad.mit.edu	37	1	152058006	152058006	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152058006T>G	uc001ezo.1	-	3	2217	c.2152A>C	c.(2152-2154)AAT>CAT	p.N718H		NM_001008536	NP_001008536	Q5QJ38	TCHL1_HUMAN	trichohyalin-like 1	718							calcium ion binding			ovary(1)|skin(1)	2	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.246)															---	---	---	---
FLG	2312	broad.mit.edu	37	1	152286125	152286125	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152286125C>T	uc001ezu.1	-	3	1273	c.1237G>A	c.(1237-1239)GGA>AGA	p.G413R	uc001ezv.2_RNA	NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	413	Ser-rich.|Filaggrin 2.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)											Ichthyosis				---	---	---	---
LCE5A	254910	broad.mit.edu	37	1	152484143	152484143	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152484143C>A	uc001ezy.2	+	2	309	c.133C>A	c.(133-135)CCA>ACA	p.P45T	CRCT1_uc001ezz.2_5'Flank	NM_178438	NP_848525	Q5TCM9	LCE5A_HUMAN	late cornified envelope 5A	45	Cys-rich.				keratinization					ovary(1)	1	Hepatocellular(266;0.0877)|all_hematologic(923;0.127)|Melanoma(130;0.242)		LUSC - Lung squamous cell carcinoma(543;0.206)															---	---	---	---
S100A7A	338324	broad.mit.edu	37	1	153390650	153390650	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153390650G>T	uc001fbt.1	+	2	149	c.92G>T	c.(91-93)AGC>ATC	p.S31I		NM_176823	NP_789793	Q86SG5	S1A7A_HUMAN	S100 calcium binding protein A7-like 1	31	EF-hand 1.					cytoplasm	calcium ion binding			skin(1)	1	all_lung(78;2.81e-33)|Lung NSC(65;9.54e-32)|Hepatocellular(266;0.0877)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.171)															---	---	---	---
KCNN3	3782	broad.mit.edu	37	1	154680583	154680583	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154680583G>T	uc001ffp.2	-	8	2379	c.2065C>A	c.(2065-2067)CTG>ATG	p.L689M	KCNN3_uc001ffo.2_Missense_Mutation_p.L384M	NM_002249	NP_002240	Q9UGI6	KCNN3_HUMAN	small conductance calcium-activated potassium	694						integral to membrane	calmodulin binding			lung(1)	1	all_lung(78;2.29e-27)|all_hematologic(923;0.088)|Hepatocellular(266;0.108)|all_neural(408;0.245)		BRCA - Breast invasive adenocarcinoma(34;0.00819)															---	---	---	---
THBS3	7059	broad.mit.edu	37	1	155167338	155167338	+	Silent	SNP	G	A	A	rs139408803		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155167338G>A	uc001fix.2	-	20	2438	c.2415C>T	c.(2413-2415)TAC>TAT	p.Y805Y	RAG1AP1_uc010pey.1_Intron|THBS3_uc009wqi.2_Silent_p.Y796Y|THBS3_uc001fiz.2_Silent_p.Y768Y|THBS3_uc001fiy.2_Silent_p.Y334Y|THBS3_uc010pfu.1_Silent_p.Y685Y	NM_007112	NP_009043	P49746	TSP3_HUMAN	thrombospondin 3 precursor	805	TSP C-terminal.				cell-matrix adhesion	extracellular region|perinuclear region of cytoplasm	calcium ion binding|heparin binding|structural molecule activity			breast(3)|ovary(2)	5	all_epithelial(22;5.72e-28)|all_lung(78;2.07e-24)|all_hematologic(923;0.0359)|Hepatocellular(266;0.0877)		Epithelial(20;3.72e-10)|all cancers(21;1.19e-09)|BRCA - Breast invasive adenocarcinoma(34;0.000752)|LUSC - Lung squamous cell carcinoma(543;0.193)															---	---	---	---
CLK2	1196	broad.mit.edu	37	1	155237889	155237889	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155237889T>C	uc001fjy.2	-	6	873	c.583A>G	c.(583-585)ATT>GTT	p.I195V	RAG1AP1_uc010pey.1_Intron|CLK2_uc001fjw.2_Missense_Mutation_p.I194V|CLK2_uc001fjx.2_5'UTR|CLK2_uc009wqm.2_Missense_Mutation_p.I195V	NM_003993	NP_003984	P49760	CLK2_HUMAN	CDC-like kinase 2	195	Protein kinase.					nucleus	ATP binding|protein serine/threonine kinase activity|protein tyrosine kinase activity				0	all_lung(78;2.32e-23)|Hepatocellular(266;0.0877)|all_hematologic(923;0.088)		Epithelial(20;3.72e-10)|all cancers(21;1.19e-09)|BRCA - Breast invasive adenocarcinoma(34;0.000752)|LUSC - Lung squamous cell carcinoma(543;0.193)										Other_conserved_DNA_damage_response_genes					---	---	---	---
PKLR	5313	broad.mit.edu	37	1	155264997	155264997	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155264997C>T	uc001fkb.3	-	5	643	c.604G>A	c.(604-606)GTG>ATG	p.V202M	RAG1AP1_uc010pey.1_Intron|PKLR_uc001fka.3_Missense_Mutation_p.V171M	NM_000298	NP_000289	P30613	KPYR_HUMAN	pyruvate kinase, liver and RBC isoform 1	202					endocrine pancreas development|energy reserve metabolic process|glycolysis|positive regulation of cellular metabolic process	cytosol	ATP binding|magnesium ion binding|potassium ion binding|pyruvate kinase activity			skin(4)|ovary(1)	5	all_lung(78;6.99e-23)|Hepatocellular(266;0.0877)|all_hematologic(923;0.145)		Epithelial(20;3.18e-10)|all cancers(21;7.9e-10)|BRCA - Breast invasive adenocarcinoma(34;0.00116)|LUSC - Lung squamous cell carcinoma(543;0.127)		Pyruvic acid(DB00119)													---	---	---	---
ASH1L	55870	broad.mit.edu	37	1	155449273	155449273	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155449273G>A	uc009wqq.2	-	3	3868	c.3388C>T	c.(3388-3390)CCC>TCC	p.P1130S	ASH1L_uc001fkt.2_Missense_Mutation_p.P1130S|ASH1L_uc009wqr.1_Missense_Mutation_p.P1130S	NM_018489	NP_060959	Q9NR48	ASH1L_HUMAN	absent, small, or homeotic 1-like	1130					cell-cell signaling|DNA packaging|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	chromosome|Golgi apparatus|nucleus|tight junction	DNA binding|histone-lysine N-methyltransferase activity|zinc ion binding			skin(5)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	11	Hepatocellular(266;0.0997)|all_neural(408;0.129)|all_hematologic(923;0.145)		Epithelial(20;1.74e-08)|all cancers(21;3.29e-08)|BRCA - Breast invasive adenocarcinoma(34;0.021)															---	---	---	---
ASH1L	55870	broad.mit.edu	37	1	155451950	155451950	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155451950C>T	uc009wqq.2	-	3	1191	c.711G>A	c.(709-711)CCG>CCA	p.P237P	ASH1L_uc001fkt.2_Silent_p.P237P|ASH1L_uc009wqr.1_Silent_p.P237P	NM_018489	NP_060959	Q9NR48	ASH1L_HUMAN	absent, small, or homeotic 1-like	237					cell-cell signaling|DNA packaging|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	chromosome|Golgi apparatus|nucleus|tight junction	DNA binding|histone-lysine N-methyltransferase activity|zinc ion binding			skin(5)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	11	Hepatocellular(266;0.0997)|all_neural(408;0.129)|all_hematologic(923;0.145)		Epithelial(20;1.74e-08)|all cancers(21;3.29e-08)|BRCA - Breast invasive adenocarcinoma(34;0.021)															---	---	---	---
PAQR6	79957	broad.mit.edu	37	1	156214585	156214585	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156214585C>T	uc001fnu.1	-	7	797	c.727G>A	c.(727-729)GAA>AAA	p.E243K	PAQR6_uc010phf.1_Intron|PAQR6_uc001fny.1_Silent_p.L20L|PAQR6_uc001fnv.1_Missense_Mutation_p.E219K|PAQR6_uc010phg.1_Missense_Mutation_p.E240K|PAQR6_uc001fnx.1_Missense_Mutation_p.E137K|PAQR6_uc001fnw.1_Missense_Mutation_p.E137K|PAQR6_uc001fnz.1_Missense_Mutation_p.E137K|PAQR6_uc010phh.1_Missense_Mutation_p.E243K|PAQR6_uc001foa.1_Missense_Mutation_p.E137K|PAQR6_uc001fob.1_RNA	NM_198406	NP_940798	Q6TCH4	PAQR6_HUMAN	progestin and adipoQ receptor family member VI	243	Extracellular (Potential).					integral to membrane	receptor activity				0	Hepatocellular(266;0.158)																	---	---	---	---
PYHIN1	149628	broad.mit.edu	37	1	158908274	158908274	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158908274C>T	uc001ftb.2	+	3	598	c.353C>T	c.(352-354)GCA>GTA	p.A118V	PYHIN1_uc001fta.3_Missense_Mutation_p.A118V|PYHIN1_uc001ftc.2_Missense_Mutation_p.A109V|PYHIN1_uc001ftd.2_Missense_Mutation_p.A118V|PYHIN1_uc001fte.2_Missense_Mutation_p.A109V	NM_152501	NP_689714	Q6K0P9	IFIX_HUMAN	pyrin and HIN domain family, member 1 alpha 1	118					cell cycle	nuclear speck				ovary(3)|pancreas(1)	4	all_hematologic(112;0.0378)																	---	---	---	---
PYHIN1	149628	broad.mit.edu	37	1	158911818	158911818	+	Nonsense_Mutation	SNP	C	T	T	rs144716673		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158911818C>T	uc001ftb.2	+	5	876	c.631C>T	c.(631-633)CGA>TGA	p.R211*	PYHIN1_uc001ftc.2_Nonsense_Mutation_p.R202*|PYHIN1_uc001ftd.2_Nonsense_Mutation_p.R211*|PYHIN1_uc001fte.2_Nonsense_Mutation_p.R202*	NM_152501	NP_689714	Q6K0P9	IFIX_HUMAN	pyrin and HIN domain family, member 1 alpha 1	211	HIN-200.				cell cycle	nuclear speck				ovary(3)|pancreas(1)	4	all_hematologic(112;0.0378)																	---	---	---	---
FCER1A	2205	broad.mit.edu	37	1	159273976	159273976	+	Intron	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:159273976A>C	uc001ftq.2	+							NM_002001	NP_001992			Fc fragment of IgE, high affinity I, receptor							integral to plasma membrane				lung(2)|skin(2)|prostate(1)	5	all_hematologic(112;0.0429)				Benzylpenicilloyl Polylysine(DB00895)|Omalizumab(DB00043)													---	---	---	---
DCAF8	50717	broad.mit.edu	37	1	160251955	160251955	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160251955G>T	uc010pjc.1	-	3	299	c.27C>A	c.(25-27)GCC>GCA	p.A9A	PEX19_uc010pje.1_RNA|PEX19_uc001fvs.2_Silent_p.A156A|PEX19_uc001fvt.2_Silent_p.A66A	NM_015726	NP_056541	Q5TAQ9	DCAF8_HUMAN	DDB1 and CUL4 associated factor 8	Error:Variant_position_missing_in_Q5TAQ9_after_alignment						CUL4 RING ubiquitin ligase complex	protein binding			skin(2)	2																		---	---	---	---
OLFML2B	25903	broad.mit.edu	37	1	161953686	161953686	+	Missense_Mutation	SNP	C	T	T	rs141909728	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161953686C>T	uc001gbu.2	-	8	2456	c.2032G>A	c.(2032-2034)GTC>ATC	p.V678I	OLFML2B_uc001gbt.2_Missense_Mutation_p.V161I|OLFML2B_uc010pkq.1_Missense_Mutation_p.V679I	NM_015441	NP_056256	Q68BL8	OLM2B_HUMAN	olfactomedin-like 2B precursor	678	Olfactomedin-like.									skin(1)	1	all_hematologic(112;0.156)		BRCA - Breast invasive adenocarcinoma(70;0.0172)															---	---	---	---
ADCY10	55811	broad.mit.edu	37	1	167802290	167802290	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:167802290G>T	uc001ger.2	-	25	3826	c.3528C>A	c.(3526-3528)ATC>ATA	p.I1176I	ADCY10_uc009wvj.2_RNA|ADCY10_uc009wvk.2_Silent_p.I1084I|ADCY10_uc010plj.1_Silent_p.I1023I	NM_018417	NP_060887	Q96PN6	ADCYA_HUMAN	adenylate cyclase 10	1176					intracellular signal transduction|spermatogenesis	cytoskeleton|cytosol|perinuclear region of cytoplasm|plasma membrane|soluble fraction	adenylate cyclase activity|ATP binding|magnesium ion binding			central_nervous_system(2)|ovary(1)	3																		---	---	---	---
RC3H1	149041	broad.mit.edu	37	1	173951935	173951935	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173951935C>T	uc001gju.3	-	4	785	c.698G>A	c.(697-699)CGG>CAG	p.R233Q	RC3H1_uc010pms.1_Missense_Mutation_p.R233Q|RC3H1_uc001gjv.2_Missense_Mutation_p.R233Q|RC3H1_uc010pmt.1_Missense_Mutation_p.R233Q	NM_172071	NP_742068	Q5TC82	RC3H1_HUMAN	roquin	233					cytoplasmic mRNA processing body assembly|negative regulation of activated T cell proliferation|negative regulation of B cell proliferation|negative regulation of germinal center formation|negative regulation of T-helper cell differentiation|nuclear-transcribed mRNA catabolic process|regulation of mRNA stability|regulation of T cell receptor signaling pathway	cytoplasmic mRNA processing body|stress granule	mRNA 3'-UTR binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
RABGAP1L	9910	broad.mit.edu	37	1	174780992	174780992	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:174780992A>G	uc001gjx.2	+	19	2429	c.2234A>G	c.(2233-2235)CAG>CGG	p.Q745R	RABGAP1L_uc001gkb.3_5'UTR|RABGAP1L_uc001gkc.3_Missense_Mutation_p.Q52R|RABGAP1L_uc001gkd.3_Missense_Mutation_p.Q71R|RABGAP1L_uc001gke.3_Missense_Mutation_p.Q64R	NM_014857	NP_055672	Q5R372	RBG1L_HUMAN	RAB GTPase activating protein 1-like isoform A	745					regulation of protein localization	early endosome|Golgi apparatus|nucleus	Rab GTPase activator activity			ovary(2)|lung(1)|kidney(1)	4																		---	---	---	---
ASTN1	460	broad.mit.edu	37	1	176918359	176918359	+	Silent	SNP	C	T	T	rs34739197		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:176918359C>T	uc001glc.2	-	12	2228	c.2016G>A	c.(2014-2016)CCG>CCA	p.P672P	ASTN1_uc001glb.1_Silent_p.P672P|ASTN1_uc001gld.1_Silent_p.P672P|ASTN1_uc009wwx.1_Silent_p.P672P	NM_004319	NP_004310	O14525	ASTN1_HUMAN	astrotactin isoform 1	680	EGF-like 3.				cell migration|neuron cell-cell adhesion	integral to membrane				ovary(6)|skin(5)|central_nervous_system(2)|large_intestine(1)|lung(1)	15																OREG0014004	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
KIAA1614	57710	broad.mit.edu	37	1	180886022	180886022	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:180886022C>T	uc001gok.2	+	2	850	c.783C>T	c.(781-783)TCC>TCT	p.S261S		NM_020950	NP_066001	Q5VZ46	K1614_HUMAN	hypothetical protein LOC57710	261										ovary(3)|skin(1)	4																		---	---	---	---
GLT25D2	23127	broad.mit.edu	37	1	183908027	183908027	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183908027C>A	uc001gqr.2	-	12	2121	c.1749G>T	c.(1747-1749)GTG>GTT	p.V583V	GLT25D2_uc010poj.1_Intron|GLT25D2_uc001gqp.2_Silent_p.V191V|GLT25D2_uc001gqq.2_Silent_p.V320V|GLT25D2_uc001gqs.2_Silent_p.V463V	NM_015101	NP_055916	Q8IYK4	GT252_HUMAN	glycosyltransferase 25 domain containing 2	583					lipopolysaccharide biosynthetic process	endoplasmic reticulum lumen	procollagen galactosyltransferase activity			ovary(1)|breast(1)	2																		---	---	---	---
C1orf25	81627	broad.mit.edu	37	1	185106864	185106864	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:185106864A>T	uc001grf.3	-	10	1659	c.1387T>A	c.(1387-1389)TTG>ATG	p.L463M	C1orf25_uc010pon.1_Missense_Mutation_p.L307M	NM_030934	NP_112196	Q7Z2T5	TRM1L_HUMAN	N2,N2-dimethylguanosine tRNA	463						intracellular	RNA binding|tRNA (guanine-N2-)-methyltransferase activity|zinc ion binding				0																		---	---	---	---
CDC73	79577	broad.mit.edu	37	1	193107230	193107230	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:193107230C>T	uc001gtb.2	+	6	682	c.439C>T	c.(439-441)CGC>TGC	p.R147C		NM_024529	NP_078805	Q6P1J9	CDC73_HUMAN	parafibromin	147					cell cycle|histone H2B ubiquitination|histone monoubiquitination|transcription, DNA-dependent	Cdc73/Paf1 complex	protein binding	p.R147C(1)		parathyroid(46)|ovary(1)|breast(1)|pancreas(1)	49														Hyperparathyroidism_Familial_Isolated|Hyperparathyroidism-Jaw_Tumor_Syndrome				---	---	---	---
CFH	3075	broad.mit.edu	37	1	196648770	196648770	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:196648770C>T	uc001gtj.3	+	6	877	c.637C>T	c.(637-639)CCA>TCA	p.P213S	CFH_uc001gti.3_Missense_Mutation_p.P213S|CFH_uc009wyw.2_Missense_Mutation_p.P213S|CFH_uc009wyx.2_Missense_Mutation_p.P149S	NM_000186	NP_000177	P08603	CFAH_HUMAN	complement factor H isoform a precursor	213	Sushi 4.				complement activation, alternative pathway	extracellular space				skin(4)|ovary(1)|breast(1)	6																		---	---	---	---
F13B	2165	broad.mit.edu	37	1	197026313	197026313	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:197026313A>G	uc001gtt.1	-	7	1045	c.1001T>C	c.(1000-1002)GTA>GCA	p.V334A		NM_001994	NP_001985	P05160	F13B_HUMAN	coagulation factor XIII B subunit precursor	334	Sushi 6.				blood coagulation	extracellular region				upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
KIF14	9928	broad.mit.edu	37	1	200522567	200522567	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200522567G>A	uc010ppk.1	-	30	5335	c.4896C>T	c.(4894-4896)TCC>TCT	p.S1632S	KIF14_uc010ppj.1_Silent_p.S1141S	NM_014875	NP_055690	Q15058	KIF14_HUMAN	kinesin family member 14	1632	Required for CIT-binding.				microtubule-based movement	cytoplasm|microtubule|nucleus|spindle	ATP binding|microtubule motor activity|protein binding			breast(3)|ovary(2)|skin(2)	7																		---	---	---	---
LGR6	59352	broad.mit.edu	37	1	202163322	202163322	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202163322G>A	uc001gxu.2	+	1	205	c.205G>A	c.(205-207)GCT>ACT	p.A69T		NM_001017403	NP_001017403	Q9HBX8	LGR6_HUMAN	leucine-rich repeat-containing G protein-coupled	69	Extracellular (Potential).					integral to membrane|plasma membrane	protein-hormone receptor activity	p.299_300insGRS(1)		large_intestine(4)|ovary(3)|skin(2)|pancreas(1)	10																		---	---	---	---
PPP1R12B	4660	broad.mit.edu	37	1	202318225	202318225	+	Silent	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202318225T>G	uc001gya.1	+	1	390	c.246T>G	c.(244-246)GCT>GCG	p.A82A	PPP1R12B_uc001gxy.2_Silent_p.A82A|PPP1R12B_uc009xad.1_5'UTR|PPP1R12B_uc009xae.1_Silent_p.A82A|PPP1R12B_uc001gxz.1_Silent_p.A82A	NM_002481	NP_002472	O60237	MYPT2_HUMAN	protein phosphatase 1, regulatory (inhibitor)	82	ANK 1.				regulation of muscle contraction|signal transduction	cytoplasm	enzyme activator activity			ovary(3)	3			BRCA - Breast invasive adenocarcinoma(75;0.166)															---	---	---	---
OPTC	26254	broad.mit.edu	37	1	203465253	203465253	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:203465253C>A	uc001gzu.1	+	2	236	c.120C>A	c.(118-120)TCC>TCA	p.S40S		NM_014359	NP_055174	Q9UBM4	OPT_HUMAN	opticin precursor	40						proteinaceous extracellular matrix	extracellular matrix structural constituent|protein binding				0			BRCA - Breast invasive adenocarcinoma(75;0.109)															---	---	---	---
TMCC2	9911	broad.mit.edu	37	1	205238752	205238752	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205238752C>T	uc001hbz.1	+	4	1866	c.1422C>T	c.(1420-1422)GGC>GGT	p.G474G	TMCC2_uc010prf.1_Silent_p.G396G|TMCC2_uc001hca.2_Silent_p.G249G|TMCC2_uc001hcb.1_Silent_p.G234G|TMCC2_uc001hcc.1_Silent_p.G95G|TMCC2_uc001hcd.2_Silent_p.G241G	NM_014858	NP_055673	O75069	TMCC2_HUMAN	transmembrane and coiled-coil domain family 2	474						integral to membrane	protein binding			pancreas(1)	1	Breast(84;0.0871)		BRCA - Breast invasive adenocarcinoma(75;0.117)															---	---	---	---
KLHDC8A	55220	broad.mit.edu	37	1	205312590	205312590	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205312590C>T	uc001hcf.1	-	2	711	c.143G>A	c.(142-144)TGC>TAC	p.C48Y	KLHDC8A_uc010prg.1_Intron|KLHDC8A_uc001hcg.1_Missense_Mutation_p.C48Y	NM_018203	NP_060673	Q8IYD2	KLD8A_HUMAN	kelch domain containing 8A	48	Kelch 2.									ovary(1)	1	Breast(84;0.23)		BRCA - Breast invasive adenocarcinoma(75;0.117)															---	---	---	---
SLC26A9	115019	broad.mit.edu	37	1	205898413	205898413	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205898413A>G	uc001hdq.2	-	7	903	c.789T>C	c.(787-789)GGT>GGC	p.G263G	SLC26A9_uc001hdo.2_5'Flank|SLC26A9_uc001hdp.2_Silent_p.G263G	NM_052934	NP_443166	Q7LBE3	S26A9_HUMAN	solute carrier family 26, member 9 isoform a	263	Helical; (Potential).					integral to membrane	chloride channel activity|secondary active sulfate transmembrane transporter activity			ovary(1)|skin(1)	2	Breast(84;0.201)		BRCA - Breast invasive adenocarcinoma(75;0.0458)															---	---	---	---
CTSE	1510	broad.mit.edu	37	1	206328752	206328752	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206328752C>T	uc001hdu.2	+	7	937	c.819C>T	c.(817-819)TCC>TCT	p.S273S	CTSE_uc001hdv.2_Intron|CTSE_uc010prs.1_Intron	NM_001910	NP_001901	P14091	CATE_HUMAN	cathepsin E isoform a preproprotein	278					antigen processing and presentation of exogenous peptide antigen via MHC class II|digestion|proteolysis	endosome	aspartic-type endopeptidase activity			ovary(1)	1			BRCA - Breast invasive adenocarcinoma(75;0.0754)															---	---	---	---
CR1L	1379	broad.mit.edu	37	1	207881608	207881608	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207881608C>T	uc001hga.3	+	10	1535	c.1414C>T	c.(1414-1416)CAA>TAA	p.Q472*	CR1L_uc001hfz.2_Intron|CR1L_uc001hgb.1_Intron	NM_175710	NP_783641	Q2VPA4	CR1L_HUMAN	complement component (3b/4b) receptor 1-like	472	Sushi 7.					cytoplasm|extracellular region|membrane					0																		---	---	---	---
SLC30A1	7779	broad.mit.edu	37	1	211751694	211751694	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:211751694G>A	uc001hio.1	-	1	406	c.261C>T	c.(259-261)ATC>ATT	p.I87I		NM_021194	NP_067017	Q9Y6M5	ZNT1_HUMAN	solute carrier family 30 (zinc transporter),	87	Helical; (Potential).				cadmium ion transmembrane transport|cellular calcium ion homeostasis|cellular zinc ion homeostasis|negative regulation of calcium ion import|negative regulation of neurotransmitter secretion|negative regulation of zinc ion import	integral to membrane|T-tubule	calcium channel inhibitor activity|zinc ion transmembrane transporter activity			ovary(3)|central_nervous_system(1)	4				OV - Ovarian serous cystadenocarcinoma(81;0.00535)|GBM - Glioblastoma multiforme(131;0.051)|all cancers(67;0.0604)|Epithelial(68;0.0978)														---	---	---	---
CENPF	1063	broad.mit.edu	37	1	214814768	214814768	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:214814768T>C	uc001hkm.2	+	12	3261	c.3087T>C	c.(3085-3087)TGT>TGC	p.C1029C		NM_016343	NP_057427	P49454	CENPF_HUMAN	centromere protein F	1029	Potential.				cell differentiation|cell division|cell proliferation|DNA replication|G2 phase of mitotic cell cycle|kinetochore assembly|metaphase plate congression|mitotic cell cycle spindle assembly checkpoint|mitotic prometaphase|muscle organ development|negative regulation of transcription, DNA-dependent|protein transport|regulation of G2/M transition of mitotic cell cycle|regulation of striated muscle tissue development|response to drug	condensed chromosome outer kinetochore|cytosol|midbody|nuclear envelope|nuclear matrix|perinuclear region of cytoplasm|spindle pole	chromatin binding|dynein binding|protein C-terminus binding|protein homodimerization activity|transcription factor binding			ovary(6)|central_nervous_system(4)|large_intestine(2)|skin(1)	13				all cancers(67;0.00836)|OV - Ovarian serous cystadenocarcinoma(81;0.00855)|GBM - Glioblastoma multiforme(131;0.0694)|Epithelial(68;0.0833)														---	---	---	---
DISP1	84976	broad.mit.edu	37	1	223156446	223156446	+	Silent	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223156446A>C	uc001hnu.1	+	3	681	c.534A>C	c.(532-534)CCA>CCC	p.P178P		NM_032890	NP_116279	Q96F81	DISP1_HUMAN	dispatched A	178					diaphragm development|protein homotrimerization|regulation of protein secretion|smoothened signaling pathway	basolateral plasma membrane|integral to membrane	hedgehog receptor activity|peptide transporter activity				0				GBM - Glioblastoma multiforme(131;0.102)														---	---	---	---
DISP1	84976	broad.mit.edu	37	1	223176379	223176379	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223176379G>A	uc001hnu.1	+	8	1787	c.1640G>A	c.(1639-1641)CGT>CAT	p.R547H		NM_032890	NP_116279	Q96F81	DISP1_HUMAN	dispatched A	547	SSD.				diaphragm development|protein homotrimerization|regulation of protein secretion|smoothened signaling pathway	basolateral plasma membrane|integral to membrane	hedgehog receptor activity|peptide transporter activity				0				GBM - Glioblastoma multiforme(131;0.102)														---	---	---	---
PSEN2	5664	broad.mit.edu	37	1	227075861	227075861	+	Splice_Site	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:227075861T>C	uc009xeo.1	+	7	993	c.566_splice	c.e7+2	p.G189_splice	PSEN2_uc009xep.1_Splice_Site_p.G189_splice|PSEN2_uc001hqk.2_Splice_Site	NM_000447	NP_000438			presenilin 2 isoform 1						amyloid precursor protein catabolic process|anti-apoptosis|apoptosis|beta-amyloid metabolic process|calcium ion transport|induction of apoptosis by extracellular signals|intracellular signal transduction|membrane protein ectodomain proteolysis|membrane protein intracellular domain proteolysis|nerve growth factor receptor signaling pathway|Notch receptor processing|Notch signaling pathway|positive regulation of catalytic activity	apical plasma membrane|axon|cell cortex|cell surface|centrosome|ciliary rootlet|dendritic shaft|endoplasmic reticulum membrane|Golgi membrane|growth cone|integral to plasma membrane|kinetochore|lysosomal membrane|membrane raft|mitochondrial inner membrane|neuromuscular junction|neuronal cell body|nuclear inner membrane|perinuclear region of cytoplasm|Z disc	aspartic-type endopeptidase activity|protein binding			lung(2)	2		Prostate(94;0.0771)																---	---	---	---
OBSCN	84033	broad.mit.edu	37	1	228476440	228476440	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228476440G>A	uc009xez.1	+	38	10234	c.10190G>A	c.(10189-10191)CGT>CAT	p.R3397H	OBSCN_uc001hsn.2_Missense_Mutation_p.R3397H|OBSCN_uc001hsq.1_Missense_Mutation_p.R653H	NM_001098623	NP_001092093	Q5VST9	OBSCN_HUMAN	obscurin, cytoskeletal calmodulin and	3397	Ig-like 34.				apoptosis|cell differentiation|induction of apoptosis by extracellular signals|multicellular organismal development|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|M band|Z disc	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity|Rho guanyl-nucleotide exchange factor activity|structural constituent of muscle|titin binding			stomach(8)|large_intestine(7)|breast(5)|ovary(4)|skin(2)|central_nervous_system(1)|pancreas(1)	28		Prostate(94;0.0405)																---	---	---	---
OBSCN	84033	broad.mit.edu	37	1	228496852	228496852	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228496852C>T	uc009xez.1	+	48	12836	c.12792C>T	c.(12790-12792)GGC>GGT	p.G4264G	OBSCN_uc001hsn.2_Silent_p.G4264G	NM_001098623	NP_001092093	Q5VST9	OBSCN_HUMAN	obscurin, cytoskeletal calmodulin and	4264	Ig-like 44.				apoptosis|cell differentiation|induction of apoptosis by extracellular signals|multicellular organismal development|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|M band|Z disc	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity|Rho guanyl-nucleotide exchange factor activity|structural constituent of muscle|titin binding			stomach(8)|large_intestine(7)|breast(5)|ovary(4)|skin(2)|central_nervous_system(1)|pancreas(1)	28		Prostate(94;0.0405)																---	---	---	---
OBSCN	84033	broad.mit.edu	37	1	228528416	228528416	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228528416C>T	uc009xez.1	+						OBSCN_uc001hsn.2_Intron|OBSCN_uc001hsr.1_Intron	NM_001098623	NP_001092093			obscurin, cytoskeletal calmodulin and						apoptosis|cell differentiation|induction of apoptosis by extracellular signals|multicellular organismal development|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|M band|Z disc	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity|Rho guanyl-nucleotide exchange factor activity|structural constituent of muscle|titin binding			stomach(8)|large_intestine(7)|breast(5)|ovary(4)|skin(2)|central_nervous_system(1)|pancreas(1)	28		Prostate(94;0.0405)																---	---	---	---
DISC1	27185	broad.mit.edu	37	1	231830287	231830287	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:231830287T>C	uc001huz.2	+	2	836	c.783T>C	c.(781-783)TGT>TGC	p.C261C	TSNAX-DISC1_uc010pwe.1_Silent_p.C216C|TSNAX-DISC1_uc010pwf.1_Silent_p.C216C|TSNAX-DISC1_uc010pwg.1_Silent_p.C250C|TSNAX-DISC1_uc010pwh.1_Silent_p.C216C|TSNAX-DISC1_uc010pwi.1_Silent_p.C216C|TSNAX-DISC1_uc010pwj.1_Silent_p.C250C|TSNAX-DISC1_uc010pwk.1_Silent_p.C250C|TSNAX-DISC1_uc010pwl.1_RNA|DISC1_uc010pwo.1_Silent_p.C261C|DISC1_uc010pwp.1_Silent_p.C261C|DISC1_uc010pwq.1_Silent_p.C261C|DISC1_uc010pwr.1_Silent_p.C261C|DISC1_uc010pws.1_Silent_p.C261C|DISC1_uc010pwt.1_Silent_p.C261C|DISC1_uc010pwu.1_Intron|DISC1_uc010pwv.1_RNA|DISC1_uc010pww.1_Silent_p.C261C|DISC1_uc010pwx.1_RNA|DISC1_uc010pwy.1_RNA|DISC1_uc010pwz.1_RNA|DISC1_uc010pxa.1_RNA|DISC1_uc001huy.2_Silent_p.C261C|DISC1_uc010pxb.1_Silent_p.C261C|DISC1_uc010pxc.1_Silent_p.C261C|DISC1_uc010pxd.1_5'UTR|DISC1_uc010pxe.1_Silent_p.C261C|DISC1_uc009xfr.2_Silent_p.C216C|DISC1_uc010pxf.1_Silent_p.C261C|DISC1_uc010pxg.1_Silent_p.C261C|DISC1_uc010pxh.1_Silent_p.C261C|DISC1_uc010pxi.1_RNA|DISC1_uc010pxj.1_5'UTR|DISC1_uc010pxk.1_RNA|DISC1_uc010pxl.1_RNA|DISC1_uc010pxm.1_Silent_p.C261C|DISC1_uc010pxn.1_5'UTR|DISC1_uc001hva.2_Silent_p.C261C|DISC1_uc010pwm.1_Silent_p.C261C|DISC1_uc001hux.1_Silent_p.C261C|DISC1_uc001hvc.3_Silent_p.C261C|DISC1_uc010pwn.1_Silent_p.C261C	NM_018662	NP_061132	Q9NRI5	DISC1_HUMAN	disrupted in schizophrenia 1 isoform L	261	Interaction with MAP1A.				microtubule cytoskeleton organization|neuron migration|positive regulation of neuroblast proliferation|positive regulation of Wnt receptor signaling pathway|Wnt receptor signaling pathway	centrosome|microtubule	protein binding			skin(1)	1		all_cancers(173;0.0208)|Prostate(94;0.0975)																---	---	---	---
KIAA1383	54627	broad.mit.edu	37	1	232941415	232941415	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:232941415G>A	uc001hvh.2	+	1	778	c.646G>A	c.(646-648)GGC>AGC	p.G216S		NM_019090	NP_061963	Q9P2G4	K1383_HUMAN	hypothetical protein LOC54627	74										ovary(1)	1		all_cancers(173;0.00528)|Prostate(94;0.122)|all_epithelial(177;0.169)																---	---	---	---
KIAA1804	84451	broad.mit.edu	37	1	233497844	233497844	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:233497844C>T	uc001hvt.3	+	5	1618	c.1357C>T	c.(1357-1359)CAG>TAG	p.Q453*	KIAA1804_uc001hvs.1_Nonsense_Mutation_p.Q453*	NM_032435	NP_115811	Q5TCX8	M3KL4_HUMAN	mixed lineage kinase 4	453					activation of JUN kinase activity|protein autophosphorylation		ATP binding|MAP kinase kinase kinase activity|protein homodimerization activity			lung(5)|central_nervous_system(2)|skin(1)	8		all_cancers(173;0.000405)|all_epithelial(177;0.0345)|Prostate(94;0.122)																---	---	---	---
RYR2	6262	broad.mit.edu	37	1	237872219	237872219	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237872219G>A	uc001hyl.1	+	69	10083	c.9963G>A	c.(9961-9963)CCG>CCA	p.P3321P	RYR2_uc010pxz.1_Silent_p.P276P	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	3321					cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---
RYR2	6262	broad.mit.edu	37	1	237947592	237947592	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237947592G>A	uc001hyl.1	+	90	12700	c.12580G>A	c.(12580-12582)GAG>AAG	p.E4194K	RYR2_uc010pya.1_Missense_Mutation_p.E609K	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	4194					cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---
FMN2	56776	broad.mit.edu	37	1	240370335	240370335	+	Silent	SNP	G	A	A	rs144753167		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:240370335G>A	uc010pyd.1	+	5	2448	c.2223G>A	c.(2221-2223)GCG>GCA	p.A741A	FMN2_uc010pye.1_Silent_p.A745A	NM_020066	NP_064450	Q9NZ56	FMN2_HUMAN	formin 2	741					actin cytoskeleton organization|establishment of meiotic spindle localization|intracellular signal transduction|meiotic chromosome movement towards spindle pole|meiotic metaphase I|multicellular organismal development|oogenesis|polar body extrusion after meiotic divisions		actin binding			ovary(4)|pancreas(3)|skin(3)|large_intestine(1)|central_nervous_system(1)	12	Ovarian(103;0.127)	all_cancers(173;0.013)	OV - Ovarian serous cystadenocarcinoma(106;0.0106)															---	---	---	---
CNST	163882	broad.mit.edu	37	1	246797236	246797236	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:246797236A>G	uc001ibp.2	+	5	1005	c.627A>G	c.(625-627)GCA>GCG	p.A209A	CNST_uc001ibo.3_Silent_p.A209A	NM_152609	NP_689822	Q6PJW8	CNST_HUMAN	hypothetical protein LOC163882 isoform 1	209					positive regulation of Golgi to plasma membrane protein transport	integral to membrane|plasma membrane|protein complex|trans-Golgi network|transport vesicle	connexin binding				0																		---	---	---	---
ZNF496	84838	broad.mit.edu	37	1	247464565	247464565	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247464565C>T	uc001ico.2	-	9	1485	c.1020G>A	c.(1018-1020)CCG>CCA	p.P340P	ZNF496_uc009xgv.2_Silent_p.P376P|ZNF496_uc001icp.2_Silent_p.P340P	NM_032752	NP_116141	Q96IT1	ZN496_HUMAN	zinc finger protein 496	340					positive regulation of transcription, DNA-dependent|viral reproduction		DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2	all_cancers(71;0.000136)|all_epithelial(71;2.62e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0607)|Lung NSC(105;0.0661)		OV - Ovarian serous cystadenocarcinoma(106;0.00703)															---	---	---	---
OR11L1	391189	broad.mit.edu	37	1	248005039	248005039	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248005039G>A	uc001idn.1	-	1	160	c.160C>T	c.(160-162)CGA>TGA	p.R54*		NM_001001959	NP_001001959	Q8NGX0	O11L1_HUMAN	olfactory receptor, family 11, subfamily L,	54	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3	all_cancers(71;8.78e-05)|all_epithelial(71;9.15e-06)|Breast(184;0.0117)|Ovarian(71;0.0377)|all_lung(81;0.0786)|Lung NSC(105;0.0858)		OV - Ovarian serous cystadenocarcinoma(106;0.0319)															---	---	---	---
OR2L8	391190	broad.mit.edu	37	1	248112877	248112877	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248112877T>C	uc001idt.1	+	1	718	c.718T>C	c.(718-720)TGC>CGC	p.C240R	OR2L13_uc001ids.2_Intron	NM_001001963	NP_001001963	Q8NGY9	OR2L8_HUMAN	olfactory receptor, family 2, subfamily L,	240	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2	all_cancers(71;0.000139)|all_epithelial(71;1.58e-05)|Breast(184;0.0117)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0152)															---	---	---	---
OR2T2	401992	broad.mit.edu	37	1	248616240	248616240	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248616240C>G	uc001iek.1	+	1	142	c.142C>G	c.(142-144)CTG>GTG	p.L48V		NM_001004136	NP_001004136	Q6IF00	OR2T2_HUMAN	olfactory receptor, family 2, subfamily T,	48	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)															---	---	---	---
SNTG2	54221	broad.mit.edu	37	2	1263213	1263213	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1263213G>A	uc002qwq.2	+	13	1205	c.1077G>A	c.(1075-1077)AAG>AAA	p.K359K	SNTG2_uc010ewi.2_Silent_p.K232K	NM_018968	NP_061841	Q9NY99	SNTG2_HUMAN	syntrophin, gamma 2	359	PH.				central nervous system development	cytoplasm|cytoskeleton|sarcolemma|syntrophin complex	actin binding|PDZ domain binding			ovary(1)|large_intestine(1)|breast(1)	3	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.00469)		all cancers(51;0.0178)|OV - Ovarian serous cystadenocarcinoma(76;0.07)|Epithelial(75;0.0864)|GBM - Glioblastoma multiforme(21;0.173)														---	---	---	---
GREB1	9687	broad.mit.edu	37	2	11752742	11752742	+	Intron	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:11752742T>C	uc002rbk.1	+						GREB1_uc002rbp.1_Intron	NM_014668	NP_055483			growth regulation by estrogen in breast cancer 1							integral to membrane				ovary(1)	1	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.115)|OV - Ovarian serous cystadenocarcinoma(76;0.186)														---	---	---	---
LPIN1	23175	broad.mit.edu	37	2	11964797	11964797	+	Silent	SNP	G	A	A	rs114931326	byFrequency;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:11964797G>A	uc010yjn.1	+	21	2827	c.2553G>A	c.(2551-2553)CCG>CCA	p.P851P	LPIN1_uc010yjm.1_Silent_p.P936P|LPIN1_uc002rbt.2_Silent_p.P851P|LPIN1_uc010yjo.1_Silent_p.P352P	NM_145693	NP_663731	Q14693	LPIN1_HUMAN	lipin 1	851					fatty acid catabolic process|transcription, DNA-dependent|triglyceride biosynthetic process|triglyceride mobilization	cytosol|endoplasmic reticulum membrane	phosphatidate phosphatase activity			ovary(2)|large_intestine(1)|skin(1)	4	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.11)|OV - Ovarian serous cystadenocarcinoma(76;0.173)														---	---	---	---
NBAS	51594	broad.mit.edu	37	2	15613424	15613424	+	Silent	SNP	G	A	A	rs138310172		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:15613424G>A	uc002rcc.1	-	16	1673	c.1647C>T	c.(1645-1647)TAC>TAT	p.Y549Y	NBAS_uc002rcd.1_RNA	NM_015909	NP_056993	A2RRP1	NBAS_HUMAN	neuroblastoma-amplified protein	549										ovary(2)|liver(1)|skin(1)	4																		---	---	---	---
HS1BP3	64342	broad.mit.edu	37	2	20845204	20845204	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:20845204C>A	uc002rdw.1	-	2	135	c.94G>T	c.(94-96)GGC>TGC	p.G32C	HS1BP3_uc002rdx.2_Missense_Mutation_p.G32C|HS1BP3_uc002rdy.2_Missense_Mutation_p.G32C	NM_022460	NP_071905	Q53T59	H1BP3_HUMAN	HCLS1 binding protein 3	32	PX.				cell communication		phosphatidylinositol binding			ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---
APOB	338	broad.mit.edu	37	2	21228330	21228330	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:21228330C>T	uc002red.2	-	26	11538	c.11410G>A	c.(11410-11412)GAA>AAA	p.E3804K		NM_000384	NP_000375	P04114	APOB_HUMAN	apolipoprotein B precursor	3804					cholesterol homeostasis|cholesterol metabolic process|leukocyte migration|low-density lipoprotein particle clearance|low-density lipoprotein particle remodeling|platelet activation|positive regulation of cholesterol storage|positive regulation of macrophage derived foam cell differentiation|receptor-mediated endocytosis|response to virus	chylomicron remnant|clathrin-coated endocytic vesicle membrane|endoplasmic reticulum lumen|endoplasmic reticulum membrane|endosome lumen|endosome membrane|intermediate-density lipoprotein particle|low-density lipoprotein particle|mature chylomicron|microsome|plasma membrane|very-low-density lipoprotein particle	cholesterol transporter activity|enzyme binding|heparin binding|low-density lipoprotein particle receptor binding|phospholipid binding|protein heterodimerization activity			ovary(11)|skin(9)|central_nervous_system(3)|large_intestine(2)|upper_aerodigestive_tract(1)|pancreas(1)	27	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				Atorvastatin(DB01076)													---	---	---	---
APOB	338	broad.mit.edu	37	2	21228376	21228376	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:21228376C>T	uc002red.2	-	26	11492	c.11364G>A	c.(11362-11364)GAG>GAA	p.E3788E		NM_000384	NP_000375	P04114	APOB_HUMAN	apolipoprotein B precursor	3788					cholesterol homeostasis|cholesterol metabolic process|leukocyte migration|low-density lipoprotein particle clearance|low-density lipoprotein particle remodeling|platelet activation|positive regulation of cholesterol storage|positive regulation of macrophage derived foam cell differentiation|receptor-mediated endocytosis|response to virus	chylomicron remnant|clathrin-coated endocytic vesicle membrane|endoplasmic reticulum lumen|endoplasmic reticulum membrane|endosome lumen|endosome membrane|intermediate-density lipoprotein particle|low-density lipoprotein particle|mature chylomicron|microsome|plasma membrane|very-low-density lipoprotein particle	cholesterol transporter activity|enzyme binding|heparin binding|low-density lipoprotein particle receptor binding|phospholipid binding|protein heterodimerization activity			ovary(11)|skin(9)|central_nervous_system(3)|large_intestine(2)|upper_aerodigestive_tract(1)|pancreas(1)	27	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				Atorvastatin(DB01076)													---	---	---	---
APOB	338	broad.mit.edu	37	2	21265342	21265342	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:21265342G>A	uc002red.2	-	3	256	c.128C>T	c.(127-129)GCG>GTG	p.A43V		NM_000384	NP_000375	P04114	APOB_HUMAN	apolipoprotein B precursor	43	Heparin-binding.				cholesterol homeostasis|cholesterol metabolic process|leukocyte migration|low-density lipoprotein particle clearance|low-density lipoprotein particle remodeling|platelet activation|positive regulation of cholesterol storage|positive regulation of macrophage derived foam cell differentiation|receptor-mediated endocytosis|response to virus	chylomicron remnant|clathrin-coated endocytic vesicle membrane|endoplasmic reticulum lumen|endoplasmic reticulum membrane|endosome lumen|endosome membrane|intermediate-density lipoprotein particle|low-density lipoprotein particle|mature chylomicron|microsome|plasma membrane|very-low-density lipoprotein particle	cholesterol transporter activity|enzyme binding|heparin binding|low-density lipoprotein particle receptor binding|phospholipid binding|protein heterodimerization activity			ovary(11)|skin(9)|central_nervous_system(3)|large_intestine(2)|upper_aerodigestive_tract(1)|pancreas(1)	27	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				Atorvastatin(DB01076)											OREG0014485	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
C2orf79	391356	broad.mit.edu	37	2	25013338	25013338	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:25013338C>T	uc002rfm.2	-	2	370	c.365G>A	c.(364-366)CGG>CAG	p.R122Q	CENPO_uc002rfn.2_5'Flank|CENPO_uc002rfo.1_5'Flank|CENPO_uc002rfp.1_5'Flank|CENPO_uc002rfq.1_5'Flank	NM_001013663	NP_001013685	Q6GMV3	PTRD1_HUMAN	hypothetical protein LOC391356	122					translation		aminoacyl-tRNA hydrolase activity|protein tyrosine phosphatase activity				0																		---	---	---	---
DNMT3A	1788	broad.mit.edu	37	2	25464521	25464521	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:25464521C>A	uc002rgc.2	-	17	2249	c.1992G>T	c.(1990-1992)GAG>GAT	p.E664D	DNMT3A_uc002rgd.2_Missense_Mutation_p.E664D|DNMT3A_uc010eyi.2_RNA|DNMT3A_uc002rgb.2_Missense_Mutation_p.E475D	NM_022552	NP_072046	Q9Y6K1	DNM3A_HUMAN	DNA cytosine methyltransferase 3 alpha isoform	664					regulation of gene expression by genetic imprinting	cytoplasm|euchromatin|nuclear matrix	DNA (cytosine-5-)-methyltransferase activity|DNA binding|metal ion binding|protein binding			haematopoietic_and_lymphoid_tissue(133)|lung(4)|ovary(3)	140	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)							Mis|F|N|S		AML								---	---	---	---
EMILIN1	11117	broad.mit.edu	37	2	27305168	27305168	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27305168G>A	uc002rii.3	+	4	1157	c.729G>A	c.(727-729)CAG>CAA	p.Q243Q	EMILIN1_uc010eyq.1_Silent_p.Q243Q|EMILIN1_uc002rik.3_5'Flank	NM_007046	NP_008977	Q9Y6C2	EMIL1_HUMAN	elastin microfibril interfacer 1 precursor	243	Potential.				cell adhesion	collagen				pancreas(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---
CAD	790	broad.mit.edu	37	2	27456970	27456970	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27456970C>T	uc002rji.2	+	22	3656	c.3494C>T	c.(3493-3495)GCG>GTG	p.A1165V	CAD_uc010eyw.2_Missense_Mutation_p.A1102V	NM_004341	NP_004332	P27708	PYR1_HUMAN	carbamoylphosphate synthetase 2/aspartate	1165	CPSase B.|ATP-grasp 2.|CPSase (Carbamoyl-phosphate synthase).				'de novo' pyrimidine base biosynthetic process|drug metabolic process|glutamine metabolic process|peptidyl-threonine phosphorylation|protein autophosphorylation|pyrimidine nucleoside biosynthetic process|pyrimidine nucleotide biosynthetic process	cytosol|neuronal cell body|nuclear matrix|terminal button	aspartate binding|aspartate carbamoyltransferase activity|ATP binding|carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity|dihydroorotase activity|enzyme binding|identical protein binding|metal ion binding|protein kinase activity			ovary(4)|large_intestine(2)|kidney(2)|lung(1)|pancreas(1)	10	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				L-Aspartic Acid(DB00128)|L-Glutamine(DB00130)													---	---	---	---
EIF2B4	8890	broad.mit.edu	37	2	27587741	27587741	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27587741G>A	uc002rkb.2	-	12	1359	c.1216C>T	c.(1216-1218)CAT>TAT	p.H406Y	EIF2B4_uc002rjz.2_Missense_Mutation_p.H426Y|EIF2B4_uc002rka.2_Missense_Mutation_p.H391Y|EIF2B4_uc002rkc.2_Missense_Mutation_p.H405Y|EIF2B4_uc002rkd.2_Missense_Mutation_p.H200Y|EIF2B4_uc002rke.2_Missense_Mutation_p.H375Y	NM_001034116	NP_001029288	Q9UI10	EI2BD_HUMAN	eukaryotic translation initiation factor 2B,	406					myelination|negative regulation of translational initiation in response to stress|oligodendrocyte development|ovarian follicle development|response to glucose stimulus|response to heat|response to peptide hormone stimulus	cytosol|eukaryotic translation initiation factor 2B complex	translation initiation factor activity|translation initiation factor binding				0	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---
PPP1CB	5500	broad.mit.edu	37	2	29022154	29022154	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:29022154G>A	uc002rmg.2	+	9	1129	c.969G>A	c.(967-969)CCG>CCA	p.P323P	PPP1CB_uc010ymj.1_Silent_p.P295P|PPP1CB_uc010yml.1_Silent_p.P295P|PPP1CB_uc002rmh.2_Silent_p.P323P|SPDYA_uc002rmi.2_5'UTR	NM_206876	NP_996759	P62140	PP1B_HUMAN	protein phosphatase 1, catalytic subunit, beta	323					cell cycle|cell division|glycogen metabolic process|triglyceride catabolic process	MLL5-L complex|nucleolus|PTW/PP1 phosphatase complex	metal ion binding|myosin phosphatase activity|myosin-light-chain-phosphatase activity|protein binding			skin(1)	1	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
NLRC4	58484	broad.mit.edu	37	2	32476488	32476488	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32476488C>T	uc002roi.2	-	4	691	c.445G>A	c.(445-447)GTG>ATG	p.V149M	NLRC4_uc002roj.1_Missense_Mutation_p.V149M|NLRC4_uc010ezt.1_Intron	NM_021209	NP_067032	Q9NPP4	NLRC4_HUMAN	caspase recruitment domain protein 12	149					activation of caspase activity|defense response to bacterium|detection of bacterium|interleukin-1 beta secretion|positive regulation of apoptosis	cytoplasm	ATP binding|magnesium ion binding|protein homodimerization activity			ovary(3)|large_intestine(1)|lung(1)|skin(1)	6	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.208)																	---	---	---	---
BIRC6	57448	broad.mit.edu	37	2	32824935	32824935	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32824935C>T	uc010ezu.2	+	70	14094	c.13960C>T	c.(13960-13962)CGA>TGA	p.R4654*		NM_016252	NP_057336	Q9NR09	BIRC6_HUMAN	baculoviral IAP repeat-containing 6	4654	Ubiquitin-conjugating.				anti-apoptosis|apoptosis	intracellular	acid-amino acid ligase activity|cysteine-type endopeptidase inhibitor activity|protein binding			ovary(5)|skin(4)|lung(2)|central_nervous_system(1)|breast(1)|pancreas(1)	14	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
LTBP1	4052	broad.mit.edu	37	2	33500077	33500077	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:33500077G>A	uc002ros.2	+	17	2792	c.2792G>A	c.(2791-2793)CGC>CAC	p.R931H	LTBP1_uc002rot.2_Missense_Mutation_p.R605H|LTBP1_uc002rou.2_Missense_Mutation_p.R604H|LTBP1_uc002rov.2_Missense_Mutation_p.R551H|LTBP1_uc010ymz.1_Missense_Mutation_p.R604H|LTBP1_uc010yna.1_Missense_Mutation_p.R551H	NM_206943	NP_996826	Q14766	LTBP1_HUMAN	latent transforming growth factor beta binding	930	EGF-like 5; calcium-binding (Potential).				negative regulation of transforming growth factor beta receptor signaling pathway by extracellular sequestering of TGFbeta	proteinaceous extracellular matrix	calcium ion binding|growth factor binding|transforming growth factor beta receptor activity			ovary(3)|skin(2)|upper_aerodigestive_tract(1)|lung(1)|central_nervous_system(1)	8	all_hematologic(175;0.115)	Medulloblastoma(90;0.215)																---	---	---	---
SULT6B1	391365	broad.mit.edu	37	2	37414569	37414569	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:37414569C>A	uc002rpu.2	-	2	148	c.127G>T	c.(127-129)GCT>TCT	p.A43S	SULT6B1_uc010yni.1_RNA	NM_001032377	NP_001027549	Q6IMI4	ST6B1_HUMAN	sulfotransferase family, cytosolic, 6B, member	81						cytoplasm	sulfotransferase activity			ovary(1)|breast(1)|central_nervous_system(1)	3		all_hematologic(82;0.248)																---	---	---	---
CCDC88A	55704	broad.mit.edu	37	2	55539564	55539564	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:55539564A>G	uc002ryv.2	-						CCDC88A_uc010yoz.1_Intron|CCDC88A_uc010ypa.1_Intron|CCDC88A_uc002ryu.2_Intron|CCDC88A_uc002rys.2_Intron|CCDC88A_uc002ryw.2_Intron|CCDC88A_uc010fby.1_Intron	NM_001135597	NP_001129069			coiled-coil domain containing 88A isoform 1						activation of protein kinase B activity|cell migration|cellular membrane organization|DNA replication|lamellipodium assembly|microtubule cytoskeleton organization|regulation of actin cytoskeleton organization|regulation of cell proliferation|regulation of DNA replication|regulation of neuron projection development|TOR signaling cascade	cytoplasmic membrane-bounded vesicle|cytosol|endoplasmic reticulum|Golgi apparatus|lamellipodium|plasma membrane	actin binding|microtubule binding|phosphatidylinositol binding|protein homodimerization activity|protein kinase B binding			ovary(2)|skin(2)	4																		---	---	---	---
KIAA1841	84542	broad.mit.edu	37	2	61319641	61319641	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61319641C>T	uc002saw.3	+	11	1434	c.1131C>T	c.(1129-1131)TTC>TTT	p.F377F	KIAA1841_uc002sax.3_Silent_p.F231F|KIAA1841_uc002say.2_Silent_p.F377F	NM_001129993	NP_001123465	Q6NSI8	K1841_HUMAN	KIAA1841 protein isoform a	377											0			Epithelial(17;0.193)															---	---	---	---
USP34	9736	broad.mit.edu	37	2	61433932	61433932	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61433932C>T	uc002sbe.2	-	71	9031	c.9009G>A	c.(9007-9009)TCG>TCA	p.S3003S	USP34_uc002sbd.2_5'Flank	NM_014709	NP_055524	Q70CQ2	UBP34_HUMAN	ubiquitin specific protease 34	3003					positive regulation of canonical Wnt receptor signaling pathway|protein K48-linked deubiquitination|ubiquitin-dependent protein catabolic process|Wnt receptor signaling pathway		cysteine-type endopeptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(8)|breast(5)|skin(3)|lung(2)|prostate(1)	19			Epithelial(17;0.229)															---	---	---	---
OTX1	5013	broad.mit.edu	37	2	63282962	63282962	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:63282962G>A	uc002scd.2	+	5	824	c.576G>A	c.(574-576)TCG>TCA	p.S192S	OTX1_uc010ypt.1_Silent_p.S126S	NM_014562	NP_055377	P32242	OTX1_HUMAN	orthodenticle homeobox 1	192						nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			pancreas(2)	2	Lung NSC(7;0.121)|all_lung(7;0.211)																	---	---	---	---
ANTXR1	84168	broad.mit.edu	37	2	69271944	69271944	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:69271944A>G	uc002sfg.2	+	3	651	c.295A>G	c.(295-297)AGA>GGA	p.R99G	ANTXR1_uc002sfe.2_Missense_Mutation_p.R99G|ANTXR1_uc002sff.2_Missense_Mutation_p.R99G|ANTXR1_uc002sfd.2_Missense_Mutation_p.R99G	NM_032208	NP_115584	Q9H6X2	ANTR1_HUMAN	anthrax toxin receptor 1 isoform 1 precursor	99	Extracellular (Potential).|VWFA.				actin cytoskeleton reorganization|substrate adhesion-dependent cell spreading	filopodium membrane|integral to membrane|lamellipodium membrane	actin filament binding|collagen binding|metal ion binding|protein binding|transmembrane receptor activity			ovary(2)|skin(2)	4														Familial_Infantile_Hemangioma				---	---	---	---
C2orf42	54980	broad.mit.edu	37	2	70392335	70392335	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:70392335A>G	uc002sgh.2	-							NM_017880	NP_060350			hypothetical protein LOC54980												0																		---	---	---	---
ADD2	119	broad.mit.edu	37	2	70905912	70905912	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:70905912G>A	uc002sgz.2	-	11	1772	c.1307C>T	c.(1306-1308)ACG>ATG	p.T436M	ADD2_uc010fds.1_RNA|ADD2_uc002sgy.2_Missense_Mutation_p.T436M|ADD2_uc002sha.2_Intron|ADD2_uc002sgx.2_Missense_Mutation_p.T436M|ADD2_uc010fdt.1_Missense_Mutation_p.T436M|ADD2_uc002shc.1_Missense_Mutation_p.T436M|ADD2_uc002shd.1_Intron|ADD2_uc010fdu.1_Missense_Mutation_p.T452M	NM_001617	NP_001608	P35612	ADDB_HUMAN	adducin 2 isoform a	436	Interaction with calmodulin (Potential).				actin filament bundle assembly|barbed-end actin filament capping|positive regulation of protein binding	cytoplasm|F-actin capping protein complex|plasma membrane	actin filament binding|calmodulin binding|metal ion binding|protein heterodimerization activity|protein homodimerization activity|spectrin binding			ovary(2)|pancreas(1)	3																		---	---	---	---
DYSF	8291	broad.mit.edu	37	2	71753393	71753393	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71753393G>A	uc002sie.2	+	12	1473	c.1097G>A	c.(1096-1098)AGC>AAC	p.S366N	DYSF_uc010feg.2_Missense_Mutation_p.S397N|DYSF_uc010feh.2_Missense_Mutation_p.S366N|DYSF_uc002sig.3_Missense_Mutation_p.S366N|DYSF_uc010yqx.1_RNA|DYSF_uc010fee.2_Missense_Mutation_p.S366N|DYSF_uc010fef.2_Missense_Mutation_p.S397N|DYSF_uc010fei.2_Missense_Mutation_p.S397N|DYSF_uc010fek.2_Missense_Mutation_p.S398N|DYSF_uc010fej.2_Missense_Mutation_p.S367N|DYSF_uc010fel.2_Missense_Mutation_p.S367N|DYSF_uc010feo.2_Missense_Mutation_p.S398N|DYSF_uc010fem.2_Missense_Mutation_p.S367N|DYSF_uc010fen.2_Missense_Mutation_p.S398N|DYSF_uc002sif.2_Missense_Mutation_p.S367N	NM_003494	NP_003485	O75923	DYSF_HUMAN	dysferlin isoform 8	366	Cytoplasmic (Potential).|C2 3.					cytoplasmic vesicle membrane|integral to membrane|sarcolemma	calcium-dependent phospholipid binding			ovary(3)|breast(2)|pancreas(1)|skin(1)	7																		---	---	---	---
SMYD5	10322	broad.mit.edu	37	2	73452826	73452826	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73452826T>C	uc002siw.2	+	12	1132	c.1103T>C	c.(1102-1104)CTC>CCC	p.L368P	SMYD5_uc010yre.1_Missense_Mutation_p.L252P|SMYD5_uc002six.1_RNA	NM_006062	NP_006053	Q6GMV2	SMYD5_HUMAN	SMYD family member 5	368							metal ion binding				0																		---	---	---	---
SMYD5	10322	broad.mit.edu	37	2	73453008	73453008	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73453008A>G	uc002siw.2	+	13	1220	c.1191A>G	c.(1189-1191)GAA>GAG	p.E397E	SMYD5_uc010yre.1_Silent_p.E281E|SMYD5_uc002six.1_RNA	NM_006062	NP_006053	Q6GMV2	SMYD5_HUMAN	SMYD family member 5	397	Glu-rich.						metal ion binding				0																		---	---	---	---
ALMS1	7840	broad.mit.edu	37	2	73826620	73826620	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73826620A>G	uc002sje.1	+	19	11754	c.11643A>G	c.(11641-11643)GTA>GTG	p.V3881V	ALMS1_uc002sjf.1_Silent_p.V3837V|ALMS1_uc002sjh.1_Silent_p.V3267V	NM_015120	NP_055935	Q8TCU4	ALMS1_HUMAN	Alstrom syndrome 1	3879					G2/M transition of mitotic cell cycle	centrosome|cilium|cytosol|microtubule basal body|spindle pole				skin(3)|ovary(2)|breast(2)|pancreas(1)|lung(1)	9																		---	---	---	---
C2orf78	388960	broad.mit.edu	37	2	74043233	74043233	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74043233T>C	uc002sjr.1	+	3	2004	c.1883T>C	c.(1882-1884)ATG>ACG	p.M628T		NM_001080474	NP_001073943	A6NCI8	CB078_HUMAN	hypothetical protein LOC388960	628										ovary(2)	2																		---	---	---	---
ACTG2	72	broad.mit.edu	37	2	74143792	74143792	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74143792C>G	uc002sjw.2	+	8	1009	c.887C>G	c.(886-888)GCC>GGC	p.A296G	ACTG2_uc010fey.2_Missense_Mutation_p.A296G|ACTG2_uc010yrn.1_Missense_Mutation_p.A253G	NM_001615	NP_001606	P63267	ACTH_HUMAN	actin, gamma 2 propeptide	296					muscle contraction	cytoskeleton|cytosol	ATP binding				0																		---	---	---	---
BOLA3	388962	broad.mit.edu	37	2	74362716	74362716	+	3'UTR	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74362716G>A	uc002skc.1	-	4					BOLA3_uc002skd.1_Missense_Mutation_p.T80M	NM_212552	NP_997717			bolA-like 3 isoform 1							extracellular region					0																		---	---	---	---
AUP1	550	broad.mit.edu	37	2	74755569	74755569	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74755569T>C	uc010yrx.1	-	4	869	c.743A>G	c.(742-744)CAA>CGA	p.Q248R	DQX1_uc010yrw.1_5'Flank|AUP1_uc002sme.2_5'Flank|AUP1_uc002smf.2_Missense_Mutation_p.Q191R|AUP1_uc002smg.2_RNA|AUP1_uc002smh.2_Missense_Mutation_p.Q100R|HTRA2_uc002smi.1_5'Flank|HTRA2_uc002smj.1_5'Flank|HTRA2_uc002smk.1_5'Flank|HTRA2_uc002sml.1_5'Flank|HTRA2_uc002smm.1_5'Flank|HTRA2_uc002smn.1_5'Flank|HTRA2_uc010ffl.2_5'Flank			Q9Y679	AUP1_HUMAN	SubName: Full=cDNA FLJ57204, highly similar to Homo sapiens ancient ubiquitous protein 1 (AUP1), transcript variant 2, mRNA;	257	Cytoplasmic (Potential).					endoplasmic reticulum membrane|integral to membrane|nucleus	protein binding				0																		---	---	---	---
CTNNA2	1496	broad.mit.edu	37	2	80646660	80646660	+	Missense_Mutation	SNP	C	A	A	rs148134866	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:80646660C>A	uc010ysh.1	+	8	1229	c.1224C>A	c.(1222-1224)AGC>AGA	p.S408R	CTNNA2_uc010yse.1_Missense_Mutation_p.S408R|CTNNA2_uc010ysf.1_Missense_Mutation_p.S408R|CTNNA2_uc010ysg.1_Missense_Mutation_p.S408R|CTNNA2_uc010ysi.1_Missense_Mutation_p.S40R	NM_004389	NP_004380	P26232	CTNA2_HUMAN	catenin, alpha 2 isoform 1	408					axonogenesis|brain morphogenesis|cell-cell adhesion|dendrite morphogenesis|muscle cell differentiation|positive regulation of muscle cell differentiation|prepulse inhibition|radial glia guided migration of Purkinje cell|regulation of synapse structural plasticity	actin cytoskeleton|axon|cytosol	cadherin binding|structural constituent of cytoskeleton			pancreas(4)|lung(3)|breast(1)|skin(1)	9																		---	---	---	---
SFTPB	6439	broad.mit.edu	37	2	85892493	85892493	+	Silent	SNP	G	A	A	rs45530632	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:85892493G>A	uc002sqh.2	-	6	597	c.591C>T	c.(589-591)TCC>TCT	p.S197S	SFTPB_uc002sqi.2_Silent_p.S209S|SFTPB_uc002sqj.2_Silent_p.S197S	NM_198843	NP_942140	P07988	PSPB_HUMAN	surfactant, pulmonary-associated protein B	197					organ morphogenesis|respiratory gaseous exchange|sphingolipid metabolic process	extracellular space|lysosome				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
PTCD3	55037	broad.mit.edu	37	2	86352130	86352130	+	Silent	SNP	C	T	T	rs75290041		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:86352130C>T	uc002sqw.2	+	10	795	c.729C>T	c.(727-729)AAC>AAT	p.N243N	PTCD3_uc010ytc.1_RNA|PTCD3_uc002sqx.1_Translation_Start_Site	NM_017952	NP_060422	Q96EY7	PTCD3_HUMAN	pentatricopeptide repeat domain 3 precursor	243						mitochondrion	protein binding	p.N243N(1)		ovary(1)	1																		---	---	---	---
KDM3A	55818	broad.mit.edu	37	2	86677036	86677036	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:86677036A>G	uc002sri.3	+	3	620	c.293A>G	c.(292-294)GAA>GGA	p.E98G	KDM3A_uc010ytj.1_Missense_Mutation_p.E98G|KDM3A_uc010ytk.1_Intron	NM_018433	NP_060903	Q9Y4C1	KDM3A_HUMAN	jumonji domain containing 1A	98					androgen receptor signaling pathway|cell differentiation|formaldehyde biosynthetic process|histone H3-K9 demethylation|hormone-mediated signaling pathway|positive regulation of transcription, DNA-dependent|spermatogenesis|transcription, DNA-dependent	cytoplasm|nucleus	androgen receptor binding|iron ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			breast(2)|ovary(1)|central_nervous_system(1)|skin(1)	5																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	90060915	90060915	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:90060915A>G	uc010fhm.2	+											Parts of antibodies, mostly variable regions.																														---	---	---	---
FAHD2B	151313	broad.mit.edu	37	2	97751910	97751910	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:97751910G>A	uc002sxm.2	-	4	639	c.488C>T	c.(487-489)GCC>GTC	p.A163V		NM_199336	NP_955368	Q6P2I3	FAH2B_HUMAN	fumarylacetoacetate hydrolase domain containing	163							hydrolase activity|metal ion binding				0																		---	---	---	---
VWA3B	200403	broad.mit.edu	37	2	98804519	98804519	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:98804519G>A	uc002syo.2	+	10	1657	c.1393G>A	c.(1393-1395)GTC>ATC	p.V465I	VWA3B_uc010yvh.1_Missense_Mutation_p.V315I|VWA3B_uc002syj.2_RNA|VWA3B_uc002syk.1_Intron|VWA3B_uc002syl.1_Intron|VWA3B_uc002sym.2_Missense_Mutation_p.V465I|VWA3B_uc002syn.1_Intron|VWA3B_uc010yvi.1_Missense_Mutation_p.V122I	NM_144992	NP_659429	Q502W6	VWA3B_HUMAN	von Willebrand factor A domain containing 3B	465										ovary(3)|large_intestine(2)|skin(1)	6																		---	---	---	---
LONRF2	164832	broad.mit.edu	37	2	100916228	100916228	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:100916228G>A	uc002tal.3	-	5	1858	c.1218C>T	c.(1216-1218)GAC>GAT	p.D406D	LONRF2_uc010yvs.1_RNA	NM_198461	NP_940863	Q1L5Z9	LONF2_HUMAN	LON peptidase N-terminal domain and ring finger	406					proteolysis		ATP-dependent peptidase activity|zinc ion binding			large_intestine(1)|skin(1)	2																		---	---	---	---
C2orf29	55571	broad.mit.edu	37	2	101885796	101885796	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:101885796G>A	uc002taw.3	+	7	1536	c.1454G>A	c.(1453-1455)CGA>CAA	p.R485Q		NM_017546	NP_060016	Q9UKZ1	CB029_HUMAN	hypothetical protein LOC55571	485					cell proliferation|nuclear-transcribed mRNA poly(A) tail shortening	cytosol				ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5																		---	---	---	---
ANAPC1	64682	broad.mit.edu	37	2	112608394	112608394	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:112608394T>C	uc002thi.2	-	14	1856	c.1609A>G	c.(1609-1611)ACT>GCT	p.T537A		NM_022662	NP_073153	Q9H1A4	APC1_HUMAN	anaphase promoting complex subunit 1	537					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell division|mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|cytosol|nucleoplasm				skin(2)	2																		---	---	---	---
ANAPC1	64682	broad.mit.edu	37	2	112614266	112614266	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:112614266C>A	uc002thi.2	-							NM_022662	NP_073153			anaphase promoting complex subunit 1						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell division|mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|cytosol|nucleoplasm				skin(2)	2																		---	---	---	---
EN1	2019	broad.mit.edu	37	2	119600627	119600627	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:119600627C>T	uc002tlm.2	-	2	2082	c.1066G>A	c.(1066-1068)GCC>ACC	p.A356T		NM_001426	NP_001417	Q05925	HME1_HUMAN	engrailed homeobox 1	356	Homeobox.				skeletal system development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			large_intestine(1)|lung(1)	2																		---	---	---	---
WDR33	55339	broad.mit.edu	37	2	128476878	128476878	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128476878C>T	uc002tpg.1	-	16	2904	c.2721G>A	c.(2719-2721)ACG>ACA	p.T907T		NM_018383	NP_060853	Q9C0J8	WDR33_HUMAN	WD repeat domain 33 isoform 1	907					postreplication repair|spermatogenesis	collagen|nucleus	protein binding				0	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.0695)														---	---	---	---
WDR33	55339	broad.mit.edu	37	2	128476952	128476952	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128476952G>A	uc002tpg.1	-	16	2830	c.2647C>T	c.(2647-2649)CCT>TCT	p.P883S		NM_018383	NP_060853	Q9C0J8	WDR33_HUMAN	WD repeat domain 33 isoform 1	883					postreplication repair|spermatogenesis	collagen|nucleus	protein binding				0	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.0695)														---	---	---	---
FAM123C	205147	broad.mit.edu	37	2	131521965	131521965	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:131521965C>T	uc002trw.2	+	2	2510	c.2320C>T	c.(2320-2322)CCC>TCC	p.P774S	FAM123C_uc010fmv.2_Missense_Mutation_p.P774S|FAM123C_uc010fms.1_Missense_Mutation_p.P774S|FAM123C_uc010fmt.1_Missense_Mutation_p.P774S|FAM123C_uc010fmu.1_Missense_Mutation_p.P774S	NM_152698	NP_689911	Q8N944	F123C_HUMAN	hypothetical protein LOC205147	774										pancreas(2)|ovary(1)	3	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.13)														---	---	---	---
NCKAP5	344148	broad.mit.edu	37	2	133483297	133483297	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:133483297G>A	uc002ttp.2	-	19	5990	c.5616C>T	c.(5614-5616)AGC>AGT	p.S1872S	NCKAP5_uc002ttq.2_Silent_p.S553S	NM_207363	NP_997246	O14513	NCKP5_HUMAN	Nck-associated protein 5 isoform 1	1872							protein binding				0																		---	---	---	---
TMEM163	81615	broad.mit.edu	37	2	135215680	135215680	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:135215680C>T	uc002ttx.2	-	7	798	c.732G>A	c.(730-732)AAG>AAA	p.K244K	TMEM163_uc002tty.2_RNA	NM_030923	NP_112185	Q8TC26	TM163_HUMAN	transmembrane protein 163	244						integral to membrane					0				BRCA - Breast invasive adenocarcinoma(221;0.154)														---	---	---	---
LRP1B	53353	broad.mit.edu	37	2	141201956	141201956	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141201956T>C	uc002tvj.1	-	65	11209	c.10237A>G	c.(10237-10239)AAC>GAC	p.N3413D		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	3413	Extracellular (Potential).|LDL-receptor class A 23.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)											TSP Lung(27;0.18)			---	---	---	---
LRP1B	53353	broad.mit.edu	37	2	141660492	141660492	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141660492C>T	uc002tvj.1	-	23	4735	c.3763G>A	c.(3763-3765)GTT>ATT	p.V1255I	LRP1B_uc010fnl.1_Missense_Mutation_p.V437I	NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	1255	Extracellular (Potential).				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)											TSP Lung(27;0.18)			---	---	---	---
KIF5C	3800	broad.mit.edu	37	2	149806981	149806981	+	Intron	SNP	G	A	A	rs113633344	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:149806981G>A	uc010zbu.1	+						KIF5C_uc002tws.1_Intron	NM_004522	NP_004513			kinesin family member 5C						microtubule-based movement|organelle organization	cytoplasm|kinesin complex|microtubule	ATP binding|microtubule motor activity			skin(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.108)														---	---	---	---
CACNB4	785	broad.mit.edu	37	2	152739824	152739824	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152739824G>A	uc002tya.2	-	3	276	c.208C>T	c.(208-210)CGG>TGG	p.R70W	CACNB4_uc002txy.2_Missense_Mutation_p.R36W|CACNB4_uc002txz.2_Missense_Mutation_p.R52W|CACNB4_uc010fnz.2_Missense_Mutation_p.R70W|CACNB4_uc002tyb.2_Missense_Mutation_p.R36W	NM_000726	NP_000717	O00305	CACB4_HUMAN	calcium channel, voltage-dependent, beta 4	70					axon guidance|membrane depolarization|synaptic transmission	cytosol|internal side of plasma membrane|plasma membrane|synapse|voltage-gated calcium channel complex	protein binding|voltage-gated calcium channel activity			ovary(2)	2				BRCA - Breast invasive adenocarcinoma(221;0.156)	Verapamil(DB00661)													---	---	---	---
TANC1	85461	broad.mit.edu	37	2	160025864	160025864	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160025864T>C	uc002uag.2	+	9	1324	c.1050T>C	c.(1048-1050)GGT>GGC	p.G350G	TANC1_uc010fol.1_Silent_p.G244G|TANC1_uc010zcm.1_Splice_Site_p.A349_splice|TANC1_uc010fom.1_Silent_p.G156G	NM_033394	NP_203752	Q9C0D5	TANC1_HUMAN	tetratricopeptide repeat, ankyrin repeat and	350						cell junction|postsynaptic density|postsynaptic membrane	binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
TBR1	10716	broad.mit.edu	37	2	162280585	162280585	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:162280585C>T	uc002ubw.1	+	6	2198	c.1896C>T	c.(1894-1896)TAC>TAT	p.Y632Y	TBR1_uc010foy.2_Silent_p.Y345Y	NM_006593	NP_006584	Q16650	TBR1_HUMAN	T-box, brain, 1	632						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
COBLL1	22837	broad.mit.edu	37	2	165600195	165600195	+	Splice_Site	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:165600195A>G	uc010zcw.1	-	4	513	c.389_splice	c.e4+1	p.S130_splice	COBLL1_uc002ucp.2_Splice_Site_p.S77_splice|COBLL1_uc002ucq.2_Splice_Site_p.S77_splice|COBLL1_uc010zcx.1_Splice_Site_p.S123_splice|COBLL1_uc002ucs.1_Splice_Site|COBLL1_uc002uct.2_Missense_Mutation_p.Y78H	NM_014900	NP_055715			COBL-like 1											ovary(2)|pancreas(1)	3																		---	---	---	---
LRP2	4036	broad.mit.edu	37	2	170042445	170042445	+	Missense_Mutation	SNP	C	A	A	rs35086590	byFrequency;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170042445C>A	uc002ues.2	-	50	9626	c.9413G>T	c.(9412-9414)CGT>CTT	p.R3138L		NM_004525	NP_004516	P98164	LRP2_HUMAN	low density lipoprotein-related protein 2	3138	EGF-like 11.|Extracellular (Potential).				hormone biosynthetic process|protein glycosylation|receptor-mediated endocytosis|vitamin D metabolic process	coated pit|integral to membrane|lysosome	calcium ion binding|receptor activity|SH3 domain binding			ovary(13)|skin(6)|central_nervous_system(4)|large_intestine(3)|kidney(2)|pancreas(1)	29				STAD - Stomach adenocarcinoma(1183;0.000766)|COAD - Colon adenocarcinoma(177;0.0101)	Gentamicin(DB00798)|Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Urokinase(DB00013)													---	---	---	---
UBR3	130507	broad.mit.edu	37	2	170938287	170938287	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170938287A>G	uc010zdi.1	+	39	5601	c.5601A>G	c.(5599-5601)CAA>CAG	p.Q1867Q	UBR3_uc002ufr.3_RNA|UBR3_uc010fqa.2_Silent_p.Q688Q|UBR3_uc002uft.3_Silent_p.Q724Q|UBR3_uc010zdj.1_Silent_p.Q558Q|UBR3_uc002ufu.3_Silent_p.Q373Q	NM_172070	NP_742067	Q6ZT12	UBR3_HUMAN	E3 ubiquitin-protein ligase UBR3	1867					sensory perception of smell|suckling behavior|ubiquitin-dependent protein catabolic process	integral to membrane	ubiquitin-protein ligase activity|zinc ion binding				0																		---	---	---	---
GORASP2	26003	broad.mit.edu	37	2	171822463	171822463	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:171822463C>T	uc002ugk.2	+	10	1322	c.1182C>T	c.(1180-1182)CCC>CCT	p.P394P	GORASP2_uc002ugj.2_Silent_p.P326P|GORASP2_uc010zdl.1_Silent_p.P406P|GORASP2_uc010zdm.1_Silent_p.P350P|GORASP2_uc002ugl.2_Silent_p.P326P|GORASP2_uc002ugm.2_Silent_p.P176P	NM_015530	NP_056345	Q9H8Y8	GORS2_HUMAN	golgi reassembly stacking protein 2	394						Golgi membrane				breast(1)|central_nervous_system(1)	2																		---	---	---	---
CDCA7	83879	broad.mit.edu	37	2	174229538	174229538	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:174229538C>T	uc002uid.1	+	5	609	c.478C>T	c.(478-480)CGA>TGA	p.R160*	CDCA7_uc002uic.1_Nonsense_Mutation_p.R239*|CDCA7_uc010zej.1_Nonsense_Mutation_p.R195*|CDCA7_uc010zek.1_Nonsense_Mutation_p.R118*	NM_145810	NP_665809	Q9BWT1	CDCA7_HUMAN	cell division cycle associated 7 isoform 2	160	Arg-rich.				regulation of cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.116)															---	---	---	---
HOXD9	3235	broad.mit.edu	37	2	176987559	176987559	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:176987559C>T	uc010zex.1	+	1	147	c.63C>T	c.(61-63)TAC>TAT	p.Y21Y		NM_014213	NP_055028	P28356	HXD9_HUMAN	homeobox D9	21						nucleus	sequence-specific DNA binding				0			OV - Ovarian serous cystadenocarcinoma(117;0.0207)|Epithelial(96;0.195)	Colorectal(32;0.0226)|READ - Rectum adenocarcinoma(9;0.0556)														---	---	---	---
PDE11A	50940	broad.mit.edu	37	2	178740634	178740634	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:178740634T>C	uc002ulq.2	-	5	1637	c.1319A>G	c.(1318-1320)AAA>AGA	p.K440R	PDE11A_uc002ulp.2_5'UTR|PDE11A_uc002ulr.2_Missense_Mutation_p.K190R|PDE11A_uc002uls.1_Missense_Mutation_p.K82R|PDE11A_uc002ult.1_Missense_Mutation_p.K190R|PDE11A_uc002ulu.1_Missense_Mutation_p.K82R	NM_016953	NP_058649	Q9HCR9	PDE11_HUMAN	phosphodiesterase 11A isoform 4	440	GAF 2.				platelet activation|signal transduction	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding			ovary(3)|large_intestine(1)	4			OV - Ovarian serous cystadenocarcinoma(117;0.00121)|Epithelial(96;0.00455)|all cancers(119;0.02)											Primary_Pigmented_Nodular_Adrenocortical_Disease_Familial				---	---	---	---
TTN	7273	broad.mit.edu	37	2	179443547	179443547	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179443547G>A	uc010zfg.1	-	269	60730	c.60506C>T	c.(60505-60507)GCG>GTG	p.A20169V	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.A13864V|TTN_uc010zfi.1_Missense_Mutation_p.A13797V|TTN_uc010zfj.1_Missense_Mutation_p.A13672V|uc002umv.1_5'UTR	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	21096							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179474231	179474231	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179474231G>A	uc010zfg.1	-	222	44326	c.44102C>T	c.(44101-44103)GCA>GTA	p.A14701V	uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.A8396V|TTN_uc010zfi.1_Missense_Mutation_p.A8329V|TTN_uc010zfj.1_Missense_Mutation_p.A8204V	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	15628							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179474816	179474816	+	Splice_Site	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179474816C>T	uc010zfg.1	-	220	43956	c.43732_splice	c.e220+1	p.Q14578_splice	uc002ump.1_Intron|TTN_uc010zfh.1_Splice_Site_p.Q8273_splice|TTN_uc010zfi.1_Splice_Site_p.Q8206_splice|TTN_uc010zfj.1_Splice_Site_p.Q8081_splice	NM_133378	NP_596869			titin isoform N2-A								ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179576715	179576715	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179576715T>C	uc010zfg.1	-	93	24334	c.24110A>G	c.(24109-24111)AAC>AGC	p.N8037S	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Missense_Mutation_p.N4698S	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	8964							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179580340	179580340	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179580340C>T	uc010zfg.1	-	86	22293	c.22069G>A	c.(22069-22071)GTT>ATT	p.V7357I	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Missense_Mutation_p.V4018I	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	8284							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
ITGA4	3676	broad.mit.edu	37	2	182323028	182323028	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:182323028C>T	uc002unu.2	+	2	1066	c.303C>T	c.(301-303)TGC>TGT	p.C101C	ITGA4_uc002unt.2_Silent_p.C101C|ITGA4_uc010zfl.1_Silent_p.C101C	NM_000885	NP_000876	P13612	ITA4_HUMAN	integrin alpha 4 precursor	101	Extracellular (Potential).				blood coagulation|integrin-mediated signaling pathway|leukocyte cell-cell adhesion|leukocyte migration|regulation of immune response	integrin complex	identical protein binding|receptor activity			ovary(3)|lung(1)|central_nervous_system(1)|pancreas(1)	6			OV - Ovarian serous cystadenocarcinoma(117;0.0593)		Natalizumab(DB00108)													---	---	---	---
MYO1B	4430	broad.mit.edu	37	2	192141734	192141734	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:192141734G>A	uc010fsg.2	+	2	368	c.113G>A	c.(112-114)CGC>CAC	p.R38H	MYO1B_uc002usq.2_Missense_Mutation_p.R38H|MYO1B_uc002usr.2_Missense_Mutation_p.R38H|MYO1B_uc002uss.1_Missense_Mutation_p.R38H	NM_001130158	NP_001123630	O43795	MYO1B_HUMAN	myosin IB isoform 1	38	Myosin head-like.					myosin complex	actin binding|ATP binding|calmodulin binding|motor activity			central_nervous_system(5)|large_intestine(2)|ovary(1)	8			OV - Ovarian serous cystadenocarcinoma(117;0.0112)|Epithelial(96;0.104)|all cancers(119;0.236)															---	---	---	---
STK17B	9262	broad.mit.edu	37	2	197002360	197002360	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197002360G>T	uc002utk.2	-	8	1254	c.930C>A	c.(928-930)TCC>TCA	p.S310S	STK17B_uc010fsh.2_Silent_p.S310S	NM_004226	NP_004217	O94768	ST17B_HUMAN	serine/threonine kinase 17B	310	Poly-Ser.				apoptosis|induction of apoptosis|intracellular protein kinase cascade	nucleus	ATP binding|protein serine/threonine kinase activity			lung(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.141)															---	---	---	---
HECW2	57520	broad.mit.edu	37	2	197183855	197183855	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197183855C>T	uc002utm.1	-	9	1942	c.1759G>A	c.(1759-1761)GCA>ACA	p.A587T	HECW2_uc002utl.1_Missense_Mutation_p.A231T	NM_020760	NP_065811	Q9P2P5	HECW2_HUMAN	HECT, C2 and WW domain containing E3 ubiquitin	587					protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm	ubiquitin-protein ligase activity			skin(5)|ovary(5)|lung(4)|pancreas(2)|central_nervous_system(1)|kidney(1)	18																		---	---	---	---
GTF3C3	9330	broad.mit.edu	37	2	197654592	197654592	+	Intron	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197654592A>T	uc002uts.2	-						GTF3C3_uc010zgu.1_Intron|GTF3C3_uc002utu.2_Intron	NM_012086	NP_036218			general transcription factor IIIC, polypeptide							transcription factor TFIIIC complex	DNA binding|protein binding			ovary(3)|breast(3)|pancreas(1)	7																		---	---	---	---
SGOL2	151246	broad.mit.edu	37	2	201437347	201437347	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:201437347G>T	uc002uvw.2	+	7	2391	c.2278G>T	c.(2278-2280)GAC>TAC	p.D760Y	SGOL2_uc010zhd.1_Missense_Mutation_p.D760Y|SGOL2_uc010zhe.1_Missense_Mutation_p.D760Y	NM_152524	NP_689737	Q562F6	SGOL2_HUMAN	shugoshin-like 2 isoform 1	760					cell division|mitotic prometaphase	condensed chromosome kinetochore|cytosol|mitotic cohesin complex	protein binding			ovary(2)|skin(2)	4																		---	---	---	---
CASP8	841	broad.mit.edu	37	2	202149917	202149917	+	Missense_Mutation	SNP	C	T	T	rs34208389		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202149917C>T	uc002uxr.1	+	9	1390	c.1181C>T	c.(1180-1182)CCG>CTG	p.P394L	CASP8_uc002uxp.1_Missense_Mutation_p.P411L|CASP8_uc002uxq.1_Missense_Mutation_p.P379L|CASP8_uc002uxt.1_Missense_Mutation_p.P453L|CASP8_uc002uxu.1_RNA|CASP8_uc002uxw.1_Missense_Mutation_p.P379L|CASP8_uc002uxy.1_Intron|CASP8_uc002uxx.1_Intron|CASP8_uc010ftf.2_Missense_Mutation_p.P310L	NM_033355	NP_203519	Q14790	CASP8_HUMAN	caspase 8 isoform B precursor	394					activation of caspase activity|activation of pro-apoptotic gene products|cellular component disassembly involved in apoptosis|cellular response to mechanical stimulus|induction of apoptosis by extracellular signals|induction of apoptosis by intracellular signals|positive regulation of I-kappaB kinase/NF-kappaB cascade|proteolysis involved in cellular protein catabolic process|response to tumor necrosis factor	centrosome|cytosol|mitochondrial outer membrane	cysteine-type endopeptidase activity|protein binding|protein binding			upper_aerodigestive_tract(2)|ovary(1)|breast(1)|skin(1)	5															HNSCC(4;0.00038)			---	---	---	---
SPAG16	79582	broad.mit.edu	37	2	214878701	214878701	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:214878701G>A	uc002veq.2	+	13	1519	c.1427G>A	c.(1426-1428)GGA>GAA	p.G476E	SPAG16_uc010fuz.1_Missense_Mutation_p.G327E|SPAG16_uc002ver.2_Missense_Mutation_p.G422E|SPAG16_uc010zjk.1_Missense_Mutation_p.G382E	NM_024532	NP_078808	Q8N0X2	SPG16_HUMAN	sperm associated antigen 16 isoform 1	476	WD 4.				cilium assembly	cilium axoneme|flagellar axoneme				ovary(1)|skin(1)	2		Renal(323;0.00461)		UCEC - Uterine corpus endometrioid carcinoma (47;0.0525)|Epithelial(149;7.07e-07)|all cancers(144;7.96e-05)|Lung(261;0.00255)|LUSC - Lung squamous cell carcinoma(224;0.00599)														---	---	---	---
ABCA12	26154	broad.mit.edu	37	2	215839522	215839522	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:215839522C>T	uc002vew.2	-	35	5668	c.5448G>A	c.(5446-5448)ATG>ATA	p.M1816I	ABCA12_uc002vev.2_Missense_Mutation_p.M1498I|ABCA12_uc010zjn.1_Missense_Mutation_p.M743I	NM_173076	NP_775099	Q86UK0	ABCAC_HUMAN	ATP-binding cassette, sub-family A, member 12	1816					cellular homeostasis|lipid transport	integral to membrane	ATP binding|ATPase activity			ovary(6)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	11		Renal(323;0.127)		Epithelial(149;1.01e-05)|all cancers(144;0.00112)|LUSC - Lung squamous cell carcinoma(224;0.00829)|Lung(261;0.011)														---	---	---	---
MREG	55686	broad.mit.edu	37	2	216809613	216809613	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:216809613C>T	uc002vfo.2	-	5	914	c.618G>A	c.(616-618)CTG>CTA	p.L206L	MREG_uc002vfq.2_RNA	NM_018000	NP_060470	Q8N565	MREG_HUMAN	whn-dependent transcript 2	206						apical plasma membrane					0		Renal(323;0.0328)		Epithelial(149;4.64e-07)|all cancers(144;5.56e-05)|LUSC - Lung squamous cell carcinoma(224;0.00832)|Lung(261;0.0111)														---	---	---	---
IGFBP5	3488	broad.mit.edu	37	2	217559282	217559282	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:217559282G>A	uc002vgj.3	-	1	991	c.217C>T	c.(217-219)CGC>TGC	p.R73C		NM_000599	NP_000590	P24593	IBP5_HUMAN	insulin-like growth factor binding protein 5	73	IGFBP N-terminal.				negative regulation of insulin-like growth factor receptor signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of smooth muscle cell proliferation|negative regulation of translation|signal transduction		insulin-like growth factor I binding				0		Renal(323;0.0822)		Epithelial(149;2.1e-06)|all cancers(144;0.000165)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
RNF25	64320	broad.mit.edu	37	2	219532655	219532655	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219532655T>C	uc002vit.2	-	5	425	c.337A>G	c.(337-339)ATG>GTG	p.M113V	RNF25_uc010fvw.2_Missense_Mutation_p.M1V	NM_022453	NP_071898	Q96BH1	RNF25_HUMAN	ring finger protein 25	113	RWD.				positive regulation of NF-kappaB transcription factor activity	cytosol|nucleus	NF-kappaB binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2		Renal(207;0.0474)		Epithelial(149;6.99e-07)|all cancers(144;0.000129)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
CDK5R2	8941	broad.mit.edu	37	2	219825311	219825311	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219825311G>A	uc002vjf.2	+	1	914	c.769G>A	c.(769-771)GAG>AAG	p.E257K		NM_003936	NP_003927	Q13319	CD5R2_HUMAN	cyclin-dependent kinase 5, regulatory subunit 2	257					regulation of cyclin-dependent protein kinase activity	cyclin-dependent protein kinase 5 holoenzyme complex	cyclin-dependent protein kinase 5 activator activity			ovary(1)	1		Renal(207;0.0474)		Epithelial(149;9.77e-07)|all cancers(144;0.000167)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
PTPRN	5798	broad.mit.edu	37	2	220164503	220164503	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220164503A>G	uc002vkz.2	-	10	1531	c.1442T>C	c.(1441-1443)CTG>CCG	p.L481P	PTPRN_uc010zlc.1_Missense_Mutation_p.L391P|PTPRN_uc002vla.2_Intron	NM_002846	NP_002837	Q16849	PTPRN_HUMAN	protein tyrosine phosphatase, receptor type, N	481	Extracellular (Potential).				response to reactive oxygen species	integral to plasma membrane	transmembrane receptor protein tyrosine phosphatase activity			ovary(2)|lung(1)|skin(1)	4		Renal(207;0.0474)		Epithelial(149;4.22e-07)|all cancers(144;8.82e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)|STAD - Stomach adenocarcinoma(1183;0.0875)														---	---	---	---
CHPF	79586	broad.mit.edu	37	2	220404955	220404955	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220404955C>T	uc002vmc.3	-	4	1705	c.1478G>A	c.(1477-1479)CGC>CAC	p.R493H	CHPF_uc010zlh.1_Missense_Mutation_p.R331H	NM_024536	NP_078812	Q8IZ52	CHSS2_HUMAN	chondroitin polymerizing factor	493	Lumenal (Potential).					Golgi cisterna membrane|integral to membrane	glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity|metal ion binding|N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity|protein binding				0		Renal(207;0.0183)		Epithelial(149;3.02e-08)|all cancers(144;3.41e-06)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00802)														---	---	---	---
SLC4A3	6508	broad.mit.edu	37	2	220494985	220494985	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220494985T>G	uc002vmp.3	+	6	991	c.722T>G	c.(721-723)CTG>CGG	p.L241R	SLC4A3_uc002vmn.2_Missense_Mutation_p.L268R|SLC4A3_uc002vmo.3_Missense_Mutation_p.L268R|SLC4A3_uc010fwm.2_5'UTR|SLC4A3_uc010fwn.1_5'Flank	NM_005070	NP_005061	P48751	B3A3_HUMAN	solute carrier family 4, anion exchanger, member	241	Cytoplasmic.				bicarbonate transport	integral to plasma membrane|membrane fraction	inorganic anion exchanger activity			ovary(2)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	5		Renal(207;0.0183)		Epithelial(149;2.53e-07)|all cancers(144;5.57e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
SLC4A3	6508	broad.mit.edu	37	2	220501408	220501408	+	Nonsense_Mutation	SNP	C	T	T	rs150010736		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220501408C>T	uc002vmp.3	+	16	2616	c.2347C>T	c.(2347-2349)CGA>TGA	p.R783*	SLC4A3_uc002vmo.3_Nonsense_Mutation_p.R810*|SLC4A3_uc010fwm.2_Nonsense_Mutation_p.R333*|SLC4A3_uc010fwn.1_Nonsense_Mutation_p.R292*	NM_005070	NP_005061	P48751	B3A3_HUMAN	solute carrier family 4, anion exchanger, member	783	Membrane (anion exchange).				bicarbonate transport	integral to plasma membrane|membrane fraction	inorganic anion exchanger activity			ovary(2)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	5		Renal(207;0.0183)		Epithelial(149;2.53e-07)|all cancers(144;5.57e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
EPHA4	2043	broad.mit.edu	37	2	222308249	222308249	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:222308249C>T	uc002vmq.2	-	10	1894	c.1852G>A	c.(1852-1854)GCA>ACA	p.A618T	EPHA4_uc002vmr.2_Missense_Mutation_p.A618T|EPHA4_uc010zlm.1_Missense_Mutation_p.A559T|EPHA4_uc010zln.1_Missense_Mutation_p.A618T	NM_004438	NP_004429	P54764	EPHA4_HUMAN	ephrin receptor EphA4 precursor	618	Cytoplasmic (Potential).					integral to plasma membrane	ATP binding|ephrin receptor activity			lung(6)|large_intestine(2)|central_nervous_system(2)|urinary_tract(1)|skin(1)	12		Renal(207;0.0183)		Epithelial(121;5.38e-09)|all cancers(144;2.47e-06)|LUSC - Lung squamous cell carcinoma(224;0.0115)|Lung(261;0.0154)														---	---	---	---
TRIP12	9320	broad.mit.edu	37	2	230725188	230725188	+	Intron	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:230725188T>A	uc002vpw.1	-						TRIP12_uc002vpx.1_Missense_Mutation_p.N53I|TRIP12_uc002vpy.1_Intron|TRIP12_uc010zlz.1_RNA|TRIP12_uc010fxh.1_Intron	NM_004238	NP_004229			thyroid hormone receptor interactor 12						protein ubiquitination involved in ubiquitin-dependent protein catabolic process	proteasome complex	thyroid hormone receptor binding|ubiquitin-protein ligase activity			ovary(4)|lung(2)|breast(1)|central_nervous_system(1)|skin(1)	9		Renal(207;0.025)|all_hematologic(139;0.122)|all_lung(227;0.126)|Acute lymphoblastic leukemia(138;0.164)		Epithelial(121;4.76e-13)|all cancers(144;4.34e-10)|LUSC - Lung squamous cell carcinoma(224;0.00864)|Lung(119;0.0116)														---	---	---	---
B3GNT7	93010	broad.mit.edu	37	2	232262945	232262945	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:232262945G>A	uc002vrs.2	+	2	695	c.515G>A	c.(514-516)CGC>CAC	p.R172H		NM_145236	NP_660279	Q8NFL0	B3GN7_HUMAN	UDP-GlcNAc:betaGal	172	Lumenal (Potential).				protein glycosylation	Golgi membrane|integral to membrane	galactosyltransferase activity				0		Renal(207;0.025)|all_hematologic(139;0.094)|Acute lymphoblastic leukemia(138;0.164)|Medulloblastoma(418;0.232)		Epithelial(121;3.22e-11)|LUSC - Lung squamous cell carcinoma(224;0.0115)|Lung(119;0.0139)														---	---	---	---
TRPM8	79054	broad.mit.edu	37	2	234854587	234854587	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:234854587G>A	uc002vvh.2	+	7	827	c.787G>A	c.(787-789)GTG>ATG	p.V263M	TRPM8_uc010fyj.2_Translation_Start_Site	NM_024080	NP_076985	Q7Z2W7	TRPM8_HUMAN	transient receptor potential cation channel,	263	Cytoplasmic (Potential).					integral to membrane				skin(4)	4		Breast(86;0.00205)|Renal(207;0.00694)|all_lung(227;0.0129)|Lung NSC(271;0.0408)|all_hematologic(139;0.0753)|Acute lymphoblastic leukemia(138;0.224)		Epithelial(121;1.19e-17)|BRCA - Breast invasive adenocarcinoma(100;0.000139)|Lung(119;0.00758)|LUSC - Lung squamous cell carcinoma(224;0.0108)	Menthol(DB00825)													---	---	---	---
RNPEPL1	57140	broad.mit.edu	37	2	241517269	241517269	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:241517269G>A	uc002vzi.2	+	11	2038	c.1445G>A	c.(1444-1446)AGC>AAC	p.S482N	RNPEPL1_uc010fzf.2_Missense_Mutation_p.S388N|RNPEPL1_uc002vzj.2_Missense_Mutation_p.S130N	NM_018226	NP_060696	Q9HAU8	RNPL1_HUMAN	arginyl aminopeptidase (aminopeptidase B)-like	482					leukotriene biosynthetic process|proteolysis		aminopeptidase activity|metallopeptidase activity|zinc ion binding			large_intestine(1)|skin(1)	2		all_epithelial(40;1.13e-11)|Breast(86;0.000169)|Renal(207;0.00571)|Ovarian(221;0.104)|all_hematologic(139;0.182)|all_lung(227;0.204)|Melanoma(123;0.238)		Epithelial(32;3.05e-31)|all cancers(36;8.2e-29)|OV - Ovarian serous cystadenocarcinoma(60;8.55e-15)|Kidney(56;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;5.12e-06)|Lung(119;0.00168)|Colorectal(34;0.005)|LUSC - Lung squamous cell carcinoma(224;0.00813)|COAD - Colon adenocarcinoma(134;0.0322)														---	---	---	---
GPR35	2859	broad.mit.edu	37	2	241569626	241569626	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:241569626C>T	uc002vzs.1	+	1	832	c.257C>T	c.(256-258)ACG>ATG	p.T86M	GPR35_uc010fzh.1_Missense_Mutation_p.T117M|GPR35_uc010fzi.1_Missense_Mutation_p.T117M	NM_005301	NP_005292	Q9HC97	GPR35_HUMAN	G protein-coupled receptor 35	86	Extracellular (Potential).					integral to plasma membrane	G-protein coupled receptor activity			skin(2)|pancreas(1)	3		all_epithelial(40;7.49e-12)|Breast(86;0.000148)|Renal(207;0.00571)|Ovarian(221;0.104)|all_neural(83;0.107)|all_hematologic(139;0.182)|all_lung(227;0.186)|Melanoma(123;0.238)		Epithelial(32;5.29e-32)|all cancers(36;1.38e-29)|OV - Ovarian serous cystadenocarcinoma(60;2.13e-15)|Kidney(56;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;5.02e-06)|Lung(119;0.00163)|Colorectal(34;0.00463)|LUSC - Lung squamous cell carcinoma(224;0.008)|COAD - Colon adenocarcinoma(134;0.031)														---	---	---	---
CNTN6	27255	broad.mit.edu	37	3	1424848	1424848	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:1424848T>C	uc003boz.2	+	18	2656	c.2389T>C	c.(2389-2391)TCT>CCT	p.S797P	CNTN6_uc011asj.1_Missense_Mutation_p.S725P|CNTN6_uc003bpa.2_Missense_Mutation_p.S797P	NM_014461	NP_055276	Q9UQ52	CNTN6_HUMAN	contactin 6 precursor	797					axon guidance|cell adhesion|central nervous system development|Notch signaling pathway	anchored to membrane|plasma membrane				skin(3)|lung(2)|breast(2)|pancreas(1)	8		all_cancers(2;0.000164)|all_epithelial(2;0.107)		Epithelial(13;0.000233)|all cancers(10;0.0013)|OV - Ovarian serous cystadenocarcinoma(96;0.0139)														---	---	---	---
CNTN4	152330	broad.mit.edu	37	3	3081856	3081856	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:3081856G>A	uc003bpc.2	+	19	2520	c.2299G>A	c.(2299-2301)GTG>ATG	p.V767M	CNTN4_uc003bpb.1_Missense_Mutation_p.V438M|CNTN4_uc003bpe.2_Missense_Mutation_p.V439M|CNTN4_uc003bpf.2_Missense_Mutation_p.V438M|CNTN4_uc003bpg.2_Missense_Mutation_p.V23M	NM_175607	NP_783200	Q8IWV2	CNTN4_HUMAN	contactin 4 isoform a precursor	767	Fibronectin type-III 2.				axon guidance|axonal fasciculation|brain development|negative regulation of neuron differentiation|neuron cell-cell adhesion|regulation of synaptic plasticity	anchored to membrane|axon|extracellular region|plasma membrane	protein binding			large_intestine(2)|ovary(2)|lung(1)|central_nervous_system(1)|pancreas(1)	7		Ovarian(110;0.156)		Epithelial(13;0.000695)|all cancers(10;0.0047)|OV - Ovarian serous cystadenocarcinoma(96;0.01)														---	---	---	---
IL5RA	3568	broad.mit.edu	37	3	3143376	3143376	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:3143376C>A	uc011ask.1	-	6	1011	c.367G>T	c.(367-369)GGG>TGG	p.G123W	IL5RA_uc010hbq.2_Missense_Mutation_p.G123W|IL5RA_uc010hbr.2_Nonsense_Mutation_p.G123*|IL5RA_uc010hbs.2_Missense_Mutation_p.G123W|IL5RA_uc011asl.1_Missense_Mutation_p.G123W|IL5RA_uc011asm.1_Missense_Mutation_p.G123W|IL5RA_uc010hbt.2_Missense_Mutation_p.G123W|IL5RA_uc011asn.1_Missense_Mutation_p.G123W|IL5RA_uc010hbu.2_Missense_Mutation_p.G123W	NM_000564	NP_000555	Q01344	IL5RA_HUMAN	interleukin 5 receptor, alpha isoform 1	123	Extracellular (Potential).				cell proliferation	extracellular space|integral to membrane|plasma membrane	interleukin-5 receptor activity			ovary(1)	1				Epithelial(13;0.00278)|all cancers(10;0.00809)|OV - Ovarian serous cystadenocarcinoma(96;0.00944)														---	---	---	---
OXTR	5021	broad.mit.edu	37	3	8809756	8809756	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:8809756G>A	uc003brc.2	-	3	740	c.118C>T	c.(118-120)CGC>TGC	p.R40C		NM_000916	NP_000907	P30559	OXYR_HUMAN	oxytocin receptor	40	Helical; Name=1; (Potential).				female pregnancy|lactation|muscle contraction	integral to plasma membrane	oxytocin receptor activity|vasopressin receptor activity				0				OV - Ovarian serous cystadenocarcinoma(96;0.15)	Carbetocin(DB01282)													---	---	---	---
IRAK2	3656	broad.mit.edu	37	3	10206671	10206671	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10206671G>T	uc003bve.1	+	1	109	c.33G>T	c.(31-33)TGG>TGT	p.W11C		NM_001570	NP_001561	O43187	IRAK2_HUMAN	interleukin-1 receptor-associated kinase 2	11					activation of MAPK activity|I-kappaB kinase/NF-kappaB cascade|inflammatory response|innate immune response|interleukin-1-mediated signaling pathway|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of NF-kappaB transcription factor activity|positive regulation of NF-kappaB transcription factor activity|regulation of cytokine-mediated signaling pathway|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cell surface|cytosol|endosome membrane|plasma membrane	ATP binding|NF-kappaB-inducing kinase activity|protein heterodimerization activity|protein homodimerization activity			lung(5)|breast(3)	8																		---	---	---	---
SLC6A11	6538	broad.mit.edu	37	3	10861146	10861146	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10861146A>G	uc003bvz.2	+						SLC6A11_uc003bvy.1_Intron	NM_014229	NP_055044			solute carrier family 6 (neurotransmitter						neurotransmitter secretion	integral to plasma membrane	gamma-aminobutyric acid:sodium symporter activity|neurotransmitter:sodium symporter activity			skin(3)|ovary(1)	4				OV - Ovarian serous cystadenocarcinoma(96;0.229)														---	---	---	---
ATG7	10533	broad.mit.edu	37	3	11372885	11372885	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:11372885C>T	uc003bwc.2	+	8	867	c.750C>T	c.(748-750)GTC>GTT	p.V250V	ATG7_uc003bwd.2_Silent_p.V250V|ATG7_uc011aum.1_Silent_p.V211V	NM_006395	NP_006386	O95352	ATG7_HUMAN	APG7 autophagy 7-like isoform a	250					autophagy|cellular membrane fusion|positive regulation of protein modification process|protein lipidation|protein transport	cytoplasm	APG12 activating enzyme activity|protein homodimerization activity|ubiquitin activating enzyme activity			central_nervous_system(1)	1																		---	---	---	---
FBLN2	2199	broad.mit.edu	37	3	13679178	13679178	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:13679178G>A	uc011avb.1	+	17	3439	c.3314G>A	c.(3313-3315)CGC>CAC	p.R1105H	FBLN2_uc011auz.1_Missense_Mutation_p.R1131H|FBLN2_uc011ava.1_Missense_Mutation_p.R1152H|FBLN2_uc011avc.1_Missense_Mutation_p.R1152H	NM_001998	NP_001989	P98095	FBLN2_HUMAN	fibulin 2 isoform b precursor	1105	Domain III.					proteinaceous extracellular matrix	calcium ion binding|extracellular matrix structural constituent			ovary(1)	1			UCEC - Uterine corpus endometrioid carcinoma (1;0.00416)															---	---	---	---
RFTN1	23180	broad.mit.edu	37	3	16358500	16358500	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:16358500G>A	uc003cay.2	-	10	1854	c.1572C>T	c.(1570-1572)GGC>GGT	p.G524G	RFTN1_uc010hes.2_Silent_p.G488G|OXNAD1_uc003cax.2_Intron|OXNAD1_uc011awb.1_Intron	NM_015150	NP_055965	Q14699	RFTN1_HUMAN	raft-linking protein	524						plasma membrane				ovary(3)|central_nervous_system(1)	4																		---	---	---	---
THRB	7068	broad.mit.edu	37	3	24185082	24185082	+	Silent	SNP	G	A	A	rs143993214		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:24185082G>A	uc003ccx.3	-	8	997	c.648C>T	c.(646-648)GAC>GAT	p.D216D	THRB_uc010hfe.2_Silent_p.D216D|THRB_uc003ccy.3_Silent_p.D216D|THRB_uc003ccz.3_Silent_p.D211D	NM_001128176	NP_001121648	P10828	THB_HUMAN	thyroid hormone receptor, beta	216					regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	enzyme binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|thyroid hormone receptor activity|transcription corepressor activity|zinc ion binding			skin(2)|pancreas(1)	3					Levothyroxine(DB00451)|Liothyronine(DB00279)													---	---	---	---
NEK10	152110	broad.mit.edu	37	3	27326330	27326330	+	Splice_Site	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:27326330C>T	uc003cdt.1	-	22	2185	c.1911_splice	c.e22+1	p.Q637_splice	NEK10_uc003cds.1_Splice_Site_p.Q34_splice	NM_199347	NP_955379			NIMA-related kinase 10 isoform 3								ATP binding|metal ion binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(5)|stomach(2)|central_nervous_system(2)|lung(2)|skin(1)|pancreas(1)	13																		---	---	---	---
EOMES	8320	broad.mit.edu	37	3	27758906	27758906	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:27758906C>A	uc003cdx.2	-	6	1716	c.1716G>T	c.(1714-1716)ATG>ATT	p.M572I	EOMES_uc003cdy.3_Missense_Mutation_p.M591I|EOMES_uc010hfn.2_3'UTR|EOMES_uc011axc.1_Missense_Mutation_p.M296I	NM_005442	NP_005433	O95936	EOMES_HUMAN	eomesodermin	572	Required for transcription activation (By similarity).				CD8-positive, alpha-beta T cell differentiation involved in immune response|cell differentiation involved in embryonic placenta development|endoderm formation|mesoderm formation|mesodermal to mesenchymal transition involved in gastrulation|positive regulation of transcription, DNA-dependent	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(3)|breast(1)	4																		---	---	---	---
TRIM71	131405	broad.mit.edu	37	3	32859669	32859669	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:32859669T>C	uc003cff.2	+	1	160	c.97T>C	c.(97-99)TCG>CCG	p.S33P		NM_001039111	NP_001034200	Q2Q1W2	LIN41_HUMAN	tripartite motif-containing 71	33	RING-type.|Ser-rich.				multicellular organismal development	cytoplasm	zinc ion binding			ovary(2)|large_intestine(1)	3																		---	---	---	---
CRTAP	10491	broad.mit.edu	37	3	33165922	33165922	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:33165922G>A	uc003cfl.3	+	3	764	c.644G>A	c.(643-645)CGG>CAG	p.R215Q	CRTAP_uc010hfz.2_Missense_Mutation_p.R215Q|CRTAP_uc003cfm.2_Missense_Mutation_p.R36Q|CRTAP_uc003cfn.2_Missense_Mutation_p.R36Q	NM_006371	NP_006362	O75718	CRTAP_HUMAN	cartilage associated protein precursor	215						proteinaceous extracellular matrix	binding				0																		---	---	---	---
ACVR2B	93	broad.mit.edu	37	3	38524744	38524744	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38524744G>A	uc003cif.2	+	11	1484	c.1460G>A	c.(1459-1461)GGC>GAC	p.G487D	ACVR2B_uc003cig.2_Missense_Mutation_p.G278D	NM_001106	NP_001097	Q13705	AVR2B_HUMAN	activin A receptor, type IIB precursor	487	Cytoplasmic (Potential).				activin receptor signaling pathway|anterior/posterior pattern formation|BMP signaling pathway|positive regulation of activin receptor signaling pathway|positive regulation of bone mineralization|positive regulation of osteoblast differentiation|regulation of transcription, DNA-dependent	cell surface|cytoplasm|integral to plasma membrane	activin receptor activity|ATP binding|growth factor binding|metal ion binding|receptor signaling protein serine/threonine kinase activity|transforming growth factor beta receptor activity			lung(1)	1	Medulloblastoma(35;0.163)			KIRC - Kidney renal clear cell carcinoma(284;0.0565)|Kidney(284;0.071)														---	---	---	---
SCN5A	6331	broad.mit.edu	37	3	38592438	38592438	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38592438T>C	uc003cio.2	-	28	5619	c.5425A>G	c.(5425-5427)ATT>GTT	p.I1809V	SCN5A_uc003cin.2_Missense_Mutation_p.I1808V|SCN5A_uc003cil.3_Missense_Mutation_p.I1809V|SCN5A_uc010hhi.2_Missense_Mutation_p.I1791V|SCN5A_uc010hhk.2_Missense_Mutation_p.I1776V|SCN5A_uc011ayr.1_Missense_Mutation_p.I1755V	NM_198056	NP_932173	Q14524	SCN5A_HUMAN	voltage-gated sodium channel type V alpha	1809					blood circulation|cellular response to calcium ion|muscle contraction|regulation of heart contraction	sarcolemma|voltage-gated sodium channel complex	protein binding|voltage-gated sodium channel activity			ovary(4)|pancreas(2)|skin(2)|central_nervous_system(1)	9	Medulloblastoma(35;0.163)			KIRC - Kidney renal clear cell carcinoma(284;0.0822)|Kidney(284;0.1)	Benzonatate(DB00868)|Bepridil(DB01244)|Carbamazepine(DB00564)|Cocaine(DB00907)|Dibucaine(DB00527)|Disopyramide(DB00280)|Encainide(DB01228)|Ethotoin(DB00754)|Flecainide(DB01195)|Fosphenytoin(DB01320)|Hexylcaine(DB00473)|Indecainide(DB00192)|Lamotrigine(DB00555)|Lidocaine(DB00281)|Mephenytoin(DB00532)|Mexiletine(DB00379)|Mibefradil(DB01388)|Moricizine(DB00680)|Oxcarbazepine(DB00776)|Phenytoin(DB00252)|Prilocaine(DB00750)|Procainamide(DB01035)|Propafenone(DB01182)|Quinidine(DB00908)|Riluzole(DB00740)|Tocainide(DB01056)|Verapamil(DB00661)													---	---	---	---
SCN10A	6336	broad.mit.edu	37	3	38739967	38739967	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38739967G>A	uc003ciq.2	-	27	4744	c.4744C>T	c.(4744-4746)CGC>TGC	p.R1582C		NM_006514	NP_006505	Q9Y5Y9	SCNAA_HUMAN	sodium channel, voltage-gated, type X, alpha	1582	IV.|Helical; Voltage-sensor; Name=S4 of repeat IV; (Potential).				sensory perception	voltage-gated sodium channel complex				ovary(5)|skin(3)|large_intestine(1)|kidney(1)	10				KIRC - Kidney renal clear cell carcinoma(284;0.0769)|Kidney(284;0.0945)	Benzocaine(DB01086)|Bupivacaine(DB00297)|Chloroprocaine(DB01161)|Cocaine(DB00907)|Dibucaine(DB00527)|Dyclonine(DB00645)|Hexylcaine(DB00473)|Levobupivacaine(DB01002)|Lidocaine(DB00281)|Mepivacaine(DB00961)|Oxybuprocaine(DB00892)|Procaine(DB00721)|Proparacaine(DB00807)|Ropivacaine(DB00296)													---	---	---	---
SCN11A	11280	broad.mit.edu	37	3	38889120	38889120	+	Nonsense_Mutation	SNP	G	A	A	rs150141467		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38889120G>A	uc011ays.1	-	26	4640	c.4441C>T	c.(4441-4443)CGA>TGA	p.R1481*		NM_014139	NP_054858	Q9UI33	SCNBA_HUMAN	sodium channel, voltage-gated, type XI, alpha	1481	IV.|Helical; Voltage-sensor; Name=S4 of repeat IV; (By similarity).				response to drug	voltage-gated sodium channel complex	voltage-gated sodium channel activity			skin(6)|ovary(1)|haematopoietic_and_lymphoid_tissue(1)|pancreas(1)	9				Kidney(284;0.00202)|KIRC - Kidney renal clear cell carcinoma(284;0.00226)	Cocaine(DB00907)													---	---	---	---
XIRP1	165904	broad.mit.edu	37	3	39228640	39228640	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:39228640C>T	uc003cjk.1	-	2	2518	c.2297G>A	c.(2296-2298)AGC>AAC	p.S766N	XIRP1_uc003cji.2_Missense_Mutation_p.S766N|XIRP1_uc003cjj.2_Intron	NM_194293	NP_919269	Q702N8	XIRP1_HUMAN	xin actin-binding repeat containing 1	766							actin binding			ovary(4)|breast(2)|central_nervous_system(1)|pancreas(1)	8				KIRC - Kidney renal clear cell carcinoma(284;0.0517)|Kidney(284;0.065)														---	---	---	---
SEC22C	9117	broad.mit.edu	37	3	42605070	42605070	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:42605070G>T	uc003clj.2	-	3	409	c.291C>A	c.(289-291)TCC>TCA	p.S97S	SEC22C_uc003clh.2_Silent_p.S97S|SEC22C_uc011azo.1_Silent_p.S27S|SEC22C_uc010hic.2_Silent_p.S97S|SEC22C_uc003cli.2_Silent_p.S97S	NM_032970	NP_116752	Q9BRL7	SC22C_HUMAN	SEC22 vesicle trafficking protein homolog C	97	Longin.|Cytoplasmic (Potential).				ER to Golgi vesicle-mediated transport|protein transport	endoplasmic reticulum membrane|integral to membrane					0				KIRC - Kidney renal clear cell carcinoma(284;0.222)														---	---	---	---
ZNF445	353274	broad.mit.edu	37	3	44488178	44488178	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:44488178G>T	uc003cnf.2	-	8	3333	c.2985C>A	c.(2983-2985)AGC>AGA	p.S995R	ZNF445_uc011azv.1_Missense_Mutation_p.S983R|ZNF445_uc011azw.1_Missense_Mutation_p.S995R	NM_181489	NP_852466	P59923	ZN445_HUMAN	zinc finger protein 445	995	C2H2-type 13.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(197;0.0514)|Kidney(197;0.0646)														---	---	---	---
ZNF35	7584	broad.mit.edu	37	3	44700211	44700211	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:44700211T>C	uc003cnq.2	+	4	577	c.356T>C	c.(355-357)CTA>CCA	p.L119P	ZNF35_uc003cnr.2_5'UTR	NM_003420	NP_003411	P13682	ZNF35_HUMAN	zinc finger protein 35	119	Globular domain.				cellular response to retinoic acid|spermatogenesis	nucleus|perinuclear region of cytoplasm	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Ovarian(412;0.0228)		OV - Ovarian serous cystadenocarcinoma(275;2.49e-27)|KIRC - Kidney renal clear cell carcinoma(197;0.0475)|Kidney(197;0.0595)														---	---	---	---
CLEC3B	7123	broad.mit.edu	37	3	45077254	45077254	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:45077254C>T	uc003cok.3	+	3	543	c.447C>T	c.(445-447)GGC>GGT	p.G149G	CLEC3B_uc003col.2_Silent_p.G107G	NM_003278	NP_003269	P05452	TETN_HUMAN	C-type lectin domain family 3, member B	149	C-type lectin.				skeletal system development	extracellular space	protein binding|sugar binding				0				BRCA - Breast invasive adenocarcinoma(193;0.00863)|KIRC - Kidney renal clear cell carcinoma(197;0.0475)|Kidney(197;0.0595)	Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---
LTF	4057	broad.mit.edu	37	3	46487972	46487972	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:46487972C>A	uc003cpq.2	-	11	1354	c.1316G>T	c.(1315-1317)AGC>ATC	p.S439I	LTF_uc003fzr.2_Missense_Mutation_p.S395I|LTF_uc010hjh.2_Missense_Mutation_p.S437I|LTF_uc003cpr.2_Missense_Mutation_p.S426I	NM_002343	NP_002334	P02788	TRFL_HUMAN	lactotransferrin precursor	439	Transferrin-like 2.				cellular iron ion homeostasis|defense response to bacterium|humoral immune response|iron ion transport	extracellular region|stored secretory granule	ferric iron binding|heparin binding|protein binding|serine-type endopeptidase activity			central_nervous_system(2)|ovary(1)|lung(1)	4				all cancers(1;7.55e-14)|GBM - Glioblastoma multiforme(1;2.1e-09)|Epithelial(1;9.25e-07)|Colorectal(1;3.81e-05)|BRCA - Breast invasive adenocarcinoma(193;0.00129)|COAD - Colon adenocarcinoma(1;0.00308)|KIRC - Kidney renal clear cell carcinoma(197;0.0205)|Kidney(197;0.0242)|OV - Ovarian serous cystadenocarcinoma(275;0.089)	Pefloxacin(DB00487)													---	---	---	---
DHX30	22907	broad.mit.edu	37	3	47889884	47889884	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:47889884G>A	uc003cru.2	+						DHX30_uc003crt.2_Intron|MIR1226_hsa-mir-1226|MI0006313_5'Flank	NM_138615	NP_619520			DEAH (Asp-Glu-Ala-His) box polypeptide 30							mitochondrial nucleoid	ATP binding|ATP-dependent helicase activity|protein binding|RNA binding			ovary(2)|skin(2)	4				BRCA - Breast invasive adenocarcinoma(193;0.000696)|KIRC - Kidney renal clear cell carcinoma(197;0.00609)|Kidney(197;0.007)														---	---	---	---
COL7A1	1294	broad.mit.edu	37	3	48611124	48611124	+	Missense_Mutation	SNP	G	A	A	rs140543032		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48611124G>A	uc003ctz.2	-	81	6573	c.6572C>T	c.(6571-6573)CCG>CTG	p.P2191L		NM_000094	NP_000085	Q02388	CO7A1_HUMAN	alpha 1 type VII collagen precursor	2191	Triple-helical region.				cell adhesion|epidermis development	basement membrane|collagen type VII	protein binding|serine-type endopeptidase inhibitor activity			ovary(4)|breast(3)|skin(3)|central_nervous_system(1)	11				BRCA - Breast invasive adenocarcinoma(193;0.000293)|KIRC - Kidney renal clear cell carcinoma(197;0.00558)|Kidney(197;0.00632)														---	---	---	---
CELSR3	1951	broad.mit.edu	37	3	48692475	48692475	+	Splice_Site	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48692475A>G	uc003cul.2	-	6	5269	c.4988_splice	c.e6+1	p.K1663_splice	CELSR3_uc003cuf.1_Splice_Site_p.K1733_splice|CELSR3_uc010hkg.2_5'Flank	NM_001407	NP_001398			cadherin EGF LAG seven-pass G-type receptor 3						homophilic cell adhesion|multicellular organismal development|neuropeptide signaling pathway	integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(5)|upper_aerodigestive_tract(2)|central_nervous_system(2)|skin(2)	11				BRCA - Breast invasive adenocarcinoma(193;0.000292)|KIRC - Kidney renal clear cell carcinoma(197;0.00549)|Kidney(197;0.00619)														---	---	---	---
CELSR3	1951	broad.mit.edu	37	3	48692646	48692646	+	Intron	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48692646G>T	uc003cul.2	-						CELSR3_uc003cuf.1_Intron	NM_001407	NP_001398			cadherin EGF LAG seven-pass G-type receptor 3						homophilic cell adhesion|multicellular organismal development|neuropeptide signaling pathway	integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(5)|upper_aerodigestive_tract(2)|central_nervous_system(2)|skin(2)	11				BRCA - Breast invasive adenocarcinoma(193;0.000292)|KIRC - Kidney renal clear cell carcinoma(197;0.00549)|Kidney(197;0.00619)														---	---	---	---
CELSR3	1951	broad.mit.edu	37	3	48699498	48699498	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48699498G>A	uc003cul.2	-	1	851	c.570C>T	c.(568-570)AAC>AAT	p.N190N	CELSR3_uc003cuf.1_Silent_p.N260N	NM_001407	NP_001398	Q9NYQ7	CELR3_HUMAN	cadherin EGF LAG seven-pass G-type receptor 3	190	Extracellular (Potential).				homophilic cell adhesion|multicellular organismal development|neuropeptide signaling pathway	integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(5)|upper_aerodigestive_tract(2)|central_nervous_system(2)|skin(2)	11				BRCA - Breast invasive adenocarcinoma(193;0.000292)|KIRC - Kidney renal clear cell carcinoma(197;0.00549)|Kidney(197;0.00619)														---	---	---	---
LAMB2	3913	broad.mit.edu	37	3	49161199	49161199	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49161199G>T	uc003cwe.2	-	24	4058	c.3759C>A	c.(3757-3759)GCC>GCA	p.A1253A	USP19_uc003cvz.3_5'Flank|USP19_uc011bcg.1_5'Flank|USP19_uc003cwb.2_5'Flank|USP19_uc003cwd.1_5'Flank|USP19_uc011bch.1_5'Flank|USP19_uc011bci.1_5'Flank	NM_002292	NP_002283	P55268	LAMB2_HUMAN	laminin, beta 2 precursor	1253	Domain II.|Potential.				cell adhesion	laminin-11 complex|laminin-3 complex	structural molecule activity			ovary(3)	3				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.00219)|KIRC - Kidney renal clear cell carcinoma(197;0.00245)														---	---	---	---
RNF123	63891	broad.mit.edu	37	3	49742418	49742418	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49742418G>A	uc003cxh.2	+	23	2047	c.1961G>A	c.(1960-1962)CGC>CAC	p.R654H	RNF123_uc010hky.1_Missense_Mutation_p.R316H|RNF123_uc003cxi.2_RNA	NM_022064	NP_071347	Q5XPI4	RN123_HUMAN	ring finger protein 123	654						cytoplasm	ligase activity|protein binding|zinc ion binding			kidney(3)|ovary(1)|lung(1)|breast(1)|skin(1)	7				BRCA - Breast invasive adenocarcinoma(193;4.71e-05)|Kidney(197;0.00227)|KIRC - Kidney renal clear cell carcinoma(197;0.00255)														---	---	---	---
MST1R	4486	broad.mit.edu	37	3	49940481	49940481	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49940481C>T	uc003cxy.3	-	1	826	c.562G>A	c.(562-564)GTG>ATG	p.V188M	MST1R_uc011bdd.1_Missense_Mutation_p.V188M|MST1R_uc011bde.1_Missense_Mutation_p.V188M|MST1R_uc011bdf.1_Missense_Mutation_p.V188M|MST1R_uc011bdg.1_Missense_Mutation_p.V188M	NM_002447	NP_002438	Q04912	RON_HUMAN	macrophage stimulating 1 receptor precursor	188	Extracellular (Potential).|Sema.				cellular component movement|defense response|multicellular organismal development|positive regulation of cell proliferation|single fertilization|transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|macrophage colony-stimulating factor receptor activity|protein binding			ovary(5)|lung(1)	6				BRCA - Breast invasive adenocarcinoma(193;4.65e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.00553)|Kidney(197;0.00625)														---	---	---	---
VPRBP	9730	broad.mit.edu	37	3	51455629	51455629	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51455629A>G	uc003dbe.1	-	16	3627	c.3459T>C	c.(3457-3459)TCT>TCC	p.S1153S	VPRBP_uc003dbf.1_Silent_p.S429S	NM_014703	NP_055518	Q9Y4B6	VPRBP_HUMAN	HIV-1 Vpr binding protein	1153	WD 2.|WD repeat-like region.				interspecies interaction between organisms	cytoplasm|nucleus	protein binding			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.000272)|Kidney(197;0.000729)|KIRC - Kidney renal clear cell carcinoma(197;0.000875)														---	---	---	---
VPRBP	9730	broad.mit.edu	37	3	51464938	51464938	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51464938A>G	uc003dbe.1	-	12	1900	c.1732T>C	c.(1732-1734)TAT>CAT	p.Y578H		NM_014703	NP_055518	Q9Y4B6	VPRBP_HUMAN	HIV-1 Vpr binding protein	578					interspecies interaction between organisms	cytoplasm|nucleus	protein binding			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.000272)|Kidney(197;0.000729)|KIRC - Kidney renal clear cell carcinoma(197;0.000875)														---	---	---	---
VPRBP	9730	broad.mit.edu	37	3	51474173	51474173	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51474173A>G	uc003dbe.1	-							NM_014703	NP_055518			HIV-1 Vpr binding protein						interspecies interaction between organisms	cytoplasm|nucleus	protein binding			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.000272)|Kidney(197;0.000729)|KIRC - Kidney renal clear cell carcinoma(197;0.000875)														---	---	---	---
DNAH1	25981	broad.mit.edu	37	3	52423487	52423487	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52423487G>A	uc011bef.1	+	60	9767	c.9506G>A	c.(9505-9507)CGC>CAC	p.R3169H	DNAH1_uc003ddv.2_Missense_Mutation_p.R27H	NM_015512	NP_056327	Q9P2D7	DYH1_HUMAN	dynein, axonemal, heavy chain 1	3234					ciliary or flagellar motility|microtubule-based movement|response to mechanical stimulus	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			large_intestine(3)	3				BRCA - Breast invasive adenocarcinoma(193;2.02e-05)|OV - Ovarian serous cystadenocarcinoma(275;0.000207)|Kidney(197;0.0022)|KIRC - Kidney renal clear cell carcinoma(197;0.00245)														---	---	---	---
APPL1	26060	broad.mit.edu	37	3	57283464	57283464	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:57283464C>T	uc003dio.2	+	11	1087	c.940C>T	c.(940-942)CGT>TGT	p.R314C	APPL1_uc010hnb.2_Missense_Mutation_p.R314C|APPL1_uc011bey.1_Missense_Mutation_p.R297C	NM_012096	NP_036228	Q9UKG1	DP13A_HUMAN	adaptor protein, phosphotyrosine interaction, PH	314	Required for RAB5A binding.|PH.				apoptosis|cell cycle|cell proliferation|insulin receptor signaling pathway|regulation of apoptosis|regulation of establishment of protein localization in plasma membrane|regulation of glucose import	cytosol|early endosome membrane|microsome|nucleus|vesicle membrane	protein kinase B binding			breast(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.0124)|Kidney(284;0.0144)														---	---	---	---
PTPRG	5793	broad.mit.edu	37	3	62153736	62153736	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:62153736G>A	uc003dlb.2	+	8	1651	c.932G>A	c.(931-933)CGT>CAT	p.R311H	PTPRG_uc003dlc.2_Missense_Mutation_p.R311H	NM_002841	NP_002832	P23470	PTPRG_HUMAN	protein tyrosine phosphatase, receptor type, G	311	Extracellular (Potential).|Alpha-carbonic anhydrase.				transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	identical protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(5)|lung(2)	7				BRCA - Breast invasive adenocarcinoma(55;0.000376)|KIRC - Kidney renal clear cell carcinoma(10;0.0499)|Kidney(10;0.065)														---	---	---	---
PRICKLE2	166336	broad.mit.edu	37	3	64133071	64133071	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:64133071C>T	uc003dmf.2	-	7	1681	c.1095G>A	c.(1093-1095)CTG>CTA	p.L365L		NM_198859	NP_942559	Q7Z3G6	PRIC2_HUMAN	prickle-like 2	365						cytoplasm|nuclear membrane	zinc ion binding			ovary(4)|skin(1)	5		Lung NSC(201;0.136)		BRCA - Breast invasive adenocarcinoma(55;0.000971)|KIRC - Kidney renal clear cell carcinoma(15;0.00443)|Kidney(15;0.00497)														---	---	---	---
MAGI1	9223	broad.mit.edu	37	3	65416494	65416494	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:65416494G>A	uc003dmn.2	-	11	1952	c.1426C>T	c.(1426-1428)CGG>TGG	p.R476W	MAGI1_uc003dmm.2_Missense_Mutation_p.R476W|MAGI1_uc003dmo.2_Missense_Mutation_p.R476W|MAGI1_uc003dmp.2_Missense_Mutation_p.R476W|MAGI1_uc010hny.2_Missense_Mutation_p.R361W	NM_001033057	NP_001028229	Q96QZ7	MAGI1_HUMAN	membrane associated guanylate kinase, WW and PDZ	476	PDZ 2.				cell adhesion|cell surface receptor linked signaling pathway|protein complex assembly	tight junction	ATP binding|protein C-terminus binding			lung(2)|skin(1)|breast(1)|kidney(1)|pancreas(1)	6		Lung NSC(201;0.0016)		BRCA - Breast invasive adenocarcinoma(55;0.00138)|KIRC - Kidney renal clear cell carcinoma(15;0.0988)|Kidney(15;0.133)														---	---	---	---
KBTBD8	84541	broad.mit.edu	37	3	67058751	67058751	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:67058751G>A	uc003dmy.2	+	4	1801	c.1748G>A	c.(1747-1749)CGG>CAG	p.R583Q	KBTBD8_uc011bfv.1_Missense_Mutation_p.R141Q	NM_032505	NP_115894	Q8NFY9	KBTB8_HUMAN	T-cell activation kelch repeat protein	583	Kelch 5.									ovary(2)|large_intestine(1)|breast(1)	4		Lung NSC(201;0.0765)		BRCA - Breast invasive adenocarcinoma(55;6.02e-06)|KIRC - Kidney renal clear cell carcinoma(39;0.105)|Kidney(39;0.125)														---	---	---	---
ROBO2	6092	broad.mit.edu	37	3	77607139	77607139	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:77607139A>G	uc003dpy.3	+	9	1919	c.1276A>G	c.(1276-1278)AAC>GAC	p.N426D	ROBO2_uc003dpz.2_Missense_Mutation_p.N430D|ROBO2_uc011bgj.1_RNA|ROBO2_uc011bgk.1_Missense_Mutation_p.N430D	NM_002942	NP_002933	Q9HCK4	ROBO2_HUMAN	roundabout, axon guidance receptor, homolog 2	426	Ig-like C2-type 5.|Extracellular (Potential).				apoptosis involved in luteolysis|axon midline choice point recognition|cellular response to hormone stimulus|homophilic cell adhesion|metanephros development|negative regulation of negative chemotaxis|negative regulation of synaptogenesis|olfactory bulb interneuron development|positive regulation of axonogenesis|retinal ganglion cell axon guidance|ureteric bud development	axolemma|cell surface|integral to membrane	axon guidance receptor activity|identical protein binding			lung(5)|skin(3)|ovary(1)|large_intestine(1)|liver(1)	11				Epithelial(33;0.00199)|LUSC - Lung squamous cell carcinoma(21;0.008)|BRCA - Breast invasive adenocarcinoma(55;0.00884)|Lung(72;0.0183)|KIRC - Kidney renal clear cell carcinoma(39;0.0832)|Kidney(39;0.103)														---	---	---	---
ARL13B	200894	broad.mit.edu	37	3	93755588	93755588	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:93755588C>T	uc003drc.2	+	5	965	c.679C>T	c.(679-681)CGA>TGA	p.R227*	ARL13B_uc010hop.2_Nonsense_Mutation_p.R78*|ARL13B_uc003drd.2_Nonsense_Mutation_p.R120*|ARL13B_uc003dre.2_Nonsense_Mutation_p.R212*|ARL13B_uc003drf.2_Nonsense_Mutation_p.R227*|ARL13B_uc003drg.2_Nonsense_Mutation_p.R124*	NM_182896	NP_878899	Q3SXY8	AR13B_HUMAN	ADP-ribosylation factor-like 2-like 1 isoform 1	227	Potential.						GTP binding				0																		---	---	---	---
HHLA2	11148	broad.mit.edu	37	3	108095332	108095332	+	Intron	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108095332T>C	uc003dwy.3	+						HHLA2_uc011bhl.1_Intron|HHLA2_uc010hpu.2_Intron|HHLA2_uc003dwz.2_Intron	NM_007072	NP_009003			HERV-H LTR-associating 2 precursor							integral to membrane				ovary(1)	1																		---	---	---	---
ARHGAP31	57514	broad.mit.edu	37	3	119134094	119134094	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:119134094C>A	uc003ecj.3	+	12	3850	c.3318C>A	c.(3316-3318)TCC>TCA	p.S1106S		NM_020754	NP_065805	Q2M1Z3	RHG31_HUMAN	Cdc42 GTPase-activating protein	1106					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|focal adhesion|lamellipodium	GTPase activator activity			ovary(2)	2																		---	---	---	---
GTF2E1	2960	broad.mit.edu	37	3	120500198	120500198	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:120500198C>T	uc003edz.3	+	5	1315	c.1201C>T	c.(1201-1203)CGT>TGT	p.R401C		NM_005513	NP_005504	P29083	T2EA_HUMAN	general transcription factor IIE, polypeptide 1,	401					interspecies interaction between organisms|regulation of transcription, DNA-dependent|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|viral reproduction	nucleoplasm	protein binding|zinc ion binding			ovary(1)	1				GBM - Glioblastoma multiforme(114;0.159)														---	---	---	---
GOLGB1	2804	broad.mit.edu	37	3	121415620	121415620	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121415620G>A	uc003eei.3	-	13	3861	c.3735C>T	c.(3733-3735)GAC>GAT	p.D1245D	GOLGB1_uc010hrc.2_Silent_p.D1250D|GOLGB1_uc003eej.3_Silent_p.D1211D|GOLGB1_uc011bjm.1_Silent_p.D1131D|GOLGB1_uc010hrd.1_Silent_p.D1209D	NM_004487	NP_004478	Q14789	GOGB1_HUMAN	golgi autoantigen, golgin subfamily b,	1245	Cytoplasmic (Potential).|Potential.				Golgi organization	ER-Golgi intermediate compartment|Golgi membrane|Golgi stack|integral to membrane	protein binding			ovary(6)|breast(2)|skin(2)	10				GBM - Glioblastoma multiforme(114;0.0989)														---	---	---	---
GOLGB1	2804	broad.mit.edu	37	3	121416977	121416977	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121416977A>G	uc003eei.3	-	13	2504	c.2378T>C	c.(2377-2379)CTG>CCG	p.L793P	GOLGB1_uc010hrc.2_Missense_Mutation_p.L798P|GOLGB1_uc003eej.3_Missense_Mutation_p.L759P|GOLGB1_uc011bjm.1_Missense_Mutation_p.L679P|GOLGB1_uc010hrd.1_Missense_Mutation_p.L757P	NM_004487	NP_004478	Q14789	GOGB1_HUMAN	golgi autoantigen, golgin subfamily b,	793	Cytoplasmic (Potential).|Potential.				Golgi organization	ER-Golgi intermediate compartment|Golgi membrane|Golgi stack|integral to membrane	protein binding			ovary(6)|breast(2)|skin(2)	10				GBM - Glioblastoma multiforme(114;0.0989)														---	---	---	---
SEMA5B	54437	broad.mit.edu	37	3	122632777	122632777	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:122632777C>T	uc003efz.1	-	15	2364	c.2060G>A	c.(2059-2061)CGC>CAC	p.R687H	SEMA5B_uc011bju.1_Missense_Mutation_p.R629H|SEMA5B_uc003ega.1_RNA|SEMA5B_uc003egb.1_Missense_Mutation_p.R687H|SEMA5B_uc010hro.1_Missense_Mutation_p.R629H|SEMA5B_uc003efy.1_5'Flank	NM_001031702	NP_001026872	Q9P283	SEM5B_HUMAN	semaphorin 5B isoform 1	687	Extracellular (Potential).|TSP type-1 1.				cell differentiation|nervous system development	integral to membrane	receptor activity			ovary(2)|breast(2)|pancreas(2)|central_nervous_system(1)	7				GBM - Glioblastoma multiforme(114;0.0367)														---	---	---	---
KALRN	8997	broad.mit.edu	37	3	123987730	123987730	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:123987730C>T	uc003ehg.2	+	5	718	c.591C>T	c.(589-591)GCC>GCT	p.A197A	KALRN_uc010hrv.1_Silent_p.A197A|KALRN_uc003ehf.1_Silent_p.A197A|KALRN_uc011bjy.1_Silent_p.A197A	NM_001024660	NP_001019831	O60229	KALRN_HUMAN	kalirin, RhoGEF kinase isoform 1	197	Spectrin 1.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|nervous system development|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|vesicle-mediated transport	actin cytoskeleton|cytosol	ATP binding|GTPase activator activity|metal ion binding|protein binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(2)|ovary(2)|central_nervous_system(1)|skin(1)	6																		---	---	---	---
ATP2C1	27032	broad.mit.edu	37	3	130682921	130682921	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130682921C>T	uc003enl.2	+	13	1228	c.1006C>T	c.(1006-1008)CCT>TCT	p.P336S	ATP2C1_uc011blg.1_Missense_Mutation_p.P370S|ATP2C1_uc011blh.1_Missense_Mutation_p.P331S|ATP2C1_uc011bli.1_Missense_Mutation_p.P370S|ATP2C1_uc003enk.2_Missense_Mutation_p.P320S|ATP2C1_uc003enm.2_Missense_Mutation_p.P336S|ATP2C1_uc003enn.2_Missense_Mutation_p.P320S|ATP2C1_uc003eno.2_Missense_Mutation_p.P336S|ATP2C1_uc003enp.2_Missense_Mutation_p.P336S|ATP2C1_uc003enq.2_Missense_Mutation_p.P336S|ATP2C1_uc003enr.2_Missense_Mutation_p.P336S|ATP2C1_uc003ens.2_Missense_Mutation_p.P336S|ATP2C1_uc003ent.2_Missense_Mutation_p.P336S|ATP2C1_uc003enu.2_Missense_Mutation_p.P14S	NM_014382	NP_055197	P98194	AT2C1_HUMAN	calcium-transporting ATPase 2C1 isoform 1a	336	Cytoplasmic (By similarity).				actin cytoskeleton reorganization|ATP biosynthetic process|calcium-dependent cell-cell adhesion|cellular calcium ion homeostasis|cellular manganese ion homeostasis|epidermis development|Golgi calcium ion homeostasis|Golgi calcium ion transport|positive regulation of I-kappaB kinase/NF-kappaB cascade	Golgi apparatus|Golgi membrane|integral to membrane|trans-Golgi network	ATP binding|ATP binding|calcium ion binding|calcium-transporting ATPase activity|manganese ion binding|manganese-transporting ATPase activity|metal ion binding|signal transducer activity			skin(1)	1					Arsenic trioxide(DB01169)|Desflurane(DB01189)|Enflurane(DB00228)|Halothane(DB01159)|Isoflurane(DB00753)|Methoxyflurane(DB01028)|Miconazole(DB01110)|Sevoflurane(DB01236)									Hailey-Hailey_disease				---	---	---	---
ACAD11	84129	broad.mit.edu	37	3	132323997	132323997	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132323997T>C	uc003eov.3	-	12	1847	c.1467A>G	c.(1465-1467)AAA>AAG	p.K489K	ACAD11_uc011blr.1_Silent_p.K100K	NM_032169	NP_115545	Q709F0	ACD11_HUMAN	putative acyl-CoA dehydrogenase	489						peroxisome	acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding|transferase activity, transferring phosphorus-containing groups			ovary(1)	1																		---	---	---	---
NPHP3	27031	broad.mit.edu	37	3	132403629	132403629	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132403629G>A	uc003epe.1	-	24	3416	c.3339C>T	c.(3337-3339)GAC>GAT	p.D1113D	NPHP3_uc003eoz.1_5'UTR|NPHP3_uc003epd.1_Silent_p.D355D	NM_153240	NP_694972	Q7Z494	NPHP3_HUMAN	nephrocystin 3	1113	TPR 7.				maintenance of organ identity|negative regulation of canonical Wnt receptor signaling pathway|photoreceptor cell maintenance|regulation of Wnt receptor signaling pathway, planar cell polarity pathway|Wnt receptor signaling pathway	cilium	protein binding			ovary(1)	1																		---	---	---	---
TF	7018	broad.mit.edu	37	3	133476768	133476768	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133476768C>T	uc003epu.1	+	13	2754	c.1026C>T	c.(1024-1026)ATC>ATT	p.I342I	TF_uc011blt.1_Silent_p.I215I|TF_uc003epw.1_Intron|TF_uc003epv.1_Silent_p.I342I	NM_001063	NP_001054	P02787	TRFE_HUMAN	transferrin precursor	342	Transferrin-like 1.				cellular iron ion homeostasis|platelet activation|platelet degranulation|transferrin transport|transmembrane transport	apical plasma membrane|basal plasma membrane|coated pit|early endosome|endocytic vesicle|endosome membrane|extracellular region|late endosome|perinuclear region of cytoplasm|recycling endosome|stored secretory granule	ferric iron binding			ovary(1)|skin(1)	2					Aluminium(DB01370)|Bismuth(DB01402)|Iron Dextran(DB00893)													---	---	---	---
PCCB	5096	broad.mit.edu	37	3	136048788	136048788	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:136048788C>T	uc003eqy.1	+	15	1591	c.1540C>T	c.(1540-1542)CGA>TGA	p.R514*	PCCB_uc003eqz.1_Nonsense_Mutation_p.R514*|PCCB_uc011bmc.1_Nonsense_Mutation_p.R534*	NM_000532	NP_000523	P05166	PCCB_HUMAN	propionyl Coenzyme A carboxylase, beta	514	Carboxyltransferase.				fatty acid beta-oxidation	mitochondrial matrix	ATP binding|propionyl-CoA carboxylase activity				0					Biotin(DB00121)|L-Valine(DB00161)													---	---	---	---
FOXL2	668	broad.mit.edu	37	3	138665438	138665438	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:138665438C>T	uc003esw.2	-	1	545	c.127G>A	c.(127-129)GGG>AGG	p.G43R	uc003esv.1_5'Flank|C3orf72_uc003esx.1_5'Flank|C3orf72_uc011bmr.1_5'Flank	NM_023067	NP_075555	P58012	FOXL2_HUMAN	forkhead box L2	43	Poly-Gly.				convergent extension|DNA fragmentation involved in apoptotic nuclear change|embryonic eye morphogenesis|extraocular skeletal muscle development|female somatic sex determination|induction of apoptosis|menstruation|negative regulation of transcription, DNA-dependent|ovarian follicle development|pattern specification process|positive regulation of caspase activity|positive regulation of transcription from RNA polymerase II promoter|regulation of sequence-specific DNA binding transcription factor activity	transcription factor complex	caspase regulator activity|DNA bending activity|double-stranded DNA binding|estrogen receptor binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding|ubiquitin conjugating enzyme binding			ovary(266)|large_intestine(1)|skin(1)	268								Mis		granulosa-cell tumour of the ovary		Blepharophimosis|ptosis and epicanthus inversus Types I|II; Premature ovarian failure type III						---	---	---	---
COPB2	9276	broad.mit.edu	37	3	139077618	139077618	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:139077618C>A	uc003etf.3	-	20	2651	c.2521G>T	c.(2521-2523)GAC>TAC	p.D841Y	COPB2_uc011bmv.1_Missense_Mutation_p.D812Y|COPB2_uc010hui.2_Missense_Mutation_p.D812Y	NM_004766	NP_004757	P35606	COPB2_HUMAN	coatomer protein complex, subunit beta 2 (beta	841					COPI coating of Golgi vesicle|intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat|cytosol	protein binding|structural molecule activity			ovary(2)	2																		---	---	---	---
COPB2	9276	broad.mit.edu	37	3	139093415	139093415	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:139093415G>A	uc003etf.3	-	7	797	c.667C>T	c.(667-669)CAG>TAG	p.Q223*	COPB2_uc011bmv.1_Nonsense_Mutation_p.Q194*|COPB2_uc010hui.2_Nonsense_Mutation_p.Q194*|COPB2_uc011bmw.1_Nonsense_Mutation_p.Q223*	NM_004766	NP_004757	P35606	COPB2_HUMAN	coatomer protein complex, subunit beta 2 (beta	223	WD 5.				COPI coating of Golgi vesicle|intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat|cytosol	protein binding|structural molecule activity			ovary(2)	2																		---	---	---	---
XRN1	54464	broad.mit.edu	37	3	142051258	142051258	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142051258T>C	uc003eus.2	-	36	4245	c.4178A>G	c.(4177-4179)GAA>GGA	p.E1393G	XRN1_uc010huu.2_Missense_Mutation_p.E860G|XRN1_uc003eut.2_Missense_Mutation_p.E1393G|XRN1_uc003euu.2_Missense_Mutation_p.E1394G	NM_019001	NP_061874	Q8IZH2	XRN1_HUMAN	5'-3' exoribonuclease 1 isoform a	1393					exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay|histone mRNA catabolic process|nuclear mRNA surveillance|rRNA catabolic process	cytosol|Golgi apparatus|intermediate filament cytoskeleton|plasma membrane	5'-3' exonuclease activity|DNA binding|protein binding|RNA binding			ovary(3)	3																		---	---	---	---
XRN1	54464	broad.mit.edu	37	3	142137373	142137373	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142137373G>A	uc003eus.2	-	12	1386	c.1319C>T	c.(1318-1320)ACG>ATG	p.T440M	XRN1_uc003eut.2_Missense_Mutation_p.T440M|XRN1_uc003euu.2_Missense_Mutation_p.T440M|XRN1_uc003euv.1_Missense_Mutation_p.T301M|XRN1_uc003euw.2_Missense_Mutation_p.T440M|XRN1_uc011bnh.1_Missense_Mutation_p.T230M	NM_019001	NP_061874	Q8IZH2	XRN1_HUMAN	5'-3' exoribonuclease 1 isoform a	440					exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay|histone mRNA catabolic process|nuclear mRNA surveillance|rRNA catabolic process	cytosol|Golgi apparatus|intermediate filament cytoskeleton|plasma membrane	5'-3' exonuclease activity|DNA binding|protein binding|RNA binding			ovary(3)	3																		---	---	---	---
ATR	545	broad.mit.edu	37	3	142272237	142272237	+	Silent	SNP	G	A	A	rs150512706		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142272237G>A	uc003eux.3	-	13	2759	c.2637C>T	c.(2635-2637)GCC>GCT	p.A879A		NM_001184	NP_001175	Q13535	ATR_HUMAN	ataxia telangiectasia and Rad3 related protein	879					cell cycle|cellular response to gamma radiation|cellular response to UV|DNA damage checkpoint|DNA repair|DNA replication|multicellular organismal development|negative regulation of DNA replication|peptidyl-serine phosphorylation|positive regulation of DNA damage response, signal transduction by p53 class mediator|protein autophosphorylation|replicative senescence	PML body	ATP binding|DNA binding|MutLalpha complex binding|MutSalpha complex binding|protein serine/threonine kinase activity			lung(5)|skin(5)|breast(4)|ovary(3)|stomach(1)|central_nervous_system(1)|liver(1)	20													Other_conserved_DNA_damage_response_genes					---	---	---	---
CHST2	9435	broad.mit.edu	37	3	142840671	142840671	+	Missense_Mutation	SNP	C	T	T	rs145959139		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142840671C>T	uc003evm.2	+	2	1902	c.1013C>T	c.(1012-1014)GCG>GTG	p.A338V		NM_004267	NP_004258	Q9Y4C5	CHST2_HUMAN	carbohydrate (N-acetylglucosamine-6-O)	338	Lumenal (Potential).|PAPS (Probable).				inflammatory response|multicellular organismal development|N-acetylglucosamine metabolic process|sulfur compound metabolic process	integral to membrane|intrinsic to Golgi membrane|trans-Golgi network	N-acetylglucosamine 6-O-sulfotransferase activity			ovary(3)	3																		---	---	---	---
SELT	51714	broad.mit.edu	37	3	150344892	150344892	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:150344892A>G	uc011bnx.1	+	6	643	c.559A>G	c.(559-561)ATG>GTG	p.M187V		NM_016275	NP_057359	P62341	SELT_HUMAN	selenoprotein T precursor	187					cell redox homeostasis|selenocysteine incorporation		selenium binding				0			LUSC - Lung squamous cell carcinoma(72;0.0538)|Lung(72;0.066)															---	---	---	---
VEPH1	79674	broad.mit.edu	37	3	157081500	157081500	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:157081500T>C	uc003fbj.1	-	9	1705	c.1388A>G	c.(1387-1389)GAT>GGT	p.D463G	VEPH1_uc003fbk.1_Missense_Mutation_p.D463G|VEPH1_uc010hvu.1_Missense_Mutation_p.D463G	NM_024621	NP_078897	Q14D04	MELT_HUMAN	ventricular zone expressed PH domain homolog 1	463						plasma membrane				breast(3)|ovary(1)|lung(1)	5			Lung(72;0.0272)|LUSC - Lung squamous cell carcinoma(72;0.0461)															---	---	---	---
WDR49	151790	broad.mit.edu	37	3	167319987	167319987	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:167319987G>A	uc003fev.1	-	3	486	c.180C>T	c.(178-180)GGC>GGT	p.G60G	WDR49_uc011bpd.1_Silent_p.G113G|WDR49_uc003few.1_Silent_p.G401G	NM_178824	NP_849146	Q8IV35	WDR49_HUMAN	WD repeat domain 49	60	WD 2.									large_intestine(1)|ovary(1)|skin(1)	3																		---	---	---	---
PHC3	80012	broad.mit.edu	37	3	169890411	169890411	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169890411C>T	uc010hws.1	-	3	298	c.234G>A	c.(232-234)CTG>CTA	p.L78L	PHC3_uc003fgl.2_Silent_p.L90L|PHC3_uc011bpq.1_Silent_p.L90L|PHC3_uc011bpr.1_Silent_p.L90L|PHC3_uc003fgm.2_Silent_p.L90L|PHC3_uc003fgo.1_Silent_p.L74L|PHC3_uc003fgp.3_Silent_p.L86L|PHC3_uc003fgq.3_Silent_p.L90L	NM_024947	NP_079223	Q8NDX5	PHC3_HUMAN	polyhomeotic like 3	78					multicellular organismal development	PcG protein complex	DNA binding|zinc ion binding			ovary(1)|central_nervous_system(1)	2	all_cancers(22;2.67e-22)|all_epithelial(15;4.73e-27)|all_lung(20;6.31e-17)|Lung NSC(18;2.61e-16)|Ovarian(172;0.000337)|Breast(254;0.169)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.0655)															---	---	---	---
KCNMB3	27094	broad.mit.edu	37	3	178984477	178984477	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:178984477C>T	uc003fjp.1	-	1	362	c.22G>A	c.(22-24)GTG>ATG	p.V8M	KCNMB3_uc011bqc.1_Missense_Mutation_p.V8M	NM_171828	NP_741979	Q9NPA1	KCMB3_HUMAN	calcium-activated potassium channel beta 3	Error:Variant_position_missing_in_Q9NPA1_after_alignment					detection of calcium ion|platelet activation|regulation of action potential in neuron	voltage-gated potassium channel complex	calcium-activated potassium channel activity|potassium channel regulator activity				0	all_cancers(143;5.6e-17)|Ovarian(172;0.0172)|Breast(254;0.155)		OV - Ovarian serous cystadenocarcinoma(80;2.41e-27)|GBM - Glioblastoma multiforme(14;0.003)|BRCA - Breast invasive adenocarcinoma(182;0.03)															---	---	---	---
USP13	8975	broad.mit.edu	37	3	179448448	179448448	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179448448C>A	uc003fkh.2	+	10	1286	c.1205C>A	c.(1204-1206)CCT>CAT	p.P402H	USP13_uc003fkf.2_Missense_Mutation_p.P402H	NM_003940	NP_003931	Q92995	UBP13_HUMAN	ubiquitin thiolesterase 13	402					ubiquitin-dependent protein catabolic process		cysteine-type endopeptidase activity|omega peptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity|zinc ion binding			ovary(1)	1	all_cancers(143;7.79e-15)|Ovarian(172;0.0338)|Breast(254;0.148)		OV - Ovarian serous cystadenocarcinoma(80;1e-25)|GBM - Glioblastoma multiforme(14;0.0169)															---	---	---	---
PEX5L	51555	broad.mit.edu	37	3	179754369	179754369	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179754369G>A	uc003fki.1	-	1	149	c.19C>T	c.(19-21)CAG>TAG	p.Q7*	PEX5L_uc003fkj.1_Nonsense_Mutation_p.Q7*|PEX5L_uc010hxd.1_Nonsense_Mutation_p.Q7*|PEX5L_uc011bqg.1_Nonsense_Mutation_p.Q7*|PEX5L_uc011bqh.1_Nonsense_Mutation_p.Q7*	NM_016559	NP_057643	Q8IYB4	PEX5R_HUMAN	peroxisomal biogenesis factor 5-like	7					protein import into peroxisome matrix|regulation of cAMP-mediated signaling	cytosol|peroxisomal membrane	peroxisome matrix targeting signal-1 binding			ovary(3)|large_intestine(1)	4	all_cancers(143;3.94e-14)|Ovarian(172;0.0338)|Breast(254;0.183)		OV - Ovarian serous cystadenocarcinoma(80;1.75e-26)|GBM - Glioblastoma multiforme(14;0.000518)															---	---	---	---
MAP6D1	79929	broad.mit.edu	37	3	183535841	183535841	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183535841C>T	uc003fmc.2	-	2	518	c.460G>A	c.(460-462)GCC>ACC	p.A154T		NM_024871	NP_079147	Q9H9H5	MA6D1_HUMAN	MAP6 domain containing 1	154						cytoskeleton					0	all_cancers(143;6.55e-10)|Ovarian(172;0.0303)		all cancers(12;5.15e-42)|Epithelial(37;4.29e-36)|OV - Ovarian serous cystadenocarcinoma(80;6.48e-22)															---	---	---	---
PDE6B	5158	broad.mit.edu	37	4	619512	619512	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:619512G>A	uc003gap.2	+	1	150	c.97G>A	c.(97-99)GCC>ACC	p.A33T	PDE6B_uc003gao.3_Missense_Mutation_p.A33T	NM_000283	NP_000274	P35913	PDE6B_HUMAN	phosphodiesterase 6B isoform 1	33				AAA -> GRG (in Ref. 1; CAA44569, 2; CAA46932 and 3; AAB22690).	cytosolic calcium ion homeostasis|GMP metabolic process|phototransduction, visible light|platelet activation|visual perception	cytosol|membrane	3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding				0																		---	---	---	---
PDE6B	5158	broad.mit.edu	37	4	619707	619707	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:619707C>T	uc003gap.2	+	1	345	c.292C>T	c.(292-294)CGC>TGC	p.R98C	PDE6B_uc003gao.3_Missense_Mutation_p.R98C	NM_000283	NP_000274	P35913	PDE6B_HUMAN	phosphodiesterase 6B isoform 1	98	GAF 1.				cytosolic calcium ion homeostasis|GMP metabolic process|phototransduction, visible light|platelet activation|visual perception	cytosol|membrane	3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding				0																		---	---	---	---
TMEM175	84286	broad.mit.edu	37	4	941650	941650	+	Silent	SNP	C	T	T	rs34645349	byFrequency;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:941650C>T	uc003gbq.2	+	2	221	c.123C>T	c.(121-123)GAC>GAT	p.D41D	TMEM175_uc010ibl.1_Silent_p.D41D|TMEM175_uc003gbp.1_Translation_Start_Site|TMEM175_uc003gbr.2_Translation_Start_Site|TMEM175_uc003gbu.2_Intron|TMEM175_uc003gbs.2_Translation_Start_Site|TMEM175_uc003gbt.2_Translation_Start_Site|TMEM175_uc003gbv.2_Intron	NM_032326	NP_115702	Q9BSA9	TM175_HUMAN	transmembrane protein 175	41	Helical; (Potential).					integral to membrane					0			OV - Ovarian serous cystadenocarcinoma(23;0.0158)															---	---	---	---
MFSD10	10227	broad.mit.edu	37	4	2932779	2932779	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:2932779C>T	uc003gfw.2	-						MFSD10_uc003gfv.2_Intron|MFSD10_uc003gfx.2_Intron|MFSD10_uc003gfz.2_Intron|MFSD10_uc003gfy.2_Intron|MFSD10_uc003gga.2_Intron|MFSD10_uc003ggb.1_Missense_Mutation_p.A421T|MFSD10_uc003ggc.2_3'UTR	NM_001120	NP_001111			major facilitator superfamily domain containing						apoptosis	integral to membrane	tetracycline transporter activity				0				UCEC - Uterine corpus endometrioid carcinoma (64;0.163)														---	---	---	---
HTT	3064	broad.mit.edu	37	4	3208281	3208281	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:3208281A>G	uc011bvq.1	+	44	5928	c.5783A>G	c.(5782-5784)GAT>GGT	p.D1928G		NM_002111	NP_002102	P42858	HD_HUMAN	huntingtin	1926					establishment of mitotic spindle orientation|Golgi organization|retrograde vesicle-mediated transport, Golgi to ER|vesicle transport along microtubule	autophagic vacuole|axon|cytoplasmic vesicle membrane|cytosol|dendrite|endoplasmic reticulum|Golgi apparatus|late endosome|membrane fraction|nucleus|protein complex	beta-tubulin binding|dynactin binding|dynein intermediate chain binding|p53 binding|transcription factor binding			skin(2)|ovary(1)|lung(1)	4		all_epithelial(65;0.18)		UCEC - Uterine corpus endometrioid carcinoma (64;0.187)														---	---	---	---
CYTL1	54360	broad.mit.edu	37	4	5016866	5016866	+	3'UTR	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:5016866G>A	uc003gig.2	-	4						NM_018659	NP_061129			cytokine-like 1 precursor						signal transduction	extracellular space|soluble fraction	receptor binding			skin(1)	1				UCEC - Uterine corpus endometrioid carcinoma (64;0.164)														---	---	---	---
EVC	2121	broad.mit.edu	37	4	5803721	5803721	+	Silent	SNP	C	T	T	rs138114051		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:5803721C>T	uc003gil.1	+	16	2533	c.2349C>T	c.(2347-2349)AGC>AGT	p.S783S	EVC_uc003gim.1_RNA|CRMP1_uc003gin.1_Intron	NM_153717	NP_714928	P57679	EVC_HUMAN	Ellis van Creveld syndrome protein	783					muscle organ development	integral to membrane				ovary(1)|skin(1)	2		Myeloproliferative disorder(84;0.117)																---	---	---	---
WFS1	7466	broad.mit.edu	37	4	6296857	6296857	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:6296857G>A	uc003giy.2	+	7	968	c.802G>A	c.(802-804)GAC>AAC	p.D268N	WFS1_uc003gix.2_Missense_Mutation_p.D268N|WFS1_uc003giz.2_Missense_Mutation_p.D86N	NM_001145853	NP_001139325	O76024	WFS1_HUMAN	wolframin	268					endoplasmic reticulum calcium ion homeostasis|endoplasmic reticulum unfolded protein response|ER overload response|ER-associated protein catabolic process|glucose homeostasis|kidney development|negative regulation of neuron apoptosis|negative regulation of sequence-specific DNA binding transcription factor activity|polyubiquitinated misfolded protein transport|positive regulation of calcium ion transport|positive regulation of growth|positive regulation of protein ubiquitination|positive regulation of proteolysis|protein stabilization|renal water homeostasis|sensory perception of sound|visual perception	dendrite|integral to endoplasmic reticulum membrane	activating transcription factor binding|ATPase binding|transporter activity|ubiquitin protein ligase binding			central_nervous_system(2)	2				Colorectal(103;0.0512)														---	---	---	---
TBC1D14	57533	broad.mit.edu	37	4	6925426	6925426	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:6925426G>A	uc011bwg.1	+	2	389	c.310G>A	c.(310-312)GCC>ACC	p.A104T	TBC1D14_uc003gjs.3_Missense_Mutation_p.A104T	NM_001113361	NP_001106832	Q9P2M4	TBC14_HUMAN	TBC1 domain family, member 14 isoform a	104						intracellular	Rab GTPase activator activity			ovary(1)|pancreas(1)	2																		---	---	---	---
CCDC96	257236	broad.mit.edu	37	4	7043869	7043869	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:7043869G>A	uc003gjv.2	-	1	860	c.797C>T	c.(796-798)GCT>GTT	p.A266V	TADA2B_uc003gjw.3_5'Flank|TADA2B_uc010idi.2_5'Flank	NM_153376	NP_699207	Q2M329	CCD96_HUMAN	coiled-coil domain containing 96	266											0																		---	---	---	---
PSAPL1	768239	broad.mit.edu	37	4	7435122	7435122	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:7435122G>A	uc011bwj.1	-	1	1579	c.1485C>T	c.(1483-1485)GCC>GCT	p.A495A	SORCS2_uc003gkb.3_Intron|SORCS2_uc011bwi.1_Intron	NM_001085382	NP_001078851	Q6NUJ1	SAPL1_HUMAN	prosaposin-like protein 1	495	Saposin A-type 2.				sphingolipid metabolic process	extracellular region|lysosome					0																		---	---	---	---
AFAP1	60312	broad.mit.edu	37	4	7802370	7802370	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:7802370G>A	uc003gkg.1	-	10	1338	c.1065C>T	c.(1063-1065)AAC>AAT	p.N355N	AFAP1_uc011bwk.1_Silent_p.N355N	NM_198595	NP_940997	Q8N556	AFAP1_HUMAN	actin filament associated protein 1	355	PH 2.					actin cytoskeleton|cytoplasm|focal adhesion	actin binding				0																		---	---	---	---
BOD1L	259282	broad.mit.edu	37	4	13605718	13605718	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:13605718C>T	uc003gmz.1	-	10	2923	c.2806G>A	c.(2806-2808)GCA>ACA	p.A936T	BOD1L_uc010idr.1_Missense_Mutation_p.A273T	NM_148894	NP_683692	Q8NFC6	BOD1L_HUMAN	biorientation of chromosomes in cell division	936	Lys-rich.						DNA binding			ovary(5)|breast(1)	6																		---	---	---	---
DHX15	1665	broad.mit.edu	37	4	24542564	24542564	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:24542564G>A	uc003gqx.2	-	9	1661	c.1493C>T	c.(1492-1494)ACC>ATC	p.T498I	DHX15_uc003gqw.2_5'Flank	NM_001358	NP_001349	O43143	DHX15_HUMAN	DEAH (Asp-Glu-Ala-His) box polypeptide 15	498	Helicase C-terminal.				mRNA processing	U12-type spliceosomal complex	ATP binding|ATP-dependent helicase activity|nucleic acid binding|RNA helicase activity			ovary(1)	1		Breast(46;0.0503)																---	---	---	---
ZCCHC4	29063	broad.mit.edu	37	4	25335563	25335563	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:25335563T>C	uc003grl.3	+	5	675	c.639T>C	c.(637-639)GGT>GGC	p.G213G	ZCCHC4_uc003grm.1_RNA|ZCCHC4_uc003grn.3_5'UTR	NM_024936	NP_079212	Q9H5U6	ZCHC4_HUMAN	zinc finger, CCHC domain containing 4	213							methyltransferase activity|nucleic acid binding|zinc ion binding			ovary(2)	2		Breast(46;0.0503)																---	---	---	---
KLHL5	51088	broad.mit.edu	37	4	39077615	39077615	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:39077615C>A	uc003gts.2	+	2	627	c.552C>A	c.(550-552)TCC>TCA	p.S184S	KLHL5_uc003gtp.2_Silent_p.S138S|KLHL5_uc003gtq.2_Translation_Start_Site|KLHL5_uc003gtr.1_Silent_p.S184S|KLHL5_uc003gtt.2_Intron	NM_015990	NP_057074	Q96PQ7	KLHL5_HUMAN	kelch-like 5 isoform 1	184						cytoplasm|cytoskeleton	actin binding			ovary(1)	1																		---	---	---	---
LNX1	84708	broad.mit.edu	37	4	54439943	54439943	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:54439943G>A	uc003hag.3	-	2	483	c.227C>T	c.(226-228)CCC>CTC	p.P76L	PDGFRA_uc003haa.2_Intron|LNX1_uc003hah.3_RNA	NM_001126328	NP_001119800	Q8TBB1	LNX1_HUMAN	ligand of numb-protein X 1 isoform a	76	RING-type.					cytoplasm	zinc ion binding			ovary(2)|central_nervous_system(2)	4	all_neural(26;0.153)		GBM - Glioblastoma multiforme(3;8.2e-46)|LUSC - Lung squamous cell carcinoma(32;0.0134)															---	---	---	---
LPHN3	23284	broad.mit.edu	37	4	62800606	62800606	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:62800606G>A	uc010ihh.2	+	11	2130	c.1957G>A	c.(1957-1959)GCA>ACA	p.A653T	LPHN3_uc003hcq.3_Missense_Mutation_p.A653T|LPHN3_uc003hct.2_Missense_Mutation_p.A46T|LPHN3_uc003hcs.1_Missense_Mutation_p.A469T	NM_015236	NP_056051	Q9HAR2	LPHN3_HUMAN	latrophilin 3 precursor	640	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity|sugar binding			lung(15)|ovary(1)|central_nervous_system(1)|pancreas(1)	18																		---	---	---	---
EPHA5	2044	broad.mit.edu	37	4	66233137	66233137	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:66233137C>T	uc003hcy.2	-	10	2055	c.1862G>A	c.(1861-1863)TGT>TAT	p.C621Y	EPHA5_uc003hcx.2_Missense_Mutation_p.C553Y|EPHA5_uc003hcz.2_Missense_Mutation_p.C599Y|EPHA5_uc011cah.1_Missense_Mutation_p.C622Y|EPHA5_uc011cai.1_Missense_Mutation_p.C600Y|EPHA5_uc003hda.2_Missense_Mutation_p.C622Y	NM_004439	NP_004430	P54756	EPHA5_HUMAN	ephrin receptor EphA5 isoform a precursor	621	Cytoplasmic (Potential).				cAMP-mediated signaling|neuron development	dendrite|external side of plasma membrane|integral to plasma membrane|neuronal cell body|perinuclear region of cytoplasm|rough endoplasmic reticulum	ATP binding|transmembrane-ephrin receptor activity			lung(19)|stomach(2)|ovary(2)|central_nervous_system(1)	24															TSP Lung(17;0.13)			---	---	---	---
RUFY3	22902	broad.mit.edu	37	4	71654646	71654646	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:71654646G>T	uc003hfq.2	+	11	1790	c.1195G>T	c.(1195-1197)GAT>TAT	p.D399Y	RUFY3_uc003hfp.3_Missense_Mutation_p.D459Y|RUFY3_uc011cax.1_Missense_Mutation_p.D417Y|RUFY3_uc003hfr.2_Missense_Mutation_p.D399Y|RUFY3_uc011cay.1_Missense_Mutation_p.D335Y	NM_014961	NP_055776	Q7L099	RUFY3_HUMAN	RUN and FYVE domain containing 3 isoform 2	399	Potential.				negative regulation of axonogenesis	filopodium|growth cone					0		all_hematologic(202;0.248)	Lung(101;0.235)															---	---	---	---
ADAMTS3	9508	broad.mit.edu	37	4	73149282	73149282	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73149282T>C	uc003hgk.1	-	22	3226	c.3189A>G	c.(3187-3189)CTA>CTG	p.L1063L		NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1063					collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)															---	---	---	---
ADAMTS3	9508	broad.mit.edu	37	4	73205406	73205406	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73205406C>T	uc003hgk.1	-	5	703	c.666G>A	c.(664-666)TCG>TCA	p.S222S		NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	222					collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)															---	---	---	---
HERC6	55008	broad.mit.edu	37	4	89326038	89326038	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:89326038C>G	uc011cdi.1	+	9	1286	c.1103C>G	c.(1102-1104)TCC>TGC	p.S368C	HERC6_uc011cdj.1_Missense_Mutation_p.S368C|HERC6_uc011cdk.1_Intron|HERC6_uc011cdl.1_Intron	NM_017912	NP_060382	Q8IVU3	HERC6_HUMAN	hect domain and RLD 6 isoform 1	368					protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytosol	ubiquitin-protein ligase activity			lung(3)|ovary(1)|kidney(1)	5		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;0.000222)														---	---	---	---
GRID2	2895	broad.mit.edu	37	4	94032033	94032033	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:94032033C>T	uc011cdt.1	+	4	922	c.664C>T	c.(664-666)CGC>TGC	p.R222C	GRID2_uc010ikx.2_Missense_Mutation_p.R222C|GRID2_uc011cdu.1_Missense_Mutation_p.R127C|GRID2_uc011cdv.1_RNA	NM_001510	NP_001501	O43424	GRID2_HUMAN	glutamate receptor, ionotropic, delta 2	222	Extracellular (Potential).				glutamate signaling pathway	cell junction|integral to plasma membrane|outer membrane-bounded periplasmic space|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|ionotropic glutamate receptor activity			ovary(3)|skin(2)|large_intestine(1)	6		Hepatocellular(203;0.114)|all_hematologic(202;0.177)		OV - Ovarian serous cystadenocarcinoma(123;3.22e-06)|LUSC - Lung squamous cell carcinoma(81;0.185)|Lung(65;0.191)	L-Glutamic Acid(DB00142)													---	---	---	---
UNC5C	8633	broad.mit.edu	37	4	96199521	96199521	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:96199521G>A	uc003htp.1	-						UNC5C_uc010ilc.1_Intron|UNC5C_uc003htq.2_Intron	NM_003728	NP_003719			unc5C precursor						apoptosis|axon guidance|brain development	integral to membrane	netrin receptor activity			ovary(3)|pancreas(1)	4		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;8.72e-10)														---	---	---	---
COL25A1	84570	broad.mit.edu	37	4	110223187	110223187	+	5'UTR	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:110223187C>T	uc003hze.1	-	2					COL25A1_uc003hzg.2_5'UTR|COL25A1_uc003hzh.1_5'UTR	NM_198721	NP_942014			collagen, type XXV, alpha 1 isoform 1							collagen|extracellular space	beta-amyloid binding|heparin binding			ovary(2)	2		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.000173)														---	---	---	---
KIAA1109	84162	broad.mit.edu	37	4	123184039	123184039	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:123184039A>G	uc003ieh.2	+	41	6928	c.6883A>G	c.(6883-6885)AGC>GGC	p.S2295G	KIAA1109_uc003iel.1_Missense_Mutation_p.S230G|KIAA1109_uc003iek.2_Missense_Mutation_p.S914G	NM_015312	NP_056127	Q2LD37	K1109_HUMAN	fragile site-associated protein	2295					regulation of cell growth|regulation of epithelial cell differentiation	integral to membrane|nucleus				ovary(8)|skin(2)|pancreas(1)|central_nervous_system(1)	12																		---	---	---	---
PHF17	79960	broad.mit.edu	37	4	129776926	129776926	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:129776926G>A	uc003igk.2	+	7	1118	c.838G>A	c.(838-840)GTT>ATT	p.V280I	PHF17_uc003igj.2_Missense_Mutation_p.V280I|PHF17_uc003igl.2_Missense_Mutation_p.V268I|PHF17_uc011cgy.1_Missense_Mutation_p.V280I|PHF17_uc003igm.2_Missense_Mutation_p.V280I	NM_199320	NP_955352	Q6IE81	JADE1_HUMAN	PHD finger protein 17 long isoform	280					apoptosis|histone H3 acetylation|histone H4-K12 acetylation|histone H4-K5 acetylation|histone H4-K8 acetylation|negative regulation of cell growth|regulation of transcription, DNA-dependent|response to stress|transcription, DNA-dependent	histone acetyltransferase complex|mitochondrion	protein binding|zinc ion binding				0																		---	---	---	---
PCDH18	54510	broad.mit.edu	37	4	138442446	138442446	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:138442446A>G	uc003ihe.3	-	4	3532	c.3145T>C	c.(3145-3147)TAC>CAC	p.Y1049H	PCDH18_uc003ihf.3_Missense_Mutation_p.Y1041H|PCDH18_uc011cgz.1_Missense_Mutation_p.Y260H|PCDH18_uc003ihg.3_Missense_Mutation_p.Y828H|PCDH18_uc011cha.1_Missense_Mutation_p.Y229H	NM_019035	NP_061908	Q9HCL0	PCD18_HUMAN	protocadherin 18 precursor	1049	Interaction with DAB1 (By similarity).|Cytoplasmic (Potential).				brain development|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			pancreas(3)|skin(2)	5	all_hematologic(180;0.24)																	---	---	---	---
MAML3	55534	broad.mit.edu	37	4	140641171	140641171	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:140641171C>A	uc003ihz.1	-	7	3460	c.2708G>T	c.(2707-2709)GGG>GTG	p.G903V	MGST2_uc010ioi.1_Intron|MAML3_uc011chd.1_Missense_Mutation_p.G371V	NM_018717	NP_061187	Q96JK9	MAML3_HUMAN	mastermind-like 3	904	Gln-rich.				Notch signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nuclear speck	transcription coactivator activity			ovary(1)	1	all_hematologic(180;0.162)																	---	---	---	---
MMAA	166785	broad.mit.edu	37	4	146576477	146576477	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:146576477C>A	uc003ikh.3	+	7	1233	c.1148C>A	c.(1147-1149)CCC>CAC	p.P383H	MMAA_uc010iow.2_RNA	NM_172250	NP_758454	Q8IVH4	MMAA_HUMAN	methylmalonic aciduria type A precursor	383						mitochondrion	GTP binding|nucleoside-triphosphatase activity			ovary(1)	1	all_hematologic(180;0.151)				Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)													---	---	---	---
NR3C2	4306	broad.mit.edu	37	4	149357534	149357534	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:149357534G>A	uc003ilj.3	-	2	813	c.479C>T	c.(478-480)CCC>CTC	p.P160L	NR3C2_uc003ilk.3_Missense_Mutation_p.P160L|NR3C2_uc010iph.2_RNA	NM_000901	NP_000892	P08235	MCR_HUMAN	nuclear receptor subfamily 3, group C, member 2	160	Modulating.				regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	endoplasmic reticulum membrane|nucleoplasm	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid binding|steroid hormone receptor activity|zinc ion binding			large_intestine(1)	1	all_hematologic(180;0.151)			GBM - Glioblastoma multiforme(119;0.0614)	Desoxycorticosterone Pivalate(DB01134)|Eplerenone(DB00700)|Fludrocortisone(DB00687)|Spironolactone(DB00421)													---	---	---	---
DCHS2	54798	broad.mit.edu	37	4	155250793	155250793	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:155250793G>A	uc003inw.2	-	11	2435	c.2435C>T	c.(2434-2436)ACA>ATA	p.T812I	DCHS2_uc003inx.2_Missense_Mutation_p.T1267I	NM_017639	NP_060109	Q6V1P9	PCD23_HUMAN	dachsous 2 isoform 1	812	Cadherin 6.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|pancreas(1)	4	all_hematologic(180;0.208)	Renal(120;0.0854)		LUSC - Lung squamous cell carcinoma(193;0.107)														---	---	---	---
FAM198B	51313	broad.mit.edu	37	4	159092457	159092457	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:159092457C>T	uc003ipp.3	-	2	523	c.71G>A	c.(70-72)CGT>CAT	p.R24H	uc003ipu.1_5'Flank|FAM198B_uc003ipq.3_Missense_Mutation_p.R24H|FAM198B_uc003ipr.3_Missense_Mutation_p.R24H|FAM198B_uc003ips.2_Missense_Mutation_p.R24H|uc003ipt.1_RNA	NM_016613	NP_057697	Q6UWH4	F198B_HUMAN	hypothetical protein LOC51313 isoform 2	24	Cytoplasmic (Potential).					Golgi membrane|integral to membrane					0																		---	---	---	---
FNIP2	57600	broad.mit.edu	37	4	159756572	159756572	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:159756572T>A	uc003iqe.3	+	7	854	c.671T>A	c.(670-672)GTT>GAT	p.V224D		NM_020840	NP_065891	Q9P278	FNIP2_HUMAN	folliculin interacting protein 2	224					DNA damage response, signal transduction resulting in induction of apoptosis|protein phosphorylation|regulation of protein phosphorylation	cytoplasm	protein binding				0	all_hematologic(180;0.24)			COAD - Colon adenocarcinoma(41;0.00936)														---	---	---	---
MFAP3L	9848	broad.mit.edu	37	4	170913207	170913207	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:170913207C>A	uc003isp.3	-	3	730	c.552G>T	c.(550-552)AAG>AAT	p.K184N	MFAP3L_uc003isn.3_Missense_Mutation_p.K81N	NM_021647	NP_067679	O75121	MFA3L_HUMAN	microfibrillar-associated protein 3-like isoform	184	Cytoplasmic (Potential).					integral to membrane|plasma membrane				ovary(1)	1		Prostate(90;0.00601)|Renal(120;0.0183)|all_neural(102;0.122)|Melanoma(52;0.17)		GBM - Glioblastoma multiforme(119;0.0201)|LUSC - Lung squamous cell carcinoma(193;0.116)														---	---	---	---
GALNTL6	442117	broad.mit.edu	37	4	172735778	172735778	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:172735778C>T	uc003isv.2	+	2	783	c.47C>T	c.(46-48)ACG>ATG	p.T16M		NM_001034845	NP_001030017	Q49A17	GLTL6_HUMAN	N-acetylgalactosaminyltransferase-like 6	16	Helical; Signal-anchor for type II membrane protein; (Potential).					Golgi membrane|integral to membrane	metal ion binding|polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			breast(2)|ovary(1)|skin(1)	4																		---	---	---	---
ASB5	140458	broad.mit.edu	37	4	177146478	177146478	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:177146478G>A	uc003iuq.1	-	2	227	c.211C>T	c.(211-213)CGA>TGA	p.R71*	ASB5_uc003iup.1_Nonsense_Mutation_p.R18*	NM_080874	NP_543150	Q8WWX0	ASB5_HUMAN	ankyrin repeat and SOCS box-containing protein	71	ANK 1.				intracellular signal transduction					skin(2)	2		Breast(14;0.00015)|Melanoma(52;0.00886)|Prostate(90;0.00996)|Renal(120;0.0183)|all_hematologic(60;0.107)|all_neural(102;0.164)		all cancers(43;2.13e-20)|Epithelial(43;9.94e-18)|OV - Ovarian serous cystadenocarcinoma(60;2e-09)|GBM - Glioblastoma multiforme(59;0.000254)|STAD - Stomach adenocarcinoma(60;0.000653)|LUSC - Lung squamous cell carcinoma(193;0.0393)														---	---	---	---
C4orf41	60684	broad.mit.edu	37	4	184605943	184605943	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:184605943A>G	uc003ivx.2	+	15	1692	c.1516A>G	c.(1516-1518)ATG>GTG	p.M506V	C4orf41_uc003ivw.2_Missense_Mutation_p.M506V|C4orf41_uc010isc.2_Intron|C4orf41_uc003ivy.2_Missense_Mutation_p.M112V	NM_021942	NP_068761	Q7Z392	CD041_HUMAN	hypothetical protein LOC60684 isoform a	506											0		all_lung(41;4.4e-14)|Lung NSC(41;1.03e-13)|Colorectal(36;0.00139)|all_hematologic(60;0.00756)|Hepatocellular(41;0.00826)|Renal(120;0.00988)|Prostate(90;0.0235)|all_neural(102;0.202)		all cancers(43;1.39e-26)|Epithelial(43;2.42e-22)|OV - Ovarian serous cystadenocarcinoma(60;6.85e-10)|GBM - Glioblastoma multiforme(59;6.71e-06)|Colorectal(24;9.67e-06)|STAD - Stomach adenocarcinoma(60;2.36e-05)|COAD - Colon adenocarcinoma(29;7.07e-05)|LUSC - Lung squamous cell carcinoma(40;0.00984)|READ - Rectum adenocarcinoma(43;0.171)														---	---	---	---
HELT	391723	broad.mit.edu	37	4	185941867	185941867	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:185941867G>A	uc011ckq.1	+	4	925	c.925G>A	c.(925-927)GGC>AGC	p.G309S	HELT_uc011cko.1_Missense_Mutation_p.G224S|HELT_uc003ixa.3_Missense_Mutation_p.G223S|HELT_uc011ckp.1_Missense_Mutation_p.G167S	NM_001029887	NP_001025058	A6NFD8	HELT_HUMAN	HES/HEY-like transcription factor	309							DNA binding				0		all_lung(41;9.65e-12)|Lung NSC(41;1.64e-11)|Colorectal(36;0.0215)|Renal(120;0.0246)|Hepatocellular(41;0.0268)|Prostate(90;0.0283)|all_hematologic(60;0.0749)		all cancers(43;8.92e-26)|Epithelial(43;3.02e-23)|OV - Ovarian serous cystadenocarcinoma(60;2.59e-11)|Colorectal(24;4.79e-05)|BRCA - Breast invasive adenocarcinoma(30;7.72e-05)|GBM - Glioblastoma multiforme(59;0.000274)|COAD - Colon adenocarcinoma(29;0.000362)|STAD - Stomach adenocarcinoma(60;0.000756)|LUSC - Lung squamous cell carcinoma(40;0.00902)|READ - Rectum adenocarcinoma(43;0.155)														---	---	---	---
SORBS2	8470	broad.mit.edu	37	4	186536191	186536191	+	Intron	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:186536191G>T	uc003iyl.2	-						SORBS2_uc003iyh.2_Intron|SORBS2_uc011ckw.1_Intron|SORBS2_uc003iyi.2_Intron|SORBS2_uc011ckx.1_Intron|SORBS2_uc003iyk.2_Intron|SORBS2_uc003iym.2_Intron|SORBS2_uc003iyn.1_Intron|SORBS2_uc011cku.1_Intron|SORBS2_uc011ckv.1_Intron|SORBS2_uc003iyd.2_Intron|SORBS2_uc003iye.2_Intron|SORBS2_uc003iya.2_Intron|SORBS2_uc003iyb.2_Intron|SORBS2_uc003iyc.2_Intron|SORBS2_uc003iyg.2_Intron|SORBS2_uc003iyf.2_Intron|SORBS2_uc003iyo.1_Intron	NM_021069	NP_066547			sorbin and SH3 domain containing 2 isoform 2							actin cytoskeleton|nucleus|perinuclear region of cytoplasm|Z disc	cytoskeletal adaptor activity|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(1)	1		all_cancers(14;4.27e-52)|all_epithelial(14;6.58e-39)|all_lung(41;1.42e-13)|Lung NSC(41;3.73e-13)|Melanoma(20;1.91e-06)|Colorectal(36;0.00692)|Hepatocellular(41;0.00826)|Renal(120;0.00994)|Prostate(90;0.0101)|all_hematologic(60;0.0174)|all_neural(102;0.244)		OV - Ovarian serous cystadenocarcinoma(60;1.54e-09)|BRCA - Breast invasive adenocarcinoma(30;0.000232)|GBM - Glioblastoma multiforme(59;0.000385)|STAD - Stomach adenocarcinoma(60;0.00109)|LUSC - Lung squamous cell carcinoma(40;0.0205)														---	---	---	---
FAT1	2195	broad.mit.edu	37	4	187527365	187527365	+	Silent	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187527365A>T	uc003izf.2	-	17	10397	c.10209T>A	c.(10207-10209)ATT>ATA	p.I3403I		NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	3403	Extracellular (Potential).|Cadherin 31.				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12															HNSCC(5;0.00058)			---	---	---	---
IRX1	79192	broad.mit.edu	37	5	3601109	3601109	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:3601109G>A	uc003jde.2	+	4	1450	c.1398G>A	c.(1396-1398)CCG>CCA	p.P466P		NM_024337	NP_077313	P78414	IRX1_HUMAN	iroquois homeobox protein 1	466						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|pancreas(1)	2																		---	---	---	---
ADAMTS16	170690	broad.mit.edu	37	5	5303789	5303789	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:5303789C>T	uc003jdl.2	+	20	3234	c.3096C>T	c.(3094-3096)TCC>TCT	p.S1032S	ADAMTS16_uc003jdk.1_Silent_p.S1032S	NM_139056	NP_620687	Q8TE57	ATS16_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1032	TSP type-1 4.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(3)|lung(2)|large_intestine(1)|breast(1)|pancreas(1)	8																		---	---	---	---
SEMA5A	9037	broad.mit.edu	37	5	9052130	9052130	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:9052130C>T	uc003jek.2	-	20	3412	c.2700G>A	c.(2698-2700)TCG>TCA	p.S900S		NM_003966	NP_003957	Q13591	SEM5A_HUMAN	semaphorin 5A precursor	900	Extracellular (Potential).|TSP type-1 7.				cell adhesion|cell-cell signaling	integral to membrane|plasma membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
DAP	1611	broad.mit.edu	37	5	10681222	10681222	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:10681222G>A	uc003jez.3	-	4	462	c.255C>T	c.(253-255)TCC>TCT	p.S85S	DAP_uc011cmw.1_Missense_Mutation_p.P71L	NM_004394	NP_004385	P51397	DAP1_HUMAN	death-associated protein	85					activation of caspase activity|cellular response to amino acid starvation|induction of apoptosis by extracellular signals|negative regulation of autophagy|negative regulation of NF-kappaB transcription factor activity|negative regulation of transcription, DNA-dependent		death domain binding				0		Ovarian(839;1.34e-05)|Breast(839;0.0634)|Lung NSC(810;0.0804)																---	---	---	---
CTNND2	1501	broad.mit.edu	37	5	11082891	11082891	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:11082891C>T	uc003jfa.1	-	16	2850	c.2705G>A	c.(2704-2706)CGA>CAA	p.R902Q	CTNND2_uc010itt.2_Missense_Mutation_p.R811Q|CTNND2_uc011cmy.1_Missense_Mutation_p.R565Q|CTNND2_uc011cmz.1_Missense_Mutation_p.R469Q|CTNND2_uc010itu.1_RNA|CTNND2_uc011cmx.1_Missense_Mutation_p.R494Q	NM_001332	NP_001323	Q9UQB3	CTND2_HUMAN	catenin (cadherin-associated protein), delta 2	902	ARM 8.				multicellular organismal development|neuron cell-cell adhesion|regulation of transcription, DNA-dependent|signal transduction|transcription, DNA-dependent	adherens junction|cytoplasm|nucleus	protein binding			large_intestine(2)|ovary(2)|skin(2)|pancreas(1)|lung(1)	8																		---	---	---	---
DNAH5	1767	broad.mit.edu	37	5	13735996	13735996	+	Missense_Mutation	SNP	C	T	T	rs139914691		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:13735996C>T	uc003jfd.2	-	67	11543	c.11501G>A	c.(11500-11502)CGC>CAC	p.R3834H	DNAH5_uc003jfc.2_Missense_Mutation_p.R2H	NM_001369	NP_001360	Q8TE73	DYH5_HUMAN	dynein, axonemal, heavy chain 5	3834					microtubule-based movement	cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(14)|skin(13)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|pancreas(1)	31	Lung NSC(4;0.00476)													Kartagener_syndrome				---	---	---	---
RNASEN	29102	broad.mit.edu	37	5	31495487	31495487	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31495487G>A	uc003jhg.2	-						RNASEN_uc003jhh.2_Intron|RNASEN_uc003jhi.2_Intron|RNASEN_uc010iui.1_Intron	NM_013235	NP_037367			ribonuclease III, nuclear isoform 1						gene silencing by RNA|ribosome biogenesis|RNA processing	nucleolus|nucleoplasm	double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity				0																		---	---	---	---
PDZD2	23037	broad.mit.edu	37	5	31799500	31799500	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31799500A>G	uc003jhl.2	+	2	533	c.145A>G	c.(145-147)AAC>GAC	p.N49D	PDZD2_uc003jhm.2_Missense_Mutation_p.N49D	NM_178140	NP_835260	O15018	PDZD2_HUMAN	PDZ domain containing 2	49					cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9																		---	---	---	---
PDZD2	23037	broad.mit.edu	37	5	32048734	32048734	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:32048734C>T	uc003jhl.2	+	8	1997	c.1609C>T	c.(1609-1611)CGA>TGA	p.R537*	PDZD2_uc003jhm.2_Nonsense_Mutation_p.R537*|PDZD2_uc011cnx.1_Nonsense_Mutation_p.R363*	NM_178140	NP_835260	O15018	PDZD2_HUMAN	PDZ domain containing 2	537					cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9																		---	---	---	---
NUP155	9631	broad.mit.edu	37	5	37314291	37314291	+	Intron	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37314291A>T	uc003jku.1	-						NUP155_uc003jkt.1_Intron|NUP155_uc010iuz.1_Intron	NM_153485	NP_705618			nucleoporin 155kDa isoform 1						carbohydrate metabolic process|glucose transport|mRNA transport|nucleocytoplasmic transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	nuclear membrane|nuclear pore	protein binding|structural constituent of nuclear pore|transporter activity			ovary(1)	1	all_lung(31;0.000137)		COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---
PARP8	79668	broad.mit.edu	37	5	50137811	50137811	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:50137811G>A	uc003jon.3	+	27	2656	c.2474G>A	c.(2473-2475)GGC>GAC	p.G825D	PARP8_uc011cpz.1_Missense_Mutation_p.G717D|PARP8_uc003joo.2_Missense_Mutation_p.G825D|PARP8_uc003jop.2_Missense_Mutation_p.G783D	NM_024615	NP_078891	Q8N3A8	PARP8_HUMAN	poly (ADP-ribose) polymerase family, member 8	825	PARP catalytic.					intracellular	NAD+ ADP-ribosyltransferase activity			lung(3)|large_intestine(1)|ovary(1)	5		Lung NSC(810;0.0305)|Breast(144;0.222)																---	---	---	---
SKIV2L2	23517	broad.mit.edu	37	5	54696084	54696084	+	Silent	SNP	C	T	T	rs143135345	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:54696084C>T	uc003jpy.3	+	21	2582	c.2316C>T	c.(2314-2316)GAC>GAT	p.D772D	SKIV2L2_uc011cqi.1_Silent_p.D671D	NM_015360	NP_056175	P42285	SK2L2_HUMAN	superkiller viralicidic activity 2-like 2	772					maturation of 5.8S rRNA	catalytic step 2 spliceosome|nucleolus	ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding			ovary(1)|skin(1)	2		Lung NSC(810;0.000744)|Breast(144;0.181)|Prostate(74;0.194)																---	---	---	---
MAP3K1	4214	broad.mit.edu	37	5	56179395	56179395	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:56179395G>A	uc003jqw.3	+	15	4209	c.3708G>A	c.(3706-3708)CCG>CCA	p.P1236P		NM_005921	NP_005912	Q13233	M3K1_HUMAN	mitogen-activated protein kinase kinase kinase	1236					cellular response to mechanical stimulus|innate immune response|MyD88-dependent toll-like receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 4 signaling pathway	cytosol	ATP binding|zinc ion binding			ovary(1)|skin(1)	2		Lung NSC(810;4.65e-05)|Prostate(74;0.0132)|Breast(144;0.0321)|Ovarian(174;0.223)		OV - Ovarian serous cystadenocarcinoma(10;6.08e-40)														---	---	---	---
RGNEF	64283	broad.mit.edu	37	5	73045775	73045775	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:73045775C>T	uc011csq.1	+	2	158	c.147C>T	c.(145-147)CGC>CGT	p.R49R	RGNEF_uc003kcx.2_Silent_p.R49R|RGNEF_uc003kcy.1_Silent_p.R49R|RGNEF_uc010izf.2_Silent_p.R49R	NM_001080479	NP_001073948	Q8N1W1	RGNEF_HUMAN	Rho-guanine nucleotide exchange factor	49					cell differentiation|intracellular signal transduction|regulation of Rho protein signal transduction	cytoplasm|plasma membrane	metal ion binding|Rho guanyl-nucleotide exchange factor activity|RNA binding				0		Lung NSC(167;0.0378)|all_lung(232;0.04)|Ovarian(174;0.0798)		OV - Ovarian serous cystadenocarcinoma(47;1.25e-51)														---	---	---	---
COL4A3BP	10087	broad.mit.edu	37	5	74681788	74681788	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:74681788G>A	uc011csu.1	-	13	1778	c.1356C>T	c.(1354-1356)GGC>GGT	p.G452G	COL4A3BP_uc003kds.2_Silent_p.G426G|COL4A3BP_uc003kdt.2_Silent_p.G580G|COL4A3BP_uc003kdu.2_Silent_p.G452G	NM_005713	NP_005704	Q9Y5P4	C43BP_HUMAN	alpha 3 type IV collagen binding protein isoform	452	START.				ER to Golgi ceramide transport|immune response	cytosol|endoplasmic reticulum membrane|Golgi apparatus	ceramide binding|phosphatidylinositol-4-phosphate binding|protein binding|protein kinase activity			skin(1)	1		all_lung(232;0.00101)|Lung NSC(167;0.00278)|Ovarian(174;0.0129)|Prostate(461;0.174)		OV - Ovarian serous cystadenocarcinoma(47;1e-53)														---	---	---	---
F2R	2149	broad.mit.edu	37	5	76012518	76012518	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:76012518G>A	uc003ken.3	+							NM_001992	NP_001983			coagulation factor II receptor precursor						activation of caspase activity|anatomical structure morphogenesis|connective tissue replacement involved in inflammatory response wound healing|negative regulation of cell proliferation|platelet activation|positive regulation of blood coagulation|positive regulation of cell migration|positive regulation of collagen biosynthetic process|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of JAK-STAT cascade|positive regulation of MAPKKK cascade|positive regulation of release of sequestered calcium ion into cytosol|positive regulation of transcription, DNA-dependent|STAT protein import into nucleus|tyrosine phosphorylation of STAT protein	caveola|extracellular region|Golgi apparatus|integral to plasma membrane|platelet dense tubular network	receptor binding|thrombin receptor activity			ovary(3)	3		all_lung(232;0.000414)|Lung NSC(167;0.0011)|Prostate(461;0.00955)|Ovarian(174;0.0129)		all cancers(79;4.43e-43)	Streptokinase(DB00086)													---	---	---	---
CMYA5	202333	broad.mit.edu	37	5	79089347	79089347	+	Silent	SNP	C	T	T	rs148082008	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79089347C>T	uc003kgc.2	+	12	11949	c.11877C>T	c.(11875-11877)CTC>CTT	p.L3959L		NM_153610	NP_705838	Q8N3K9	CMYA5_HUMAN	cardiomyopathy associated 5	3959	B30.2/SPRY.					perinuclear region of cytoplasm				ovary(6)|pancreas(2)|lung(1)	9		Lung NSC(167;0.00296)|all_lung(232;0.00327)|Ovarian(174;0.0262)		OV - Ovarian serous cystadenocarcinoma(54;9.85e-46)|Epithelial(54;3.38e-40)|all cancers(79;3.43e-35)														---	---	---	---
ZFYVE16	9765	broad.mit.edu	37	5	79746297	79746297	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79746297T>C	uc003kgr.3	+	10	3576	c.3274T>C	c.(3274-3276)TTG>CTG	p.L1092L	ZFYVE16_uc003kgp.2_Silent_p.L1092L|ZFYVE16_uc003kgq.3_Silent_p.L1092L|ZFYVE16_uc003kgs.3_Silent_p.L1092L|ZFYVE16_uc003kgt.3_Silent_p.L180L	NM_001105251	NP_001098721	Q7Z3T8	ZFY16_HUMAN	zinc finger, FYVE domain containing 16	1092					BMP signaling pathway|endosome transport|protein targeting to lysosome|regulation of endocytosis|vesicle organization	early endosome membrane	1-phosphatidylinositol binding|metal ion binding|phosphatidylinositol-3,4,5-trisphosphate binding|protein binding|protein transporter activity				0		Lung NSC(167;0.00428)|all_lung(232;0.00455)|Ovarian(174;0.0261)		OV - Ovarian serous cystadenocarcinoma(54;1.6e-46)|Epithelial(54;2.02e-41)|all cancers(79;5.05e-36)														---	---	---	---
RASGRF2	5924	broad.mit.edu	37	5	80256573	80256573	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:80256573C>T	uc003kha.1	+	1	16	c.16C>T	c.(16-18)CGC>TGC	p.R6C	RASGRF2_uc011ctn.1_RNA	NM_006909	NP_008840	O14827	RGRF2_HUMAN	Ras protein-specific guanine	6					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|synaptic transmission	cytosol|endoplasmic reticulum membrane|plasma membrane	protein binding|Rho guanyl-nucleotide exchange factor activity			breast(5)|ovary(3)|large_intestine(2)|central_nervous_system(1)|skin(1)	12		Lung NSC(167;0.00498)|all_lung(232;0.00531)|Ovarian(174;0.0357)		OV - Ovarian serous cystadenocarcinoma(54;4.22e-42)|Epithelial(54;4.04e-35)|all cancers(79;2.52e-29)														---	---	---	---
HAPLN1	1404	broad.mit.edu	37	5	82940461	82940461	+	Nonsense_Mutation	SNP	G	A	A	rs147329529	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:82940461G>A	uc003kim.2	-	3	567	c.496C>T	c.(496-498)CGA>TGA	p.R166*	HAPLN1_uc003kin.2_Nonsense_Mutation_p.R166*	NM_001884	NP_001875	P10915	HPLN1_HUMAN	hyaluronan and proteoglycan link protein 1	166	Link 1.				cell adhesion	proteinaceous extracellular matrix	hyaluronic acid binding			large_intestine(3)|ovary(1)|skin(1)	5		Lung NSC(167;0.0484)|all_lung(232;0.0522)|Ovarian(174;0.142)		OV - Ovarian serous cystadenocarcinoma(54;7.82e-42)|Epithelial(54;5.88e-35)|all cancers(79;1.14e-29)														---	---	---	---
RASA1	5921	broad.mit.edu	37	5	86668007	86668007	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:86668007C>T	uc003kiw.2	+	13	1889	c.1771C>T	c.(1771-1773)CGT>TGT	p.R591C	RASA1_uc010jav.2_RNA|RASA1_uc003kix.2_Missense_Mutation_p.R414C|RASA1_uc011ctv.1_Missense_Mutation_p.R424C|RASA1_uc011ctw.1_Missense_Mutation_p.R425C|RASA1_uc010jaw.2_Missense_Mutation_p.R413C	NM_002890	NP_002881	P20936	RASA1_HUMAN	RAS p21 protein activator 1 isoform 1	591	C2.				cytokinesis|embryo development|intracellular signal transduction|negative regulation of cell-matrix adhesion|negative regulation of neuron apoptosis|negative regulation of Ras protein signal transduction|positive regulation of anti-apoptosis|regulation of actin filament polymerization|regulation of cell shape|regulation of RNA metabolic process|vasculogenesis	cytosol|intrinsic to internal side of plasma membrane	glycoprotein binding|GTPase binding|potassium channel inhibitor activity|Ras GTPase activator activity|receptor binding			upper_aerodigestive_tract(3)|ovary(1)|lung(1)	5		all_cancers(142;8.25e-07)|Lung NSC(167;0.000185)|all_lung(232;0.000222)|Colorectal(57;0.00542)|Ovarian(174;0.0423)		OV - Ovarian serous cystadenocarcinoma(54;4.72e-41)|Epithelial(54;1.51e-36)|all cancers(79;3.76e-31)														---	---	---	---
MEF2C	4208	broad.mit.edu	37	5	88025035	88025035	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:88025035C>T	uc003kjj.2	-	9	1637	c.964G>A	c.(964-966)GAG>AAG	p.E322K	MEF2C_uc003kji.2_Missense_Mutation_p.E314K|MEF2C_uc003kjk.2_Missense_Mutation_p.E322K|MEF2C_uc003kjm.2_Missense_Mutation_p.E312K|MEF2C_uc003kjl.2_Missense_Mutation_p.E332K	NM_002397	NP_002388	Q06413	MEF2C_HUMAN	myocyte enhancer factor 2C isoform 1	322					apoptosis|B cell proliferation|innate immune response|learning or memory|muscle cell differentiation|muscle organ development|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|neuron development|positive regulation of muscle cell differentiation|positive regulation of survival gene product expression|positive regulation of transcription from RNA polymerase II promoter|regulation of germinal center formation|regulation of megakaryocyte differentiation|regulation of synaptic activity|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	nuclear speck	activating transcription factor binding|protein heterodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			lung(3)|breast(2)|ovary(1)|large_intestine(1)	7		all_cancers(142;6.67e-05)|all_epithelial(76;7.77e-07)|Lung NSC(167;0.00566)|all_lung(232;0.00732)|Colorectal(57;0.0959)|Ovarian(174;0.1)		OV - Ovarian serous cystadenocarcinoma(54;1.04e-33)|Epithelial(54;1.6e-28)|all cancers(79;2.9e-25)											HNSCC(66;0.2)			---	---	---	---
RGMB	285704	broad.mit.edu	37	5	98115403	98115403	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:98115403C>T	uc003knc.2	+	4	781	c.379C>T	c.(379-381)CGT>TGT	p.R127C	RGMB_uc003knb.2_Missense_Mutation_p.R127C	NM_001012761	NP_001012779	Q6NW40	RGMB_HUMAN	RGM domain family, member B	86					axon guidance|BMP signaling pathway|cell adhesion|positive regulation of transcription, DNA-dependent	anchored to plasma membrane|ER-Golgi intermediate compartment|membrane raft	identical protein binding				0		all_cancers(142;2.76e-08)|all_epithelial(76;2.98e-11)|all_lung(232;0.000485)|Lung NSC(167;0.000693)|Prostate(80;0.000986)|Ovarian(225;0.024)|Colorectal(57;0.117)		COAD - Colon adenocarcinoma(37;0.0587)														---	---	---	---
FER	2241	broad.mit.edu	37	5	108516611	108516611	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:108516611A>G	uc003kop.1	+						FER_uc011cvg.1_Intron	NM_005246	NP_005237			fer (fps/fes related) tyrosine kinase						intracellular signal transduction|peptidyl-tyrosine phosphorylation	cytoplasm|nucleus	ATP binding|non-membrane spanning protein tyrosine kinase activity			lung(2)|stomach(1)|ovary(1)|kidney(1)	5		all_cancers(142;2.86e-06)|all_epithelial(76;9.81e-08)|Prostate(80;0.00972)|Lung NSC(167;0.039)|Ovarian(225;0.0448)|all_lung(232;0.0496)|Colorectal(57;0.0986)|Breast(839;0.152)		OV - Ovarian serous cystadenocarcinoma(64;6.77e-10)|Epithelial(69;4.13e-08)|COAD - Colon adenocarcinoma(37;0.0174)														---	---	---	---
WDR36	134430	broad.mit.edu	37	5	110446870	110446870	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:110446870G>A	uc003kpd.2	+	15	1894	c.1777G>A	c.(1777-1779)GGC>AGC	p.G593S	WDR36_uc010jbu.2_RNA	NM_139281	NP_644810	Q8NI36	WDR36_HUMAN	WD repeat domain 36	593					response to stimulus|rRNA processing|visual perception	small-subunit processome				ovary(1)|skin(1)	2		all_cancers(142;2.72e-05)|all_epithelial(76;4.4e-07)|Prostate(80;0.00955)|Lung NSC(167;0.0418)|Ovarian(225;0.0443)|Colorectal(57;0.0465)|all_lung(232;0.0508)|Breast(839;0.244)		OV - Ovarian serous cystadenocarcinoma(64;1.39e-08)|Epithelial(69;1.82e-07)|all cancers(49;2.04e-05)|COAD - Colon adenocarcinoma(37;0.111)														---	---	---	---
APC	324	broad.mit.edu	37	5	112175150	112175150	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112175150A>C	uc010jby.2	+	16	4239	c.3859A>C	c.(3859-3861)ATA>CTA	p.I1287L	APC_uc011cvt.1_Missense_Mutation_p.I1269L|APC_uc003kpz.3_Missense_Mutation_p.I1287L|APC_uc003kpy.3_Missense_Mutation_p.I1287L|APC_uc010jbz.2_Missense_Mutation_p.I1004L|APC_uc010jca.2_Missense_Mutation_p.I587L	NM_001127511	NP_001120983	P25054	APC_HUMAN	adenomatous polyposis coli	1287	Ser-rich.|Responsible for down-regulation through a process mediated by direct ubiquitination.				canonical Wnt receptor signaling pathway|cell adhesion|cell cycle arrest|cell migration|cellular component disassembly involved in apoptosis|cytokinesis after mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cyclin-dependent protein kinase activity|negative regulation of microtubule depolymerization|positive regulation of apoptosis|positive regulation of cell migration|positive regulation of pseudopodium assembly|protein complex assembly|regulation of attachment of spindle microtubules to kinetochore|response to DNA damage stimulus|tight junction assembly	adherens junction|APC-Axin-1-beta-catenin complex|Axin-APC-beta-catenin-GSK3B complex|beta-catenin destruction complex|centrosome|cytosol|kinetochore|lamellipodium|lateral plasma membrane|nucleus|ruffle membrane|tight junction	beta-catenin binding|gamma-catenin binding|microtubule plus-end binding|protein kinase binding|protein kinase regulator activity	p.I1287fs*1(2)|p.I1287fs*3(2)|p.I1287fs*18(1)|p.?(1)|p.I1287fs*4(1)|p.K1192fs*3(1)		large_intestine(2123)|stomach(123)|soft_tissue(55)|small_intestine(34)|breast(26)|pancreas(25)|urinary_tract(20)|lung(19)|thyroid(18)|liver(13)|central_nervous_system(10)|ovary(9)|skin(7)|upper_aerodigestive_tract(6)|adrenal_gland(6)|bone(6)|NS(5)|prostate(4)|endometrium(3)|kidney(1)|oesophagus(1)|biliary_tract(1)	2515		all_cancers(142;3.01e-27)|all_epithelial(76;2.3e-18)|all_hematologic(541;4.32e-09)|Ovarian(225;1.78e-06)|Lung NSC(167;0.000195)|Breast(839;0.000231)|all_lung(232;0.000247)|Colorectal(10;0.000355)|Prostate(80;0.00133)		OV - Ovarian serous cystadenocarcinoma(64;1.09e-113)|Epithelial(69;3.79e-112)|all cancers(49;1.67e-104)|BRCA - Breast invasive adenocarcinoma(61;0.00136)|COAD - Colon adenocarcinoma(37;0.00155)|Colorectal(14;0.00191)			12	D|Mis|N|F|S		colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS	colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS			Hereditary_Desmoid_Disease|Familial_Adenomatous_Polyposis|Turcot_syndrome	TSP Lung(16;0.13)			---	---	---	---
APC	324	broad.mit.edu	37	5	112176568	112176568	+	Silent	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112176568A>C	uc010jby.2	+	16	5657	c.5277A>C	c.(5275-5277)GCA>GCC	p.A1759A	APC_uc011cvt.1_Silent_p.A1741A|APC_uc003kpz.3_Silent_p.A1759A|APC_uc003kpy.3_Silent_p.A1759A|APC_uc010jbz.2_Silent_p.A1476A|APC_uc010jca.2_Silent_p.A1059A	NM_001127511	NP_001120983	P25054	APC_HUMAN	adenomatous polyposis coli	1759	Ser-rich.				canonical Wnt receptor signaling pathway|cell adhesion|cell cycle arrest|cell migration|cellular component disassembly involved in apoptosis|cytokinesis after mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cyclin-dependent protein kinase activity|negative regulation of microtubule depolymerization|positive regulation of apoptosis|positive regulation of cell migration|positive regulation of pseudopodium assembly|protein complex assembly|regulation of attachment of spindle microtubules to kinetochore|response to DNA damage stimulus|tight junction assembly	adherens junction|APC-Axin-1-beta-catenin complex|Axin-APC-beta-catenin-GSK3B complex|beta-catenin destruction complex|centrosome|cytosol|kinetochore|lamellipodium|lateral plasma membrane|nucleus|ruffle membrane|tight junction	beta-catenin binding|gamma-catenin binding|microtubule plus-end binding|protein kinase binding|protein kinase regulator activity	p.K1192fs*3(1)|p.?(1)		large_intestine(2123)|stomach(123)|soft_tissue(55)|small_intestine(34)|breast(26)|pancreas(25)|urinary_tract(20)|lung(19)|thyroid(18)|liver(13)|central_nervous_system(10)|ovary(9)|skin(7)|upper_aerodigestive_tract(6)|adrenal_gland(6)|bone(6)|NS(5)|prostate(4)|endometrium(3)|kidney(1)|oesophagus(1)|biliary_tract(1)	2515		all_cancers(142;3.01e-27)|all_epithelial(76;2.3e-18)|all_hematologic(541;4.32e-09)|Ovarian(225;1.78e-06)|Lung NSC(167;0.000195)|Breast(839;0.000231)|all_lung(232;0.000247)|Colorectal(10;0.000355)|Prostate(80;0.00133)		OV - Ovarian serous cystadenocarcinoma(64;1.09e-113)|Epithelial(69;3.79e-112)|all cancers(49;1.67e-104)|BRCA - Breast invasive adenocarcinoma(61;0.00136)|COAD - Colon adenocarcinoma(37;0.00155)|Colorectal(14;0.00191)			12	D|Mis|N|F|S		colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS	colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS			Hereditary_Desmoid_Disease|Familial_Adenomatous_Polyposis|Turcot_syndrome	TSP Lung(16;0.13)			---	---	---	---
APC	324	broad.mit.edu	37	5	112178805	112178805	+	Missense_Mutation	SNP	G	A	A	rs147549623	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112178805G>A	uc010jby.2	+	16	7894	c.7514G>A	c.(7513-7515)CGA>CAA	p.R2505Q	APC_uc011cvt.1_Missense_Mutation_p.R2487Q|APC_uc003kpz.3_Missense_Mutation_p.R2505Q|APC_uc003kpy.3_Missense_Mutation_p.R2505Q|APC_uc010jbz.2_Missense_Mutation_p.R2222Q|APC_uc010jca.2_Missense_Mutation_p.R1805Q	NM_001127511	NP_001120983	P25054	APC_HUMAN	adenomatous polyposis coli	2505	Ser-rich.				canonical Wnt receptor signaling pathway|cell adhesion|cell cycle arrest|cell migration|cellular component disassembly involved in apoptosis|cytokinesis after mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cyclin-dependent protein kinase activity|negative regulation of microtubule depolymerization|positive regulation of apoptosis|positive regulation of cell migration|positive regulation of pseudopodium assembly|protein complex assembly|regulation of attachment of spindle microtubules to kinetochore|response to DNA damage stimulus|tight junction assembly	adherens junction|APC-Axin-1-beta-catenin complex|Axin-APC-beta-catenin-GSK3B complex|beta-catenin destruction complex|centrosome|cytosol|kinetochore|lamellipodium|lateral plasma membrane|nucleus|ruffle membrane|tight junction	beta-catenin binding|gamma-catenin binding|microtubule plus-end binding|protein kinase binding|protein kinase regulator activity	p.?(1)		large_intestine(2123)|stomach(123)|soft_tissue(55)|small_intestine(34)|breast(26)|pancreas(25)|urinary_tract(20)|lung(19)|thyroid(18)|liver(13)|central_nervous_system(10)|ovary(9)|skin(7)|upper_aerodigestive_tract(6)|adrenal_gland(6)|bone(6)|NS(5)|prostate(4)|endometrium(3)|kidney(1)|oesophagus(1)|biliary_tract(1)	2515		all_cancers(142;3.01e-27)|all_epithelial(76;2.3e-18)|all_hematologic(541;4.32e-09)|Ovarian(225;1.78e-06)|Lung NSC(167;0.000195)|Breast(839;0.000231)|all_lung(232;0.000247)|Colorectal(10;0.000355)|Prostate(80;0.00133)		OV - Ovarian serous cystadenocarcinoma(64;1.09e-113)|Epithelial(69;3.79e-112)|all cancers(49;1.67e-104)|BRCA - Breast invasive adenocarcinoma(61;0.00136)|COAD - Colon adenocarcinoma(37;0.00155)|Colorectal(14;0.00191)			12	D|Mis|N|F|S		colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS	colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS			Hereditary_Desmoid_Disease|Familial_Adenomatous_Polyposis|Turcot_syndrome	TSP Lung(16;0.13)			---	---	---	---
ZNF474	133923	broad.mit.edu	37	5	121488178	121488178	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:121488178C>A	uc003ksv.2	+	2	869	c.493C>A	c.(493-495)CTG>ATG	p.L165M		NM_207317	NP_997200	Q6S9Z5	ZN474_HUMAN	zinc finger protein 474	165						intracellular	zinc ion binding				0		all_cancers(142;0.229)|Prostate(80;0.0387)	KIRC - Kidney renal clear cell carcinoma(527;0.206)	OV - Ovarian serous cystadenocarcinoma(64;0.000197)|Epithelial(69;0.00029)|all cancers(49;0.00415)														---	---	---	---
MEGF10	84466	broad.mit.edu	37	5	126776468	126776468	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:126776468G>A	uc003kuh.3	+	19	2633	c.2271G>A	c.(2269-2271)CTG>CTA	p.L757L	MEGF10_uc003kui.3_Silent_p.L757L	NM_032446	NP_115822	Q96KG7	MEG10_HUMAN	multiple EGF-like-domains 10 precursor	757	Extracellular (Potential).|Necessary for interaction with AP2M1, self-assembly and formation of the irregular, mosaic-like adhesion pattern.|EGF-like 14.				cell adhesion|phagocytosis	basolateral plasma membrane|cell projection|integral to membrane|phagocytic cup				ovary(4)	4		Prostate(80;0.165)	KIRC - Kidney renal clear cell carcinoma(527;0.0268)|Kidney(363;0.0488)	OV - Ovarian serous cystadenocarcinoma(64;0.0657)|Epithelial(69;0.123)														---	---	---	---
SLC27A6	28965	broad.mit.edu	37	5	128359405	128359405	+	Splice_Site	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:128359405T>C	uc003kuy.2	+	7	1651	c.1255_splice	c.e7+2	p.G419_splice	SLC27A6_uc003kuz.2_Splice_Site_p.G419_splice	NM_014031	NP_054750			solute carrier family 27 (fatty acid						long-chain fatty acid transport|transmembrane transport|very long-chain fatty acid metabolic process	integral to membrane|sarcolemma	fatty acid transporter activity|long-chain fatty acid-CoA ligase activity|nucleotide binding				0		all_cancers(142;0.0483)|Prostate(80;0.055)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)	Epithelial(69;0.171)|OV - Ovarian serous cystadenocarcinoma(64;0.186)														---	---	---	---
CHSY3	337876	broad.mit.edu	37	5	129241165	129241165	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:129241165G>A	uc003kvd.2	+	1	643	c.643G>A	c.(643-645)GGC>AGC	p.G215S		NM_175856	NP_787052	Q70JA7	CHSS3_HUMAN	chondroitin sulfate synthase 3	215	Lumenal (Potential).|Pro-rich.					Golgi cisterna membrane|integral to membrane	glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity|metal ion binding|N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity			ovary(2)|pancreas(1)	3		all_cancers(142;0.0227)|Breast(839;0.198)|Prostate(80;0.215)|Lung NSC(810;0.239)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)	OV - Ovarian serous cystadenocarcinoma(64;0.136)														---	---	---	---
ACSL6	23305	broad.mit.edu	37	5	131305865	131305865	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:131305865C>T	uc010jdo.1	-	15	1471	c.1388G>A	c.(1387-1389)TGC>TAC	p.C463Y	ACSL6_uc003kvv.1_RNA|ACSL6_uc003kvx.1_Missense_Mutation_p.C488Y|ACSL6_uc003kvy.1_Missense_Mutation_p.C488Y|ACSL6_uc003kwb.2_Missense_Mutation_p.C453Y|ACSL6_uc003kvz.1_Missense_Mutation_p.C388Y|ACSL6_uc003kwa.1_Missense_Mutation_p.C474Y|ACSL6_uc003kvw.1_Missense_Mutation_p.C109Y|ACSL6_uc010jdn.1_Missense_Mutation_p.C478Y	NM_015256	NP_056071	Q9UKU0	ACSL6_HUMAN	acyl-CoA synthetase long-chain family member 6	463	Cytoplasmic (Potential).				fatty acid metabolic process|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process	endoplasmic reticulum membrane|integral to membrane|microsome|mitochondrial outer membrane|peroxisomal membrane|plasma membrane	ATP binding|long-chain fatty acid-CoA ligase activity			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3		all_cancers(142;0.107)|Breast(839;0.198)|Lung NSC(810;0.216)|all_lung(232;0.248)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---
ACSL6	23305	broad.mit.edu	37	5	131329888	131329888	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:131329888G>A	uc010jdo.1	-	2	114	c.31C>T	c.(31-33)CGA>TGA	p.R11*	ACSL6_uc003kvv.1_RNA|ACSL6_uc003kvx.1_Nonsense_Mutation_p.R36*|ACSL6_uc003kvy.1_Nonsense_Mutation_p.R36*|ACSL6_uc003kwb.2_Nonsense_Mutation_p.R36*|ACSL6_uc003kvz.1_Nonsense_Mutation_p.R11*|ACSL6_uc003kwa.1_Nonsense_Mutation_p.R22*|ACSL6_uc003kwc.1_Nonsense_Mutation_p.R11*|ACSL6_uc003kwd.1_Nonsense_Mutation_p.R11*|ACSL6_uc010jdn.1_Nonsense_Mutation_p.R11*	NM_015256	NP_056071	Q9UKU0	ACSL6_HUMAN	acyl-CoA synthetase long-chain family member 6	11					fatty acid metabolic process|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process	endoplasmic reticulum membrane|integral to membrane|microsome|mitochondrial outer membrane|peroxisomal membrane|plasma membrane	ATP binding|long-chain fatty acid-CoA ligase activity			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3		all_cancers(142;0.107)|Breast(839;0.198)|Lung NSC(810;0.216)|all_lung(232;0.248)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---
RAD50	10111	broad.mit.edu	37	5	131911487	131911487	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:131911487G>A	uc003kxi.2	+	3	619	c.232G>A	c.(232-234)GTG>ATG	p.V78M	RAD50_uc003kxg.1_Translation_Start_Site|RAD50_uc003kxh.2_Translation_Start_Site	NM_005732	NP_005723	Q92878	RAD50_HUMAN	RAD50 homolog isoform 1	78					DNA duplex unwinding|double-strand break repair via homologous recombination|positive regulation of kinase activity|positive regulation of protein autophosphorylation|reciprocal meiotic recombination|regulation of mitotic recombination|telomere maintenance via telomerase	Mre11 complex|nuclear chromosome, telomeric region|nucleoplasm	ATP binding|DNA binding|nuclease activity|protein binding, bridging|zinc ion binding			lung(2)|ovary(1)|skin(1)	4		all_cancers(142;0.0368)|Breast(839;0.198)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)										Homologous_recombination					---	---	---	---
AFF4	27125	broad.mit.edu	37	5	132270345	132270345	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:132270345C>T	uc003kyd.2	-	3	820	c.412G>A	c.(412-414)GCA>ACA	p.A138T	AFF4_uc011cxk.1_5'UTR|AFF4_uc003kye.1_Missense_Mutation_p.A138T|AFF4_uc003kyf.3_Missense_Mutation_p.A138T	NM_014423	NP_055238	Q9UHB7	AFF4_HUMAN	ALL1 fused gene from 5q31	138	Ser-rich.				transcription from RNA polymerase II promoter	mitochondrion|nucleolus	protein binding|sequence-specific DNA binding transcription factor activity			ovary(2)|kidney(2)|skin(1)	5		all_cancers(142;0.145)|Breast(839;0.198)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---
CATSPER3	347732	broad.mit.edu	37	5	134305722	134305722	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:134305722G>A	uc003lag.2	+	2	260	c.192G>A	c.(190-192)GCG>GCA	p.A64A		NM_178019	NP_821138	Q86XQ3	CTSR3_HUMAN	cation channel, sperm associated 3	64	Helical; Name=Segment S1; (Potential).				cell differentiation|multicellular organismal development|spermatogenesis	cilium|flagellar membrane|integral to membrane	calcium channel activity|voltage-gated ion channel activity			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0233)															---	---	---	---
CATSPER3	347732	broad.mit.edu	37	5	134346089	134346089	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:134346089T>C	uc003lag.2	+	7	1031	c.963T>C	c.(961-963)AGT>AGC	p.S321S		NM_178019	NP_821138	Q86XQ3	CTSR3_HUMAN	cation channel, sperm associated 3	321					cell differentiation|multicellular organismal development|spermatogenesis	cilium|flagellar membrane|integral to membrane	calcium channel activity|voltage-gated ion channel activity			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0233)															---	---	---	---
EGR1	1958	broad.mit.edu	37	5	137803102	137803102	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137803102C>T	uc003ldb.1	+	2	1234	c.964C>T	c.(964-966)CGC>TGC	p.R322C	EGR1_uc011cyu.1_Intron	NM_001964	NP_001955	P18146	EGR1_HUMAN	early growth response 1	322					cellular response to heparin|cellular response to mycophenolic acid|glomerular mesangial cell proliferation|interleukin-1-mediated signaling pathway|positive regulation of glomerular metanephric mesangial cell proliferation|positive regulation of transcription from RNA polymerase II promoter|regulation of protein sumoylation|transcription from RNA polymerase II promoter|type I interferon-mediated signaling pathway	cytoplasm|nucleus	histone acetyltransferase binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.004)|Kidney(363;0.00592)															---	---	---	---
SIL1	64374	broad.mit.edu	37	5	138287504	138287504	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:138287504C>T	uc003ldm.2	-	7	854	c.837G>A	c.(835-837)ACG>ACA	p.T279T	SIL1_uc003ldn.2_Silent_p.T278T|SIL1_uc003ldo.2_Silent_p.T279T|SIL1_uc003ldp.2_Silent_p.T279T|SIL1_uc003ldq.1_Silent_p.T72T	NM_022464	NP_071909	Q9H173	SIL1_HUMAN	SIL1 protein precursor	279					intracellular protein transport|protein folding|transmembrane transport	endoplasmic reticulum lumen	unfolded protein binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00325)											Marinesco-Sj_gren_syndrome				---	---	---	---
CXXC5	51523	broad.mit.edu	37	5	139060917	139060917	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:139060917G>A	uc010jfg.1	+	2	1099	c.809G>A	c.(808-810)CGG>CAG	p.R270Q	CXXC5_uc003let.2_Missense_Mutation_p.R270Q	NM_016463	NP_057547	Q7LFL8	CXXC5_HUMAN	CXXC finger 5	270	CXXC-type.				positive regulation of I-kappaB kinase/NF-kappaB cascade	cytoplasm|nucleus	DNA binding|signal transducer activity|zinc ion binding			central_nervous_system(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHA2	56146	broad.mit.edu	37	5	140176951	140176951	+	Intron	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140176951T>C	uc003lhd.2	+						PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhc.1_Missense_Mutation_p.L801P|PCDHA2_uc011czy.1_Intron	NM_018905	NP_061728			protocadherin alpha 2 isoform 1 precursor						homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(4)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHA5	56143	broad.mit.edu	37	5	140202504	140202504	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140202504G>A	uc003lhl.2	+	1	1144	c.1144G>A	c.(1144-1146)GGG>AGG	p.G382R	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Missense_Mutation_p.G382R|PCDHA5_uc003lhj.1_Missense_Mutation_p.G382R	NM_018908	NP_061731	Q9Y5H7	PCDA5_HUMAN	protocadherin alpha 5 isoform 1 precursor	382	Extracellular (Potential).|Cadherin 4.				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(1)|breast(1)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHA8	56140	broad.mit.edu	37	5	140221143	140221143	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140221143G>A	uc003lhs.2	+	1	237	c.237G>A	c.(235-237)CTG>CTA	p.L79L	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc003lhq.2_Intron|PCDHA8_uc003lhr.1_Silent_p.L79L	NM_018911	NP_061734	Q9Y5H6	PCDA8_HUMAN	protocadherin alpha 8 isoform 1 precursor	79	Cadherin 1.|Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			upper_aerodigestive_tract(1)|ovary(1)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHAC2	56134	broad.mit.edu	37	5	140346615	140346615	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140346615C>T	uc003lii.2	+	1	504	c.264C>T	c.(262-264)CGC>CGT	p.R88R	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc003lhq.2_Intron|PCDHA8_uc003lhs.2_Intron|PCDHA9_uc003lhu.2_Intron|PCDHA10_uc003lhw.2_Intron|PCDHA10_uc003lhx.2_Intron|PCDHA11_uc003lia.2_Intron|PCDHA12_uc003lic.2_Intron|PCDHA13_uc003lie.1_Intron|PCDHA13_uc003lif.2_Intron|PCDHAC1_uc003lih.2_Intron|PCDHAC2_uc011dag.1_Silent_p.R88R	NM_018899	NP_061722	Q9Y5I4	PCDC2_HUMAN	protocadherin alpha subfamily C, 2 isoform 1	88	Cadherin 1.|Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding			ovary(2)|skin(2)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHB8	56128	broad.mit.edu	37	5	140558711	140558711	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140558711G>A	uc011dai.1	+	1	1282	c.1096G>A	c.(1096-1098)GTT>ATT	p.V366I	PCDHB16_uc003liv.2_5'Flank	NM_019120	NP_061993	Q9UN66	PCDB8_HUMAN	protocadherin beta 8 precursor	366	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			skin(4)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---
PCDHB16	57717	broad.mit.edu	37	5	140564305	140564305	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140564305G>A	uc003liv.2	+	1	3326	c.2171G>A	c.(2170-2172)CGC>CAC	p.R724H	PCDHB9_uc003liw.1_5'Flank	NM_020957	NP_066008	Q9NRJ7	PCDBG_HUMAN	protocadherin beta 16 precursor	724	Cytoplasmic (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to membrane|plasma membrane	calcium ion binding			ovary(1)|pancreas(1)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---
PCDHB9	56127	broad.mit.edu	37	5	140569020	140569020	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140569020C>T	uc003liw.1	+	3	2129	c.2129C>T	c.(2128-2130)GCG>GTG	p.A710V	PCDHB10_uc003lix.2_5'Flank	NM_019119	NP_061992	Q9Y5E1	PCDB9_HUMAN	protocadherin beta 9 precursor	710	Helical; (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---
SLC25A2	83884	broad.mit.edu	37	5	140683317	140683317	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140683317G>A	uc003ljf.2	-	1	296	c.116C>T	c.(115-117)ACG>ATG	p.T39M		NM_031947	NP_114153	Q9BXI2	ORNT2_HUMAN	solute carrier family 25 member 2	39	Solcar 1.				mitochondrial ornithine transport|urea cycle	integral to membrane|mitochondrial inner membrane	L-ornithine transmembrane transporter activity	p.T39M(1)		ovary(1)	1		all_lung(500;0.000249)|Lung NSC(810;0.0011)|Ovarian(839;0.00556)|Breast(839;0.0173)|all_hematologic(541;0.152)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)	GBM - Glioblastoma multiforme(465;0.00204)	L-Ornithine(DB00129)													---	---	---	---
PCDHGA1	56114	broad.mit.edu	37	5	140712162	140712162	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140712162G>A	uc003lji.1	+	1	1911	c.1911G>A	c.(1909-1911)GCG>GCA	p.A637A	PCDHGA1_uc011dan.1_Silent_p.A637A	NM_018912	NP_061735	Q9Y5H4	PCDG1_HUMAN	protocadherin gamma subfamily A, 1 isoform 1	637	Extracellular (Potential).|Cadherin 6.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding	p.A637A(1)		ovary(1)|breast(1)|pancreas(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHGA5	56110	broad.mit.edu	37	5	140745766	140745766	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140745766G>A	uc003lju.1	+	1	1869	c.1869G>A	c.(1867-1869)ACG>ACA	p.T623T	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc011das.1_Silent_p.T623T	NM_018918	NP_061741	Q9Y5G8	PCDG5_HUMAN	protocadherin gamma subfamily A, 5 isoform 1	623	Cadherin 6.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(4)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHGB5	56101	broad.mit.edu	37	5	140779369	140779369	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140779369C>T	uc003lkf.1	+	1	1675	c.1675C>T	c.(1675-1677)CTG>TTG	p.L559L	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc011daw.1_Silent_p.L559L	NM_018925	NP_061748	Q9Y5G0	PCDGH_HUMAN	protocadherin gamma subfamily B, 5 isoform 1	559	Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHGA10	56106	broad.mit.edu	37	5	140792807	140792807	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140792807T>A	uc003lkl.1	+	1	65	c.65T>A	c.(64-66)CTT>CAT	p.L22H	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc003lkf.1_Intron|PCDHGA9_uc003lkh.1_Intron|PCDHGB6_uc003lkj.1_Intron|PCDHGA10_uc011day.1_Missense_Mutation_p.L22H	NM_018913	NP_061736	Q9Y5H3	PCDGA_HUMAN	protocadherin gamma subfamily A, 10 isoform 1	22					homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)													OREG0016862	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PCDHGA10	56106	broad.mit.edu	37	5	140794633	140794633	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140794633C>T	uc003lkl.1	+	1	1891	c.1891C>T	c.(1891-1893)CGC>TGC	p.R631C	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc003lkf.1_Intron|PCDHGA9_uc003lkh.1_Intron|PCDHGB6_uc003lkj.1_Intron|PCDHGA10_uc011day.1_Missense_Mutation_p.R631C|PCDHGB7_uc003lkm.2_5'Flank|PCDHGB7_uc003lkn.1_5'Flank	NM_018913	NP_061736	Q9Y5H3	PCDGA_HUMAN	protocadherin gamma subfamily A, 10 isoform 1	631	Cadherin 6.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDH1	5097	broad.mit.edu	37	5	141243184	141243184	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:141243184C>A	uc003llq.2	-	3	2829	c.2712G>T	c.(2710-2712)AAG>AAT	p.K904N	PCDH1_uc003llp.2_Missense_Mutation_p.K904N|PCDH1_uc011dbf.1_Missense_Mutation_p.K882N	NM_002587	NP_002578	Q08174	PCDH1_HUMAN	protocadherin 1 isoform 1 precursor	904	Cytoplasmic (Potential).				cell-cell signaling|homophilic cell adhesion|nervous system development	cell-cell junction|integral to plasma membrane	calcium ion binding			ovary(5)	5		Lung NSC(810;0.027)|all_lung(500;0.0321)|all_hematologic(541;0.0433)|Prostate(461;0.0453)|Breast(839;0.128)|Lung SC(612;0.238)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)	GBM - Glioblastoma multiforme(465;1.06e-05)														---	---	---	---
ARHGAP26	23092	broad.mit.edu	37	5	142273906	142273906	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:142273906T>G	uc011dbj.1	+	6	625	c.590T>G	c.(589-591)GTG>GGG	p.V197G	ARHGAP26_uc003lmt.2_Missense_Mutation_p.V197G|ARHGAP26_uc003lmw.2_Missense_Mutation_p.V197G	NM_015071	NP_055886	Q9UNA1	RHG26_HUMAN	GTPase regulator associated with the focal	197					actin cytoskeleton organization|filopodium assembly|nervous system development|small GTPase mediated signal transduction	cytoskeleton|cytosol|focal adhesion	cytoskeletal adaptor activity|Rho GTPase activator activity|SH3 domain binding			ovary(1)	1		all_hematologic(541;0.0416)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)															---	---	---	---
ARHGEF37	389337	broad.mit.edu	37	5	149011746	149011746	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:149011746C>T	uc003lra.1	+	13	2084	c.2020C>T	c.(2020-2022)CCC>TCC	p.P674S		NM_001001669	NP_001001669	A1IGU5	ARH37_HUMAN	hypothetical protein LOC389337	674					regulation of Rho protein signal transduction	cytoplasm	Rho guanyl-nucleotide exchange factor activity				0																		---	---	---	---
PDGFRB	5159	broad.mit.edu	37	5	149498404	149498404	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:149498404A>G	uc003lro.2	-	21	3279	c.2810T>C	c.(2809-2811)ATG>ACG	p.M937T	PDGFRB_uc010jhd.2_Missense_Mutation_p.M776T	NM_002609	NP_002600	P09619	PGFRB_HUMAN	platelet-derived growth factor receptor beta	937	Cytoplasmic (Potential).|Protein kinase.				aorta morphogenesis|cardiac myofibril assembly|hemopoiesis|metanephric glomerular capillary formation|metanephric glomerular mesangial cell proliferation involved in metanephros development|peptidyl-tyrosine phosphorylation|positive regulation of calcium ion import|positive regulation of chemotaxis|positive regulation of DNA biosynthetic process|positive regulation of ERK1 and ERK2 cascade|positive regulation of MAP kinase activity|positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway|positive regulation of mitosis|positive regulation of phosphatidylinositol 3-kinase cascade|positive regulation of reactive oxygen species metabolic process|positive regulation of smooth muscle cell migration|positive regulation of smooth muscle cell proliferation|protein autophosphorylation|regulation of actin cytoskeleton organization|retina vasculature development in camera-type eye|smooth muscle cell chemotaxis	apical plasma membrane|cytoplasm|integral to plasma membrane|nucleus	ATP binding|platelet activating factor receptor activity|platelet-derived growth factor beta-receptor activity|platelet-derived growth factor binding|platelet-derived growth factor receptor binding|vascular endothelial growth factor receptor activity			central_nervous_system(4)|lung(4)|breast(3)|stomach(2)|prostate(2)|large_intestine(1)|ovary(1)	17		all_hematologic(541;0.224)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)		Becaplermin(DB00102)|Dasatinib(DB01254)|Imatinib(DB00619)|Sorafenib(DB00398)|Sunitinib(DB01268)			T	ETV6|TRIP11|HIP1|RAB5EP|H4|NIN|HCMOGT-1|PDE4DIP	MPD|AML|CMML|CML								---	---	---	---
CAMK2A	815	broad.mit.edu	37	5	149602647	149602647	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:149602647G>A	uc003lru.2	-	17	1553	c.1338C>T	c.(1336-1338)ACC>ACT	p.T446T	CAMK2A_uc003lrs.2_Silent_p.T157T|CAMK2A_uc003lrt.2_Silent_p.T457T	NM_171825	NP_741960	Q9UQM7	KCC2A_HUMAN	calcium/calmodulin-dependent protein kinase II	446					interferon-gamma-mediated signaling pathway|positive regulation of NF-kappaB transcription factor activity|synaptic transmission	cell junction|cytosol|endocytic vesicle membrane|nucleoplasm|presynaptic membrane	ATP binding|calmodulin binding|calmodulin-dependent protein kinase activity			large_intestine(1)	1		all_hematologic(541;0.224)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)															---	---	---	---
FAT2	2196	broad.mit.edu	37	5	150946634	150946634	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:150946634G>A	uc003lue.3	-	1	1872	c.1859C>T	c.(1858-1860)TCC>TTC	p.S620F	GM2A_uc011dcs.1_Intron|FAT2_uc010jhx.1_Missense_Mutation_p.S620F	NM_001447	NP_001438	Q9NYQ8	FAT2_HUMAN	FAT tumor suppressor 2 precursor	620	Extracellular (Potential).|Cadherin 5.				epithelial cell migration|homophilic cell adhesion	cell-cell adherens junction|integral to membrane|nucleus	calcium ion binding			ovary(4)|upper_aerodigestive_tract(1)|skin(1)	6		Medulloblastoma(196;0.0912)|all_hematologic(541;0.104)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)															---	---	---	---
HAVCR1	26762	broad.mit.edu	37	5	156482260	156482260	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156482260C>T	uc010jij.1	-	3	516	c.331G>A	c.(331-333)GGG>AGG	p.G111R	HAVCR1_uc011ddl.1_5'Flank|HAVCR1_uc003lwi.2_Missense_Mutation_p.G111R|HAVCR1_uc011ddm.1_Missense_Mutation_p.G111R	NM_001099414	NP_001092884	Q96D42	HAVR1_HUMAN	hepatitis A virus cellular receptor 1	111	Extracellular (Potential).|Ig-like V-type.				interspecies interaction between organisms	integral to membrane	receptor activity			ovary(1)|skin(1)	2	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.0999)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)															---	---	---	---
CYFIP2	26999	broad.mit.edu	37	5	156747709	156747709	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156747709C>T	uc003lwq.2	+	17	1708	c.1570C>T	c.(1570-1572)CGA>TGA	p.R524*	CYFIP2_uc011ddn.1_Nonsense_Mutation_p.R498*|CYFIP2_uc011ddo.1_Nonsense_Mutation_p.R328*|CYFIP2_uc003lwr.2_Nonsense_Mutation_p.R524*|CYFIP2_uc003lws.2_Nonsense_Mutation_p.R524*|CYFIP2_uc003lwt.2_Nonsense_Mutation_p.R402*|CYFIP2_uc011ddp.1_Nonsense_Mutation_p.R258*	NM_001037333	NP_001032410	Q96F07	CYFP2_HUMAN	cytoplasmic FMR1 interacting protein 2	524					apoptosis|cell-cell adhesion	cell junction|perinuclear region of cytoplasm|synapse|synaptosome	protein binding				0	Renal(175;0.00212)	Medulloblastoma(196;0.0306)|all_neural(177;0.0897)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)															---	---	---	---
PWWP2A	114825	broad.mit.edu	37	5	159520917	159520917	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:159520917G>A	uc011ded.1	-	2	797	c.740C>T	c.(739-741)CCG>CTG	p.P247L	PWWP2A_uc003lxv.3_Missense_Mutation_p.P247L|PWWP2A_uc011dec.1_Missense_Mutation_p.P247L	NM_001130864	NP_001124336	Q96N64	PWP2A_HUMAN	PWWP domain containing 2A isoform b	247	Pro-rich.										0	Renal(175;0.00196)	Medulloblastoma(196;0.0354)|all_neural(177;0.138)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)															---	---	---	---
CCNJL	79616	broad.mit.edu	37	5	159680793	159680793	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:159680793G>A	uc003lyb.1	-	7	1152	c.900C>T	c.(898-900)AAC>AAT	p.N300N	CCNJL_uc011dee.1_Silent_p.N252N|CCNJL_uc003lyc.1_RNA	NM_024565	NP_078841	Q8IV13	CCNJL_HUMAN	cyclin J-like	300						nucleus					0	Renal(175;0.00196)	Medulloblastoma(196;0.0354)|all_neural(177;0.116)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)															---	---	---	---
WWC1	23286	broad.mit.edu	37	5	167835607	167835607	+	Silent	SNP	G	A	A	rs140218628	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:167835607G>A	uc003lzu.2	+	7	909	c.816G>A	c.(814-816)CCG>CCA	p.P272P	WWC1_uc003lzv.2_Silent_p.P272P|WWC1_uc011den.1_Silent_p.P272P|WWC1_uc003lzw.2_Silent_p.P71P	NM_015238	NP_056053	Q8IX03	KIBRA_HUMAN	WW and C2 domain containing 1 isoform 3	272					cell migration|positive regulation of MAPKKK cascade|regulation of hippo signaling cascade|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus|perinuclear region of cytoplasm|ruffle membrane	protein binding|transcription coactivator activity			ovary(2)|skin(2)|breast(1)	5	Renal(175;0.000212)|Lung NSC(126;0.0875)|all_lung(126;0.166)	Medulloblastoma(196;0.0399)|all_neural(177;0.0577)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.0364)|Epithelial(171;0.0765)|OV - Ovarian serous cystadenocarcinoma(192;0.0918)														---	---	---	---
GPRIN1	114787	broad.mit.edu	37	5	176024847	176024847	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176024847T>C	uc003meo.1	-	2	2164	c.1989A>G	c.(1987-1989)ACA>ACG	p.T663T		NM_052899	NP_443131	Q7Z2K8	GRIN1_HUMAN	G protein-regulated inducer of neurite outgrowth	663						growth cone|plasma membrane				ovary(2)	2	all_cancers(89;0.00263)|Renal(175;0.000269)|Lung NSC(126;0.00902)|all_lung(126;0.0142)	Medulloblastoma(196;0.0208)|all_neural(177;0.0416)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
GPRIN1	114787	broad.mit.edu	37	5	176025084	176025084	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176025084C>T	uc003meo.1	-	2	1927	c.1752G>A	c.(1750-1752)CCG>CCA	p.P584P		NM_052899	NP_443131	Q7Z2K8	GRIN1_HUMAN	G protein-regulated inducer of neurite outgrowth	584						growth cone|plasma membrane				ovary(2)	2	all_cancers(89;0.00263)|Renal(175;0.000269)|Lung NSC(126;0.00902)|all_lung(126;0.0142)	Medulloblastoma(196;0.0208)|all_neural(177;0.0416)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
FGFR4	2264	broad.mit.edu	37	5	176523313	176523313	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176523313C>T	uc003mfl.2	+	15	2137	c.1970C>T	c.(1969-1971)GCG>GTG	p.A657V	FGFR4_uc003mfm.2_Missense_Mutation_p.A657V|FGFR4_uc011dfu.1_Missense_Mutation_p.A589V|FGFR4_uc003mfo.2_Missense_Mutation_p.A617V	NM_002011	NP_002002	P22455	FGFR4_HUMAN	fibroblast growth factor receptor 4 isoform 1	657	Protein kinase.|Cytoplasmic (Potential).				insulin receptor signaling pathway|positive regulation of cell proliferation	integral to plasma membrane	ATP binding|fibroblast growth factor binding|fibroblast growth factor receptor activity			lung(11)|stomach(1)|central_nervous_system(1)|breast(1)|skin(1)|prostate(1)	16	all_cancers(89;5.93e-05)|Renal(175;0.000269)|Lung NSC(126;0.0088)|all_lung(126;0.0142)	all_neural(177;0.00409)|Medulloblastoma(196;0.00498)|all_hematologic(541;0.21)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)		Palifermin(DB00039)										TSP Lung(9;0.080)			---	---	---	---
LMAN2	10960	broad.mit.edu	37	5	176765576	176765576	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176765576C>T	uc003mge.2	-	3	583	c.346G>A	c.(346-348)GTC>ATC	p.V116I	LMAN2_uc003mgd.2_Missense_Mutation_p.V116I	NM_006816	NP_006807	Q12907	LMAN2_HUMAN	lectin, mannose-binding 2 precursor	116	Lumenal (Potential).|L-type lectin-like.				protein transport	endoplasmic reticulum membrane|ER-Golgi intermediate compartment membrane|Golgi membrane|integral to membrane	metal ion binding|sugar binding				0	all_cancers(89;2.04e-05)|Renal(175;0.000269)|Lung NSC(126;0.000832)|all_lung(126;0.00152)	all_neural(177;0.00802)|Medulloblastoma(196;0.0145)|all_hematologic(541;0.248)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
TRIM7	81786	broad.mit.edu	37	5	180622450	180622450	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:180622450C>T	uc003mmz.1	-	7	1319	c.1252G>A	c.(1252-1254)GTG>ATG	p.V418M	TRIM7_uc003mmv.1_Missense_Mutation_p.V236M|TRIM7_uc003mmw.1_Missense_Mutation_p.V210M|TRIM7_uc003mmx.1_Missense_Mutation_p.V210M|TRIM7_uc003mmy.1_Missense_Mutation_p.V210M	NM_203293	NP_976038	Q9C029	TRIM7_HUMAN	tripartite motif-containing 7 isoform 1	418	B30.2/SPRY.					cytoplasm|nucleus	zinc ion binding			ovary(2)|skin(1)	3	all_cancers(89;6.03e-06)|all_epithelial(37;7.1e-07)|Renal(175;0.000159)|Lung NSC(126;0.00354)|all_lung(126;0.00609)|Breast(19;0.0684)	all_cancers(40;0.000172)|Medulloblastoma(196;0.0133)|all_neural(177;0.0199)|all_lung(500;0.0221)|all_hematologic(541;0.0433)|Lung NSC(249;0.132)|Ovarian(839;0.238)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	all cancers(165;2e-06)|Epithelial(171;1.35e-05)|OV - Ovarian serous cystadenocarcinoma(192;0.000128)|Kidney(146;0.0674)|GBM - Glioblastoma multiforme(465;0.0802)														---	---	---	---
TRIM41	90933	broad.mit.edu	37	5	180659783	180659783	+	Missense_Mutation	SNP	G	A	A	rs139355777		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:180659783G>A	uc003mne.1	+	3	1728	c.1034G>A	c.(1033-1035)CGT>CAT	p.R345H	uc003mnb.1_5'Flank|TRIM41_uc003mnc.1_3'UTR|TRIM41_uc003mnd.1_Missense_Mutation_p.R345H|TRIM41_uc003mnf.1_RNA|TRIM41_uc010jlq.1_Missense_Mutation_p.R55H|TRIM41_uc003mng.1_5'Flank	NM_033549	NP_291027	Q8WV44	TRI41_HUMAN	tripartite motif-containing 41 isoform 1	345	Potential.					cytoplasm|nucleus	ligase activity|protein binding|zinc ion binding				0	all_cancers(89;9.17e-06)|all_epithelial(37;1.19e-06)|Renal(175;0.000159)|Lung NSC(126;0.00354)|all_lung(126;0.00609)|Breast(19;0.0684)	all_cancers(40;0.000209)|Medulloblastoma(196;0.0133)|all_neural(177;0.0199)|all_lung(500;0.0221)|all_hematologic(541;0.0433)|Lung NSC(249;0.132)|Ovarian(839;0.238)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
EXOC2	55770	broad.mit.edu	37	6	599180	599180	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:599180C>T	uc003mtd.2	-	8	922	c.788G>A	c.(787-789)CGG>CAG	p.R263Q	EXOC2_uc003mte.2_Missense_Mutation_p.R263Q|EXOC2_uc011dho.1_Intron	NM_018303	NP_060773	Q96KP1	EXOC2_HUMAN	Sec5 protein	263					exocytosis|protein transport					breast(4)|ovary(2)|pancreas(1)	7	Ovarian(93;0.0733)	Breast(5;0.0014)|all_lung(73;0.0697)|all_hematologic(90;0.0897)		OV - Ovarian serous cystadenocarcinoma(45;0.0507)|BRCA - Breast invasive adenocarcinoma(62;0.14)														---	---	---	---
SYCP2L	221711	broad.mit.edu	37	6	10902994	10902994	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:10902994A>T	uc003mzo.2	+	7	847	c.551A>T	c.(550-552)GAG>GTG	p.E184V	SYCP2L_uc011din.1_Missense_Mutation_p.E25V|SYCP2L_uc010jow.2_5'UTR	NM_001040274	NP_001035364	Q5T4T6	SYC2L_HUMAN	synaptonemal complex protein 2-like	184						nucleus				ovary(1)|skin(1)	2	Breast(50;0.0838)|Ovarian(93;0.107)	all_hematologic(90;0.135)	Epithelial(50;0.239)															---	---	---	---
GFOD1	54438	broad.mit.edu	37	6	13365583	13365583	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:13365583C>T	uc003nat.1	-	2	1230	c.565G>A	c.(565-567)GGC>AGC	p.G189S	GFOD1_uc003nas.1_Missense_Mutation_p.G86S	NM_018988	NP_061861	Q9NXC2	GFOD1_HUMAN	glucose-fructose oxidoreductase domain	189						extracellular region	binding|oxidoreductase activity			ovary(2)	2	Breast(50;0.0296)|Ovarian(93;0.0454)	all_hematologic(90;0.135)	Epithelial(50;0.0348)|BRCA - Breast invasive adenocarcinoma(129;0.1)|all cancers(50;0.108)															---	---	---	---
JARID2	3720	broad.mit.edu	37	6	15497312	15497312	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:15497312G>A	uc003nbj.2	+	7	2100	c.1856G>A	c.(1855-1857)CGG>CAG	p.R619Q	JARID2_uc011diu.1_Missense_Mutation_p.R483Q|JARID2_uc011div.1_Missense_Mutation_p.R447Q|JARID2_uc011diw.1_Missense_Mutation_p.R581Q	NM_004973	NP_004964	Q92833	JARD2_HUMAN	jumonji, AT rich interactive domain 2 protein	619					central nervous system development|chromatin modification|negative regulation of histone methylation|positive regulation of histone H3-K9 methylation|stem cell differentiation|transcription, DNA-dependent		chromatin binding			ovary(2)|lung(1)|pancreas(1)	4	Breast(50;0.0142)|Ovarian(93;0.103)	all_hematologic(90;0.00612)																---	---	---	---
GPLD1	2822	broad.mit.edu	37	6	24448144	24448144	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:24448144C>T	uc003ned.1	-	17	1750	c.1639G>A	c.(1639-1641)GTG>ATG	p.V547M	GPLD1_uc010jpr.1_Missense_Mutation_p.V384M|GPLD1_uc010jps.1_Missense_Mutation_p.V547M	NM_001503	NP_001494	P80108	PHLD_HUMAN	glycosylphosphatidylinositol specific	547	FG-GAP 3.					extracellular region	glycosylphosphatidylinositol phospholipase D activity			ovary(2)|kidney(1)	3																		---	---	---	---
GPLD1	2822	broad.mit.edu	37	6	24450073	24450073	+	Missense_Mutation	SNP	C	T	T	rs144999503		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:24450073C>T	uc003ned.1	-	15	1501	c.1390G>A	c.(1390-1392)GTG>ATG	p.V464M	GPLD1_uc010jpr.1_Missense_Mutation_p.V301M|GPLD1_uc010jps.1_Missense_Mutation_p.V464M	NM_001503	NP_001494	P80108	PHLD_HUMAN	glycosylphosphatidylinositol specific	464	FG-GAP 2.					extracellular region	glycosylphosphatidylinositol phospholipase D activity			ovary(2)|kidney(1)	3																		---	---	---	---
FAM65B	9750	broad.mit.edu	37	6	24873113	24873113	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:24873113C>T	uc003neo.1	-	4	508	c.332G>A	c.(331-333)CGC>CAC	p.R111H	FAM65B_uc011djs.1_Missense_Mutation_p.R140H|FAM65B_uc011dju.1_Missense_Mutation_p.R145H|FAM65B_uc003nep.2_Missense_Mutation_p.R111H|FAM65B_uc011djt.1_Missense_Mutation_p.R111H	NM_014722	NP_055537	Q9Y4F9	FA65B_HUMAN	hypothetical protein LOC9750 isoform 1	111	Potential.|Involved in cell filopodia formation.				cell differentiation|muscle organ development	cytoskeleton|filopodium|mitochondrion	binding			ovary(1)	1																		---	---	---	---
HIST1H2BM	8342	broad.mit.edu	37	6	27783206	27783206	+	3'UTR	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27783206T>G	uc003njo.2	+	1					HIST1H2AJ_uc003njn.1_5'Flank	NM_003521	NP_003512			histone cluster 1, H2bm						nucleosome assembly	nucleosome|nucleus	DNA binding			large_intestine(1)	1																		---	---	---	---
SCAND3	114821	broad.mit.edu	37	6	28540659	28540659	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28540659G>A	uc003nlo.2	-	4	3625	c.3007C>T	c.(3007-3009)CGA>TGA	p.R1003*		NM_052923	NP_443155	Q6R2W3	SCND3_HUMAN	SCAN domain containing 3	1003					DNA integration|viral reproduction	nucleus	DNA binding|protein dimerization activity|sequence-specific DNA binding transcription factor activity			ovary(1)	1																		---	---	---	---
OR14J1	442191	broad.mit.edu	37	6	29274617	29274617	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29274617C>T	uc011dln.1	+	1	151	c.151C>T	c.(151-153)CGT>TGT	p.R51C		NM_030946	NP_112208	Q9UGF5	O14J1_HUMAN	olfactory receptor, family 5, subfamily U member	51	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1																		---	---	---	---
OR2H1	26716	broad.mit.edu	37	6	29429649	29429649	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29429649T>C	uc003nmi.2	+	3	546	c.103T>C	c.(103-105)TTG>CTG	p.L35L	OR2H1_uc003nmj.1_Silent_p.L35L|OR2H1_uc010jri.1_Intron	NM_030883	NP_112145	Q9GZK4	OR2H1_HUMAN	olfactory receptor, family 2, subfamily H,	35	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---
OR2H1	26716	broad.mit.edu	37	6	29429651	29429651	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29429651G>A	uc003nmi.2	+	3	548	c.105G>A	c.(103-105)TTG>TTA	p.L35L	OR2H1_uc003nmj.1_Silent_p.L35L|OR2H1_uc010jri.1_Intron	NM_030883	NP_112145	Q9GZK4	OR2H1_HUMAN	olfactory receptor, family 2, subfamily H,	35	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---
OR2H1	26716	broad.mit.edu	37	6	29429657	29429657	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29429657G>A	uc003nmi.2	+	3	554	c.111G>A	c.(109-111)CTG>CTA	p.L37L	OR2H1_uc003nmj.1_Silent_p.L37L|OR2H1_uc010jri.1_Intron	NM_030883	NP_112145	Q9GZK4	OR2H1_HUMAN	olfactory receptor, family 2, subfamily H,	37	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---
MDC1	9656	broad.mit.edu	37	6	30671304	30671304	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30671304G>A	uc003nrg.3	-	11	6013	c.5573C>T	c.(5572-5574)ACT>ATT	p.T1858I	MDC1_uc003nrf.3_Missense_Mutation_p.T489I	NM_014641	NP_055456	Q14676	MDC1_HUMAN	mediator of DNA-damage checkpoint 1	1858	Required for nuclear localization (NLS2).				cell cycle|double-strand break repair via homologous recombination|intra-S DNA damage checkpoint	focal adhesion|nucleoplasm	FHA domain binding|protein C-terminus binding			breast(2)|ovary(1)|kidney(1)	4													Other_conserved_DNA_damage_response_genes					---	---	---	---
VARS2	57176	broad.mit.edu	37	6	30887543	30887543	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30887543C>T	uc003nsc.1	+	11	1715	c.1083C>T	c.(1081-1083)CAC>CAT	p.H361H	VARS2_uc011dmx.1_Silent_p.H361H|VARS2_uc011dmy.1_Silent_p.H221H|VARS2_uc011dmz.1_Silent_p.H391H|VARS2_uc011dna.1_Silent_p.H361H|VARS2_uc011dnb.1_RNA|VARS2_uc011dnc.1_RNA|VARS2_uc011dnd.1_Translation_Start_Site|VARS2_uc010jsg.1_Translation_Start_Site	NM_020442	NP_065175	Q5ST30	SYVM_HUMAN	valyl-tRNA synthetase 2, mitochondrial	361					valyl-tRNA aminoacylation	mitochondrion	ATP binding|valine-tRNA ligase activity			ovary(3)|central_nervous_system(1)	4																		---	---	---	---
TCF19	6941	broad.mit.edu	37	6	31129358	31129358	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31129358C>T	uc003nss.2	+	3	897	c.373C>T	c.(373-375)CGA>TGA	p.R125*	TCF19_uc003nst.2_Nonsense_Mutation_p.R125*	NM_001077511	NP_001070979	Q9Y242	TCF19_HUMAN	transcription factor 19	125					cell proliferation|regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding transcription factor activity|zinc ion binding				0																		---	---	---	---
HLA-C	3107	broad.mit.edu	37	6	31238868	31238868	+	Nonsense_Mutation	SNP	C	A	A	rs1131103	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31238868C>A	uc003nsy.2	-	3	608	c.601G>T	c.(601-603)GAG>TAG	p.E201*	HLA-C_uc011dnj.1_Nonsense_Mutation_p.E173*|HLA-C_uc003nsx.2_Nonsense_Mutation_p.E80*|HLA-C_uc003nsz.2_Nonsense_Mutation_p.E201*|HLA-C_uc010jsl.2_Nonsense_Mutation_p.E201*|HLA-C_uc003nta.2_Nonsense_Mutation_p.E201*|HLA-C_uc003ntb.2_Intron|HLA-C_uc003ntc.1_Intron|HLA-B_uc010jsm.1_Intron|HLA-B_uc011dnk.1_Intron|HLA-C_uc011dnl.1_Nonsense_Mutation_p.E80*|HLA-B_uc003ntf.2_Nonsense_Mutation_p.E201*	NM_002117	NP_002108	Q9TNN7	1C05_HUMAN	major histocompatibility complex, class I, C	201	Extracellular (Potential).|Alpha-2.		K -> E (in allele Cw*0502).		antigen processing and presentation of peptide antigen via MHC class I|interferon-gamma-mediated signaling pathway|interspecies interaction between organisms|regulation of immune response|type I interferon-mediated signaling pathway	integral to membrane|MHC class I protein complex					0																		---	---	---	---
C2	717	broad.mit.edu	37	6	31868847	31868847	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31868847C>T	uc011dop.1	+	1	72	c.4C>T	c.(4-6)CGT>TGT	p.R2C	C2_uc003nyc.2_Intron|C2_uc011doo.1_Intron|ZBTB12_uc003nyd.1_Missense_Mutation_p.R79H	NM_001145903	NP_001139375	P06681	CO2_HUMAN	complement component 2 isoform 2 preproprotein	Error:Variant_position_missing_in_P06681_after_alignment					complement activation, classical pathway|innate immune response|proteolysis	extracellular space	serine-type endopeptidase activity			ovary(1)|skin(1)	2		Ovarian(999;0.00965)		LUAD - Lung adenocarcinoma(999;0.247)														---	---	---	---
BAK1	578	broad.mit.edu	37	6	33541918	33541918	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33541918C>T	uc003oes.2	-	5	724	c.424G>A	c.(424-426)GTC>ATC	p.V142I	BAK1_uc003oer.2_Missense_Mutation_p.V72I|BAK1_uc003oet.2_RNA|BAK1_uc010jvb.2_Missense_Mutation_p.V142I|BAK1_uc003oeu.2_Missense_Mutation_p.V83I	NM_001188	NP_001179	Q16611	BAK_HUMAN	BCL2-antagonist/killer 1	142					activation of pro-apoptotic gene products|cellular response to mechanical stimulus|cellular response to UV|establishment or maintenance of transmembrane electrochemical gradient|induction of apoptosis by extracellular signals|induction of apoptosis by intracellular signals|regulation of mitochondrial membrane permeability|regulation of mitochondrial membrane potential|regulation of protein heterodimerization activity|regulation of protein homodimerization activity|release of cytochrome c from mitochondria	integral to mitochondrial outer membrane|pore complex	metal ion binding|protein heterodimerization activity			ovary(1)	1																		---	---	---	---
GRM4	2914	broad.mit.edu	37	6	34029714	34029714	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34029714C>T	uc003oir.3	-	3	998	c.828G>A	c.(826-828)TCG>TCA	p.S276S	GRM4_uc011dsn.1_Silent_p.S276S|GRM4_uc010jvh.2_Silent_p.S276S|GRM4_uc010jvi.2_5'UTR|GRM4_uc003oio.2_5'UTR|GRM4_uc003oip.2_RNA|GRM4_uc011dsl.1_Silent_p.S136S|GRM4_uc003oiq.2_Silent_p.S143S|GRM4_uc011dsm.1_Silent_p.S107S	NM_000841	NP_000832	Q14833	GRM4_HUMAN	glutamate receptor, metabotropic 4 precursor	276	Extracellular (Potential).				activation of MAPK activity|inhibition of adenylate cyclase activity by metabotropic glutamate receptor signaling pathway|neuroprotection|neurotransmitter secretion|positive regulation of MAPKKK cascade	cytoplasmic vesicle|integral to plasma membrane	G-protein coupled receptor activity|glutamate receptor activity			lung(3)|upper_aerodigestive_tract(1)|ovary(1)|skin(1)	6					L-Glutamic Acid(DB00142)													---	---	---	---
HMGA1	3159	broad.mit.edu	37	6	34210525	34210525	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34210525C>T	uc003oit.2	+	4	494	c.172C>T	c.(172-174)CGG>TGG	p.R58W	HMGA1_uc011dso.1_Missense_Mutation_p.R58W|HMGA1_uc003oiv.2_Missense_Mutation_p.R47W|HMGA1_uc003oiw.2_Missense_Mutation_p.R47W|HMGA1_uc003oiu.2_Missense_Mutation_p.R58W|HMGA1_uc003oiy.2_Missense_Mutation_p.R47W|HMGA1_uc003oiz.2_Missense_Mutation_p.R58W|HMGA1_uc003oja.2_Missense_Mutation_p.R47W|HMGA1_uc003oix.2_Missense_Mutation_p.R47W|HMGA1_uc010jvl.2_Intron|HMGA1_uc003ojc.2_Missense_Mutation_p.R47W|HMGA1_uc011dsp.1_RNA|HMGA1_uc003ojd.2_Missense_Mutation_p.R46W	NM_145899	NP_665906	P17096	HMGA1_HUMAN	high mobility group AT-hook 1 isoform a	58	Interaction with HIPK2 (By similarity).|A.T hook 2.			R->A: Decreases methylation by PRMT6. Abolishes methylation by PRMT6; when associated with A-60.	DNA unwinding involved in replication|initiation of viral infection|interspecies interaction between organisms|loss of chromatin silencing|nucleosome disassembly|protein complex assembly|provirus integration	chromatin|cytosol|transcription factor complex	AT DNA binding|enzyme binding|ligand-dependent nuclear receptor transcription coactivator activity|peroxisome proliferator activated receptor binding|protein binding|retinoid X receptor binding|sequence-specific DNA binding transcription factor activity				0								T	?	microfollicular thyroid adenoma| various benign mesenchymal tumors,								---	---	---	---
ZNF76	7629	broad.mit.edu	37	6	35259413	35259413	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35259413G>A	uc003oki.1	+	9	1035	c.830G>A	c.(829-831)CGC>CAC	p.R277H	ZNF76_uc011dsy.1_Missense_Mutation_p.R277H|ZNF76_uc011dsz.1_Missense_Mutation_p.R277H|ZNF76_uc003okj.1_Missense_Mutation_p.R277H	NM_003427	NP_003418	P36508	ZNF76_HUMAN	zinc finger protein 76 (expressed in testis)	277	C2H2-type 4.				regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase III promoter|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
MOCS1	4337	broad.mit.edu	37	6	39874786	39874786	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:39874786C>T	uc003opb.2	-	10	1396	c.1258G>A	c.(1258-1260)GTG>ATG	p.V420M	MOCS1_uc003opa.2_3'UTR|MOCS1_uc003opc.2_Missense_Mutation_p.V404M|MOCS1_uc003opd.2_3'UTR|MOCS1_uc003ope.2_Missense_Mutation_p.V317M	NM_005942	NP_005933	Q9NZB8	MOCS1_HUMAN	molybdenum cofactor synthesis-step 1 protein	420	Molybdenum cofactor biosynthesis protein C.				Mo-molybdopterin cofactor biosynthetic process|Mo-molybdopterin cofactor biosynthetic process|water-soluble vitamin metabolic process	cytosol|molybdopterin synthase complex|nucleus	4 iron, 4 sulfur cluster binding|4 iron, 4 sulfur cluster binding|catalytic activity|GTP binding|metal ion binding			ovary(1)|liver(1)|central_nervous_system(1)	3	Ovarian(28;0.0355)|Colorectal(47;0.196)																	---	---	---	---
USP49	25862	broad.mit.edu	37	6	41774419	41774419	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41774419C>T	uc003ori.2	-	4	525	c.303G>A	c.(301-303)GCG>GCA	p.A101A		NM_018561	NP_061031	Q70CQ1	UBP49_HUMAN	ubiquitin thioesterase 49	101					ubiquitin-dependent protein catabolic process		cysteine-type peptidase activity|ubiquitin thiolesterase activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2	Ovarian(28;0.0919)|Colorectal(47;0.121)		STAD - Stomach adenocarcinoma(11;0.000204)|Epithelial(12;0.000309)|Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)															---	---	---	---
CUL7	9820	broad.mit.edu	37	6	43019980	43019980	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43019980G>A	uc003otq.2	-	2	850	c.547C>T	c.(547-549)CGG>TGG	p.R183W	CUL7_uc011dvb.1_Missense_Mutation_p.R235W|CUL7_uc010jyh.2_Intron|KLC4_uc003otr.1_Intron	NM_014780	NP_055595	Q14999	CUL7_HUMAN	cullin 7	183					interspecies interaction between organisms|ubiquitin-dependent protein catabolic process|vasculogenesis	anaphase-promoting complex|mitochondrion	ubiquitin protein ligase binding			ovary(3)|kidney(1)	4			all cancers(41;0.00231)|Colorectal(64;0.00237)|COAD - Colon adenocarcinoma(64;0.00473)|OV - Ovarian serous cystadenocarcinoma(102;0.0442)|KIRC - Kidney renal clear cell carcinoma(15;0.133)|Kidney(15;0.188)															---	---	---	---
TMEM63B	55362	broad.mit.edu	37	6	44116118	44116118	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44116118G>A	uc003owr.2	+	13	1181	c.1117G>A	c.(1117-1119)GCC>ACC	p.A373T	TMEM63B_uc003owq.1_Missense_Mutation_p.A373T|TMEM63B_uc003ows.2_Missense_Mutation_p.A276T|TMEM63B_uc010jyz.2_RNA	NM_018426	NP_060896	Q5T3F8	TM63B_HUMAN	transmembrane protein 63B	373						integral to membrane	nucleotide binding|protein binding			pancreas(2)|central_nervous_system(1)	3	all_cancers(18;1.66e-06)|Lung NSC(15;0.00108)|all_lung(25;0.00278)|Hepatocellular(11;0.00309)|Ovarian(13;0.0273)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.0215)															---	---	---	---
TMEM63B	55362	broad.mit.edu	37	6	44122158	44122158	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44122158T>C	uc003owr.2	+	23	2347	c.2283T>C	c.(2281-2283)ACT>ACC	p.T761T	TMEM63B_uc003ows.2_Silent_p.T664T|TMEM63B_uc010jyz.2_RNA	NM_018426	NP_060896	Q5T3F8	TM63B_HUMAN	transmembrane protein 63B	761						integral to membrane	nucleotide binding|protein binding			pancreas(2)|central_nervous_system(1)	3	all_cancers(18;1.66e-06)|Lung NSC(15;0.00108)|all_lung(25;0.00278)|Hepatocellular(11;0.00309)|Ovarian(13;0.0273)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.0215)															---	---	---	---
RHAG	6005	broad.mit.edu	37	6	49586939	49586939	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49586939C>A	uc003ozk.3	-	2	356	c.294G>T	c.(292-294)CAG>CAT	p.Q98H	RHAG_uc010jzl.2_Missense_Mutation_p.Q98H|RHAG_uc010jzm.2_Missense_Mutation_p.Q98H	NM_000324	NP_000315	Q02094	RHAG_HUMAN	Rh-associated glycoprotein	98	Helical; (Potential).				carbon dioxide transport|cellular ion homeostasis	integral to plasma membrane	ammonia transmembrane transporter activity|ammonium transmembrane transporter activity|ankyrin binding			breast(1)|skin(1)	2	Lung NSC(77;0.0255)																	---	---	---	---
GSTA1	2938	broad.mit.edu	37	6	52661013	52661013	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:52661013T>C	uc003paz.2	-	4	351	c.239A>G	c.(238-240)AAC>AGC	p.N80S		NM_145740	NP_665683	P08263	GSTA1_HUMAN	glutathione S-transferase alpha 1	80	GST N-terminal.				glutathione metabolic process|xenobiotic metabolic process	cytosol	glutathione transferase activity			ovary(1)	1	Lung NSC(77;0.118)				Amsacrine(DB00276)|Busulfan(DB01008)|Glutathione(DB00143)													---	---	---	---
FAM83B	222584	broad.mit.edu	37	6	54805455	54805455	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:54805455C>T	uc003pck.2	+	5	1802	c.1686C>T	c.(1684-1686)GGC>GGT	p.G562G		NM_001010872	NP_001010872	Q5T0W9	FA83B_HUMAN	hypothetical protein LOC222584	562										ovary(6)	6	Lung NSC(77;0.0178)|Renal(3;0.122)																	---	---	---	---
FAM83B	222584	broad.mit.edu	37	6	54805606	54805606	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:54805606A>G	uc003pck.2	+	5	1953	c.1837A>G	c.(1837-1839)ACC>GCC	p.T613A		NM_001010872	NP_001010872	Q5T0W9	FA83B_HUMAN	hypothetical protein LOC222584	613										ovary(6)	6	Lung NSC(77;0.0178)|Renal(3;0.122)																	---	---	---	---
FAM135A	57579	broad.mit.edu	37	6	71162259	71162259	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:71162259T>A	uc003pfj.2	+	3	275	c.142T>A	c.(142-144)TTG>ATG	p.L48M	FAM135A_uc003pfi.2_Missense_Mutation_p.L48M|FAM135A_uc003pfh.2_Intron|FAM135A_uc003pfk.2_Missense_Mutation_p.L48M|FAM135A_uc003pfl.2_Translation_Start_Site	NM_001162529	NP_001156001	Q9P2D6	F135A_HUMAN	hypothetical protein LOC57579 isoform c	48										central_nervous_system(1)	1																		---	---	---	---
B3GAT2	135152	broad.mit.edu	37	6	71665875	71665875	+	Silent	SNP	C	T	T	rs147151504		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:71665875C>T	uc003pfv.2	-	1	914	c.258G>A	c.(256-258)ACG>ACA	p.T86T	B3GAT2_uc011dxz.1_RNA|B3GAT2_uc003pfw.2_Silent_p.T86T	NM_080742	NP_542780	Q9NPZ5	B3GA2_HUMAN	beta-1,3-glucuronyltransferase 2	86	Lumenal (Potential).				carbohydrate biosynthetic process	Golgi membrane|integral to membrane	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity|metal ion binding			ovary(2)|haematopoietic_and_lymphoid_tissue(1)	3																		---	---	---	---
EEF1A1	1915	broad.mit.edu	37	6	74228320	74228320	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:74228320A>G	uc003phi.2	-	5	823	c.786T>C	c.(784-786)GTT>GTC	p.V262V	EEF1A1_uc003phd.2_5'UTR|EEF1A1_uc003phe.2_Silent_p.V252V|EEF1A1_uc003phf.2_Silent_p.V262V|EEF1A1_uc003phg.2_Silent_p.V262V|EEF1A1_uc003phh.2_Silent_p.V108V|EEF1A1_uc003phj.2_Silent_p.V262V|EEF1A1_uc003phk.2_Silent_p.V262V|EEF1A1_uc003phl.2_Intron|EEF1A1_uc003phm.1_Intron	NM_001402	NP_001393	P68104	EF1A1_HUMAN	eukaryotic translation elongation factor 1 alpha	262						cytosol|eukaryotic translation elongation factor 1 complex	GTP binding|GTPase activity|protein binding|translation elongation factor activity				0																OREG0003895	type=REGULATORY REGION|Gene=D16891|Dataset=Stanford ENCODE Dataset|EvidenceSubtype=Transient transfection luciferase assay	---	---	---	---
COL12A1	1303	broad.mit.edu	37	6	75839937	75839937	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:75839937C>T	uc003phs.2	-	37	6246	c.6080G>A	c.(6079-6081)GGA>GAA	p.G2027E	COL12A1_uc003pht.2_Missense_Mutation_p.G863E	NM_004370	NP_004361	Q99715	COCA1_HUMAN	collagen, type XII, alpha 1 long isoform	2027	Fibronectin type-III 16.				cell adhesion|collagen fibril organization|skeletal system development	collagen type XII|extracellular space	extracellular matrix structural constituent conferring tensile strength			ovary(6)|large_intestine(1)|breast(1)|skin(1)	9																		---	---	---	---
IMPG1	3617	broad.mit.edu	37	6	76640734	76640734	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76640734G>A	uc003pik.1	-	15	2309	c.2179C>T	c.(2179-2181)CCA>TCA	p.P727S		NM_001563	NP_001554	Q17R60	IMPG1_HUMAN	interphotoreceptor matrix proteoglycan 1	727					visual perception	proteinaceous extracellular matrix	extracellular matrix structural constituent|receptor activity			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(125;0.0418)|all_hematologic(105;0.222)																---	---	---	---
HTR1B	3351	broad.mit.edu	37	6	78172202	78172202	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:78172202C>T	uc003pil.1	-	1	919	c.919G>A	c.(919-921)GCT>ACT	p.A307T		NM_000863	NP_000854	P28222	5HT1B_HUMAN	5-hydroxytryptamine (serotonin) receptor 1B	307	Cytoplasmic (By similarity).				G-protein signaling, coupled to cyclic nucleotide second messenger|negative regulation of cAMP biosynthetic process|synaptic transmission	integral to plasma membrane	protein binding|serotonin receptor activity				0		all_cancers(76;0.0867)|Acute lymphoblastic leukemia(125;0.00119)|all_hematologic(105;0.0332)		BRCA - Breast invasive adenocarcinoma(397;0.205)	Almotriptan(DB00918)|Dexfenfluramine(DB01191)|Dihydroergotamine(DB00320)|Eletriptan(DB00216)|Ergotamine(DB00696)|Frovatriptan(DB00998)|Naratriptan(DB00952)|Pindolol(DB00960)|Propranolol(DB00571)|Rizatriptan(DB00953)|Sumatriptan(DB00669)|Venlafaxine(DB00285)|Zolmitriptan(DB00315)													---	---	---	---
HTR1B	3351	broad.mit.edu	37	6	78172495	78172495	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:78172495G>A	uc003pil.1	-	1	626	c.626C>T	c.(625-627)ACG>ATG	p.T209M		NM_000863	NP_000854	P28222	5HT1B_HUMAN	5-hydroxytryptamine (serotonin) receptor 1B	209	Helical; Name=5; (By similarity).				G-protein signaling, coupled to cyclic nucleotide second messenger|negative regulation of cAMP biosynthetic process|synaptic transmission	integral to plasma membrane	protein binding|serotonin receptor activity				0		all_cancers(76;0.0867)|Acute lymphoblastic leukemia(125;0.00119)|all_hematologic(105;0.0332)		BRCA - Breast invasive adenocarcinoma(397;0.205)	Almotriptan(DB00918)|Dexfenfluramine(DB01191)|Dihydroergotamine(DB00320)|Eletriptan(DB00216)|Ergotamine(DB00696)|Frovatriptan(DB00998)|Naratriptan(DB00952)|Pindolol(DB00960)|Propranolol(DB00571)|Rizatriptan(DB00953)|Sumatriptan(DB00669)|Venlafaxine(DB00285)|Zolmitriptan(DB00315)													---	---	---	---
MDN1	23195	broad.mit.edu	37	6	90397120	90397120	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90397120C>A	uc003pnn.1	-	68	11509	c.11393G>T	c.(11392-11394)CGG>CTG	p.R3798L		NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	3798					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---
MDN1	23195	broad.mit.edu	37	6	90402222	90402222	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90402222G>A	uc003pnn.1	-	63	10643	c.10527C>T	c.(10525-10527)CAC>CAT	p.H3509H		NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	3509					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---
MDN1	23195	broad.mit.edu	37	6	90428683	90428683	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90428683G>A	uc003pnn.1	-	42	6240	c.6124C>T	c.(6124-6126)CTG>TTG	p.L2042L		NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	2042					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---
RTN4IP1	84816	broad.mit.edu	37	6	107035691	107035691	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:107035691C>T	uc003prj.2	-	7	1330	c.853G>A	c.(853-855)GCT>ACT	p.A285T	RTN4IP1_uc010kdd.2_Intron|RTN4IP1_uc003prk.2_Missense_Mutation_p.A185T	NM_032730	NP_116119	Q8WWV3	RT4I1_HUMAN	reticulon 4 interacting protein 1 precursor	285						mitochondrion	oxidoreductase activity|zinc ion binding				0	Breast(9;0.0107)|all_epithelial(6;0.14)	all_cancers(87;9.45e-05)|Acute lymphoblastic leukemia(125;2.13e-07)|all_hematologic(75;5.28e-06)|all_epithelial(87;0.0144)	Epithelial(6;0.000873)|all cancers(7;0.00363)|BRCA - Breast invasive adenocarcinoma(8;0.00721)|OV - Ovarian serous cystadenocarcinoma(5;0.0394)	all cancers(137;0.113)|BRCA - Breast invasive adenocarcinoma(108;0.127)|Epithelial(106;0.144)														---	---	---	---
AKD1	221264	broad.mit.edu	37	6	109816558	109816558	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:109816558G>A	uc003ptn.2	-	39	5478	c.5401C>T	c.(5401-5403)CCT>TCT	p.P1801S	AKD1_uc011eas.1_Missense_Mutation_p.P186S	NM_001145128	NP_001138600	Q5TCS8	AKD1_HUMAN	adenylate kinase domain containing 1 isoform 1	1801					nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		ATP binding|nucleobase, nucleoside, nucleotide kinase activity|nucleoside-triphosphatase activity			ovary(1)	1																		---	---	---	---
CDC40	51362	broad.mit.edu	37	6	110538952	110538952	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:110538952C>T	uc003pua.2	+	10	1060	c.1036C>T	c.(1036-1038)CAG>TAG	p.Q346*		NM_015891	NP_056975	O60508	PRP17_HUMAN	cell division cycle 40 homolog	346	WD 2.				mRNA 3'-end processing|mRNA export from nucleus|termination of RNA polymerase II transcription	catalytic step 2 spliceosome|nucleoplasm					0		all_cancers(87;6.23e-06)|Acute lymphoblastic leukemia(125;2.66e-08)|all_hematologic(75;1.13e-06)|all_epithelial(87;0.00159)|Colorectal(196;0.0488)		Epithelial(106;0.0221)|all cancers(137;0.0314)|OV - Ovarian serous cystadenocarcinoma(136;0.034)														---	---	---	---
C6orf186	728464	broad.mit.edu	37	6	110620349	110620349	+	Nonsense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:110620349C>A	uc010kdu.1	-	4	562	c.562G>T	c.(562-564)GGA>TGA	p.G188*	C6orf186_uc003pub.2_Translation_Start_Site	NM_001123364	NP_001116836	Q5JXM2	CF186_HUMAN	chromosome 6 open reading frame 186 precursor	188						extracellular region					0																		---	---	---	---
FYN	2534	broad.mit.edu	37	6	111983105	111983105	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:111983105C>A	uc003pvj.2	-	13	1791	c.1451G>T	c.(1450-1452)AGG>ATG	p.R484M	FYN_uc003pvi.2_Missense_Mutation_p.R429M|FYN_uc003pvk.2_Missense_Mutation_p.R484M|FYN_uc003pvh.2_Missense_Mutation_p.R481M	NM_002037	NP_002028	P06241	FYN_HUMAN	protein-tyrosine kinase fyn isoform a	484	Protein kinase.				axon guidance|calcium ion transport|feeding behavior|interspecies interaction between organisms|intracellular protein kinase cascade|learning|leukocyte migration|platelet activation|regulation of defense response to virus by virus|T cell costimulation|T cell receptor signaling pathway|viral reproduction	cytosol|endosome|plasma membrane	ATP binding|glycoprotein binding|identical protein binding|metal ion binding|non-membrane spanning protein tyrosine kinase activity			lung(5)|central_nervous_system(1)|skin(1)	7		all_cancers(87;1.37e-05)|Acute lymphoblastic leukemia(125;2.15e-07)|all_hematologic(75;5.28e-06)|all_epithelial(87;0.00125)|Colorectal(196;0.0211)		all cancers(137;0.0451)|OV - Ovarian serous cystadenocarcinoma(136;0.0476)|Epithelial(106;0.102)	Dasatinib(DB01254)													---	---	---	---
LAMA4	3910	broad.mit.edu	37	6	112455712	112455712	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112455712C>A	uc003pvu.2	-	26	3823	c.3514G>T	c.(3514-3516)GAT>TAT	p.D1172Y	LAMA4_uc003pvv.2_Missense_Mutation_p.D1165Y|LAMA4_uc003pvt.2_Missense_Mutation_p.D1165Y	NM_001105206	NP_001098676	Q16363	LAMA4_HUMAN	laminin, alpha 4 isoform 1 precursor	1172	Laminin G-like 2.				cell adhesion|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	extracellular matrix structural constituent|receptor binding			ovary(4)|breast(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	9		all_cancers(87;0.000196)|all_hematologic(75;0.000114)|all_epithelial(87;0.00542)|Colorectal(196;0.0209)		all cancers(137;0.0335)|OV - Ovarian serous cystadenocarcinoma(136;0.0578)|Epithelial(106;0.0748)|BRCA - Breast invasive adenocarcinoma(108;0.242)														---	---	---	---
HDAC2	3066	broad.mit.edu	37	6	114277326	114277326	+	Intron	SNP	G	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:114277326G>C	uc003pwd.1	-						HDAC2_uc003pwc.1_Intron|HDAC2_uc003pwe.1_Intron	NM_001527	NP_001518			histone deacetylase 2						blood coagulation|dendrite development|embryonic digit morphogenesis|epidermal cell differentiation|eyelid development in camera-type eye|fungiform papilla formation|hair follicle placode formation|maintenance of chromatin silencing|negative regulation of apoptosis|negative regulation of cell cycle|negative regulation of neuron projection development|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|odontogenesis of dentine-containing tooth|positive regulation of cell proliferation|positive regulation of proteolysis|positive regulation of receptor biosynthetic process|positive regulation of transcription from RNA polymerase II promoter	cytoplasm|ESC/E(Z) complex|NuRD complex|Sin3 complex	chromatin binding|enzyme binding|histone deacetylase activity (H3-K16 specific)|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|sequence-specific DNA binding|transcription factor binding			skin(2)|ovary(1)|central_nervous_system(1)	4		all_cancers(87;0.000629)|all_epithelial(87;0.00274)|Colorectal(196;0.0317)|all_lung(197;0.24)		all cancers(137;0.00318)|OV - Ovarian serous cystadenocarcinoma(136;0.00569)|Epithelial(106;0.0112)|GBM - Glioblastoma multiforme(226;0.0832)	Vorinostat(DB02546)													---	---	---	---
TSPYL4	23270	broad.mit.edu	37	6	116574172	116574172	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:116574172G>A	uc003pwn.2	-	1	1090	c.1000C>T	c.(1000-1002)CGA>TGA	p.R334*	DSE_uc011ebf.1_5'Flank|TSPYL4_uc011ebe.1_Nonsense_Mutation_p.R162*|uc003pwo.1_5'Flank	NM_021648	NP_067680	Q9UJ04	TSYL4_HUMAN	TSPY-like 4	334					nucleosome assembly	nucleus					0		all_cancers(87;0.0144)|all_epithelial(87;0.021)|Colorectal(196;0.234)		all cancers(137;0.045)|OV - Ovarian serous cystadenocarcinoma(136;0.0666)|GBM - Glioblastoma multiforme(226;0.095)|Epithelial(106;0.125)														---	---	---	---
GOPC	57120	broad.mit.edu	37	6	117884469	117884469	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:117884469C>T	uc003pxu.2	-	9	1567	c.1337G>A	c.(1336-1338)GGT>GAT	p.G446D	GOPC_uc003pxq.1_Intron|DCBLD1_uc003pxs.2_Intron|GOPC_uc003pxv.2_Missense_Mutation_p.G438D	NM_020399	NP_065132	Q9HD26	GOPC_HUMAN	golgi associated PDZ and coiled-coil motif	446					apical protein localization|cytoplasmic sequestering of CFTR protein|ER to Golgi vesicle-mediated transport|Golgi to plasma membrane transport|protein homooligomerization|protein transport	cell junction|dendrite|Golgi membrane|postsynaptic density|postsynaptic membrane|trans-Golgi network transport vesicle	cystic fibrosis transmembrane conductance regulator binding			ovary(1)	1		all_cancers(87;0.00844)|all_epithelial(87;0.0242)		GBM - Glioblastoma multiforme(226;0.0363)|OV - Ovarian serous cystadenocarcinoma(136;0.0821)|all cancers(137;0.0976)				O	ROS1	glioblastoma								---	---	---	---
TPD52L1	7164	broad.mit.edu	37	6	125541338	125541338	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:125541338A>G	uc003pzu.1	+	2	353	c.134A>G	c.(133-135)CAG>CGG	p.Q45R	TPD52L1_uc003pzv.1_Missense_Mutation_p.Q45R|TPD52L1_uc003pzw.1_Missense_Mutation_p.Q45R|TPD52L1_uc003pzx.1_Missense_Mutation_p.Q16R|TPD52L1_uc003pzy.1_Missense_Mutation_p.Q16R|TPD52L1_uc003pzz.1_Missense_Mutation_p.Q16R	NM_003287	NP_003278	Q16890	TPD53_HUMAN	tumor protein D52-like 1 isoform 1	45	Potential.				DNA fragmentation involved in apoptotic nuclear change|G2/M transition of mitotic cell cycle|induction of apoptosis|positive regulation of JNK cascade|positive regulation of MAP kinase activity	perinuclear region of cytoplasm	caspase activator activity|protein heterodimerization activity|protein homodimerization activity				0			LUSC - Lung squamous cell carcinoma(4;0.0263)|Lung(4;0.0828)	GBM - Glioblastoma multiforme(226;0.0265)														---	---	---	---
NCOA7	135112	broad.mit.edu	37	6	126248907	126248907	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:126248907A>G	uc010kes.2	+						NCOA7_uc003qae.3_Intron|NCOA7_uc003qah.2_Intron|NCOA7_uc003qai.2_Intron|NCOA7_uc010ket.2_Intron|NCOA7_uc003qak.2_Intron	NM_181782	NP_861447			nuclear receptor coactivator 7 isoform 1						cell wall macromolecule catabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding			lung(2)|ovary(1)	3				UCEC - Uterine corpus endometrioid carcinoma (4;0.0803)|GBM - Glioblastoma multiforme(226;0.0193)|all cancers(137;0.237)														---	---	---	---
LAMA2	3908	broad.mit.edu	37	6	129785509	129785509	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:129785509G>A	uc003qbn.2	+	49	7172	c.7067G>A	c.(7066-7068)CGC>CAC	p.R2356H	LAMA2_uc003qbo.2_Missense_Mutation_p.R2356H	NM_000426	NP_000417	P24043	LAMA2_HUMAN	laminin alpha 2 subunit isoform a precursor	2356	Laminin G-like 2.				cell adhesion|muscle organ development|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	receptor binding|structural molecule activity			ovary(8)|breast(1)|skin(1)	10				OV - Ovarian serous cystadenocarcinoma(136;0.178)|all cancers(137;0.245)														---	---	---	---
HBS1L	10767	broad.mit.edu	37	6	135317929	135317929	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:135317929G>A	uc003qez.2	-	7	1158	c.951C>T	c.(949-951)GGC>GGT	p.G317G	HBS1L_uc003qey.2_Silent_p.G153G|HBS1L_uc011ecy.1_Silent_p.G41G|HBS1L_uc011ecz.1_Silent_p.G153G|HBS1L_uc011eda.1_Silent_p.G275G	NM_006620	NP_006611	Q9Y450	HBS1L_HUMAN	Hsp70 subfamily B suppressor 1-like protein	317					signal transduction		GTP binding|GTPase activity|translation elongation factor activity			skin(2)	2	Colorectal(23;0.221)			OV - Ovarian serous cystadenocarcinoma(155;0.0046)|GBM - Glioblastoma multiforme(68;0.00702)														---	---	---	---
MAP7	9053	broad.mit.edu	37	6	136687112	136687112	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:136687112G>A	uc003qgz.2	-	10	1280	c.1034C>T	c.(1033-1035)CCG>CTG	p.P345L	MAP7_uc011edf.1_Missense_Mutation_p.P330L|MAP7_uc011edg.1_Missense_Mutation_p.P375L|MAP7_uc010kgu.2_Missense_Mutation_p.P367L|MAP7_uc011edh.1_Missense_Mutation_p.P330L|MAP7_uc010kgv.2_Missense_Mutation_p.P367L|MAP7_uc010kgs.2_Missense_Mutation_p.P199L|MAP7_uc011edi.1_Missense_Mutation_p.P199L|MAP7_uc010kgq.1_Missense_Mutation_p.P251L|MAP7_uc003qha.1_Missense_Mutation_p.P308L|MAP7_uc010kgr.2_Missense_Mutation_p.P199L	NM_003980	NP_003971	Q14244	MAP7_HUMAN	microtubule-associated protein 7	345	Pro-rich.				establishment or maintenance of cell polarity|microtubule cytoskeleton organization|protein localization in plasma membrane|response to osmotic stress	basolateral plasma membrane|microtubule|microtubule associated complex|nucleus|perinuclear region of cytoplasm	receptor binding|structural molecule activity				0	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00199)|OV - Ovarian serous cystadenocarcinoma(155;0.00643)														---	---	---	---
IL20RA	53832	broad.mit.edu	37	6	137322794	137322794	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:137322794G>T	uc003qhj.2	-	7	1996	c.1563C>A	c.(1561-1563)CTC>CTA	p.L521L	IL20RA_uc011edl.1_Silent_p.L472L|IL20RA_uc003qhk.2_Silent_p.L410L|IL20RA_uc003qhi.2_Silent_p.L253L	NM_014432	NP_055247	Q9UHF4	I20RA_HUMAN	interleukin 20 receptor, alpha precursor	521	Cytoplasmic (Potential).					integral to membrane	receptor activity			ovary(2)|skin(2)	4	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.000351)|OV - Ovarian serous cystadenocarcinoma(155;0.00459)														---	---	---	---
GPR126	57211	broad.mit.edu	37	6	142688774	142688774	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:142688774C>A	uc010khc.2	+	3	583	c.172C>A	c.(172-174)CCT>ACT	p.P58T	GPR126_uc010khd.2_Missense_Mutation_p.P58T|GPR126_uc010khe.2_Missense_Mutation_p.P58T|GPR126_uc010khf.2_Missense_Mutation_p.P58T|GPR126_uc003qix.2_Missense_Mutation_p.P58T	NM_020455	NP_065188	Q86SQ4	GP126_HUMAN	G protein-coupled receptor 126 alpha 1	58	CUB.|Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(1)	1	Breast(32;0.176)			OV - Ovarian serous cystadenocarcinoma(155;9.33e-06)|GBM - Glioblastoma multiforme(68;0.00121)														---	---	---	---
GRM1	2911	broad.mit.edu	37	6	146720132	146720132	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:146720132A>G	uc010khw.1	+	8	2427	c.1957A>G	c.(1957-1959)ACT>GCT	p.T653A	GRM1_uc010khv.1_Missense_Mutation_p.T653A|GRM1_uc003qll.2_Missense_Mutation_p.T653A|GRM1_uc011edz.1_Missense_Mutation_p.T653A|GRM1_uc011eea.1_Missense_Mutation_p.T653A	NM_000838	NP_000829	Q13255	GRM1_HUMAN	glutamate receptor, metabotropic 1 isoform alpha	653	Extracellular (Potential).				synaptic transmission	integral to plasma membrane	G-protein coupled receptor activity|glutamate receptor activity			lung(8)|ovary(4)|central_nervous_system(3)|large_intestine(2)|breast(2)	19		Ovarian(120;0.0387)		OV - Ovarian serous cystadenocarcinoma(155;5.35e-08)|GBM - Glioblastoma multiforme(68;0.00762)	Acamprosate(DB00659)|L-Glutamic Acid(DB00142)													---	---	---	---
GRM1	2911	broad.mit.edu	37	6	146755775	146755775	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:146755775C>A	uc010khw.1	+	9	3898	c.3428C>A	c.(3427-3429)CCT>CAT	p.P1143H	GRM1_uc010khv.1_3'UTR|GRM1_uc003qll.2_3'UTR|GRM1_uc011edz.1_3'UTR|GRM1_uc011eea.1_3'UTR	NM_000838	NP_000829	Q13255	GRM1_HUMAN	glutamate receptor, metabotropic 1 isoform alpha	1143	Ser-rich.|Cytoplasmic (Potential).				synaptic transmission	integral to plasma membrane	G-protein coupled receptor activity|glutamate receptor activity			lung(8)|ovary(4)|central_nervous_system(3)|large_intestine(2)|breast(2)	19		Ovarian(120;0.0387)		OV - Ovarian serous cystadenocarcinoma(155;5.35e-08)|GBM - Glioblastoma multiforme(68;0.00762)	Acamprosate(DB00659)|L-Glutamic Acid(DB00142)													---	---	---	---
STXBP5	134957	broad.mit.edu	37	6	147637446	147637446	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:147637446G>A	uc003qlz.2	+	16	1866	c.1705G>A	c.(1705-1707)GTG>ATG	p.V569M	STXBP5_uc010khz.1_Missense_Mutation_p.V569M|STXBP5_uc003qlx.2_RNA|STXBP5_uc003qly.2_Missense_Mutation_p.V240M	NM_001127715	NP_001121187	Q5T5C0	STXB5_HUMAN	syntaxin binding protein 5 (tomosyn) isoform b	569	WD 9.				exocytosis|positive regulation of exocytosis|protein transport	cell junction|cytoplasmic vesicle membrane|nicotinic acetylcholine-gated receptor-channel complex|synaptic vesicle	syntaxin-1 binding				0		Ovarian(120;0.0164)		OV - Ovarian serous cystadenocarcinoma(155;1.77e-09)|GBM - Glioblastoma multiforme(68;0.0694)														---	---	---	---
UST	10090	broad.mit.edu	37	6	149285641	149285641	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:149285641G>A	uc003qmg.2	+	5	919	c.623G>A	c.(622-624)AGA>AAA	p.R208K	uc003qmh.1_Intron	NM_005715	NP_005706	Q9Y2C2	UST_HUMAN	uronyl-2-sulfotransferase	208	Lumenal (Potential).				protein sulfation	Golgi membrane|integral to membrane	sulfotransferase activity			ovary(2)	2		Ovarian(120;0.0907)		OV - Ovarian serous cystadenocarcinoma(155;1.78e-10)|GBM - Glioblastoma multiforme(68;0.138)														---	---	---	---
FNDC1	84624	broad.mit.edu	37	6	159647621	159647621	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:159647621C>T	uc010kjv.2	+						FNDC1_uc010kjw.1_Intron	NM_032532	NP_115921			fibronectin type III domain containing 1							extracellular region				large_intestine(4)|ovary(3)|central_nervous_system(1)	8		Breast(66;0.000781)|Ovarian(120;0.0308)|Prostate(117;0.195)		OV - Ovarian serous cystadenocarcinoma(65;2.6e-16)|BRCA - Breast invasive adenocarcinoma(81;1.06e-05)														---	---	---	---
PNLDC1	154197	broad.mit.edu	37	6	160230165	160230165	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:160230165T>C	uc003qsx.1	+	9	896	c.725T>C	c.(724-726)TTC>TCC	p.F242S	PNLDC1_uc003qsy.1_Missense_Mutation_p.F253S	NM_173516	NP_775787	Q8NA58	PNDC1_HUMAN	poly(A)-specific ribonuclease (PARN)-like domain	242	Cytoplasmic (Potential).					integral to membrane|nucleus	nucleic acid binding				0		Breast(66;0.00519)|Ovarian(120;0.123)		OV - Ovarian serous cystadenocarcinoma(65;1.55e-18)|BRCA - Breast invasive adenocarcinoma(81;5.87e-06)														---	---	---	---
PARK2	5071	broad.mit.edu	37	6	161990428	161990428	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:161990428T>A	uc003qtx.3	-	8	1026	c.892A>T	c.(892-894)ATT>TTT	p.I298F	PARK2_uc003qtv.3_Intron|PARK2_uc010kkd.2_Missense_Mutation_p.I107F|PARK2_uc003qtw.3_Missense_Mutation_p.I107F|PARK2_uc003qty.3_Missense_Mutation_p.I270F|PARK2_uc003qtz.3_Missense_Mutation_p.I149F|PARK2_uc010kke.1_Missense_Mutation_p.I317F|PARK2_uc011egf.1_5'UTR	NM_004562	NP_004553	O60260	PRKN2_HUMAN	parkin isoform 1	298					aggresome assembly|central nervous system development|mitochondrion degradation|negative regulation of actin filament bundle assembly|negative regulation of cell death|negative regulation of protein phosphorylation|negative regulation of release of cytochrome c from mitochondria|neuron death|positive regulation of I-kappaB kinase/NF-kappaB cascade|protein autoubiquitination|protein K48-linked ubiquitination|protein K63-linked ubiquitination|protein monoubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|regulation of autophagy|regulation of reactive oxygen species metabolic process	aggresome|cytosol|endoplasmic reticulum|Golgi apparatus|mitochondrion|nucleus|perinuclear region of cytoplasm	chaperone binding|PDZ domain binding|protein kinase binding|ubiquitin protein ligase binding|ubiquitin-protein ligase activity|zinc ion binding			upper_aerodigestive_tract(1)	1		all_cancers(1;8.13e-65)|all_epithelial(1;5.77e-64)|Colorectal(1;9.65e-15)|all_lung(1;1.66e-13)|Lung NSC(1;7.54e-11)|Melanoma(1;1.75e-09)|Breast(66;7.81e-05)|Ovarian(120;0.000981)|Prostate(117;0.0288)|Esophageal squamous(34;0.102)		UCEC - Uterine corpus endometrioid carcinoma (4;0.0663)|all cancers(1;1.9e-63)|Epithelial(1;1.5e-59)|Colorectal(1;2.16e-23)|OV - Ovarian serous cystadenocarcinoma(65;3.53e-20)|COAD - Colon adenocarcinoma(1;2.11e-15)|STAD - Stomach adenocarcinoma(1;4.64e-07)|BRCA - Breast invasive adenocarcinoma(81;1.49e-06)|READ - Rectum adenocarcinoma(1;2.95e-06)|GBM - Glioblastoma multiforme(2;7.23e-06)|Lung(1;0.00163)|KIRC - Kidney renal clear cell carcinoma(4;0.00371)|LUSC - Lung squamous cell carcinoma(1;0.00442)|Kidney(4;0.0046)														---	---	---	---
THBS2	7058	broad.mit.edu	37	6	169629684	169629684	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:169629684C>T	uc003qwt.2	-	15	2490	c.2242G>A	c.(2242-2244)GGT>AGT	p.G748S		NM_003247	NP_003238	P35442	TSP2_HUMAN	thrombospondin 2 precursor	748	TSP type-3 2.				cell adhesion	extracellular region	calcium ion binding|heparin binding|protein binding|structural molecule activity			ovary(5)	5		Breast(66;1.78e-05)|Ovarian(120;0.0728)|Esophageal squamous(34;0.247)		OV - Ovarian serous cystadenocarcinoma(33;1.85e-21)|BRCA - Breast invasive adenocarcinoma(81;1.43e-06)|GBM - Glioblastoma multiforme(31;0.000379)														---	---	---	---
THBS2	7058	broad.mit.edu	37	6	169632789	169632789	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:169632789G>A	uc003qwt.2	-	13	2150	c.1902C>T	c.(1900-1902)GTC>GTT	p.V634V		NM_003247	NP_003238	P35442	TSP2_HUMAN	thrombospondin 2 precursor	634	EGF-like 2; calcium-binding (Potential).				cell adhesion	extracellular region	calcium ion binding|heparin binding|protein binding|structural molecule activity			ovary(5)	5		Breast(66;1.78e-05)|Ovarian(120;0.0728)|Esophageal squamous(34;0.247)		OV - Ovarian serous cystadenocarcinoma(33;1.85e-21)|BRCA - Breast invasive adenocarcinoma(81;1.43e-06)|GBM - Glioblastoma multiforme(31;0.000379)														---	---	---	---
TCTE3	6991	broad.mit.edu	37	6	170151559	170151559	+	5'UTR	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170151559C>T	uc003qxe.1	-	1					TCTE3_uc003qxf.2_RNA|C6orf70_uc003qxg.1_5'Flank|C6orf70_uc011ehb.1_5'Flank|C6orf70_uc003qxh.1_5'Flank|C6orf70_uc010kky.1_5'Flank	NM_174910	NP_777570			t-complex-associated-testis-expressed 3						transport	cytoplasm|dynein complex|membrane|microtubule	motor activity				0		Breast(66;0.000338)		OV - Ovarian serous cystadenocarcinoma(33;1.08e-21)|BRCA - Breast invasive adenocarcinoma(81;1.32e-07)|GBM - Glioblastoma multiforme(31;0.00157)														---	---	---	---
DLL1	28514	broad.mit.edu	37	6	170592160	170592160	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170592160C>T	uc003qxm.2	-	10	2552	c.2082G>A	c.(2080-2082)TCG>TCA	p.S694S		NM_005618	NP_005609	O00548	DLL1_HUMAN	delta-like 1 precursor	694	Cytoplasmic (Potential).				cell communication|cell fate determination|hemopoiesis|Notch receptor processing|Notch signaling pathway|regulation of cell adhesion	extracellular region|integral to plasma membrane	calcium ion binding|Notch binding			lung(4)|ovary(1)	5		Breast(66;5.08e-05)|Ovarian(120;0.125)|Esophageal squamous(34;0.246)		OV - Ovarian serous cystadenocarcinoma(33;6.71e-23)|BRCA - Breast invasive adenocarcinoma(81;4.81e-06)|GBM - Glioblastoma multiforme(31;0.0584)														---	---	---	---
IQCE	23288	broad.mit.edu	37	7	2625867	2625867	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2625867G>A	uc003smo.3	+	12	1034	c.850G>A	c.(850-852)GCC>ACC	p.A284T	IQCE_uc010ksm.1_Missense_Mutation_p.A284T|IQCE_uc003sml.1_Missense_Mutation_p.A284T|IQCE_uc011jvy.1_Missense_Mutation_p.A268T|IQCE_uc011jvz.1_Missense_Mutation_p.A219T|IQCE_uc003smk.3_Missense_Mutation_p.A268T|IQCE_uc003smn.3_Missense_Mutation_p.A219T	NM_152558	NP_689771	Q6IPM2	IQCE_HUMAN	IQ motif containing E isoform 1	284											0		Ovarian(82;0.0112)		OV - Ovarian serous cystadenocarcinoma(56;1.23e-13)														---	---	---	---
CARD11	84433	broad.mit.edu	37	7	2953041	2953041	+	Missense_Mutation	SNP	G	A	A	rs149857605	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2953041G>A	uc003smv.2	-	22	3303	c.2899C>T	c.(2899-2901)CGC>TGC	p.R967C		NM_032415	NP_115791	Q9BXL7	CAR11_HUMAN	caspase recruitment domain family, member 11	967					positive regulation of cytokine production|positive regulation of NF-kappaB transcription factor activity|regulation of apoptosis|T cell costimulation|T cell receptor signaling pathway	cytosol|membrane raft|plasma membrane	CARD domain binding|guanylate kinase activity			haematopoietic_and_lymphoid_tissue(43)|ovary(2)|kidney(2)|skin(2)|central_nervous_system(1)	50		Ovarian(82;0.0115)		OV - Ovarian serous cystadenocarcinoma(56;8.44e-14)				Mis		DLBCL								---	---	---	---
SDK1	221935	broad.mit.edu	37	7	4011175	4011175	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4011175A>G	uc003smx.2	+	12	1931	c.1792A>G	c.(1792-1794)ACA>GCA	p.T598A		NM_152744	NP_689957	Q7Z5N4	SDK1_HUMAN	sidekick 1 precursor	598	Ig-like C2-type 6.				cell adhesion	integral to membrane				large_intestine(3)|ovary(2)|skin(1)	6		all_cancers(1;0.127)|Ovarian(82;0.0177)|Myeloproliferative disorder(862;0.194)		UCEC - Uterine corpus endometrioid carcinoma (126;0.121)|OV - Ovarian serous cystadenocarcinoma(56;9.65e-15)														---	---	---	---
SDK1	221935	broad.mit.edu	37	7	4056799	4056799	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4056799G>A	uc003smx.2	+						SDK1_uc010kso.2_Intron	NM_152744	NP_689957			sidekick 1 precursor						cell adhesion	integral to membrane				large_intestine(3)|ovary(2)|skin(1)	6		all_cancers(1;0.127)|Ovarian(82;0.0177)|Myeloproliferative disorder(862;0.194)		UCEC - Uterine corpus endometrioid carcinoma (126;0.121)|OV - Ovarian serous cystadenocarcinoma(56;9.65e-15)														---	---	---	---
SDK1	221935	broad.mit.edu	37	7	4091419	4091419	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4091419C>T	uc003smx.2	+	19	3007	c.2868C>T	c.(2866-2868)GAC>GAT	p.D956D	SDK1_uc010kso.2_Silent_p.D232D	NM_152744	NP_689957	Q7Z5N4	SDK1_HUMAN	sidekick 1 precursor	956	Fibronectin type-III 3.				cell adhesion	integral to membrane				large_intestine(3)|ovary(2)|skin(1)	6		all_cancers(1;0.127)|Ovarian(82;0.0177)|Myeloproliferative disorder(862;0.194)		UCEC - Uterine corpus endometrioid carcinoma (126;0.121)|OV - Ovarian serous cystadenocarcinoma(56;9.65e-15)														---	---	---	---
KIAA0415	9907	broad.mit.edu	37	7	4828500	4828500	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4828500C>A	uc003sne.2	+	13	1708	c.1625C>A	c.(1624-1626)CCC>CAC	p.P542H	KIAA0415_uc010ksp.2_RNA|KIAA0415_uc003snf.2_5'UTR	NM_014855	NP_055670	O43299	K0415_HUMAN	hypothetical protein LOC9907	542					cell death|double-strand break repair via homologous recombination	cytoplasm|nucleus	protein binding			central_nervous_system(1)	1		Ovarian(82;0.0175)		UCEC - Uterine corpus endometrioid carcinoma (126;0.091)|OV - Ovarian serous cystadenocarcinoma(56;8.35e-15)														---	---	---	---
DAGLB	221955	broad.mit.edu	37	7	6474590	6474590	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6474590T>C	uc003sqa.2	-	4	651	c.481A>G	c.(481-483)AAA>GAA	p.K161E	DAGLB_uc011jwt.1_5'UTR|DAGLB_uc011jwu.1_Intron|DAGLB_uc003sqb.2_Intron|DAGLB_uc003sqc.2_Intron|DAGLB_uc011jwv.1_RNA|DAGLB_uc003sqd.3_Missense_Mutation_p.K120E|DAGLB_uc011jww.1_Intron	NM_139179	NP_631918	Q8NCG7	DGLB_HUMAN	diacylglycerol lipase, beta isoform 1	161	Cytoplasmic (Potential).				lipid catabolic process|platelet activation	integral to membrane|plasma membrane	acylglycerol lipase activity|metal ion binding|triglyceride lipase activity			ovary(2)|central_nervous_system(1)	3		Ovarian(82;0.232)		UCEC - Uterine corpus endometrioid carcinoma (126;0.102)														---	---	---	---
ZDHHC4	55146	broad.mit.edu	37	7	6628377	6628377	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6628377T>C	uc003sqi.2	+	9	1229	c.871T>C	c.(871-873)TAC>CAC	p.Y291H	ZDHHC4_uc003sql.2_Missense_Mutation_p.Y291H|ZDHHC4_uc003sqh.2_Missense_Mutation_p.Y291H|ZDHHC4_uc003sqj.2_Missense_Mutation_p.Y291H|ZDHHC4_uc003sqk.2_Missense_Mutation_p.Y291H|ZDHHC4_uc003sqm.2_Missense_Mutation_p.Y291H|uc011jwy.1_5'Flank|C7orf26_uc003sqo.1_5'Flank|C7orf26_uc003sqp.1_5'Flank|C7orf26_uc003sqq.1_5'Flank	NM_001134388	NP_001127860	Q9NPG8	ZDHC4_HUMAN	zinc finger, DHHC-type containing 4	291						integral to membrane	acyltransferase activity|zinc ion binding			breast(1)|pancreas(1)	2		Ovarian(82;0.232)		UCEC - Uterine corpus endometrioid carcinoma (126;0.1)														---	---	---	---
ZNF12	7559	broad.mit.edu	37	7	6737311	6737311	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6737311C>A	uc003sqt.1	-						ZNF12_uc011jxa.1_Intron|ZNF12_uc003sqs.1_Intron	NM_016265	NP_057349			zinc finger protein 12 isoform a						negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Ovarian(82;0.0776)		UCEC - Uterine corpus endometrioid carcinoma (126;0.0231)														---	---	---	---
THSD7A	221981	broad.mit.edu	37	7	11521445	11521445	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:11521445G>A	uc003ssf.3	-	7	2239	c.1987C>T	c.(1987-1989)CGA>TGA	p.R663*		NM_015204	NP_056019	Q9UPZ6	THS7A_HUMAN	thrombospondin, type I, domain containing 7A	663	TSP type-1 6.|Extracellular (Potential).					integral to membrane				ovary(3)	3				UCEC - Uterine corpus endometrioid carcinoma (126;0.163)											HNSCC(18;0.044)			---	---	---	---
SCIN	85477	broad.mit.edu	37	7	12668733	12668733	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:12668733G>A	uc003ssn.3	+	9	1415	c.1205G>A	c.(1204-1206)CGT>CAT	p.R402H	SCIN_uc010ktt.2_RNA|SCIN_uc003sso.3_Missense_Mutation_p.R155H	NM_001112706	NP_001106177	Q9Y6U3	ADSV_HUMAN	scinderin isoform 1	402	Ca(2+)-dependent actin binding.|Gelsolin-like 4.				actin filament capping|actin filament severing|actin nucleation|calcium ion-dependent exocytosis|negative regulation of cell proliferation|positive regulation of apoptosis|positive regulation of megakaryocyte differentiation|positive regulation of secretion|regulation of chondrocyte differentiation	cell cortex|cytoskeleton	1-phosphatidylinositol binding|actin filament binding|calcium ion binding|phosphatidylinositol-4,5-bisphosphate binding|phosphatidylserine binding			ovary(2)	2				UCEC - Uterine corpus endometrioid carcinoma (126;0.195)														---	---	---	---
HOXA1	3198	broad.mit.edu	37	7	27135012	27135012	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27135012C>A	uc003sye.2	-	1	614	c.520G>T	c.(520-522)GCT>TCT	p.A174S	HOXA1_uc003syd.2_Intron|uc003syg.2_5'Flank	NM_005522	NP_005513	P49639	HXA1_HUMAN	homeobox A1 isoform a	174						nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(3)	3																		---	---	---	---
HOXA13	3209	broad.mit.edu	37	7	27237864	27237864	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27237864T>C	uc003szb.1	-	2	1149	c.1120A>G	c.(1120-1122)AGG>GGG	p.R374G	uc003szc.1_5'Flank	NM_000522	NP_000513	P31271	HXA13_HUMAN	homeobox A13	374	Homeobox.				skeletal system development	nucleus	sequence-specific DNA binding			breast(1)	1								T	NUP98	AML								---	---	---	---
CPVL	54504	broad.mit.edu	37	7	29134756	29134756	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:29134756G>A	uc003szv.2	-	5	525	c.406C>T	c.(406-408)CGT>TGT	p.R136C	CPVL_uc003szw.2_Missense_Mutation_p.R136C|CPVL_uc003szx.2_Missense_Mutation_p.R136C	NM_031311	NP_112601	Q9H3G5	CPVL_HUMAN	serine carboxypeptidase vitellogenic-like	136					proteolysis		protein binding|serine-type carboxypeptidase activity			ovary(2)	2																		---	---	---	---
NOD1	10392	broad.mit.edu	37	7	30492371	30492371	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30492371G>A	uc003tav.2	-	6	1185	c.662C>T	c.(661-663)ACG>ATG	p.T221M	NOD1_uc010kvs.2_Intron	NM_006092	NP_006083	Q9Y239	NOD1_HUMAN	nucleotide-binding oligomerization domain	221	NACHT.				activation of MAPK activity|detection of bacterium|induction of apoptosis|inflammatory response|innate immune response|interleukin-8 biosynthetic process|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of dendritic cell antigen processing and presentation|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|protein oligomerization|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	basolateral plasma membrane|cytosol	ATP binding|CARD domain binding|caspase activator activity|peptidoglycan binding|protein homodimerization activity			ovary(1)|skin(1)	2																		---	---	---	---
ADCYAP1R1	117	broad.mit.edu	37	7	31124942	31124942	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:31124942G>A	uc003tca.1	+	9	777	c.554G>A	c.(553-555)CGC>CAC	p.R185H	ADCYAP1R1_uc003tcb.1_Missense_Mutation_p.R164H|ADCYAP1R1_uc003tcc.1_Missense_Mutation_p.R185H|ADCYAP1R1_uc003tcd.1_Missense_Mutation_p.R185H|ADCYAP1R1_uc003tce.1_Missense_Mutation_p.R185H|ADCYAP1R1_uc003tcf.1_5'Flank	NM_001118	NP_001109	P41586	PACR_HUMAN	adenylate cyclase activating polypeptide 1	185	Cytoplasmic (Potential).				activation of adenylate cyclase activity|cell differentiation|nerve growth factor receptor signaling pathway|spermatogenesis	integral to plasma membrane	vasoactive intestinal polypeptide receptor activity			ovary(1)	1																		---	---	---	---
GLI3	2737	broad.mit.edu	37	7	42005764	42005764	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:42005764G>T	uc011kbh.1	-	15	2998	c.2907C>A	c.(2905-2907)GCC>GCA	p.A969A	GLI3_uc011kbg.1_Silent_p.A910A	NM_000168	NP_000159	P10071	GLI3_HUMAN	GLI-Kruppel family member GLI3	969					negative regulation of alpha-beta T cell differentiation|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of smoothened signaling pathway|negative regulation of transcription from RNA polymerase II promoter|negative thymic T cell selection|positive regulation of alpha-beta T cell differentiation|positive regulation of transcription from RNA polymerase II promoter|thymocyte apoptosis	cilium|cytosol|nucleolus	beta-catenin binding|histone acetyltransferase binding|histone deacetylase binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(11)|ovary(3)|large_intestine(2)|central_nervous_system(1)|kidney(1)|pancreas(1)	19														Greig_Cephalopolysyndactyly|Pallister-Hall_syndrome				---	---	---	---
C7orf25	79020	broad.mit.edu	37	7	42966278	42966278	+	Intron	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:42966278A>G	uc010kxr.2	-						PSMA2_uc003thy.2_Intron|PSMA2_uc010kxt.2_Intron|PSMA2_uc003thz.1_Intron	NM_001099858	NP_001093328			hypothetical protein LOC79020 a											skin(1)	1																		---	---	---	---
HECW1	23072	broad.mit.edu	37	7	43484841	43484841	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:43484841G>A	uc003tid.1	+	11	2675	c.2070G>A	c.(2068-2070)ACG>ACA	p.T690T	HECW1_uc011kbi.1_Silent_p.T690T	NM_015052	NP_055867	Q76N89	HECW1_HUMAN	NEDD4-like ubiquitin-protein ligase 1	690	Cys-rich.				protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	ubiquitin-protein ligase activity			ovary(8)|lung(6)|breast(4)|skin(4)|pancreas(1)	23																		---	---	---	---
ZMIZ2	83637	broad.mit.edu	37	7	44801116	44801116	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:44801116C>T	uc003tlr.2	+	10	1432	c.1309C>T	c.(1309-1311)CGC>TGC	p.R437C	ZMIZ2_uc003tlq.2_Missense_Mutation_p.R379C|ZMIZ2_uc003tls.2_Missense_Mutation_p.R411C|ZMIZ2_uc003tlt.2_Missense_Mutation_p.R60C|ZMIZ2_uc010kyj.2_5'UTR	NM_031449	NP_113637	Q8NF64	ZMIZ2_HUMAN	zinc finger, MIZ-type containing 2 isoform 1	437	Interaction with AR.				positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nuclear replication fork	ligand-dependent nuclear receptor transcription coactivator activity|protein binding|zinc ion binding			ovary(2)|large_intestine(2)|breast(1)	5																		---	---	---	---
ZPBP	11055	broad.mit.edu	37	7	49977188	49977188	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:49977188C>T	uc003tou.2	-	8	1062	c.992G>A	c.(991-993)CGT>CAT	p.R331H	ZPBP_uc011kci.1_Missense_Mutation_p.R257H|ZPBP_uc010kyw.2_Missense_Mutation_p.R330H	NM_007009	NP_008940	Q9BS86	ZPBP1_HUMAN	zona pellucida binding protein isoform 1	331					binding of sperm to zona pellucida	extracellular region					0	Glioma(55;0.08)|all_neural(89;0.245)																	---	---	---	---
GRB10	2887	broad.mit.edu	37	7	50683938	50683938	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:50683938C>T	uc003tpi.2	-	8	984	c.953G>A	c.(952-954)GGC>GAC	p.G318D	GRB10_uc003tph.3_Missense_Mutation_p.G260D|GRB10_uc003tpj.2_Intron|GRB10_uc003tpk.2_Missense_Mutation_p.G318D|GRB10_uc010kzb.2_Missense_Mutation_p.G260D|GRB10_uc003tpl.2_Missense_Mutation_p.G312D|GRB10_uc003tpm.2_Missense_Mutation_p.G260D|GRB10_uc003tpn.2_Missense_Mutation_p.G260D	NM_005311	NP_005302	Q13322	GRB10_HUMAN	growth factor receptor-bound protein 10 isoform	318	PH.				insulin receptor signaling pathway|insulin receptor signaling pathway|negative regulation of glucose import|negative regulation of glycogen biosynthetic process|negative regulation of insulin receptor signaling pathway|negative regulation of Wnt receptor signaling pathway|positive regulation of phosphorylation|positive regulation of vascular endothelial growth factor receptor signaling pathway	cytosol|plasma membrane	insulin receptor binding|insulin receptor binding|SH3/SH2 adaptor activity			lung(3)|ovary(2)|upper_aerodigestive_tract(1)	6	Glioma(55;0.08)|all_neural(89;0.245)													Russell-Silver_syndrome				---	---	---	---
LANCL2	55915	broad.mit.edu	37	7	55479657	55479657	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:55479657T>C	uc003tqp.2	+	6	1461	c.883T>C	c.(883-885)TAT>CAT	p.Y295H		NM_018697	NP_061167	Q9NS86	LANC2_HUMAN	LanC lantibiotic synthetase component C-like 2	295					negative regulation of transcription, DNA-dependent|positive regulation of abscisic acid mediated signaling pathway	cortical actin cytoskeleton|cytosol|nucleus|plasma membrane	ATP binding|catalytic activity|GTP binding|phosphatidylinositol-3-phosphate binding|phosphatidylinositol-4-phosphate binding|phosphatidylinositol-5-phosphate binding			ovary(1)|skin(1)	2	Breast(14;0.0379)		Lung(13;4.65e-05)|LUSC - Lung squamous cell carcinoma(13;0.000168)|STAD - Stomach adenocarcinoma(5;0.00128)|Epithelial(13;0.0706)															---	---	---	---
ZNF713	349075	broad.mit.edu	37	7	55990944	55990944	+	Silent	SNP	C	T	T	rs147455939		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:55990944C>T	uc003trc.1	+	2	176	c.138C>T	c.(136-138)GAC>GAT	p.D46D	ZNF713_uc003tra.1_Silent_p.D59D|MRPS17_uc003trb.2_Silent_p.D46D	NM_182633	NP_872439	Q8N859	ZN713_HUMAN	zinc finger protein 713	46	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2	Breast(14;0.214)		Lung(13;0.00024)|LUSC - Lung squamous cell carcinoma(13;0.00099)															---	---	---	---
ASL	435	broad.mit.edu	37	7	65557802	65557802	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:65557802G>T	uc003tuo.2	+	17	1409	c.1298G>T	c.(1297-1299)AGT>ATT	p.S433I	ASL_uc003tup.2_Missense_Mutation_p.S433I|ASL_uc003tur.2_Missense_Mutation_p.S407I|ASL_uc003tuq.2_Missense_Mutation_p.S413I	NM_000048	NP_000039	P04424	ARLY_HUMAN	argininosuccinate lyase isoform 1	433					arginine biosynthetic process via ornithine|arginine catabolic process|urea cycle	cytosol	argininosuccinate lyase activity			breast(2)	2					L-Arginine(DB00125)													---	---	---	---
WBSCR17	64409	broad.mit.edu	37	7	71130562	71130562	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:71130562C>T	uc003tvy.2	+	7	1247	c.1247C>T	c.(1246-1248)GCG>GTG	p.A416V	WBSCR17_uc003tvz.2_Missense_Mutation_p.A115V	NM_022479	NP_071924	Q6IS24	GLTL3_HUMAN	UDP-GalNAc:polypeptide	416	Lumenal (Potential).					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			skin(3)|upper_aerodigestive_tract(1)|ovary(1)|pancreas(1)|central_nervous_system(1)	7		all_cancers(73;0.2)|Lung NSC(55;0.094)|all_lung(88;0.125)																---	---	---	---
MLXIPL	51085	broad.mit.edu	37	7	73010969	73010969	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:73010969C>T	uc003tyn.1	-	11	1870	c.1822G>A	c.(1822-1824)GGC>AGC	p.G608S	MLXIPL_uc003tyj.1_Intron|MLXIPL_uc003tyk.1_Missense_Mutation_p.G608S|MLXIPL_uc003tyl.1_Missense_Mutation_p.G608S|MLXIPL_uc003tym.1_Missense_Mutation_p.G608S|MLXIPL_uc003tyo.1_Intron|MLXIPL_uc003typ.1_Missense_Mutation_p.G514S	NM_032951	NP_116569	Q9NP71	WBS14_HUMAN	Williams Beuren syndrome chromosome region 14	608					anatomical structure morphogenesis|energy reserve metabolic process|glucose mediated signaling pathway|intracellular protein kinase cascade|negative regulation of cell cycle arrest|negative regulation of oxidative phosphorylation|negative regulation of peptidyl-serine phosphorylation|positive regulation of cell proliferation|positive regulation of fatty acid biosynthetic process|positive regulation of glycolysis|positive regulation of transcription from RNA polymerase II promoter|triglyceride homeostasis	cytosol|transcription factor complex	carbohydrate response element binding|protein heterodimerization activity|sequence-specific DNA binding transcription factor activity|transcription factor binding			pancreas(1)	1		Lung NSC(55;0.0659)|all_lung(88;0.152)																---	---	---	---
PCLO	27445	broad.mit.edu	37	7	82582682	82582682	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82582682T>C	uc003uhx.2	-	5	7876	c.7587A>G	c.(7585-7587)ATA>ATG	p.I2529M	PCLO_uc003uhv.2_Missense_Mutation_p.I2529M|PCLO_uc010lec.2_5'Flank	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	2460	Pro-rich.				cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7																		---	---	---	---
PCLO	27445	broad.mit.edu	37	7	82583741	82583741	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82583741G>A	uc003uhx.2	-	5	6817	c.6528C>T	c.(6526-6528)GTC>GTT	p.V2176V	PCLO_uc003uhv.2_Silent_p.V2176V|PCLO_uc010lec.2_5'Flank	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	2107					cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7																		---	---	---	---
SEMA3E	9723	broad.mit.edu	37	7	83029537	83029537	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:83029537G>A	uc003uhy.1	-	11	1639	c.1173C>T	c.(1171-1173)TAC>TAT	p.Y391Y		NM_012431	NP_036563	O15041	SEM3E_HUMAN	semaphorin 3E precursor	391	Sema.				axon guidance	extracellular space|membrane	receptor activity			ovary(3)	3		Medulloblastoma(109;0.109)																---	---	---	---
COL1A2	1278	broad.mit.edu	37	7	94039080	94039080	+	Missense_Mutation	SNP	G	A	A	rs66612022		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:94039080G>A	uc003ung.1	+	19	1453	c.982G>A	c.(982-984)GGT>AGT	p.G328S	COL1A2_uc011kib.1_Intron	NM_000089	NP_000080	P08123	CO1A2_HUMAN	alpha 2 type I collagen precursor	328			G -> S (in OI1, OI3 AND OI4).		axon guidance|blood vessel development|collagen fibril organization|leukocyte migration|odontogenesis|platelet activation|regulation of blood pressure|Rho protein signal transduction|skeletal system development|skin morphogenesis|transforming growth factor beta receptor signaling pathway	collagen type I|extracellular space|plasma membrane	extracellular matrix structural constituent|identical protein binding|platelet-derived growth factor binding|protein binding, bridging		COL1A2/PLAG1(3)	soft_tissue(3)|central_nervous_system(3)|ovary(2)|skin(1)	9	all_cancers(62;2.46e-09)|all_epithelial(64;2.7e-08)		STAD - Stomach adenocarcinoma(171;0.0031)		Collagenase(DB00048)										HNSCC(75;0.22)			---	---	---	---
Unknown	0	broad.mit.edu	37	7	100608742	100608742	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100608742C>T	uc003uxl.1	+	7	2621	c.1821C>T	c.(1819-1821)CGC>CGT	p.R607R	uc003uxm.1_RNA|uc003uxn.1_RNA|uc010lhn.1_RNA					SubName: Full=Intestinal mucin; Flags: Fragment;																														---	---	---	---
CUX1	1523	broad.mit.edu	37	7	101755048	101755048	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:101755048C>T	uc003uyx.3	+	7	639	c.601C>T	c.(601-603)CAA>TAA	p.Q201*	CUX1_uc003uys.3_Nonsense_Mutation_p.Q212*|CUX1_uc003uyt.2_Nonsense_Mutation_p.Q212*|CUX1_uc011kkn.1_Nonsense_Mutation_p.Q175*|CUX1_uc003uyw.2_Nonsense_Mutation_p.Q166*|CUX1_uc003uyv.2_Nonsense_Mutation_p.Q196*|CUX1_uc003uyu.2_Nonsense_Mutation_p.Q212*	NM_181552	NP_853530	P39880	CUX1_HUMAN	cut-like homeobox 1 isoform a	201	Potential.				negative regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(5)|pancreas(1)|central_nervous_system(1)|skin(1)	8																		---	---	---	---
ARMC10	83787	broad.mit.edu	37	7	102738782	102738782	+	Missense_Mutation	SNP	G	A	A	rs142543653		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:102738782G>A	uc003vaw.1	+	7	1206	c.814G>A	c.(814-816)GTA>ATA	p.V272I	ARMC10_uc003vay.1_Missense_Mutation_p.V213I|ARMC10_uc003vax.1_Missense_Mutation_p.V237I|ARMC10_uc003vbb.1_Missense_Mutation_p.V178I|ARMC10_uc011kli.1_Missense_Mutation_p.V213I|ARMC10_uc010lis.1_Missense_Mutation_p.V154I|ARMC10_uc003vba.1_RNA|ARMC10_uc003vaz.1_Missense_Mutation_p.V150I	NM_031905	NP_114111	Q8N2F6	ARM10_HUMAN	SVH protein isoform a	272					regulation of growth	endoplasmic reticulum membrane|integral to membrane	binding			ovary(1)	1																		---	---	---	---
RELN	5649	broad.mit.edu	37	7	103163896	103163896	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:103163896C>T	uc003vca.2	-	47	7592	c.7432G>A	c.(7432-7434)GGG>AGG	p.G2478R	RELN_uc010liz.2_Missense_Mutation_p.G2478R	NM_005045	NP_005036	P78509	RELN_HUMAN	reelin isoform a	2478	EGF-like 6.				axon guidance|cell adhesion|cerebral cortex tangential migration|glial cell differentiation|neuron migration|peptidyl-tyrosine phosphorylation|positive regulation of protein kinase activity|positive regulation of small GTPase mediated signal transduction|response to pain|spinal cord patterning	cytoplasm|dendrite|extracellular space|proteinaceous extracellular matrix	metal ion binding|protein serine/threonine/tyrosine kinase activity|serine-type peptidase activity			ovary(8)|upper_aerodigestive_tract(5)|large_intestine(2)|central_nervous_system(2)|skin(1)|pancreas(1)	19				COAD - Colon adenocarcinoma(1;8.98e-05)|Colorectal(1;0.00184)														---	---	---	---
MLL5	55904	broad.mit.edu	37	7	104681433	104681433	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:104681433G>A	uc003vcm.2	+	3	568	c.34G>A	c.(34-36)GCA>ACA	p.A12T	MLL5_uc010lja.1_5'UTR|MLL5_uc010ljb.1_Missense_Mutation_p.A12T|MLL5_uc003vcl.2_Missense_Mutation_p.A12T|MLL5_uc010ljc.2_Missense_Mutation_p.A12T	NM_182931	NP_891847	Q8IZD2	MLL5_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 5	12					cell cycle arrest|cellular response to retinoic acid|DNA methylation|erythrocyte differentiation|neutrophil activation|neutrophil mediated immunity|positive regulation of granulocyte differentiation|positive regulation of transcription, DNA-dependent|retinoic acid receptor signaling pathway|transcription, DNA-dependent	MLL5-L complex|nuclear speck	enzyme binding|histone methyltransferase activity (H3-K4 specific)|transcription coactivator activity|zinc ion binding			ovary(2)|pancreas(1)	3																		---	---	---	---
FOXP2	93986	broad.mit.edu	37	7	114304351	114304351	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:114304351A>G	uc003vhb.2	+	16	2237	c.1863A>G	c.(1861-1863)TTA>TTG	p.L621L	FOXP2_uc003vgu.2_RNA|FOXP2_uc003vgz.2_Silent_p.L646L|FOXP2_uc003vha.2_Silent_p.L529L|FOXP2_uc011kmu.1_Silent_p.L638L|FOXP2_uc011kmv.1_Silent_p.L620L|FOXP2_uc010ljz.1_Silent_p.L436L	NM_014491	NP_055306	O15409	FOXP2_HUMAN	forkhead box P2 isoform I	621					camera-type eye development|caudate nucleus development|cerebellum development|cerebral cortex development|embryo development|growth|lung alveolus development|negative regulation of transcription, DNA-dependent|pattern specification process|positive regulation of epithelial cell proliferation involved in lung morphogenesis|positive regulation of mesenchymal cell proliferation|post-embryonic development|putamen development|regulation of sequence-specific DNA binding transcription factor activity|righting reflex|skeletal muscle tissue development|smooth muscle tissue development|vocal learning	cytoplasm|transcription factor complex	chromatin binding|DNA bending activity|double-stranded DNA binding|promoter binding|protein heterodimerization activity|protein homodimerization activity|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding|zinc ion binding			ovary(4)|pancreas(1)|lung(1)|breast(1)|skin(1)	8																		---	---	---	---
RNF133	168433	broad.mit.edu	37	7	122338804	122338804	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:122338804C>T	uc003vkj.1	-	1	405	c.169G>A	c.(169-171)GGA>AGA	p.G57R	CADPS2_uc010lkp.2_Intron|CADPS2_uc010lkq.2_Intron	NM_139175	NP_631914	Q8WVZ7	RN133_HUMAN	ring finger protein 133	57						endoplasmic reticulum membrane|integral to membrane	ligase activity|zinc ion binding			skin(1)	1																		---	---	---	---
GCC1	79571	broad.mit.edu	37	7	127224963	127224963	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127224963C>T	uc003vma.2	-	1	692	c.274G>A	c.(274-276)GAG>AAG	p.E92K		NM_024523	NP_078799	Q96CN9	GCC1_HUMAN	Golgi coiled-coil protein 1	92						Golgi membrane|plasma membrane	protein binding			ovary(2)	2																		---	---	---	---
SND1	27044	broad.mit.edu	37	7	127447556	127447556	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127447556C>T	uc003vmi.2	+	11	1397	c.1171C>T	c.(1171-1173)CGT>TGT	p.R391C	SND1_uc010lle.2_Missense_Mutation_p.R44C	NM_014390	NP_055205	Q7KZF4	SND1_HUMAN	staphylococcal nuclease domain containing 1	391	Nuclear localization signal (Potential).|TNase-like 3.				gene silencing by RNA|interspecies interaction between organisms|regulation of transcription, DNA-dependent|transcription, DNA-dependent	melanosome|nucleus|RNA-induced silencing complex	nuclease activity|nucleic acid binding|protein binding|transcription cofactor activity			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
LRRC4	64101	broad.mit.edu	37	7	127670140	127670140	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127670140T>A	uc003vmk.2	-	2	691	c.554A>T	c.(553-555)GAG>GTG	p.E185V	SND1_uc003vmi.2_Intron|SND1_uc010lle.2_Intron	NM_022143	NP_071426	Q9HBW1	LRRC4_HUMAN	leucine rich repeat containing 4 precursor	185	LRR 5.|Extracellular (Potential).					cell junction|integral to membrane|postsynaptic membrane				large_intestine(1)|breast(1)|central_nervous_system(1)|pancreas(1)	4				Lung(243;0.124)														---	---	---	---
SMO	6608	broad.mit.edu	37	7	128845210	128845210	+	Missense_Mutation	SNP	C	T	T	rs142599757		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128845210C>T	uc003vor.2	+	3	984	c.704C>T	c.(703-705)GCG>GTG	p.A235V	SMO_uc003vos.2_5'Flank	NM_005631	NP_005622	Q99835	SMO_HUMAN	smoothened precursor	235	Helical; Name=1; (Potential).				adenohypophysis development|axon extension involved in axon guidance|canonical Wnt receptor signaling pathway|cardioblast differentiation|central nervous system neuron differentiation|cerebellar cortex morphogenesis|ciliary receptor clustering involved in smoothened signaling pathway|determination of left/right symmetry|dorsal/ventral neural tube patterning|embryonic camera-type eye development|embryonic digestive tract morphogenesis|embryonic neurocranium morphogenesis|embryonic viscerocranium morphogenesis|exocrine pancreas development|facial nerve development|floor plate formation|gonad development|heart morphogenesis|muscle cell fate commitment|negative regulation of apoptosis|neural crest cell migration|neuron fate commitment|neuron projection regeneration|odontogenesis of dentine-containing tooth|osteoblast differentiation|otolith morphogenesis|positive regulation of epithelial cell proliferation|positive regulation of mesenchymal cell proliferation|positive regulation of neuroblast proliferation|positive regulation of smoothened signaling pathway|semicircular canal morphogenesis|smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation|smoothened signaling pathway involved in ventral spinal cord patterning|spermatogenesis|vasculogenesis	cilium|cytoplasm|integral to membrane|neuronal cell body|plasma membrane	G-protein coupled receptor activity|PDZ domain binding|Wnt receptor activity|Wnt-protein binding			skin(19)|large_intestine(10)|central_nervous_system(3)|upper_aerodigestive_tract(2)|biliary_tract(1)|lung(1)|liver(1)	37								Mis		skin basal cell 								---	---	---	---
SMO	6608	broad.mit.edu	37	7	128845574	128845574	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128845574C>T	uc003vor.2	+	4	1151	c.871C>T	c.(871-873)CGA>TGA	p.R291*	SMO_uc003vos.2_5'Flank	NM_005631	NP_005622	Q99835	SMO_HUMAN	smoothened precursor	291	Extracellular (Potential).				adenohypophysis development|axon extension involved in axon guidance|canonical Wnt receptor signaling pathway|cardioblast differentiation|central nervous system neuron differentiation|cerebellar cortex morphogenesis|ciliary receptor clustering involved in smoothened signaling pathway|determination of left/right symmetry|dorsal/ventral neural tube patterning|embryonic camera-type eye development|embryonic digestive tract morphogenesis|embryonic neurocranium morphogenesis|embryonic viscerocranium morphogenesis|exocrine pancreas development|facial nerve development|floor plate formation|gonad development|heart morphogenesis|muscle cell fate commitment|negative regulation of apoptosis|neural crest cell migration|neuron fate commitment|neuron projection regeneration|odontogenesis of dentine-containing tooth|osteoblast differentiation|otolith morphogenesis|positive regulation of epithelial cell proliferation|positive regulation of mesenchymal cell proliferation|positive regulation of neuroblast proliferation|positive regulation of smoothened signaling pathway|semicircular canal morphogenesis|smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation|smoothened signaling pathway involved in ventral spinal cord patterning|spermatogenesis|vasculogenesis	cilium|cytoplasm|integral to membrane|neuronal cell body|plasma membrane	G-protein coupled receptor activity|PDZ domain binding|Wnt receptor activity|Wnt-protein binding			skin(19)|large_intestine(10)|central_nervous_system(3)|upper_aerodigestive_tract(2)|biliary_tract(1)|lung(1)|liver(1)	37								Mis		skin basal cell 								---	---	---	---
AHCYL2	23382	broad.mit.edu	37	7	129045670	129045670	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:129045670C>T	uc011kov.1	+						AHCYL2_uc003vot.2_Intron|AHCYL2_uc003vov.2_Intron|AHCYL2_uc011kow.1_Intron|AHCYL2_uc011kox.1_Intron	NM_015328	NP_056143			S-adenosylhomocysteine hydrolase-like 2 isoform						one-carbon metabolic process		adenosylhomocysteinase activity			ovary(2)	2																		---	---	---	---
PLXNA4	91584	broad.mit.edu	37	7	132192529	132192529	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:132192529G>A	uc003vra.3	-	2	1153	c.924C>T	c.(922-924)CGC>CGT	p.R308R	PLXNA4_uc003vrc.2_Silent_p.R308R|PLXNA4_uc003vrb.2_Silent_p.R308R	NM_020911	NP_065962	Q9HCM2	PLXA4_HUMAN	plexin A4 isoform 1	308	Extracellular (Potential).|Sema.					integral to membrane|intracellular|plasma membrane				ovary(1)	1																		---	---	---	---
PLXNA4	91584	broad.mit.edu	37	7	132192530	132192530	+	Missense_Mutation	SNP	C	A	A	rs149257060		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:132192530C>A	uc003vra.3	-	2	1152	c.923G>T	c.(922-924)CGC>CTC	p.R308L	PLXNA4_uc003vrc.2_Missense_Mutation_p.R308L|PLXNA4_uc003vrb.2_Missense_Mutation_p.R308L	NM_020911	NP_065962	Q9HCM2	PLXA4_HUMAN	plexin A4 isoform 1	308	Extracellular (Potential).|Sema.					integral to membrane|intracellular|plasma membrane				ovary(1)	1																		---	---	---	---
CALD1	800	broad.mit.edu	37	7	134617839	134617839	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:134617839C>T	uc003vrz.2	+	5	778	c.319C>T	c.(319-321)CGC>TGC	p.R107C	CALD1_uc003vry.2_Missense_Mutation_p.R107C|CALD1_uc003vsa.2_Missense_Mutation_p.R107C|CALD1_uc003vsb.2_Missense_Mutation_p.R107C|CALD1_uc010lmm.2_Missense_Mutation_p.R107C|CALD1_uc011kpt.1_Intron|CALD1_uc003vsc.2_Missense_Mutation_p.R101C|CALD1_uc003vsd.2_Missense_Mutation_p.R101C|CALD1_uc011kpu.1_Missense_Mutation_p.R112C|CALD1_uc011kpv.1_Translation_Start_Site|CALD1_uc003vse.2_Translation_Start_Site	NM_033138	NP_149129	Q05682	CALD1_HUMAN	caldesmon 1 isoform 1	107	Myosin and calmodulin-binding (By similarity).				cellular component movement|muscle contraction	cytosol|focal adhesion|myofibril	actin binding|calmodulin binding|myosin binding|tropomyosin binding				0																		---	---	---	---
CALD1	800	broad.mit.edu	37	7	134635160	134635160	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:134635160G>A	uc003vrz.2	+	9	2289	c.1830G>A	c.(1828-1830)AGG>AGA	p.R610R	CALD1_uc003vry.2_Silent_p.R355R|CALD1_uc003vsa.2_Silent_p.R381R|CALD1_uc003vsb.2_Silent_p.R355R|CALD1_uc010lmm.2_Silent_p.R381R|CALD1_uc011kpt.1_Silent_p.R129R|CALD1_uc003vsc.2_Silent_p.R375R|CALD1_uc003vsd.2_Silent_p.R349R|CALD1_uc011kpu.1_Silent_p.R360R|CALD1_uc011kpv.1_Silent_p.R219R|CALD1_uc003vse.2_Silent_p.R474R	NM_033138	NP_149129	Q05682	CALD1_HUMAN	caldesmon 1 isoform 1	610	Tropomyosin-binding (Potential).				cellular component movement|muscle contraction	cytosol|focal adhesion|myofibril	actin binding|calmodulin binding|myosin binding|tropomyosin binding				0																		---	---	---	---
DENND2A	27147	broad.mit.edu	37	7	140285478	140285478	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:140285478T>C	uc010lnj.2	-	3	1301	c.1156A>G	c.(1156-1158)ATC>GTC	p.I386V	DENND2A_uc011kre.1_RNA|DENND2A_uc010lnk.2_Missense_Mutation_p.I386V|DENND2A_uc003vvw.2_Missense_Mutation_p.I386V|DENND2A_uc003vvx.2_Missense_Mutation_p.I386V	NM_015689	NP_056504	Q9ULE3	DEN2A_HUMAN	DENN/MADD domain containing 2A	386										ovary(3)|breast(1)	4	Melanoma(164;0.00956)																	---	---	---	---
SSBP1	6742	broad.mit.edu	37	7	141443711	141443711	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141443711G>A	uc003vwo.1	+	5	314	c.236G>A	c.(235-237)AGT>AAT	p.S79N	SSBP1_uc011kri.1_Missense_Mutation_p.S79N|SSBP1_uc010lnp.1_Missense_Mutation_p.S79N	NM_003143	NP_003134	Q04837	SSBP_HUMAN	single-stranded DNA binding protein 1 precursor	79	SSB.				DNA replication|positive regulation of helicase activity	mitochondrial nucleoid	single-stranded DNA binding			ovary(1)	1	Melanoma(164;0.0171)																	---	---	---	---
Unknown	0	broad.mit.edu	37	7	142111392	142111392	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142111392G>A	uc011kro.1	+						uc011krp.1_Intron|uc011krr.1_Intron					SubName: Full=V_segment translation product; Flags: Fragment;																														---	---	---	---
Unknown	0	broad.mit.edu	37	7	142148977	142148977	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142148977G>A	uc011kro.1	+						uc011krp.1_Intron|uc011krr.1_Intron|uc010lnw.1_Silent_p.N98N					SubName: Full=V_segment translation product; Flags: Fragment;																														---	---	---	---
NOBOX	135935	broad.mit.edu	37	7	144098304	144098304	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:144098304G>A	uc011kue.1	-	4	679	c.679C>T	c.(679-681)CGT>TGT	p.R227C		NM_001080413	NP_001073882	O60393	NOBOX_HUMAN	NOBOX oogenesis homeobox	227					cell differentiation|oogenesis	nucleus	sequence-specific DNA binding			ovary(1)	1	Melanoma(164;0.14)																	---	---	---	---
CNTNAP2	26047	broad.mit.edu	37	7	147092805	147092805	+	Missense_Mutation	SNP	G	A	A	rs76475298	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:147092805G>A	uc003weu.1	+	10	2119	c.1603G>A	c.(1603-1605)GAA>AAA	p.E535K		NM_014141	NP_054860	Q9UHC6	CNTP2_HUMAN	cell recognition molecule Caspr2 precursor	535	Extracellular (Potential).|Laminin G-like 2.				behavior|cell adhesion|clustering of voltage-gated potassium channels|limbic system development|neuron recognition|signal transduction|striatum development|superior temporal gyrus development|thalamus development|transmission of nerve impulse	axolemma|cell body fiber|dendrite|juxtaparanode region of axon|voltage-gated potassium channel complex	receptor binding			ovary(9)|central_nervous_system(1)|pancreas(1)	11	Melanoma(164;0.153)	all_cancers(3;3.51e-10)|all_epithelial(3;1.4e-05)|Myeloproliferative disorder(3;0.00452)|Lung NSC(3;0.0067)|all_lung(3;0.00794)	OV - Ovarian serous cystadenocarcinoma(82;0.0319)												HNSCC(39;0.1)			---	---	---	---
ZNF777	27153	broad.mit.edu	37	7	149129019	149129019	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149129019C>T	uc003wfv.2	-	6	2507	c.2344G>A	c.(2344-2346)GAG>AAG	p.E782K		NM_015694	NP_056509	Q9ULD5	ZN777_HUMAN	zinc finger protein 777	Error:Variant_position_missing_in_Q9ULD5_after_alignment					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)	1	Melanoma(164;0.165)		OV - Ovarian serous cystadenocarcinoma(82;0.00358)															---	---	---	---
ZNF777	27153	broad.mit.edu	37	7	149129035	149129035	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149129035C>T	uc003wfv.2	-	6	2491	c.2328G>A	c.(2326-2328)CGG>CGA	p.R776R		NM_015694	NP_056509	Q9ULD5	ZN777_HUMAN	zinc finger protein 777	Error:Variant_position_missing_in_Q9ULD5_after_alignment					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)	1	Melanoma(164;0.165)		OV - Ovarian serous cystadenocarcinoma(82;0.00358)															---	---	---	---
ABCB8	11194	broad.mit.edu	37	7	150732996	150732996	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150732996G>A	uc003wil.3	+	8	1099	c.1006G>A	c.(1006-1008)GAG>AAG	p.E336K	ABCB8_uc003wii.2_Missense_Mutation_p.E356K|ABCB8_uc003wij.3_Missense_Mutation_p.E319K|ABCB8_uc010lpw.1_Missense_Mutation_p.R184Q|ABCB8_uc010lpx.2_Missense_Mutation_p.E319K|ABCB8_uc011kvd.1_Missense_Mutation_p.E231K|ABCB8_uc003wim.3_Missense_Mutation_p.E114K|ABCB8_uc003wik.3_Missense_Mutation_p.E319K	NM_007188	NP_009119	Q9NUT2	ABCB8_HUMAN	ATP-binding cassette, sub-family B, member 8	336	ABC transmembrane type-1.					ATP-binding cassette (ABC) transporter complex|integral to membrane|membrane fraction|mitochondrial inner membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			breast(2)|upper_aerodigestive_tract(1)	3			OV - Ovarian serous cystadenocarcinoma(82;0.0121)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---
CDK5	1020	broad.mit.edu	37	7	150751541	150751541	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150751541G>A	uc003wir.1	-	10	723	c.662C>T	c.(661-663)ACG>ATG	p.T221M		NM_004935	NP_004926	Q00535	CDK5_HUMAN	cyclin-dependent kinase 5 isoform 1	221	Protein kinase.				activation of pro-apoptotic gene products|blood coagulation|cell division|cell proliferation|embryo development|negative regulation of transcription, DNA-dependent|positive regulation of neuron apoptosis	axon|cytosol|dendrite|growth cone|lamellipodium|membrane|neuromuscular junction|neuronal cell body	acetylcholine receptor activator activity|ATP binding|cyclin-dependent protein kinase activity|ErbB-2 class receptor binding|ErbB-3 class receptor binding|tau-protein kinase activity			lung(1)|central_nervous_system(1)	2		Breast(660;0.159)|Ovarian(593;0.182)	OV - Ovarian serous cystadenocarcinoma(82;0.0121)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)|LUSC - Lung squamous cell carcinoma(290;0.008)|Lung(243;0.00942)|BRCA - Breast invasive adenocarcinoma(188;0.242)														---	---	---	---
SLC4A2	6522	broad.mit.edu	37	7	150771346	150771346	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150771346G>A	uc003wit.3	+	17	3012	c.2756G>A	c.(2755-2757)CGC>CAC	p.R919H	SLC4A2_uc011kve.1_Missense_Mutation_p.R910H|SLC4A2_uc003wiu.3_Missense_Mutation_p.R905H|SLC4A2_uc003wiv.3_Missense_Mutation_p.R113H	NM_003040	NP_003031	P04920	B3A2_HUMAN	solute carrier family 4, anion exchanger, member	919	Membrane (anion exchange).|Cytoplasmic (Potential).				bicarbonate transport	integral to membrane|membrane fraction	inorganic anion exchanger activity				0			OV - Ovarian serous cystadenocarcinoma(82;0.0121)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---
MLL3	58508	broad.mit.edu	37	7	151879075	151879075	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151879075G>A	uc003wla.2	-	36	6089	c.5870C>T	c.(5869-5871)ACG>ATG	p.T1957M	MLL3_uc003wkz.2_Missense_Mutation_p.T1018M	NM_170606	NP_733751	Q8NEZ4	MLL3_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 3	1957	Pro-rich.				intracellular signal transduction|regulation of transcription, DNA-dependent|transcription, DNA-dependent		DNA binding|protein binding|zinc ion binding			large_intestine(27)|pancreas(13)|ovary(9)|central_nervous_system(8)|breast(3)|upper_aerodigestive_tract(1)|urinary_tract(1)|skin(1)	63	all_neural(206;0.187)	all_hematologic(28;0.0592)|Prostate(32;0.0906)	OV - Ovarian serous cystadenocarcinoma(82;0.00715)	UCEC - Uterine corpus endometrioid carcinoma (81;0.0597)|BRCA - Breast invasive adenocarcinoma(188;0.0462)				N		medulloblastoma								---	---	---	---
CNPY1	285888	broad.mit.edu	37	7	155301590	155301590	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:155301590G>A	uc003wmc.1	-	2	288	c.143C>T	c.(142-144)GCG>GTG	p.A48V		NM_001103176	NP_001096646	Q3B7I2	CNPY1_HUMAN	canopy 1 homolog	48											0	all_neural(206;0.119)	all_hematologic(28;0.0592)	OV - Ovarian serous cystadenocarcinoma(82;0.011)	UCEC - Uterine corpus endometrioid carcinoma (81;0.171)														---	---	---	---
RBM33	155435	broad.mit.edu	37	7	155503962	155503962	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:155503962G>A	uc010lqk.1	+	8	1382	c.1014G>A	c.(1012-1014)CCG>CCA	p.P338P	RBM33_uc011kvv.1_Silent_p.P147P	NM_053043	NP_444271	Q96EV2	RBM33_HUMAN	RNA binding motif protein 33	338	Pro-rich.						nucleotide binding|RNA binding			ovary(1)	1	all_neural(206;0.101)	all_hematologic(28;0.0592)	OV - Ovarian serous cystadenocarcinoma(82;0.011)	UCEC - Uterine corpus endometrioid carcinoma (81;0.2)														---	---	---	---
NCAPG2	54892	broad.mit.edu	37	7	158445018	158445018	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:158445018C>A	uc003wnv.1	-	23	3046	c.2901G>T	c.(2899-2901)CGG>CGT	p.R967R	NCAPG2_uc010lqu.1_Silent_p.R759R|NCAPG2_uc003wnw.1_RNA|NCAPG2_uc003wnx.1_Silent_p.R967R|NCAPG2_uc011kwe.1_Silent_p.R967R|NCAPG2_uc011kwc.1_Silent_p.R468R|NCAPG2_uc011kwd.1_Silent_p.R410R	NM_017760	NP_060230	Q86XI2	CNDG2_HUMAN	leucine zipper protein 5	967					cell division|chromosome condensation|mitosis	nucleus	methylated histone residue binding			ovary(1)|breast(1)|kidney(1)	3	Ovarian(565;0.152)	all_cancers(7;3.44e-11)|all_epithelial(9;3.05e-05)|all_hematologic(28;0.014)	OV - Ovarian serous cystadenocarcinoma(82;0.00174)	UCEC - Uterine corpus endometrioid carcinoma (81;0.187)|STAD - Stomach adenocarcinoma(7;0.18)														---	---	---	---
FBXO25	26260	broad.mit.edu	37	8	418731	418731	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:418731G>A	uc003wox.2	+	11	1297	c.1031G>A	c.(1030-1032)TGC>TAC	p.C344Y	FBXO25_uc003woy.2_Missense_Mutation_p.C335Y|FBXO25_uc003woz.2_Missense_Mutation_p.C268Y|FBXO25_uc003wpa.2_Missense_Mutation_p.C118Y	NM_183421	NP_904357	Q8TCJ0	FBX25_HUMAN	F-box only protein 25 isoform 1	344						nucleus|SCF ubiquitin ligase complex	actin binding|ubiquitin-protein ligase activity			lung(1)	1		Ovarian(12;0.00965)|Colorectal(14;0.0815)|Myeloproliferative disorder(644;0.116)|all_neural(12;0.122)		Epithelial(5;3.14e-14)|OV - Ovarian serous cystadenocarcinoma(5;1.56e-07)|BRCA - Breast invasive adenocarcinoma(11;1.88e-06)														---	---	---	---
MYOM2	9172	broad.mit.edu	37	8	2041865	2041865	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:2041865G>A	uc003wpx.3	+	17	2210	c.2072G>A	c.(2071-2073)GGG>GAG	p.G691E	MYOM2_uc011kwi.1_Missense_Mutation_p.G116E	NM_003970	NP_003961	P54296	MYOM2_HUMAN	myomesin 2	691	Fibronectin type-III 3.				muscle contraction	myosin filament	structural constituent of muscle			ovary(4)|central_nervous_system(1)|skin(1)	6		Ovarian(12;0.0572)|Colorectal(14;0.0844)|Hepatocellular(245;0.217)		BRCA - Breast invasive adenocarcinoma(11;1.85e-05)|Colorectal(4;0.0101)|READ - Rectum adenocarcinoma(4;0.148)|COAD - Colon adenocarcinoma(4;0.179)														---	---	---	---
RP1L1	94137	broad.mit.edu	37	8	10468839	10468839	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:10468839G>A	uc003wtc.2	-	4	2998	c.2769C>T	c.(2767-2769)TCC>TCT	p.S923S		NM_178857	NP_849188	Q8IWN7	RP1L1_HUMAN	retinitis pigmentosa 1-like 1	923					intracellular signal transduction					ovary(4)|breast(3)|central_nervous_system(1)	8				COAD - Colon adenocarcinoma(149;0.0811)														---	---	---	---
RP1L1	94137	broad.mit.edu	37	8	10470600	10470600	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:10470600C>T	uc003wtc.2	-	4	1237	c.1008G>A	c.(1006-1008)ACG>ACA	p.T336T		NM_178857	NP_849188	Q8IWN7	RP1L1_HUMAN	retinitis pigmentosa 1-like 1	336					intracellular signal transduction					ovary(4)|breast(3)|central_nervous_system(1)	8				COAD - Colon adenocarcinoma(149;0.0811)														---	---	---	---
NEIL2	252969	broad.mit.edu	37	8	11637219	11637219	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:11637219C>T	uc003wug.2	+	3	926	c.251C>T	c.(250-252)GCG>GTG	p.A84V	NEIL2_uc003wue.2_Missense_Mutation_p.A84V|NEIL2_uc003wuf.2_Missense_Mutation_p.A23V|NEIL2_uc011kxd.1_Intron	NM_145043	NP_659480	Q969S2	NEIL2_HUMAN	nei like 2 isoform a	84					base-excision repair|nucleotide-excision repair	nucleus	damaged DNA binding|DNA-(apurinic or apyrimidinic site) lyase activity|hydrolase activity, hydrolyzing N-glycosyl compounds|zinc ion binding				0	all_epithelial(15;0.103)		STAD - Stomach adenocarcinoma(15;0.00225)	COAD - Colon adenocarcinoma(149;0.166)									BER_DNA_glycosylases					---	---	---	---
NEIL2	252969	broad.mit.edu	37	8	11643696	11643696	+	Missense_Mutation	SNP	G	A	A	rs139505292	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:11643696G>A	uc003wug.2	+	5	1588	c.913G>A	c.(913-915)GAA>AAA	p.E305K	NEIL2_uc003wue.2_Missense_Mutation_p.E305K|NEIL2_uc003wuf.2_Missense_Mutation_p.E244K|NEIL2_uc011kxd.1_Missense_Mutation_p.E189K	NM_145043	NP_659480	Q969S2	NEIL2_HUMAN	nei like 2 isoform a	305	FPG-type.				base-excision repair|nucleotide-excision repair	nucleus	damaged DNA binding|DNA-(apurinic or apyrimidinic site) lyase activity|hydrolase activity, hydrolyzing N-glycosyl compounds|zinc ion binding				0	all_epithelial(15;0.103)		STAD - Stomach adenocarcinoma(15;0.00225)	COAD - Colon adenocarcinoma(149;0.166)									BER_DNA_glycosylases					---	---	---	---
LONRF1	91694	broad.mit.edu	37	8	12586437	12586437	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:12586437G>A	uc003wwd.1	-	10	2046	c.1983C>T	c.(1981-1983)GCC>GCT	p.A661A	LONRF1_uc011kxv.1_Silent_p.A250A|LONRF1_uc010lsp.1_Silent_p.A261A	NM_152271	NP_689484	Q17RB8	LONF1_HUMAN	LON peptidase N-terminal domain and ring finger	661	Lon.				proteolysis		ATP-dependent peptidase activity|zinc ion binding			ovary(1)	1				READ - Rectum adenocarcinoma(644;0.236)														---	---	---	---
GFRA2	2675	broad.mit.edu	37	8	21608381	21608381	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:21608381A>G	uc003wzu.1	-	4	1188	c.513T>C	c.(511-513)AAT>AAC	p.N171N	GFRA2_uc003wzv.1_Silent_p.N66N|GFRA2_uc003wzw.1_Silent_p.N38N|DOK2_uc003wzx.1_Intron	NM_001495	NP_001486	O00451	GFRA2_HUMAN	GDNF family receptor alpha 2 isoform a	171						anchored to membrane|extrinsic to membrane|plasma membrane	glial cell-derived neurotrophic factor receptor activity				0				Colorectal(74;0.0189)|COAD - Colon adenocarcinoma(73;0.0727)														---	---	---	---
XPO7	23039	broad.mit.edu	37	8	21853019	21853019	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:21853019C>T	uc003xaa.3	+	21	2356	c.2254C>T	c.(2254-2256)CCA>TCA	p.P752S	XPO7_uc010lti.2_Missense_Mutation_p.P761S|XPO7_uc010ltk.2_Missense_Mutation_p.P753S	NM_015024	NP_055839	Q9UIA9	XPO7_HUMAN	exportin 7 isoform b	752					mRNA transport|protein export from nucleus|transmembrane transport	cytoplasm|nuclear pore	nuclear export signal receptor activity|protein transporter activity			ovary(1)|kidney(1)|breast(1)|central_nervous_system(1)|pancreas(1)	5				Colorectal(74;0.0187)|COAD - Colon adenocarcinoma(73;0.0724)														---	---	---	---
HR	55806	broad.mit.edu	37	8	21984985	21984985	+	Missense_Mutation	SNP	G	A	A	rs143170974	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:21984985G>A	uc003xas.2	-	3	1635	c.970C>T	c.(970-972)CGG>TGG	p.R324W	HR_uc003xat.2_Missense_Mutation_p.R324W	NM_005144	NP_005135	O43593	HAIR_HUMAN	hairless protein isoform a	324							DNA binding|metal ion binding|sequence-specific DNA binding transcription factor activity			large_intestine(1)|ovary(1)	2		Breast(100;0.000162)|Acute lymphoblastic leukemia(644;0.0775)|Prostate(55;0.116)		KIRC - Kidney renal clear cell carcinoma(542;1.19e-05)|BRCA - Breast invasive adenocarcinoma(99;3.56e-05)|Colorectal(74;0.00191)|COAD - Colon adenocarcinoma(73;0.0615)|READ - Rectum adenocarcinoma(644;0.1)														---	---	---	---
STMN4	81551	broad.mit.edu	37	8	27097669	27097669	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27097669G>A	uc003xfk.2	-	5	443	c.329C>T	c.(328-330)GCG>GTG	p.A110V	STMN4_uc003xfj.2_Missense_Mutation_p.A137V|STMN4_uc011lai.1_Missense_Mutation_p.A137V|STMN4_uc011laj.1_Missense_Mutation_p.A101V|STMN4_uc011lak.1_Missense_Mutation_p.A137V|STMN4_uc010luo.2_Missense_Mutation_p.A110V			Q9H169	STMN4_HUMAN	RecName: Full=Stathmin-4; AltName: Full=Stathmin-like protein B3;          Short=RB3;	110	Potential.				intracellular signal transduction					large_intestine(1)|pancreas(1)	2		Ovarian(32;0.00167)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0214)|Epithelial(17;9.82e-10)|Colorectal(74;0.142)														---	---	---	---
SCARA3	51435	broad.mit.edu	37	8	27516059	27516059	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27516059G>T	uc003xga.1	+	5	513	c.372G>T	c.(370-372)CAG>CAT	p.Q124H	SCARA3_uc003xgb.1_Missense_Mutation_p.Q124H	NM_016240	NP_057324	Q6AZY7	SCAR3_HUMAN	scavenger receptor class A, member 3 isoform 1	124	Extracellular (Potential).				response to oxidative stress|UV protection	collagen|endoplasmic reticulum membrane|Golgi membrane|integral to membrane	scavenger receptor activity			skin(2)|ovary(1)|breast(1)	4		Ovarian(32;2.61e-05)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0219)|Colorectal(74;0.148)														---	---	---	---
KCNU1	157855	broad.mit.edu	37	8	36721991	36721991	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:36721991C>T	uc010lvw.2	+	19	2048	c.1961C>T	c.(1960-1962)CCG>CTG	p.P654L	KCNU1_uc003xjw.2_RNA	NM_001031836	NP_001027006	A8MYU2	KCNU1_HUMAN	potassium channel, subfamily U, member 1	654	Cytoplasmic (Potential).					voltage-gated potassium channel complex	binding|large conductance calcium-activated potassium channel activity|voltage-gated potassium channel activity			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(67;0.0504)|Kidney(114;0.0634)														---	---	---	---
RAB11FIP1	80223	broad.mit.edu	37	8	37729675	37729675	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:37729675G>A	uc003xkm.1	-	4	2689	c.2645C>T	c.(2644-2646)GCG>GTG	p.A882V	RAB11FIP1_uc010lvz.1_Intron|RAB11FIP1_uc003xkn.1_Intron|RAB11FIP1_uc003xkl.1_Missense_Mutation_p.A211V|RAB11FIP1_uc003xko.1_Missense_Mutation_p.A211V|RAB11FIP1_uc003xkp.1_Intron	NM_001002814	NP_001002814	Q6WKZ4	RFIP1_HUMAN	RAB11 family interacting protein 1 isoform 3	882					protein transport	centrosome|phagocytic vesicle membrane|recycling endosome	protein binding			ovary(1)|central_nervous_system(1)|skin(1)	3		Lung NSC(58;0.118)|all_lung(54;0.195)	LUSC - Lung squamous cell carcinoma(8;3.62e-11)															---	---	---	---
PLAT	5327	broad.mit.edu	37	8	42033662	42033662	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:42033662G>A	uc003xos.2	-	14	1747	c.1538C>T	c.(1537-1539)TCG>TTG	p.S513L	PLAT_uc010lxf.1_Missense_Mutation_p.S430L|PLAT_uc010lxg.1_Missense_Mutation_p.S338L|PLAT_uc003xot.2_Missense_Mutation_p.S467L|PLAT_uc011lcm.1_Missense_Mutation_p.S424L|PLAT_uc011lcn.1_Missense_Mutation_p.S387L	NM_000930	NP_000921	P00750	TPA_HUMAN	plasminogen activator, tissue isoform 1	513	Peptidase S1.	Charge relay system.			blood coagulation|fibrinolysis|negative regulation of proteolysis|protein modification process|proteolysis	cell surface|cytoplasm|extracellular space	protein binding|serine-type endopeptidase activity			breast(1)|skin(1)	2	all_cancers(6;3.84e-26)|all_epithelial(6;9.61e-28)|all_lung(13;7.2e-13)|Lung NSC(13;1.18e-11)|Ovarian(28;0.00438)|Prostate(17;0.0119)|Colorectal(14;0.0468)|Lung SC(25;0.211)	all_lung(54;0.000378)|Lung NSC(58;0.00145)|Hepatocellular(245;0.0524)|Renal(179;0.0822)|Esophageal squamous(32;0.0954)	BRCA - Breast invasive adenocarcinoma(8;5.23e-10)|OV - Ovarian serous cystadenocarcinoma(14;0.00135)|Colorectal(10;0.00165)|Lung(22;0.00467)|COAD - Colon adenocarcinoma(11;0.0171)|LUSC - Lung squamous cell carcinoma(45;0.024)		Alteplase(DB00009)|Aminocaproic Acid(DB00513)|Anistreplase(DB00029)|Iloprost(DB01088)|Reteplase(DB00015)|Tenecteplase(DB00031)|Tranexamic Acid(DB00302)|Urokinase(DB00013)													---	---	---	---
VDAC3	7419	broad.mit.edu	37	8	42252652	42252652	+	Splice_Site	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:42252652G>A	uc011lct.1	+	4	260	c.117_splice	c.e4+1	p.V39_splice	VDAC3_uc010lxk.2_Splice_Site_p.V39_splice|VDAC3_uc003xpc.2_Splice_Site_p.V39_splice	NM_005662	NP_005653			voltage-dependent anion channel 3 isoform b						adenine transport	mitochondrial outer membrane|pore complex	nucleotide binding|porin activity|protein binding|voltage-gated anion channel activity			upper_aerodigestive_tract(1)	1	all_cancers(6;3.86e-23)|all_lung(13;6.47e-12)|Lung NSC(13;1.08e-10)|Ovarian(28;0.00769)|Prostate(17;0.0119)|Lung SC(25;0.211)	all_lung(54;0.00671)|Lung NSC(58;0.0184)|Esophageal squamous(32;0.131)|Hepatocellular(245;0.133)|Renal(179;0.151)	BRCA - Breast invasive adenocarcinoma(8;3.48e-10)|OV - Ovarian serous cystadenocarcinoma(14;0.00266)|Lung(22;0.00849)|LUSC - Lung squamous cell carcinoma(45;0.024)		Dihydroxyaluminium(DB01375)													---	---	---	---
ST18	9705	broad.mit.edu	37	8	53092689	53092689	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:53092689A>G	uc003xqz.2	-	4	426	c.270T>C	c.(268-270)TCT>TCC	p.S90S	ST18_uc011ldq.1_5'UTR|ST18_uc011ldr.1_Silent_p.S55S|ST18_uc011lds.1_5'UTR|ST18_uc003xra.2_Silent_p.S90S|ST18_uc003xrb.2_Silent_p.S90S|ST18_uc010lyb.2_RNA	NM_014682	NP_055497	O60284	ST18_HUMAN	suppression of tumorigenicity 18	90						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)|skin(1)	5		Lung NSC(129;0.131)|all_epithelial(80;0.217)|all_lung(136;0.229)																---	---	---	---
NPBWR1	2831	broad.mit.edu	37	8	53852517	53852517	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:53852517C>T	uc011ldu.1	+	1	50	c.50C>T	c.(49-51)CCG>CTG	p.P17L		NM_005285	NP_005276	P48145	NPBW1_HUMAN	G protein-coupled receptor 7	17	Extracellular (Potential).				synaptic transmission	plasma membrane	opioid receptor activity|protein binding			ovary(2)|breast(1)	3		Lung NSC(129;0.0222)|all_epithelial(80;0.0301)|all_lung(136;0.0431)																---	---	---	---
CHD7	55636	broad.mit.edu	37	8	61754314	61754314	+	Splice_Site	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:61754314G>A	uc003xue.2	+	20	5121	c.4644_splice	c.e20+1	p.R1548_splice		NM_017780	NP_060250			chromodomain helicase DNA binding protein 7						central nervous system development|chromatin modification|cognition|cranial nerve development|face development|heart morphogenesis|in utero embryonic development|inner ear morphogenesis|nose development|palate development|regulation of growth hormone secretion|regulation of transcription, DNA-dependent|retina development in camera-type eye|skeletal system development|T cell differentiation|transcription, DNA-dependent	nucleus	ATP binding|chromatin binding|DNA binding|helicase activity			ovary(4)|large_intestine(1)|central_nervous_system(1)|lung(1)|breast(1)|pancreas(1)	9		all_cancers(86;0.2)|all_lung(136;0.0402)|Lung NSC(129;0.0459)|all_epithelial(80;0.0477)	BRCA - Breast invasive adenocarcinoma(89;0.143)															---	---	---	---
CHD7	55636	broad.mit.edu	37	8	61764678	61764678	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:61764678C>T	uc003xue.2	+	29	6243	c.5766C>T	c.(5764-5766)CGC>CGT	p.R1922R		NM_017780	NP_060250	Q9P2D1	CHD7_HUMAN	chromodomain helicase DNA binding protein 7	1922					central nervous system development|chromatin modification|cognition|cranial nerve development|face development|heart morphogenesis|in utero embryonic development|inner ear morphogenesis|nose development|palate development|regulation of growth hormone secretion|regulation of transcription, DNA-dependent|retina development in camera-type eye|skeletal system development|T cell differentiation|transcription, DNA-dependent	nucleus	ATP binding|chromatin binding|DNA binding|helicase activity			ovary(4)|large_intestine(1)|central_nervous_system(1)|lung(1)|breast(1)|pancreas(1)	9		all_cancers(86;0.2)|all_lung(136;0.0402)|Lung NSC(129;0.0459)|all_epithelial(80;0.0477)	BRCA - Breast invasive adenocarcinoma(89;0.143)															---	---	---	---
TRIM55	84675	broad.mit.edu	37	8	67064641	67064641	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:67064641G>A	uc003xvv.2	+	8	1241	c.1015G>A	c.(1015-1017)GGA>AGA	p.G339R	TRIM55_uc003xvu.2_Missense_Mutation_p.G339R|TRIM55_uc003xvw.2_Missense_Mutation_p.G339R|TRIM55_uc003xvx.2_Intron	NM_184085	NP_908973	Q9BYV6	TRI55_HUMAN	tripartite motif-containing 55 isoform 1	339						cytoplasm|microtubule|nucleus	signal transducer activity|zinc ion binding			skin(3)|ovary(1)|central_nervous_system(1)	5		Lung NSC(129;0.138)|all_lung(136;0.221)	Epithelial(68;0.0136)|all cancers(69;0.0582)|BRCA - Breast invasive adenocarcinoma(89;0.0628)|OV - Ovarian serous cystadenocarcinoma(28;0.0904)															---	---	---	---
NCOA2	10499	broad.mit.edu	37	8	71041179	71041179	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:71041179C>T	uc003xyn.1	-	17	3523	c.3361G>A	c.(3361-3363)GAT>AAT	p.D1121N	NCOA2_uc011lfb.1_Missense_Mutation_p.D209N	NM_006540	NP_006531	Q15596	NCOA2_HUMAN	nuclear receptor coactivator 2	1121					cellular lipid metabolic process|transcription, DNA-dependent	nucleoplasm	histone acetyltransferase activity|ligand-dependent nuclear receptor binding|nuclear hormone receptor binding|signal transducer activity		PAX3/NCOA2(4)	lung(6)|soft_tissue(4)|breast(2)|skin(2)|ovary(1)|pancreas(1)	16	Breast(64;0.201)		Epithelial(68;0.0147)|OV - Ovarian serous cystadenocarcinoma(28;0.0455)|all cancers(69;0.0606)					T	RUNXBP2	AML								---	---	---	---
KCNB2	9312	broad.mit.edu	37	8	73849334	73849334	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:73849334C>T	uc003xzb.2	+	3	2332	c.1744C>T	c.(1744-1746)CCA>TCA	p.P582S		NM_004770	NP_004761	Q92953	KCNB2_HUMAN	potassium voltage-gated channel, Shab-related	582	Cytoplasmic (Potential).				regulation of smooth muscle contraction	voltage-gated potassium channel complex	delayed rectifier potassium channel activity|protein binding			skin(3)|large_intestine(1)|pancreas(1)|ovary(1)|central_nervous_system(1)	7	Breast(64;0.137)		Epithelial(68;0.105)															---	---	---	---
PEX2	5828	broad.mit.edu	37	8	77896329	77896329	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77896329A>G	uc003yax.2	-	4	544	c.86T>C	c.(85-87)CTG>CCG	p.L29P	PEX2_uc003yay.2_Missense_Mutation_p.L29P|PEX2_uc003yaz.2_Missense_Mutation_p.L29P	NM_000318	NP_000309	P28328	PEX2_HUMAN	peroxin 2	29					peroxisome organization	integral to peroxisomal membrane	protein binding|zinc ion binding			ovary(1)	1																		---	---	---	---
IMPA1	3612	broad.mit.edu	37	8	82572840	82572840	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:82572840G>A	uc003ych.2	-	8	756	c.629C>T	c.(628-630)GCA>GTA	p.A210V	IMPA1_uc011lfq.1_Missense_Mutation_p.A269V|IMPA1_uc011lfr.1_Missense_Mutation_p.H174Y	NM_005536	NP_005527	P29218	IMPA1_HUMAN	inositol(myo)-1(or 4)-monophosphatase 1 isoform	210					inositol phosphate dephosphorylation|phosphatidylinositol biosynthetic process|signal transduction	cytoplasm	inositol-1(or 4)-monophosphatase activity|metal ion binding|protein homodimerization activity			skin(1)	1					Lithium(DB01356)													---	---	---	---
WWP1	11059	broad.mit.edu	37	8	87393104	87393104	+	Intron	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:87393104T>C	uc003ydt.2	+						WWP1_uc010mai.2_Intron	NM_007013	NP_008944			WW domain containing E3 ubiquitin protein ligase						central nervous system development|entry of virus into host cell|negative regulation of transcription, DNA-dependent|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|signal transduction	cytoplasm|nucleus|plasma membrane|ubiquitin ligase complex	protein binding|ubiquitin-protein ligase activity			lung(1)|liver(1)	2																		---	---	---	---
RIPK2	8767	broad.mit.edu	37	8	90770396	90770396	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:90770396C>T	uc003yee.2	+	1	422	c.108C>T	c.(106-108)CGC>CGT	p.R36R	uc003yed.2_5'Flank|RIPK2_uc003yef.2_5'UTR	NM_003821	NP_003812	O43353	RIPK2_HUMAN	receptor-interacting serine-threonine kinase 2	36	Protein kinase.				activation of MAPK activity|anti-apoptosis|apoptosis|inflammatory response|innate immune response|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|positive regulation of protein ubiquitination|stress-activated MAPK cascade|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol	ATP binding|CARD domain binding|LIM domain binding|protein homodimerization activity|protein serine/threonine kinase activity|signal transducer activity			ovary(2)	2			BRCA - Breast invasive adenocarcinoma(11;0.0474)															---	---	---	---
NBN	4683	broad.mit.edu	37	8	90967518	90967518	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:90967518T>C	uc003yej.1	-	10	1500	c.1390A>G	c.(1390-1392)AAA>GAA	p.K464E	NBN_uc003yei.1_Missense_Mutation_p.K382E|NBN_uc011lgb.1_Missense_Mutation_p.K464E	NM_002485	NP_002476	O60934	NBN_HUMAN	nibrin	464	Nuclear localization signal.				cell cycle arrest|DNA damage response, signal transduction by p53 class mediator|DNA duplex unwinding|double-strand break repair via homologous recombination|meiosis|mitotic cell cycle G1/S transition checkpoint|mitotic cell cycle G2/M transition DNA damage checkpoint|positive regulation of kinase activity|positive regulation of protein autophosphorylation|regulation of DNA-dependent DNA replication initiation|telomere maintenance	Mre11 complex|nuclear chromosome, telomeric region|nuclear inclusion body|nucleolus|nucleoplasm	protein N-terminus binding|transcription factor binding			central_nervous_system(3)|kidney(3)|lung(1)	7			BRCA - Breast invasive adenocarcinoma(11;0.0344)										Direct_reversal_of_damage|Homologous_recombination	Nijmegen_Breakage_syndrome				---	---	---	---
KIAA1429	25962	broad.mit.edu	37	8	95539535	95539535	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95539535G>A	uc003ygo.1	-	8	950	c.937C>T	c.(937-939)CGT>TGT	p.R313C	KIAA1429_uc003ygp.2_Missense_Mutation_p.R313C|KIAA1429_uc010maz.1_RNA	NM_015496	NP_056311	Q69YN4	VIR_HUMAN	hypothetical protein LOC25962 isoform 1	313	Glu-rich.				mRNA processing|RNA splicing	nucleus				ovary(1)|skin(1)	2	Breast(36;3.29e-05)		BRCA - Breast invasive adenocarcinoma(8;0.00185)															---	---	---	---
DPY19L4	286148	broad.mit.edu	37	8	95796029	95796029	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95796029A>G	uc003ygx.2	+	17	1971	c.1847A>G	c.(1846-1848)AAT>AGT	p.N616S		NM_181787	NP_861452	Q7Z388	D19L4_HUMAN	dpy-19-like 4	616						integral to membrane				ovary(2)	2	Breast(36;3.85e-06)																	---	---	---	---
SDC2	6383	broad.mit.edu	37	8	97620628	97620628	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:97620628C>T	uc003yhv.1	+	4	990	c.372C>T	c.(370-372)GCC>GCT	p.A124A	SDC2_uc011lgu.1_Silent_p.A95A	NM_002998	NP_002989	P34741	SDC2_HUMAN	syndecan 2 precursor	124	Extracellular (Potential).					integral to plasma membrane	cytoskeletal protein binding|PDZ domain binding			ovary(2)	2	Breast(36;3.41e-05)				Sargramostim(DB00020)													---	---	---	---
MTDH	92140	broad.mit.edu	37	8	98699707	98699707	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:98699707C>T	uc003yhz.2	+	4	947	c.619C>T	c.(619-621)CGT>TGT	p.R207C		NM_178812	NP_848927	Q86UE4	LYRIC_HUMAN	metadherin	207	Cytoplasmic (Potential).				lipopolysaccharide-mediated signaling pathway|negative regulation of apoptosis|negative regulation of transcription from RNA polymerase II promoter|positive regulation of angiogenesis|positive regulation of autophagy|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|positive regulation of protein kinase B signaling cascade	apical plasma membrane|endoplasmic reticulum membrane|integral to membrane|intercellular canaliculus|nuclear body|nuclear membrane|nucleolus|perinuclear region of cytoplasm|tight junction	NF-kappaB binding|RNA polymerase II transcription factor binding|transcription coactivator activity			liver(1)|central_nervous_system(1)	2	Breast(36;2.56e-06)		OV - Ovarian serous cystadenocarcinoma(57;0.178)															---	---	---	---
VPS13B	157680	broad.mit.edu	37	8	100866034	100866034	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:100866034A>G	uc003yiv.2	+	56	10603	c.10492A>G	c.(10492-10494)AAG>GAG	p.K3498E	VPS13B_uc003yiw.2_Missense_Mutation_p.K3473E	NM_017890	NP_060360	Q7Z7G8	VP13B_HUMAN	vacuolar protein sorting 13B isoform 5	3498					protein transport					ovary(7)|skin(4)|lung(3)|central_nervous_system(2)|pancreas(2)|breast(1)|kidney(1)	20	Breast(36;3.73e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.00636)															---	---	---	---
LRP12	29967	broad.mit.edu	37	8	105509306	105509306	+	Nonsense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:105509306T>A	uc003yma.2	-	5	1569	c.1474A>T	c.(1474-1476)AGA>TGA	p.R492*	LRP12_uc003ymb.2_Nonsense_Mutation_p.R473*|LRP12_uc003ylz.2_5'Flank	NM_013437	NP_038465	Q9Y561	LRP12_HUMAN	low density lipoprotein-related protein 12	492	Extracellular (Potential).				endocytosis|regulation of growth	coated pit|integral to plasma membrane	low-density lipoprotein receptor activity|protein binding				0			OV - Ovarian serous cystadenocarcinoma(57;1.21e-06)|STAD - Stomach adenocarcinoma(118;0.229)															---	---	---	---
CSMD3	114788	broad.mit.edu	37	8	113668504	113668504	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113668504C>T	uc003ynu.2	-	18	3042	c.2883G>A	c.(2881-2883)TTG>TTA	p.L961L	CSMD3_uc003yns.2_Silent_p.L233L|CSMD3_uc003ynt.2_Silent_p.L921L|CSMD3_uc011lhx.1_Silent_p.L857L	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	961	Extracellular (Potential).|CUB 5.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---
SLC45A4	57210	broad.mit.edu	37	8	142228905	142228905	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142228905G>A	uc003ywd.1	-	4	989	c.681C>T	c.(679-681)CAC>CAT	p.H227H	SLC45A4_uc003ywc.1_Silent_p.H227H|SLC45A4_uc010meq.1_Silent_p.H225H	NM_001080431	NP_001073900	Q5BKX6	S45A4_HUMAN	solute carrier family 45, member 4	278					transport	integral to membrane				ovary(2)	2	all_cancers(97;1.52e-15)|all_epithelial(106;2.92e-14)|Lung NSC(106;1.23e-05)|all_lung(105;1.75e-05)|Ovarian(258;0.01)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0493)															---	---	---	---
FLJ43860	389690	broad.mit.edu	37	8	142445309	142445309	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142445309C>T	uc003ywi.2	-	29	3677	c.3596G>A	c.(3595-3597)CGC>CAC	p.R1199H	FLJ43860_uc011ljs.1_RNA|FLJ43860_uc010meu.1_RNA	NM_207414	NP_997297	Q6ZUA9	Q6ZUA9_HUMAN	hypothetical protein LOC389690	1199							binding				0	all_cancers(97;7.79e-15)|all_epithelial(106;4.52e-13)|Lung NSC(106;2.07e-05)|all_lung(105;2.89e-05)|Ovarian(258;0.0303)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0493)															---	---	---	---
BAI1	575	broad.mit.edu	37	8	143570403	143570403	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:143570403T>C	uc003ywm.2	+	14	2643	c.2460T>C	c.(2458-2460)GAT>GAC	p.D820D		NM_001702	NP_001693	O14514	BAI1_HUMAN	brain-specific angiogenesis inhibitor 1	820	Extracellular (Potential).				axonogenesis|cell adhesion|negative regulation of angiogenesis|negative regulation of cell proliferation|neuropeptide signaling pathway|peripheral nervous system development	cell-cell junction|integral to plasma membrane	G-protein coupled receptor activity|protein binding			lung(3)|ovary(2)|breast(1)|central_nervous_system(1)|pancreas(1)	8	all_cancers(97;2.84e-12)|all_epithelial(106;5.91e-09)|Lung NSC(106;0.000322)|all_lung(105;0.000616)|Medulloblastoma(13;0.00276)|all_neural(13;0.00559)|Ovarian(258;0.0315)|Acute lymphoblastic leukemia(118;0.155)																	---	---	---	---
MAPK15	225689	broad.mit.edu	37	8	144804001	144804001	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144804001G>A	uc003yzj.2	+	13	1450	c.1409G>A	c.(1408-1410)CGG>CAG	p.R470Q		NM_139021	NP_620590	Q8TD08	MK15_HUMAN	mitogen-activated protein kinase 15	470					protein autophosphorylation	extracellular region	ATP binding|MAP kinase activity|SH3 domain binding			lung(2)	2	all_cancers(97;3.74e-11)|all_epithelial(106;2.62e-09)|Lung NSC(106;0.00013)|all_lung(105;0.000374)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;3.38e-41)|Epithelial(56;6.8e-40)|all cancers(56;6.43e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.146)															---	---	---	---
EPPK1	83481	broad.mit.edu	37	8	144945705	144945705	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144945705G>T	uc003zaa.1	-	1	1730	c.1717C>A	c.(1717-1719)CTG>ATG	p.L573M		NM_031308	NP_112598	P58107	EPIPL_HUMAN	epiplakin 1	573	Plectin 10.					cytoplasm|cytoskeleton	protein binding|structural molecule activity			pancreas(1)|skin(1)	2	all_cancers(97;1.42e-10)|all_epithelial(106;1.99e-09)|Lung NSC(106;0.000126)|all_lung(105;0.000354)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;2.46e-41)|Epithelial(56;2.88e-40)|all cancers(56;1.82e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)															---	---	---	---
CBWD1	55871	broad.mit.edu	37	9	164038	164038	+	Splice_Site	SNP	C	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:164038C>G	uc003zga.3	-	5	537	c.431_splice	c.e5-1	p.G144_splice	CBWD1_uc010mgs.2_Splice_Site|CBWD1_uc003zgb.3_Splice_Site_p.G108_splice|CBWD1_uc003zgc.3_Splice_Site_p.G144_splice|CBWD1_uc011llr.1_Splice_Site_p.G108_splice	NM_018491	NP_060961			COBW domain containing 1 isoform 1								ATP binding|protein binding			ovary(1)	1	all_lung(41;0.218)	all_cancers(5;3.04e-16)|all_epithelial(5;4.68e-12)|all_lung(10;1.94e-10)|Lung NSC(10;3.61e-10)|Acute lymphoblastic leukemia(5;0.00439)|Breast(48;0.0148)|all_hematologic(5;0.024)|Prostate(43;0.122)	Kidney(42;0.112)|KIRC - Kidney renal clear cell carcinoma(5;0.157)	all cancers(5;0.000704)|Lung(218;0.00755)|GBM - Glioblastoma multiforme(5;0.0149)|Epithelial(6;0.0154)														---	---	---	---
SMARCA2	6595	broad.mit.edu	37	9	2110275	2110275	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:2110275G>A	uc003zhc.2	+	24	3413	c.3314G>A	c.(3313-3315)CGT>CAT	p.R1105H	SMARCA2_uc003zhd.2_Missense_Mutation_p.R1105H|SMARCA2_uc010mha.2_Missense_Mutation_p.R1038H	NM_003070	NP_003061	P51531	SMCA2_HUMAN	SWI/SNF-related matrix-associated	1105	Helicase C-terminal.				chromatin remodeling|negative regulation of cell growth|negative regulation of transcription from RNA polymerase II promoter|nervous system development	intermediate filament cytoskeleton|nBAF complex|npBAF complex|nuclear chromatin|nucleoplasm|SWI/SNF complex|WINAC complex	ATP binding|DNA-dependent ATPase activity|helicase activity|protein binding|RNA polymerase II transcription coactivator activity|transcription regulatory region DNA binding			ovary(2)|central_nervous_system(1)	3		all_lung(10;2.06e-09)|Lung NSC(10;2.43e-09)		GBM - Glioblastoma multiforme(50;0.0475)														---	---	---	---
KCNV2	169522	broad.mit.edu	37	9	2718008	2718008	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:2718008G>A	uc003zho.1	+	1	483	c.269G>A	c.(268-270)AGC>AAC	p.S90N		NM_133497	NP_598004	Q8TDN2	KCNV2_HUMAN	potassium channel, subfamily V, member 2	90	Cytoplasmic (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(1)|central_nervous_system(1)	2				GBM - Glioblastoma multiforme(50;0.0257)														---	---	---	---
UHRF2	115426	broad.mit.edu	37	9	6482085	6482085	+	Nonsense_Mutation	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:6482085A>T	uc003zjy.2	+	8	1718	c.1378A>T	c.(1378-1380)AGA>TGA	p.R460*	UHRF2_uc003zjz.2_RNA|UHRF2_uc003zka.1_Nonsense_Mutation_p.R237*	NM_152896	NP_690856	Q96PU4	UHRF2_HUMAN	ubiquitin-like with PHD and ring finger domains	460	YDG.|Methyl-CpG binding and interaction with HDAC1.				cell cycle|cell differentiation|cell proliferation|protein autoubiquitination|regulation of cell cycle|ubiquitin-dependent protein catabolic process	nucleus	DNA binding|histone binding|ubiquitin-protein ligase activity|zinc ion binding			large_intestine(2)|ovary(1)	3		Acute lymphoblastic leukemia(23;0.158)		GBM - Glioblastoma multiforme(50;0.0392)|Lung(218;0.129)														---	---	---	---
TYRP1	7306	broad.mit.edu	37	9	12694160	12694160	+	Missense_Mutation	SNP	G	A	A	rs139670838		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:12694160G>A	uc003zkv.3	+	2	342	c.164G>A	c.(163-165)CGC>CAC	p.R55H		NM_000550	NP_000541	P17643	TYRP1_HUMAN	tyrosinase-related protein 1 precursor	55	Lumenal, melanosome (Potential).				melanin biosynthetic process	clathrin-coated endocytic vesicle membrane|endosome membrane|integral to membrane|melanosome membrane	copper ion binding|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, another compound as one donor, and incorporation of one atom of oxygen|protein heterodimerization activity|protein homodimerization activity			lung(1)	1		all_cancers(3;3.1e-05)|all_lung(3;1.7e-06)|Lung NSC(3;2.09e-06)|all_epithelial(3;0.000695)|all_hematologic(3;0.0033)|Acute lymphoblastic leukemia(23;0.0744)		GBM - Glioblastoma multiforme(50;9.85e-06)										Oculocutaneous_Albinism				---	---	---	---
TYRP1	7306	broad.mit.edu	37	9	12698563	12698563	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:12698563C>A	uc003zkv.3	+	4	999	c.821C>A	c.(820-822)TCC>TAC	p.S274Y		NM_000550	NP_000541	P17643	TYRP1_HUMAN	tyrosinase-related protein 1 precursor	274	Lumenal, melanosome (Potential).				melanin biosynthetic process	clathrin-coated endocytic vesicle membrane|endosome membrane|integral to membrane|melanosome membrane	copper ion binding|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, another compound as one donor, and incorporation of one atom of oxygen|protein heterodimerization activity|protein homodimerization activity			lung(1)	1		all_cancers(3;3.1e-05)|all_lung(3;1.7e-06)|Lung NSC(3;2.09e-06)|all_epithelial(3;0.000695)|all_hematologic(3;0.0033)|Acute lymphoblastic leukemia(23;0.0744)		GBM - Glioblastoma multiforme(50;9.85e-06)										Oculocutaneous_Albinism				---	---	---	---
PSIP1	11168	broad.mit.edu	37	9	15479598	15479598	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:15479598G>A	uc003zlv.3	-	7	874	c.544C>T	c.(544-546)CGA>TGA	p.R182*	PSIP1_uc003zlw.3_Nonsense_Mutation_p.R182*|PSIP1_uc003zlz.3_Nonsense_Mutation_p.R182*|PSIP1_uc003zma.3_Nonsense_Mutation_p.R173*|PSIP1_uc003zly.2_Nonsense_Mutation_p.R182*	NM_033222	NP_150091	O75475	PSIP1_HUMAN	PC4 and SFRS1 interacting protein 1 isoform 2	182					initiation of viral infection|interspecies interaction between organisms|nuclear mRNA 5'-splice site recognition|provirus integration|regulation of transcription, DNA-dependent|response to heat|response to oxidative stress|transcription, DNA-dependent	cytosol|nuclear heterochromatin|nuclear periphery|nucleoplasm|nucleoplasm|transcriptionally active chromatin	activating transcription factor binding|chromatin binding|DNA secondary structure binding|RNA polymerase II transcription coactivator activity			breast(1)	1				GBM - Glioblastoma multiforme(50;2.38e-06)														---	---	---	---
IFNA8	3445	broad.mit.edu	37	9	21409548	21409548	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:21409548C>T	uc003zpc.1	+	1	403	c.373C>T	c.(373-375)CAG>TAG	p.Q125*		NM_002170	NP_002161	P32881	IFNA8_HUMAN	interferon, alpha 8 precursor	125					blood coagulation|regulation of type I interferon-mediated signaling pathway|response to virus|type I interferon-mediated signaling pathway	extracellular space	cytokine activity|cytokine receptor binding				0				Lung(24;7.66e-27)|LUSC - Lung squamous cell carcinoma(38;1.4e-13)|OV - Ovarian serous cystadenocarcinoma(39;0.0174)														---	---	---	---
TOPORS	10210	broad.mit.edu	37	9	32542476	32542476	+	Missense_Mutation	SNP	G	A	A	rs143249653		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:32542476G>A	uc003zrb.2	-	3	2214	c.2047C>T	c.(2047-2049)CGG>TGG	p.R683W	TOPORS_uc003zrc.2_Missense_Mutation_p.R616W	NM_005802	NP_005793	Q9NS56	TOPRS_HUMAN	topoisomerase I binding, arginine/serine-rich	683	Interaction with TOP1.|Arg-rich.|Interaction with p53/TP53.				DNA damage response, signal transduction resulting in induction of apoptosis|maintenance of protein location in nucleus|proteasomal ubiquitin-dependent protein catabolic process|protein sumoylation|transcription, DNA-dependent	nuclear speck|PML body	antigen binding|DNA binding|DNA topoisomerase I binding|SUMO ligase activity|ubiquitin-protein ligase activity|zinc ion binding			ovary(3)|upper_aerodigestive_tract(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(29;0.0181)	GBM - Glioblastoma multiforme(74;0.0018)														---	---	---	---
DNAJA1	3301	broad.mit.edu	37	9	33038834	33038834	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33038834A>G	uc003zsd.1	+	9	1310	c.1127A>G	c.(1126-1128)TAC>TGC	p.Y376C	DNAJA1_uc011lnt.1_Missense_Mutation_p.Y219C	NM_001539	NP_001530	P31689	DNJA1_HUMAN	DnaJ (Hsp40) homolog, subfamily A, member 1	376					protein folding|response to heat|response to unfolded protein	membrane	ATP binding|heat shock protein binding|low-density lipoprotein particle receptor binding|metal ion binding|unfolded protein binding				0			LUSC - Lung squamous cell carcinoma(29;0.0227)	GBM - Glioblastoma multiforme(74;0.102)														---	---	---	---
NOL6	65083	broad.mit.edu	37	9	33467247	33467247	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33467247C>T	uc003zsz.2	-	14	1840	c.1739G>A	c.(1738-1740)CGC>CAC	p.R580H	SUGT1P1_uc010mjq.1_Intron|NOL6_uc003zsy.2_5'Flank|NOL6_uc003zta.2_Missense_Mutation_p.R580H|NOL6_uc010mjv.2_Missense_Mutation_p.R577H|NOL6_uc011lob.1_Missense_Mutation_p.R528H|NOL6_uc003ztb.1_Missense_Mutation_p.R580H	NM_022917	NP_075068	Q9H6R4	NOL6_HUMAN	nucleolar protein family 6 alpha isoform	580					rRNA processing	condensed nuclear chromosome|nucleolus	RNA binding			ovary(2)	2			LUSC - Lung squamous cell carcinoma(29;0.00788)	GBM - Glioblastoma multiforme(74;0.152)												OREG0019137	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
KIAA1161	57462	broad.mit.edu	37	9	34372899	34372899	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:34372899G>A	uc003zue.3	-	2	210	c.43C>T	c.(43-45)CGC>TGC	p.R15C		NM_020702	NP_065753	Q6NSJ0	K1161_HUMAN	hypothetical protein LOC57462	15	Cytoplasmic (Potential).				carbohydrate metabolic process	integral to membrane	hydrolase activity, hydrolyzing O-glycosyl compounds			ovary(1)|breast(1)|central_nervous_system(1)	3			LUSC - Lung squamous cell carcinoma(29;0.0107)	GBM - Glioblastoma multiforme(74;0.126)														---	---	---	---
DCTN3	11258	broad.mit.edu	37	9	34617918	34617918	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:34617918T>C	uc003zux.1	-	3	267	c.232A>G	c.(232-234)ATA>GTA	p.I78V	DCTN3_uc003zuw.1_Missense_Mutation_p.I78V	NM_007234	NP_009165	O75935	DCTN3_HUMAN	dynactin 3 isoform 1	78					cytokinesis|G2/M transition of mitotic cell cycle|mitosis	centrosome|cleavage furrow|condensed chromosome kinetochore|cytosol|dynactin complex|midbody|perinuclear region of cytoplasm|spindle	protein binding|structural molecule activity				0	all_epithelial(49;0.0863)		STAD - Stomach adenocarcinoma(86;0.178)	GBM - Glioblastoma multiforme(74;0.0388)														---	---	---	---
STOML2	30968	broad.mit.edu	37	9	35101920	35101920	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35101920C>T	uc003zwi.2	-	4	386	c.323G>A	c.(322-324)CGC>CAC	p.R108H	STOML2_uc003zwh.2_5'UTR|STOML2_uc003zwj.2_5'UTR|STOML2_uc011lou.1_Missense_Mutation_p.R108H|STOML2_uc003zwk.2_Missense_Mutation_p.R57H	NM_013442	NP_038470	Q9UJZ1	STML2_HUMAN	stomatin (EPB72)-like 2	108						cytoskeleton	receptor binding				0			LUSC - Lung squamous cell carcinoma(32;0.00343)|Lung(28;0.00778)															---	---	---	---
UNC13B	10497	broad.mit.edu	37	9	35396831	35396831	+	Intron	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35396831G>T	uc003zwq.2	+						UNC13B_uc003zwr.2_Intron	NM_006377	NP_006368			UNC13 (C. elegans)-like						excretion|induction of apoptosis|intracellular signal transduction	cell junction|Golgi apparatus|synapse	metal ion binding|receptor activity			ovary(3)|large_intestine(1)|skin(1)	5	all_epithelial(49;0.212)		LUSC - Lung squamous cell carcinoma(32;0.00343)|Lung(28;0.00778)|STAD - Stomach adenocarcinoma(86;0.194)															---	---	---	---
RUSC2	9853	broad.mit.edu	37	9	35559222	35559222	+	Splice_Site	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35559222G>T	uc003zww.2	+	9	3597	c.3342_splice	c.e9-1	p.N1114_splice	RUSC2_uc010mkq.2_Splice_Site|RUSC2_uc003zwx.3_Splice_Site_p.N1114_splice	NM_014806	NP_055621			RUN and SH3 domain containing 2							cytosol				ovary(1)	1			Lung(28;0.000837)|LUSC - Lung squamous cell carcinoma(32;0.00109)|STAD - Stomach adenocarcinoma(86;0.194)															---	---	---	---
NPR2	4882	broad.mit.edu	37	9	35794060	35794060	+	Missense_Mutation	SNP	G	A	A	rs114995755	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35794060G>A	uc003zyd.2	+	2	833	c.833G>A	c.(832-834)CGC>CAC	p.R278H	NPR2_uc010mlb.2_Missense_Mutation_p.R278H	NM_003995	NP_003986	P20594	ANPRB_HUMAN	natriuretic peptide receptor B precursor	278	Extracellular (Potential).				intracellular signal transduction|ossification|receptor guanylyl cyclase signaling pathway|regulation of blood pressure	integral to membrane|plasma membrane	GTP binding|guanylate cyclase activity|natriuretic peptide receptor activity|protein kinase activity|transmembrane receptor activity			ovary(2)|stomach(1)	3	all_epithelial(49;0.161)		LUSC - Lung squamous cell carcinoma(32;0.00521)|Lung(28;0.00697)|STAD - Stomach adenocarcinoma(86;0.194)		Erythrityl Tetranitrate(DB01613)|Nesiritide(DB04899)													---	---	---	---
FBXO10	26267	broad.mit.edu	37	9	37541398	37541398	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:37541398C>T	uc004aab.2	-	2	417	c.368G>A	c.(367-369)AGT>AAT	p.S123N	FBXO10_uc004aac.2_Missense_Mutation_p.S139N|FBXO10_uc004aad.2_Intron	NM_012166	NP_036298	Q9UK96	FBX10_HUMAN	F-box protein 10	123						ubiquitin ligase complex	ubiquitin-protein ligase activity			lung(5)	5				GBM - Glioblastoma multiforme(29;0.0107)														---	---	---	---
TRPM3	80036	broad.mit.edu	37	9	73152135	73152135	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:73152135C>T	uc004aid.2	-	25	4102	c.3858G>A	c.(3856-3858)TCG>TCA	p.S1286S	TRPM3_uc004ahu.2_Silent_p.S1128S|TRPM3_uc004ahv.2_Silent_p.S1088S|TRPM3_uc004ahw.2_Silent_p.S1158S|TRPM3_uc004ahx.2_Silent_p.S1145S|TRPM3_uc004ahy.2_Silent_p.S1148S|TRPM3_uc004ahz.2_Silent_p.S1135S|TRPM3_uc004aia.2_Silent_p.S1133S|TRPM3_uc004aib.2_Silent_p.S1123S|TRPM3_uc004aic.2_Silent_p.S1286S	NM_001007471	NP_001007472	Q9HCF6	TRPM3_HUMAN	transient receptor potential cation channel,	1311	Cytoplasmic (Potential).					integral to membrane	calcium channel activity			ovary(3)|pancreas(2)|central_nervous_system(2)|skin(2)	9																		---	---	---	---
TMC1	117531	broad.mit.edu	37	9	75369791	75369791	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:75369791C>T	uc004aiz.1	+	12	1272	c.732C>T	c.(730-732)TAC>TAT	p.Y244Y	TMC1_uc010moz.1_Silent_p.Y202Y|TMC1_uc004aja.1_RNA|TMC1_uc004ajb.1_RNA|TMC1_uc004ajc.1_Silent_p.Y98Y|TMC1_uc010mpa.1_Silent_p.Y98Y	NM_138691	NP_619636	Q8TDI8	TMC1_HUMAN	transmembrane channel-like 1	244	Extracellular (Potential).				sensory perception of sound	integral to membrane				ovary(1)	1																		---	---	---	---
VPS13A	23230	broad.mit.edu	37	9	79792679	79792679	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:79792679T>C	uc004akr.2	+	1	319	c.59T>C	c.(58-60)GTG>GCG	p.V20A	VPS13A_uc004akp.3_Missense_Mutation_p.V20A|VPS13A_uc004akq.3_Missense_Mutation_p.V20A|VPS13A_uc004aks.2_Missense_Mutation_p.V20A|uc011lsn.1_RNA	NM_033305	NP_150648	Q96RL7	VP13A_HUMAN	vacuolar protein sorting 13A isoform A	20					Golgi to endosome transport|protein transport	intracellular	protein binding			pancreas(3)|skin(3)|ovary(2)|large_intestine(1)|central_nervous_system(1)	10																		---	---	---	---
CTSL1	1514	broad.mit.edu	37	9	90343560	90343560	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:90343560C>T	uc004aph.2	+	5	807	c.457C>T	c.(457-459)CGG>TGG	p.R153W	CTSL1_uc004api.2_Missense_Mutation_p.R153W|CTSL1_uc004apj.2_Missense_Mutation_p.R98W|CTSL1_uc010mqh.2_Intron|CTSL1_uc004apk.2_Missense_Mutation_p.R153W|CTSL1_uc004apl.2_Missense_Mutation_p.R153W	NM_001912	NP_001903	P07711	CATL1_HUMAN	cathepsin L1 preproprotein	153					macrophage apoptosis|proteolysis	extracellular region|lysosome|nucleus	cysteine-type endopeptidase activity|histone binding			ovary(3)	3					Glucagon recombinant(DB00040)													---	---	---	---
SECISBP2	79048	broad.mit.edu	37	9	91964707	91964707	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:91964707C>T	uc004aqj.1	+	13	1835	c.1755C>T	c.(1753-1755)GAC>GAT	p.D585D	SECISBP2_uc011ltk.1_Silent_p.D584D|SECISBP2_uc004aqk.1_Silent_p.D512D|SECISBP2_uc010mqo.1_Silent_p.D290D|SECISBP2_uc011ltl.1_Silent_p.D517D	NM_024077	NP_076982	Q96T21	SEBP2_HUMAN	SECIS binding protein 2	585					translation	nucleus	mRNA 3'-UTR binding			ovary(2)|skin(1)	3																		---	---	---	---
IARS	3376	broad.mit.edu	37	9	95012488	95012488	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95012488C>T	uc004art.1	-	24	2770	c.2513G>A	c.(2512-2514)CGA>CAA	p.R838Q	IARS_uc004ars.1_Missense_Mutation_p.R683Q|IARS_uc004aru.3_Missense_Mutation_p.R838Q|IARS_uc010mqr.2_Missense_Mutation_p.R728Q|IARS_uc010mqt.2_Missense_Mutation_p.R61Q	NM_013417	NP_038203	P41252	SYIC_HUMAN	isoleucine tRNA synthetase	838					isoleucyl-tRNA aminoacylation	cytosol|nucleus|soluble fraction	ATP binding|isoleucine-tRNA ligase activity|protein binding			ovary(1)|skin(1)	2					L-Isoleucine(DB00167)													---	---	---	---
NOL8	55035	broad.mit.edu	37	9	95073456	95073456	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95073456T>C	uc004arv.2	-	8	2781	c.2444A>G	c.(2443-2445)CAG>CGG	p.Q815R	NOL8_uc010mqw.2_RNA|NOL8_uc004arw.2_Missense_Mutation_p.Q47R|NOL8_uc011ltw.1_Missense_Mutation_p.Q747R	NM_017948	NP_060418	Q76FK4	NOL8_HUMAN	nucleolar protein 8	815					DNA replication|positive regulation of cell growth	nucleolus	nucleotide binding|protein binding|RNA binding			ovary(1)	1																		---	---	---	---
FGD3	89846	broad.mit.edu	37	9	95796871	95796871	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95796871C>T	uc004asw.2	+	17	2462	c.1834C>T	c.(1834-1836)CGG>TGG	p.R612W	FGD3_uc004asx.2_Missense_Mutation_p.R611W|FGD3_uc004asz.2_Missense_Mutation_p.R612W|FGD3_uc011luc.1_Missense_Mutation_p.R215W	NM_001083536	NP_001077005	Q5JSP0	FGD3_HUMAN	FYVE, RhoGEF and PH domain containing 3	612	PH 2.				actin cytoskeleton organization|apoptosis|filopodium assembly|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Cdc42 GTPase activity|regulation of cell shape|small GTPase mediated signal transduction	cytoskeleton|cytosol|Golgi apparatus|lamellipodium|ruffle	metal ion binding|Rho guanyl-nucleotide exchange factor activity|small GTPase binding			ovary(1)|breast(1)	2																		---	---	---	---
FAM120A	23196	broad.mit.edu	37	9	96214614	96214614	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96214614G>A	uc004atw.2	+	1	442	c.417G>A	c.(415-417)CTG>CTA	p.L139L	FAM120AOS_uc004atm.2_5'Flank|FAM120AOS_uc004atn.3_5'Flank|FAM120AOS_uc004ato.3_5'Flank|FAM120AOS_uc004atp.3_5'Flank|FAM120AOS_uc004atq.3_5'Flank|FAM120AOS_uc004atr.3_5'Flank|FAM120AOS_uc004ats.3_Intron|FAM120AOS_uc004att.3_Intron|FAM120AOS_uc004atu.3_Silent_p.G126G|FAM120A_uc004atv.2_Silent_p.L139L	NM_014612	NP_055427	Q9NZB2	F120A_HUMAN	oxidative stress-associated Src activator	139						cytoplasm|plasma membrane	RNA binding				0																		---	---	---	---
ZNF367	195828	broad.mit.edu	37	9	99150564	99150564	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:99150564C>T	uc004awf.2	-	5	1363	c.1008G>A	c.(1006-1008)GCG>GCA	p.A336A		NM_153695	NP_710162	Q7RTV3	ZN367_HUMAN	zinc finger protein 367	336	Potential.				regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Acute lymphoblastic leukemia(62;0.0167)																---	---	---	---
ERP44	23071	broad.mit.edu	37	9	102778630	102778630	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:102778630G>A	uc004bam.2	-	8	944	c.736C>T	c.(736-738)CGA>TGA	p.R246*	ERP44_uc010msy.2_RNA|ERP44_uc010msz.2_Nonsense_Mutation_p.R246*	NM_015051	NP_055866	Q9BS26	ERP44_HUMAN	thioredoxin domain containing 4 (endoplasmic	246	Interaction with ITPR1 (By similarity).				cell redox homeostasis|glycoprotein metabolic process|protein folding|response to unfolded protein	endoplasmic reticulum lumen|endoplasmic reticulum membrane|ER-Golgi intermediate compartment	protein binding|protein disulfide isomerase activity				0																		---	---	---	---
ERP44	23071	broad.mit.edu	37	9	102782969	102782969	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:102782969C>T	uc004bam.2	-	6	724	c.516G>A	c.(514-516)TCG>TCA	p.S172S	ERP44_uc010msy.2_RNA|ERP44_uc010msz.2_Silent_p.S172S	NM_015051	NP_055866	Q9BS26	ERP44_HUMAN	thioredoxin domain containing 4 (endoplasmic	172					cell redox homeostasis|glycoprotein metabolic process|protein folding|response to unfolded protein	endoplasmic reticulum lumen|endoplasmic reticulum membrane|ER-Golgi intermediate compartment	protein binding|protein disulfide isomerase activity				0																		---	---	---	---
OR13C4	138804	broad.mit.edu	37	9	107289389	107289389	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:107289389C>T	uc011lvn.1	-	1	102	c.102G>A	c.(100-102)ATG>ATA	p.M34I		NM_001001919	NP_001001919	Q8NGS5	O13C4_HUMAN	olfactory receptor, family 13, subfamily C,	34	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1																		---	---	---	---
ZNF462	58499	broad.mit.edu	37	9	109692859	109692859	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:109692859C>T	uc004bcz.2	+	4	6190	c.5901C>T	c.(5899-5901)GGC>GGT	p.G1967G	ZNF462_uc010mto.2_Silent_p.G1815G|ZNF462_uc004bda.2_Silent_p.G1815G|ZNF462_uc011lvz.1_5'Flank	NM_021224	NP_067047	Q96JM2	ZN462_HUMAN	zinc finger protein 462	1967					transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(5)	5																		---	---	---	---
ZNF462	58499	broad.mit.edu	37	9	109694807	109694807	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:109694807G>A	uc004bcz.2	+	5	6382	c.6093G>A	c.(6091-6093)TCG>TCA	p.S2031S	ZNF462_uc010mto.2_Silent_p.S1940S|ZNF462_uc004bda.2_Silent_p.S1939S|ZNF462_uc011lvz.1_5'Flank	NM_021224	NP_067047	Q96JM2	ZN462_HUMAN	zinc finger protein 462	2031	C2H2-type 19.				transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(5)	5																		---	---	---	---
KLF4	9314	broad.mit.edu	37	9	110248069	110248069	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:110248069G>A	uc004bdh.2	-	4	2099	c.1478C>T	c.(1477-1479)TCG>TTG	p.S493L	KLF4_uc004bdf.1_Missense_Mutation_p.S418L|KLF4_uc004bdg.2_Missense_Mutation_p.S468L	NM_004235	NP_004226	O43474	KLF4_HUMAN	Kruppel-like factor 4 (gut)	502	C2H2-type 3.|Interaction with target DNA (By similarity).				fat cell differentiation|mesodermal cell fate determination|negative regulation of cell proliferation|negative regulation of transcription, DNA-dependent|positive regulation of transcription from RNA polymerase II promoter|stem cell maintenance|transcription from RNA polymerase II promoter	nucleus	RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor recruiting transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			central_nervous_system(2)|lung(1)	3																		---	---	---	---
ZNF883	169834	broad.mit.edu	37	9	115760546	115760546	+	5'UTR	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:115760546T>C	uc011lwy.1	-	5						NM_001101338	NP_001094808			hypothetical protein LOC169834						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
ALAD	210	broad.mit.edu	37	9	116152094	116152094	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:116152094G>A	uc011lxf.1	-	8	787	c.585C>T	c.(583-585)AGC>AGT	p.S195S	ALAD_uc011lxe.1_Silent_p.S178S|ALAD_uc004bhl.3_Silent_p.S224S	NM_000031	NP_000022	P13716	HEM2_HUMAN	delta-aminolevulinic acid dehydratase	195					heme biosynthetic process|protein homooligomerization	cytosol	identical protein binding|lead ion binding|porphobilinogen synthase activity|zinc ion binding				0					Aminolevulinic acid(DB00855)													---	---	---	---
GSN	2934	broad.mit.edu	37	9	124074693	124074693	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:124074693G>A	uc004blf.1	+	5	804	c.743G>A	c.(742-744)CGG>CAG	p.R248Q	GSN_uc004bld.1_Missense_Mutation_p.R197Q|GSN_uc010mvq.1_Missense_Mutation_p.R208Q|GSN_uc010mvr.1_Missense_Mutation_p.R208Q|GSN_uc010mvu.1_Missense_Mutation_p.R197Q|GSN_uc010mvt.1_Missense_Mutation_p.R197Q|GSN_uc010mvs.1_Missense_Mutation_p.R197Q|GSN_uc004ble.1_Missense_Mutation_p.R197Q|GSN_uc010mvv.1_Missense_Mutation_p.R197Q|GSN_uc011lyh.1_Missense_Mutation_p.R214Q|GSN_uc011lyi.1_Missense_Mutation_p.R197Q|GSN_uc011lyj.1_Missense_Mutation_p.R221Q|GSN_uc004blg.1_5'UTR	NM_000177	NP_000168	P06396	GELS_HUMAN	gelsolin isoform a precursor	248					actin filament polymerization|actin filament severing|barbed-end actin filament capping|cellular component disassembly involved in apoptosis|cilium morphogenesis	actin cytoskeleton|cytosol	actin binding|calcium ion binding|protein binding			breast(2)|ovary(1)	3																		---	---	---	---
MORN5	254956	broad.mit.edu	37	9	124962220	124962220	+	3'UTR	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:124962220G>A	uc004blw.2	+	5					MORN5_uc011lyo.1_3'UTR	NM_198469	NP_940871			MORN repeat containing 5												0																		---	---	---	---
PTGS1	5742	broad.mit.edu	37	9	125148845	125148845	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:125148845C>T	uc004bmg.1	+	9	1265	c.1130C>T	c.(1129-1131)GCC>GTC	p.A377V	PTGS1_uc011lys.1_Missense_Mutation_p.A352V|PTGS1_uc010mwb.1_Missense_Mutation_p.A268V|PTGS1_uc004bmf.1_Missense_Mutation_p.A377V|PTGS1_uc004bmh.1_Missense_Mutation_p.A268V|PTGS1_uc011lyt.1_Missense_Mutation_p.A268V	NM_000962	NP_000953	P23219	PGH1_HUMAN	prostaglandin-endoperoxide synthase 1 isoform 1	377					cyclooxygenase pathway|hormone biosynthetic process|regulation of blood pressure|response to oxidative stress|xenobiotic metabolic process	endoplasmic reticulum membrane|Golgi apparatus|microsome|plasma membrane	heme binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|peroxidase activity|prostaglandin-endoperoxide synthase activity			ovary(1)|skin(1)	2					Acetaminophen(DB00316)|Aspirin(DB00945)|Balsalazide(DB01014)|Bromfenac(DB00963)|Ciclopirox(DB01188)|Diclofenac(DB00586)|Diflunisal(DB00861)|Dipyrone(DB04817)|Etodolac(DB00749)|Fenoprofen(DB00573)|Flurbiprofen(DB00712)|gamma-Homolinolenic acid(DB00154)|Ibuprofen(DB01050)|Icosapent(DB00159)|Indomethacin(DB00328)|Ketoprofen(DB01009)|Ketorolac(DB00465)|Lumiracoxib(DB01283)|Meclofenamic acid(DB00939)|Mefenamic acid(DB00784)|Mesalazine(DB00244)|Minoxidil(DB00350)|Nabumetone(DB00461)|Naproxen(DB00788)|Phenacetin(DB03783)|Piroxicam(DB00554)|Rofecoxib(DB00533)|Salicyclic acid(DB00936)|Salsalate(DB01399)|Sulindac(DB00605)|Suprofen(DB00870)|Tenoxicam(DB00469)|Tolmetin(DB00500)													---	---	---	---
OR1Q1	158131	broad.mit.edu	37	9	125377740	125377740	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:125377740G>A	uc011lyy.1	+	1	724	c.724G>A	c.(724-726)GGC>AGC	p.G242S		NM_012364	NP_036496	Q15612	OR1Q1_HUMAN	olfactory receptor, family 1, subfamily Q,	242	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1																		---	---	---	---
GPR21	2844	broad.mit.edu	37	9	125797169	125797169	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:125797169A>G	uc011lzk.1	+	1	324	c.324A>G	c.(322-324)GTA>GTG	p.V108V	RABGAP1_uc004bnl.3_Intron|RABGAP1_uc011lzh.1_Intron|RABGAP1_uc011lzj.1_Intron|GPR21_uc011lzi.1_RNA	NM_005294	NP_005285	Q99679	GPR21_HUMAN	G protein-coupled receptor 21	108	Helical; Name=3; (Potential).					integral to plasma membrane	G-protein coupled receptor activity			ovary(1)	1																		---	---	---	---
NR5A1	2516	broad.mit.edu	37	9	127262518	127262518	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:127262518G>A	uc004boo.1	-	4	908	c.721C>T	c.(721-723)CGG>TGG	p.R241W		NM_004959	NP_004950	Q13285	STF1_HUMAN	nuclear receptor subfamily 5, group A, member 1	241	Important for dimerization.				cell-cell signaling|male gonad development|positive regulation of transcription from RNA polymerase II promoter|primary sex determination|regulation of steroid biosynthetic process|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	enzyme binding|phospholipid binding|steroid hormone receptor activity|transcription coactivator activity|zinc ion binding				0																		---	---	---	---
NR6A1	2649	broad.mit.edu	37	9	127289148	127289148	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:127289148G>A	uc004bor.1	-	8	1289	c.1111C>T	c.(1111-1113)CGG>TGG	p.R371W	NR6A1_uc004boq.1_Missense_Mutation_p.R366W|NR6A1_uc010mwq.1_Missense_Mutation_p.R367W	NM_033334	NP_201591	Q15406	NR6A1_HUMAN	nuclear receptor subfamily 6, group A, member 1	371					cell proliferation|negative regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|spermatogenesis	transcription factor complex	protein homodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(3)	3																		---	---	---	---
GARNL3	84253	broad.mit.edu	37	9	130053437	130053437	+	Intron	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130053437T>C	uc011mae.1	+						GARNL3_uc011mad.1_Intron	NM_032293	NP_115669			GTPase activating Rap/RanGAP domain-like 3						regulation of small GTPase mediated signal transduction	intracellular	GTPase activator activity|small GTPase regulator activity			ovary(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
FAM129B	64855	broad.mit.edu	37	9	130272446	130272446	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130272446G>A	uc004brh.2	-	9	1342	c.1140C>T	c.(1138-1140)GGC>GGT	p.G380G	FAM129B_uc004bri.2_Silent_p.G367G|FAM129B_uc004brj.3_Silent_p.G380G	NM_022833	NP_073744	Q96TA1	NIBL1_HUMAN	hypothetical protein LOC64855 isoform 1	380							protein binding				0																		---	---	---	---
SH2D3C	10044	broad.mit.edu	37	9	130507379	130507379	+	Splice_Site	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130507379C>T	uc004bsc.2	-	7	1407	c.1265_splice	c.e7-1	p.V422_splice	SH2D3C_uc010mxo.2_Splice_Site_p.V262_splice|SH2D3C_uc004bry.2_Splice_Site_p.V264_splice|SH2D3C_uc004brz.3_Splice_Site_p.V68_splice|SH2D3C_uc011mak.1_Splice_Site_p.V68_splice|SH2D3C_uc004bsa.2_Splice_Site_p.V265_splice|SH2D3C_uc004bsb.2_Splice_Site_p.V354_splice	NM_170600	NP_733745			SH2 domain containing 3C isoform a						JNK cascade|small GTPase mediated signal transduction	cytoplasm|membrane	guanyl-nucleotide exchange factor activity|SH3/SH2 adaptor activity			ovary(1)	1																		---	---	---	---
CERCAM	51148	broad.mit.edu	37	9	131191074	131191074	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131191074C>T	uc004buz.3	+	7	1323	c.925C>T	c.(925-927)CGG>TGG	p.R309W	CERCAM_uc004buy.1_Missense_Mutation_p.R231W|CERCAM_uc010mxz.2_Missense_Mutation_p.R231W|CERCAM_uc010mya.1_Missense_Mutation_p.R150W	NM_016174	NP_057258	Q5T4B2	GT253_HUMAN	cerebral endothelial cell adhesion molecule 1	309					cellular component movement|leukocyte cell-cell adhesion|lipopolysaccharide biosynthetic process	endoplasmic reticulum lumen|plasma membrane				pancreas(1)	1																		---	---	---	---
SET	6418	broad.mit.edu	37	9	131455924	131455924	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131455924C>T	uc004bvt.3	+	6	780	c.539C>T	c.(538-540)ACG>ATG	p.T180M	SET_uc004bvu.3_Missense_Mutation_p.T167M|SET_uc010myg.2_RNA|SET_uc011mbj.1_Missense_Mutation_p.T156M	NM_001122821	NP_001116293	Q01105	SET_HUMAN	SET translocation (myeloid leukemia-associated)	180					DNA replication|mRNA metabolic process|negative regulation of histone acetylation|negative regulation of neuron apoptosis|negative regulation of transcription, DNA-dependent|nucleocytoplasmic transport|nucleosome assembly|nucleosome disassembly	cytosol|endoplasmic reticulum|nucleoplasm|perinuclear region of cytoplasm|protein complex	histone binding|protein phosphatase inhibitor activity|protein phosphatase type 2A regulator activity				0		Myeloproliferative disorder(178;0.204)		GBM - Glioblastoma multiforme(294;3.1e-09)				T	NUP214	AML								---	---	---	---
LAMC3	10319	broad.mit.edu	37	9	133914292	133914292	+	Missense_Mutation	SNP	C	T	T	rs146887458		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:133914292C>T	uc004caa.1	+	5	1116	c.1018C>T	c.(1018-1020)CGG>TGG	p.R340W		NM_006059	NP_006050	Q9Y6N6	LAMC3_HUMAN	laminin, gamma 3 precursor	340	Laminin EGF-like 2.				cell adhesion	basement membrane|membrane	structural molecule activity			ovary(2)|pancreas(1)	3	all_hematologic(7;0.0028)	Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;5.06e-05)|Epithelial(140;0.000551)														---	---	---	---
LAMC3	10319	broad.mit.edu	37	9	133942368	133942368	+	Missense_Mutation	SNP	A	G	G	rs147529316		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:133942368A>G	uc004caa.1	+	14	2467	c.2369A>G	c.(2368-2370)GAT>GGT	p.D790G		NM_006059	NP_006050	Q9Y6N6	LAMC3_HUMAN	laminin, gamma 3 precursor	790	Laminin EGF-like 7.				cell adhesion	basement membrane|membrane	structural molecule activity			ovary(2)|pancreas(1)	3	all_hematologic(7;0.0028)	Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;5.06e-05)|Epithelial(140;0.000551)														---	---	---	---
POMT1	10585	broad.mit.edu	37	9	134394352	134394352	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134394352C>T	uc004cav.2	+						POMT1_uc004cax.2_Intron|POMT1_uc011mcj.1_Intron|POMT1_uc004cau.2_Intron|POMT1_uc004caw.2_Intron|POMT1_uc011mck.1_Intron|POMT1_uc011mcl.1_Intron|POMT1_uc011mcm.1_Intron	NM_007171	NP_009102			protein-O-mannosyltransferase 1 isoform a						multicellular organismal development|protein O-linked glycosylation	endoplasmic reticulum membrane|integral to membrane	dolichyl-phosphate-mannose-protein mannosyltransferase activity|metal ion binding			upper_aerodigestive_tract(1)	1		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;2.65e-05)|Epithelial(140;0.000259)														---	---	---	---
BRD3	8019	broad.mit.edu	37	9	136901415	136901415	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136901415C>T	uc004cew.2	-	10	1863	c.1675G>A	c.(1675-1677)GCC>ACC	p.A559T	BRD3_uc004cex.2_3'UTR	NM_007371	NP_031397	Q15059	BRD3_HUMAN	bromodomain containing protein 3	559						nucleus	protein binding		BRD3/C15orf55(3)	stomach(4)|midline_organs(3)|kidney(1)	8				OV - Ovarian serous cystadenocarcinoma(145;1.43e-08)|Epithelial(140;8.41e-08)|all cancers(34;5.21e-07)				T	NUT|C15orf55	lethal midline carcinoma of young people								---	---	---	---
OLFM1	10439	broad.mit.edu	37	9	138011370	138011370	+	Nonsense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:138011370T>A	uc010nar.2	+	6	1120	c.804T>A	c.(802-804)TAT>TAA	p.Y268*	OLFM1_uc004cfl.3_Nonsense_Mutation_p.Y250*|OLFM1_uc004cfn.3_Nonsense_Mutation_p.Y19*	NM_014279	NP_055094	Q99784	NOE1_HUMAN	olfactomedin related ER localized protein	268	Olfactomedin-like.				nervous system development	endoplasmic reticulum lumen	protein binding			ovary(1)|skin(1)	2		Myeloproliferative disorder(178;0.0333)		Epithelial(140;5.49e-08)|OV - Ovarian serous cystadenocarcinoma(145;9.68e-08)|all cancers(34;1.88e-07)														---	---	---	---
QSOX2	169714	broad.mit.edu	37	9	139113734	139113734	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139113734G>A	uc010nbi.2	-	6	767	c.729C>T	c.(727-729)GAC>GAT	p.D243D		NM_181701	NP_859052	Q6ZRP7	QSOX2_HUMAN	quiescin Q6 sulfhydryl oxidase 2 precursor	243					cell redox homeostasis	extracellular region|integral to membrane|nuclear membrane|plasma membrane	thiol oxidase activity			ovary(1)	1		Myeloproliferative disorder(178;0.0511)		Epithelial(140;7.78e-08)|OV - Ovarian serous cystadenocarcinoma(145;1.55e-07)														---	---	---	---
SNAPC4	6621	broad.mit.edu	37	9	139279234	139279234	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139279234T>C	uc004chh.2	-	13	1367	c.1358A>G	c.(1357-1359)AAG>AGG	p.K453R		NM_003086	NP_003077	Q5SXM2	SNPC4_HUMAN	small nuclear RNA activating complex,	453	HTH myb-type 3.				snRNA transcription from RNA polymerase II promoter|snRNA transcription from RNA polymerase III promoter	snRNA-activating protein complex	DNA binding|sequence-specific DNA binding transcription factor activity				0		Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;5.31e-06)|Epithelial(140;7.13e-06)														---	---	---	---
PMPCA	23203	broad.mit.edu	37	9	139311677	139311677	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139311677G>A	uc004chl.2	+						PMPCA_uc010nbl.2_Intron|PMPCA_uc011mdz.1_Intron|PMPCA_uc004chm.1_Intron|PMPCA_uc004chn.1_5'Flank	NM_015160	NP_055975			peptidase (mitochondrial processing) alpha						proteolysis	mitochondrial inner membrane|mitochondrial matrix	metalloendopeptidase activity|zinc ion binding				0		Myeloproliferative disorder(178;0.0821)		OV - Ovarian serous cystadenocarcinoma(145;9.3e-06)|Epithelial(140;1.15e-05)														---	---	---	---
NOTCH1	4851	broad.mit.edu	37	9	139412379	139412379	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139412379G>T	uc004chz.2	-	8	1266	c.1266C>A	c.(1264-1266)CCC>CCA	p.P422P		NM_017617	NP_060087	P46531	NOTC1_HUMAN	notch1 preproprotein	422	Extracellular (Potential).|EGF-like 11; calcium-binding (Potential).				aortic valve morphogenesis|immune response|negative regulation of BMP signaling pathway|negative regulation of cell-substrate adhesion|negative regulation of myoblast differentiation|negative regulation of osteoblast differentiation|negative regulation of transcription, DNA-dependent|Notch receptor processing	cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to membrane|nucleoplasm|plasma membrane	calcium ion binding|protein binding|receptor activity			haematopoietic_and_lymphoid_tissue(791)|upper_aerodigestive_tract(29)|lung(13)|central_nervous_system(10)|breast(9)|large_intestine(1)|skin(1)|oesophagus(1)|pancreas(1)	856	all_cancers(76;0.223)	Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;5.34e-06)|Epithelial(140;7.77e-06)				T|Mis|O	TRB@	T-ALL					HNSCC(8;0.001)			---	---	---	---
KIAA1984	84960	broad.mit.edu	37	9	139699855	139699855	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139699855C>T	uc004cjf.2	+	9	942	c.894C>T	c.(892-894)GGC>GGT	p.G298G	C9orf86_uc004cjm.2_5'Flank|C9orf86_uc004cjh.2_5'Flank|C9orf86_uc004cjj.1_5'Flank|C9orf86_uc004cjk.1_5'Flank|C9orf86_uc004cji.1_5'Flank|C9orf86_uc010nbr.1_5'Flank|LOC100131193_uc004cjg.1_RNA	NM_001039374	NP_001034463	Q5T5S1	K1984_HUMAN	hypothetical protein LOC84960	298										ovary(1)	1	all_cancers(76;0.0882)|all_epithelial(76;0.228)	Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;9.33e-06)|Epithelial(140;0.000124)														---	---	---	---
C9orf172	389813	broad.mit.edu	37	9	139741105	139741105	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139741105C>T	uc011meh.1	+	1	2239	c.2239C>T	c.(2239-2241)CGC>TGC	p.R747C	PHPT1_uc004cjp.2_5'Flank|PHPT1_uc011mei.1_5'Flank|PHPT1_uc004cjq.3_5'Flank	NM_001080482	NP_001073951	C9J069	CI172_HUMAN	chromosome 9 open reading frame 172	747											0																		---	---	---	---
EDF1	8721	broad.mit.edu	37	9	139757759	139757759	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139757759G>A	uc004cjt.1	-	3	300	c.272C>T	c.(271-273)ACG>ATG	p.T91M	EDF1_uc004cju.1_Missense_Mutation_p.T91M	NM_003792	NP_003783	O60869	EDF1_HUMAN	endothelial differentiation-related factor 1	91	Interaction with TBP and NR5A1.|HTH cro/C1-type.|Interaction with NR5A2, PPARG and NR1H3.			T->A: No effect on CALM-binding.|T->D: Partial loss of interaction with CALM. Complete loss of interaction; when associated with D-40; D-58 and D-111.	endothelial cell differentiation|multicellular organismal development|positive regulation of DNA binding|positive regulation of transcription, DNA-dependent|regulation of lipid metabolic process|transcription, DNA-dependent	cytoplasm|cytoplasm|nucleolus|nucleus	calmodulin binding|protein binding|protein binding|sequence-specific DNA binding|transcription coactivator activity				0	all_cancers(76;0.0841)|all_epithelial(76;0.217)	Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;1.52e-05)|Epithelial(140;0.000171)														---	---	---	---
C9orf142	286257	broad.mit.edu	37	9	139888076	139888076	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139888076C>T	uc004cki.2	+	6	561	c.535C>T	c.(535-537)CGG>TGG	p.R179W		NM_183241	NP_899064	Q9BUH6	CI142_HUMAN	hypothetical protein LOC286257	179											0	all_cancers(76;0.11)	Myeloproliferative disorder(178;0.0821)	STAD - Stomach adenocarcinoma(284;0.123)	OV - Ovarian serous cystadenocarcinoma(145;2.94e-05)|Epithelial(140;0.00048)														---	---	---	---
GRIN1	2902	broad.mit.edu	37	9	140033932	140033932	+	5'UTR	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140033932C>T	uc004clk.2	+	1					GRIN1_uc004cli.1_5'UTR|GRIN1_uc004clj.1_5'UTR|GRIN1_uc004cll.2_5'UTR|GRIN1_uc004clm.2_5'UTR|GRIN1_uc004cln.2_5'UTR|GRIN1_uc004clo.2_5'UTR	NM_007327	NP_015566			NMDA receptor 1 isoform NR1-3 precursor						ionotropic glutamate receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|regulation of excitatory postsynaptic membrane potential|response to ethanol|visual learning	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|outer membrane-bounded periplasmic space|postsynaptic density|postsynaptic membrane|synaptic vesicle|synaptosome	calcium ion binding|calmodulin binding|extracellular-glutamate-gated ion channel activity|glutamate binding|glycine binding			skin(1)	1	all_cancers(76;0.0926)		STAD - Stomach adenocarcinoma(284;0.0878)	OV - Ovarian serous cystadenocarcinoma(145;6.87e-05)|Epithelial(140;0.00095)	L-Glutamic Acid(DB00142)|Orphenadrine(DB01173)													---	---	---	---
CACNA1B	774	broad.mit.edu	37	9	140809195	140809195	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140809195G>A	uc004cog.2	+	5	857	c.712G>A	c.(712-714)GCC>ACC	p.A238T		NM_000718	NP_000709	Q00975	CAC1B_HUMAN	calcium channel, voltage-dependent, N type,	238	Helical; Name=S5 of repeat I; (Potential).|I.				membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	ATP binding|protein C-terminus binding|voltage-gated calcium channel activity			breast(3)|large_intestine(2)|ovary(1)	6	all_cancers(76;0.166)			OV - Ovarian serous cystadenocarcinoma(145;1.16e-05)|Epithelial(140;0.000476)	Amlodipine(DB00381)|Gabapentin(DB00996)													---	---	---	---
ADARB2	105	broad.mit.edu	37	10	1279635	1279635	+	Splice_Site	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:1279635C>T	uc009xhq.2	-	6	1887	c.1513_splice	c.e6+1	p.L505_splice		NM_018702	NP_061172			adenosine deaminase, RNA-specific, B2						mRNA processing	mitochondrion|nucleus	adenosine deaminase activity|double-stranded RNA binding|metal ion binding|single-stranded RNA binding			large_intestine(2)|central_nervous_system(1)	3		all_epithelial(10;0.059)|Colorectal(49;0.0815)		all cancers(11;0.0224)|GBM - Glioblastoma multiforme(2;0.0414)|Epithelial(11;0.165)														---	---	---	---
AKR1C3	8644	broad.mit.edu	37	10	5144398	5144398	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:5144398C>T	uc001ihr.2	+	6	859	c.676C>T	c.(676-678)CGA>TGA	p.R226*	AKR1C3_uc010qap.1_Nonsense_Mutation_p.R203*|AKR1C3_uc001ihu.2_Nonsense_Mutation_p.R226*	NM_003739	NP_003730	P42330	AK1C3_HUMAN	aldo-keto reductase family 1, member C3	226	NADP (By similarity).				prostaglandin metabolic process	cytoplasm	aldo-keto reductase (NADP) activity|androsterone dehydrogenase (A-specific) activity|indanol dehydrogenase activity|prostaglandin-F synthase activity|testosterone 17-beta-dehydrogenase (NAD+) activity|testosterone 17-beta-dehydrogenase (NADP+) activity|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity			skin(1)	1					Dimethyl sulfoxide(DB01093)|NADH(DB00157)													---	---	---	---
C10orf18	54906	broad.mit.edu	37	10	5799586	5799586	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:5799586C>A	uc001iij.2	+	17	7461	c.6836C>A	c.(6835-6837)GCA>GAA	p.A2279E	C10orf18_uc001iik.2_Missense_Mutation_p.A1123E	NM_017782	NP_060252	Q5VWN6	CJ018_HUMAN	hypothetical protein LOC54906	2279										ovary(1)|central_nervous_system(1)	2																		---	---	---	---
IL2RA	3559	broad.mit.edu	37	10	6067873	6067873	+	Silent	SNP	G	A	A	rs74162093		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:6067873G>A	uc001iiz.1	-	2	339	c.180C>T	c.(178-180)AGC>AGT	p.S60S	IL2RA_uc009xih.1_Silent_p.S60S|IL2RA_uc001ija.1_Silent_p.S22S	NM_000417	NP_000408	P01589	IL2RA_HUMAN	interleukin 2 receptor, alpha chain precursor	60	Sushi 1.|Extracellular (Potential).				cell proliferation	integral to membrane	interleukin-2 receptor activity			ovary(1)|skin(1)	2					Aldesleukin(DB00041)|Basiliximab(DB00074)|Daclizumab(DB00111)|Denileukin diftitox(DB00004)													---	---	---	---
CELF2	10659	broad.mit.edu	37	10	11363317	11363317	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:11363317A>C	uc001iki.3	+	11	1315	c.1223A>C	c.(1222-1224)CAG>CCG	p.Q408P	CELF2_uc010qbj.1_Missense_Mutation_p.Q414P|CELF2_uc001ikk.2_Missense_Mutation_p.Q433P|CELF2_uc001ikl.3_Missense_Mutation_p.Q421P|CELF2_uc010qbl.1_Missense_Mutation_p.Q384P|CELF2_uc010qbm.1_Missense_Mutation_p.Q180P|CELF2_uc001iko.3_Missense_Mutation_p.Q388P|CELF2_uc001ikp.3_Missense_Mutation_p.Q390P|CELF2_uc010qbn.1_Missense_Mutation_p.Q396P|CELF2_uc010qbo.1_Missense_Mutation_p.Q303P|CELF2_uc010qbp.1_Missense_Mutation_p.Q180P	NM_001025077	NP_001020248	O95319	CELF2_HUMAN	CUG triplet repeat, RNA binding protein 2	408	Necessary for RNA-binding, TNNT2 exon 5 and NMDA R1 exon 21 inclusion.				mRNA processing|regulation of heart contraction	cytoplasm|nucleus	nucleotide binding|protein binding|RNA binding				0																		---	---	---	---
CUBN	8029	broad.mit.edu	37	10	16990509	16990509	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:16990509C>T	uc001ioo.2	-	35	5229	c.5177G>A	c.(5176-5178)GGT>GAT	p.G1726D		NM_001081	NP_001072	O60494	CUBN_HUMAN	cubilin precursor	1726	CUB 11.				cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)													---	---	---	---
MRC1	4360	broad.mit.edu	37	10	18138557	18138557	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18138557T>C	uc001ipm.2	+	7	1216	c.1113T>C	c.(1111-1113)GGT>GGC	p.G371G		NM_002438	NP_002429	P22897	MRC1_HUMAN	mannose receptor C type 1 precursor	371	Extracellular (Potential).|C-type lectin 2.				receptor-mediated endocytosis	endosome membrane|integral to plasma membrane	mannose binding|receptor activity				0																		---	---	---	---
KIAA1217	56243	broad.mit.edu	37	10	24825761	24825761	+	Missense_Mutation	SNP	G	A	A	rs145406190		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:24825761G>A	uc001iru.3	+	17	3876	c.3473G>A	c.(3472-3474)CGG>CAG	p.R1158Q	KIAA1217_uc001irs.2_Intron|KIAA1217_uc001irt.3_Intron|KIAA1217_uc010qcy.1_Missense_Mutation_p.R1122Q|KIAA1217_uc010qcz.1_Missense_Mutation_p.R1123Q|KIAA1217_uc001irw.2_Missense_Mutation_p.R841Q|KIAA1217_uc001irz.2_Intron|KIAA1217_uc001irx.2_Missense_Mutation_p.R841Q|KIAA1217_uc001iry.2_Missense_Mutation_p.R841Q	NM_019590	NP_062536	Q5T5P2	SKT_HUMAN	sickle tail isoform 1	1158					embryonic skeletal system development	cytoplasm				ovary(5)|skin(2)	7																		---	---	---	---
GPR158	57512	broad.mit.edu	37	10	25886723	25886723	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:25886723C>T	uc001isj.2	+	11	2228	c.2168C>T	c.(2167-2169)GCC>GTC	p.A723V	GPR158_uc001isk.2_Missense_Mutation_p.A98V	NM_020752	NP_065803	Q5T848	GP158_HUMAN	G protein-coupled receptor 158 precursor	723	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(4)|large_intestine(2)|pancreas(1)|skin(1)	8																		---	---	---	---
FZD8	8325	broad.mit.edu	37	10	35929020	35929020	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:35929020C>T	uc001iyz.1	-	1	1343	c.1338G>A	c.(1336-1338)TGG>TGA	p.W446*		NM_031866	NP_114072	Q9H461	FZD8_HUMAN	frizzled 8 precursor	446	Helical; Name=4; (Potential).				axonogenesis|brain development|canonical Wnt receptor signaling pathway|embryo development|gonad development|T cell differentiation in thymus|vasculature development	cell projection|Golgi apparatus|integral to membrane|plasma membrane	G-protein coupled receptor activity|PDZ domain binding|Wnt receptor activity|Wnt-protein binding				0																		---	---	---	---
ZNF248	57209	broad.mit.edu	37	10	38120692	38120692	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:38120692C>T	uc001izd.1	-	6	2090	c.1591G>A	c.(1591-1593)GAA>AAA	p.E531K	ZNF248_uc009xmc.2_Intron|ZNF248_uc001izb.2_Intron|ZNF248_uc001izc.2_Intron|ZNF248_uc010qeu.1_Missense_Mutation_p.E531K	NM_021045	NP_066383	Q8NDW4	ZN248_HUMAN	zinc finger protein 248	531	C2H2-type 7.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1																		---	---	---	---
BMS1	9790	broad.mit.edu	37	10	43292210	43292210	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43292210T>C	uc001jaj.2	+	10	1876	c.1518T>C	c.(1516-1518)GAT>GAC	p.D506D		NM_014753	NP_055568	Q14692	BMS1_HUMAN	BMS1-like, ribosome assembly protein	506					ribosome assembly	nucleolus	ATP binding|GTP binding|GTPase activity			ovary(2)|upper_aerodigestive_tract(1)	3																		---	---	---	---
ZNF239	8187	broad.mit.edu	37	10	44052449	44052449	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:44052449G>A	uc001jaw.3	-	2	1732	c.1079C>T	c.(1078-1080)TCG>TTG	p.S360L	ZNF239_uc001jax.3_Missense_Mutation_p.S360L|ZNF239_uc009xmj.2_Missense_Mutation_p.S360L|ZNF239_uc009xmk.2_Missense_Mutation_p.S360L	NM_005674	NP_005665	Q16600	ZN239_HUMAN	zinc finger protein 239	360	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|RNA binding|zinc ion binding				0																		---	---	---	---
GPRIN2	9721	broad.mit.edu	37	10	46999541	46999541	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:46999541C>T	uc001jec.2	+	3	796	c.661C>T	c.(661-663)CTG>TTG	p.L221L	GPRIN2_uc010qfq.1_5'Flank	NM_014696	NP_055511	O60269	GRIN2_HUMAN	G protein-regulated inducer of neurite outgrowth	221											0																		---	---	---	---
PPYR1	5540	broad.mit.edu	37	10	47087175	47087175	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:47087175C>T	uc001jee.2	+	3	811	c.392C>T	c.(391-393)TCG>TTG	p.S131L	ANXA8_uc001jed.3_Intron|PPYR1_uc009xna.2_Missense_Mutation_p.S131L	NM_005972	NP_005963	P50391	NPY4R_HUMAN	pancreatic polypeptide receptor 1	131	Helical; Name=3; (Potential).				blood circulation|digestion|feeding behavior	integral to plasma membrane				ovary(1)|skin(1)	2																		---	---	---	---
RBP3	5949	broad.mit.edu	37	10	48389221	48389221	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:48389221C>T	uc001jez.2	-	1	1771	c.1657G>A	c.(1657-1659)GCC>ACC	p.A553T		NM_002900	NP_002891	P10745	RET3_HUMAN	retinol-binding protein 3 precursor	553	4 X approximate tandem repeats.|2.				lipid metabolic process|proteolysis|transport|visual perception	interphotoreceptor matrix	retinal binding|serine-type peptidase activity			large_intestine(1)|central_nervous_system(1)	2					Vitamin A(DB00162)													---	---	---	---
GDF2	2658	broad.mit.edu	37	10	48414123	48414123	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:48414123T>C	uc001jfa.1	-	2	908	c.745A>G	c.(745-747)AGA>GGA	p.R249G		NM_016204	NP_057288	Q9UK05	GDF2_HUMAN	growth differentiation factor 2 precursor	249					activin receptor signaling pathway|BMP signaling pathway|cartilage development|cellular iron ion homeostasis|growth|negative regulation of angiogenesis|negative regulation of blood vessel endothelial cell migration|negative regulation of cell growth|negative regulation of DNA replication|negative regulation of endothelial cell proliferation|ossification|pathway-restricted SMAD protein phosphorylation|patterning of blood vessels|positive regulation of angiogenesis|positive regulation of endothelial cell proliferation|positive regulation of pathway-restricted SMAD protein phosphorylation|positive regulation of transcription, DNA-dependent	extracellular space	cytokine activity|growth factor activity			ovary(2)|skin(1)	3																		---	---	---	---
C10orf72	196740	broad.mit.edu	37	10	50315742	50315742	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:50315742C>T	uc001jhf.2	-	2	383	c.354G>A	c.(352-354)CAG>CAA	p.Q118Q	C10orf72_uc001jhh.2_Silent_p.Q118Q	NM_001031746	NP_001026916	Q8IW00	CJ072_HUMAN	hypothetical protein LOC196740 isoform 1	118	Ig-like.|Extracellular (Potential).					integral to membrane|plasma membrane					0																		---	---	---	---
TFAM	7019	broad.mit.edu	37	10	60154714	60154714	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:60154714C>T	uc001jkf.2	+	7	753	c.621C>T	c.(619-621)GAC>GAT	p.D207D	TFAM_uc001jkg.2_RNA|TFAM_uc001jkh.2_Silent_p.D175D	NM_003201	NP_003192	Q00059	TFAM_HUMAN	transcription factor A, mitochondrial precursor	207	HMG box 2.				DNA-dependent DNA replication|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase I promoter|transcription initiation from mitochondrial promoter	mitochondrial nucleoid	mitochondrial light strand promoter sense binding|protein binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
PHYHIPL	84457	broad.mit.edu	37	10	60994193	60994193	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:60994193G>A	uc001jkk.3	+	2	502	c.236G>A	c.(235-237)CGC>CAC	p.R79H	PHYHIPL_uc001jkl.3_Missense_Mutation_p.R33H|PHYHIPL_uc001jkm.3_Missense_Mutation_p.R53H	NM_032439	NP_115815	Q96FC7	PHIPL_HUMAN	phytanoyl-CoA 2-hydroxylase interacting	79	Fibronectin type-III.										0																		---	---	---	---
ANK3	288	broad.mit.edu	37	10	61831926	61831926	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:61831926G>A	uc001jky.2	-	37	8905	c.8713C>T	c.(8713-8715)CGC>TGC	p.R2905C	ANK3_uc001jkw.2_Intron|ANK3_uc009xpa.2_Intron|ANK3_uc001jkx.2_Intron|ANK3_uc010qih.1_Intron|ANK3_uc001jkz.3_Intron|ANK3_uc001jkv.2_Intron|ANK3_uc009xpb.1_Intron	NM_020987	NP_066267	Q12955	ANK3_HUMAN	ankyrin 3 isoform 1	2905					establishment of protein localization|signal transduction	basolateral plasma membrane|cytoplasm|cytoskeleton	protein binding			skin(9)|ovary(6)|pancreas(2)|central_nervous_system(2)	19																		---	---	---	---
EGR2	1959	broad.mit.edu	37	10	64573218	64573218	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64573218C>T	uc010qim.1	-	3	1334	c.1180G>A	c.(1180-1182)GGT>AGT	p.G394S	EGR2_uc010qin.1_Missense_Mutation_p.G344S|EGR2_uc001jmi.2_Missense_Mutation_p.G394S|EGR2_uc010qio.1_Missense_Mutation_p.G407S|EGR2_uc009xph.2_Missense_Mutation_p.G394S	NM_001136177	NP_001129649	P11161	EGR2_HUMAN	early growth response 2 protein isoform a	394					fat cell differentiation|protein export from nucleus|transcription from RNA polymerase II promoter	cytoplasm|nucleus	chromatin binding|RNA polymerase II activating transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|ubiquitin protein ligase binding|zinc ion binding			ovary(2)	2	Prostate(12;0.0297)|all_hematologic(501;0.228)																	---	---	---	---
EGR2	1959	broad.mit.edu	37	10	64573837	64573837	+	Silent	SNP	C	T	T	rs144739493	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64573837C>T	uc010qim.1	-	3	715	c.561G>A	c.(559-561)GCG>GCA	p.A187A	EGR2_uc010qin.1_Silent_p.A137A|EGR2_uc001jmi.2_Silent_p.A187A|EGR2_uc010qio.1_Silent_p.A200A|EGR2_uc009xph.2_Silent_p.A187A	NM_001136177	NP_001129649	P11161	EGR2_HUMAN	early growth response 2 protein isoform a	187					fat cell differentiation|protein export from nucleus|transcription from RNA polymerase II promoter	cytoplasm|nucleus	chromatin binding|RNA polymerase II activating transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|ubiquitin protein ligase binding|zinc ion binding			ovary(2)	2	Prostate(12;0.0297)|all_hematologic(501;0.228)																	---	---	---	---
JMJD1C	221037	broad.mit.edu	37	10	64968900	64968900	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64968900T>C	uc001jmn.2	-	9	3090	c.2790A>G	c.(2788-2790)GCA>GCG	p.A930A	JMJD1C_uc001jml.2_Silent_p.A711A|JMJD1C_uc001jmm.2_Silent_p.A642A|JMJD1C_uc010qiq.1_Silent_p.A748A|JMJD1C_uc009xpi.2_Silent_p.A748A|JMJD1C_uc009xpj.1_RNA|JMJD1C_uc009xpk.1_5'Flank	NM_032776	NP_116165	Q15652	JHD2C_HUMAN	jumonji domain containing 1C isoform a	930					blood coagulation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm	histone demethylase activity (H3-K9 specific)|metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|thyroid hormone receptor binding			ovary(4)|breast(1)|central_nervous_system(1)	6	Prostate(12;0.0119)|all_hematologic(501;0.191)																	---	---	---	---
CTNNA3	29119	broad.mit.edu	37	10	69407188	69407188	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69407188C>T	uc009xpn.1	-	2	207	c.84G>A	c.(82-84)GAG>GAA	p.E28E	CTNNA3_uc001jmw.2_Silent_p.E28E|CTNNA3_uc001jmx.3_Silent_p.E28E|CTNNA3_uc009xpo.1_5'UTR|CTNNA3_uc001jna.2_Silent_p.E40E	NM_001127384	NP_001120856	Q9UI47	CTNA3_HUMAN	catenin, alpha 3	28					cell-cell adhesion	actin cytoskeleton|cytoplasm|fascia adherens	cadherin binding|structural molecule activity			skin(3)|ovary(2)|pancreas(1)|lung(1)|central_nervous_system(1)	8																		---	---	---	---
ATOH7	220202	broad.mit.edu	37	10	69991318	69991318	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69991318C>T	uc001jnq.2	-	1	538	c.117G>A	c.(115-117)GCG>GCA	p.A39A		NM_145178	NP_660161	Q8N100	ATOH7_HUMAN	atonal homolog 7	39					cell differentiation|nervous system development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding				0																		---	---	---	---
H2AFY2	55506	broad.mit.edu	37	10	71851564	71851564	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:71851564C>T	uc001jqm.2	+	4	790	c.331C>T	c.(331-333)CCC>TCC	p.P111S	H2AFY2_uc001jqn.2_RNA	NM_018649	NP_061119	Q9P0M6	H2AW_HUMAN	H2A histone family, member Y2	111	Histone H2A.				chromatin modification|dosage compensation|nucleosome assembly	Barr body|nucleosome	DNA binding			skin(1)	1																		---	---	---	---
ADAMTS14	140766	broad.mit.edu	37	10	72511870	72511870	+	Silent	SNP	C	T	T	rs147720294		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72511870C>T	uc001jrh.2	+	18	2616	c.2616C>T	c.(2614-2616)TAC>TAT	p.Y872Y	ADAMTS14_uc001jrg.2_Silent_p.Y875Y	NM_080722	NP_542453	Q8WXS8	ATS14_HUMAN	ADAM metallopeptidase with thrombospondin type 1	872	TSP type-1 2.				collagen catabolic process|proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(5)|upper_aerodigestive_tract(1)	6																		---	---	---	---
ADAMTS14	140766	broad.mit.edu	37	10	72511949	72511949	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72511949C>T	uc001jrh.2	+	18	2695	c.2695C>T	c.(2695-2697)CGG>TGG	p.R899W	ADAMTS14_uc001jrg.2_Missense_Mutation_p.R902W	NM_080722	NP_542453	Q8WXS8	ATS14_HUMAN	ADAM metallopeptidase with thrombospondin type 1	899	TSP type-1 2.				collagen catabolic process|proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(5)|upper_aerodigestive_tract(1)	6																		---	---	---	---
UNC5B	219699	broad.mit.edu	37	10	73047450	73047450	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:73047450G>A	uc001jro.2	+	6	1274	c.829G>A	c.(829-831)GCT>ACT	p.A277T	UNC5B_uc001jrp.2_Missense_Mutation_p.A277T	NM_170744	NP_734465	Q8IZJ1	UNC5B_HUMAN	unc-5 homolog B precursor	277	TSP type-1 1.|Extracellular (Potential).				apoptosis|axon guidance|regulation of apoptosis	integral to membrane				ovary(2)|lung(1)	3																		---	---	---	---
DUPD1	338599	broad.mit.edu	37	10	76803595	76803595	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:76803595C>T	uc001jwq.1	-	2	381	c.381G>A	c.(379-381)CCG>CCA	p.P127P		NM_001003892	NP_001003892	Q68J44	DUPD1_HUMAN	dual specificity phosphatase and pro isomerase	127	Tyrosine-protein phosphatase.					cytoplasm	protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			ovary(2)	2	all_cancers(46;0.0207)|all_epithelial(25;0.00126)|Prostate(51;0.0112)|Ovarian(15;0.0348)																	---	---	---	---
MAT1A	4143	broad.mit.edu	37	10	82034359	82034359	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:82034359G>T	uc001kbw.2	-	8	1257	c.1002C>A	c.(1000-1002)ACC>ACA	p.T334T		NM_000429	NP_000420	Q00266	METK1_HUMAN	methionine adenosyltransferase I, alpha	334					methylation|S-adenosylmethionine biosynthetic process|xenobiotic metabolic process	cytosol	ATP binding|metal ion binding|methionine adenosyltransferase activity				0			Colorectal(32;0.229)		L-Methionine(DB00134)|S-Adenosylmethionine(DB00118)													---	---	---	---
MMRN2	79812	broad.mit.edu	37	10	88696544	88696544	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:88696544G>T	uc001kea.2	-	7	2933	c.2806C>A	c.(2806-2808)CTG>ATG	p.L936M	MMRN2_uc010qmn.1_Missense_Mutation_p.L579M	NM_024756	NP_079032	Q9H8L6	MMRN2_HUMAN	multimerin 2 precursor	936	C1q.					extracellular space				large_intestine(1)	1																		---	---	---	---
RNLS	55328	broad.mit.edu	37	10	90122398	90122398	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:90122398G>A	uc001kfe.2	-	5	746	c.611C>T	c.(610-612)ACG>ATG	p.T204M	RNLS_uc010qms.1_Missense_Mutation_p.T121M|RNLS_uc001kfd.2_Missense_Mutation_p.T204M|RNLS_uc009xtj.2_Missense_Mutation_p.T36M	NM_001031709	NP_001026879	Q5VYX0	RNLS_HUMAN	renalase isoform 1	204						extracellular region	oxidoreductase activity			ovary(1)	1																		---	---	---	---
ANKRD22	118932	broad.mit.edu	37	10	90582785	90582785	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:90582785G>A	uc001kfj.3	-							NM_144590	NP_653191			ankyrin repeat domain 22												0		Colorectal(252;0.0163)		Colorectal(12;6.29e-05)|COAD - Colon adenocarcinoma(12;7.69e-05)														---	---	---	---
PANK1	53354	broad.mit.edu	37	10	91353042	91353042	+	Missense_Mutation	SNP	G	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:91353042G>C	uc001kgp.1	-	5	1679	c.1523C>G	c.(1522-1524)TCC>TGC	p.S508C	PANK1_uc001kgn.1_Missense_Mutation_p.S283C|PANK1_uc001kgo.1_Missense_Mutation_p.S224C|PANK1_uc009xtu.1_Missense_Mutation_p.S310C|uc001kgq.1_5'Flank|MIR107_hsa-mir-107|MI0000114_5'Flank	NM_148977	NP_683878	Q8TE04	PANK1_HUMAN	pantothenate kinase 1 isoform alpha	508					coenzyme A biosynthetic process|pantothenate metabolic process	cytosol|nucleus	ATP binding|pantothenate kinase activity				0					Bezafibrate(DB01393)													---	---	---	---
PPP1R3C	5507	broad.mit.edu	37	10	93390388	93390388	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:93390388G>A	uc001kho.2	-	2	382	c.250C>T	c.(250-252)CGC>TGC	p.R84C		NM_005398	NP_005389	Q9UQK1	PPR3C_HUMAN	protein phosphatase 1, regulatory (inhibitor)	84							protein serine/threonine phosphatase activity			breast(1)	1		Colorectal(252;0.235)																---	---	---	---
PDE6C	5146	broad.mit.edu	37	10	95381733	95381733	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95381733T>C	uc001kiu.3	+	4	906	c.768T>C	c.(766-768)GAT>GAC	p.D256D		NM_006204	NP_006195	P51160	PDE6C_HUMAN	phosphodiesterase 6C	256	GAF 2.				visual perception	plasma membrane	3',5'-cyclic-GMP phosphodiesterase activity|cGMP binding|metal ion binding			ovary(2)|kidney(1)|skin(1)	4		Colorectal(252;0.123)																---	---	---	---
BLNK	29760	broad.mit.edu	37	10	97987263	97987263	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97987263G>A	uc001kls.3	-	5	442	c.264C>T	c.(262-264)GCC>GCT	p.A88A	BLNK_uc001kme.3_Silent_p.A6A|BLNK_uc001klt.3_Silent_p.A6A|BLNK_uc009xvc.2_Intron|BLNK_uc001klu.3_Silent_p.A6A|BLNK_uc001klv.3_Silent_p.A88A|BLNK_uc001klw.3_RNA|BLNK_uc001klx.3_Silent_p.A88A|BLNK_uc001kly.3_Silent_p.A88A|BLNK_uc001klz.3_RNA|BLNK_uc001kma.3_Silent_p.A88A|BLNK_uc001kmb.3_5'UTR|BLNK_uc001kmc.3_RNA|BLNK_uc001kmd.3_Silent_p.A6A|BLNK_uc009xvd.2_RNA	NM_013314	NP_037446	Q8WV28	BLNK_HUMAN	B-cell linker isoform 1	88					B cell differentiation|humoral immune response|inflammatory response|intracellular signal transduction	cytoplasm|plasma membrane	SH3/SH2 adaptor activity|transmembrane receptor protein tyrosine kinase adaptor activity			skin(2)	2		Colorectal(252;0.083)		Epithelial(162;7.89e-08)|all cancers(201;2.27e-06)														---	---	---	---
HPS1	3257	broad.mit.edu	37	10	100185361	100185361	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:100185361G>A	uc010qpf.1	-	13	1518	c.1272C>T	c.(1270-1272)CTC>CTT	p.L424L	HPS1_uc001kpi.1_Silent_p.L424L|HPS1_uc001kpj.1_Silent_p.L331L|HPS1_uc001kpk.1_Silent_p.L248L|HPS1_uc010qpg.1_Silent_p.L44L|HPS1_uc009xwb.2_RNA	NM_000195	NP_000186	Q92902	HPS1_HUMAN	Hermansky-Pudlak syndrome 1 protein isoform a	424					lysosome organization|response to stimulus|visual perception	cytoplasmic membrane-bounded vesicle|integral to plasma membrane|lysosome|membrane fraction|soluble fraction	protein dimerization activity			skin(1)	1		Colorectal(252;0.234)		Epithelial(162;3.87e-12)|all cancers(201;5.63e-10)										Hermansky-Pudlak_syndrome		OREG0020430	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
DNMBP	23268	broad.mit.edu	37	10	101639896	101639896	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101639896G>T	uc001kqj.2	-	16	4312	c.4220C>A	c.(4219-4221)TCT>TAT	p.S1407Y	DNMBP_uc010qpl.1_Missense_Mutation_p.S343Y|DNMBP_uc001kqg.2_Missense_Mutation_p.S695Y|DNMBP_uc001kqh.2_Missense_Mutation_p.S1039Y	NM_015221	NP_056036	Q6XZF7	DNMBP_HUMAN	dynamin binding protein	1407	Ser-rich.				intracellular signal transduction|regulation of Rho protein signal transduction	cell junction|cytoskeleton|Golgi stack|synapse	protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(5)|skin(1)	6		Colorectal(252;0.234)		Epithelial(162;2.94e-10)|all cancers(201;3.15e-08)														---	---	---	---
DNMBP	23268	broad.mit.edu	37	10	101643829	101643829	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101643829C>A	uc001kqj.2	-	15	4028	c.3936G>T	c.(3934-3936)GTG>GTT	p.V1312V	DNMBP_uc010qpl.1_Silent_p.V248V|DNMBP_uc001kqg.2_Silent_p.V600V|DNMBP_uc001kqh.2_Silent_p.V944V	NM_015221	NP_056036	Q6XZF7	DNMBP_HUMAN	dynamin binding protein	1312	SH3 5.				intracellular signal transduction|regulation of Rho protein signal transduction	cell junction|cytoskeleton|Golgi stack|synapse	protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(5)|skin(1)	6		Colorectal(252;0.234)		Epithelial(162;2.94e-10)|all cancers(201;3.15e-08)														---	---	---	---
HPS6	79803	broad.mit.edu	37	10	103826053	103826053	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:103826053C>A	uc001kuj.2	+	1	907	c.822C>A	c.(820-822)GCC>GCA	p.A274A		NM_024747	NP_079023	Q86YV9	HPS6_HUMAN	Hermansky-Pudlak syndrome-6	274						cytosol|early endosome membrane|endoplasmic reticulum|microsome					0		Colorectal(252;0.122)		Epithelial(162;5.93e-08)|all cancers(201;1.03e-06)										Hermansky-Pudlak_syndrome				---	---	---	---
TDRD1	56165	broad.mit.edu	37	10	115981158	115981158	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:115981158T>C	uc001lbg.1	+	20	2966	c.2813T>C	c.(2812-2814)GTG>GCG	p.V938A	TDRD1_uc001lbf.2_Missense_Mutation_p.V815A|TDRD1_uc001lbh.1_Missense_Mutation_p.V925A|TDRD1_uc001lbi.1_Missense_Mutation_p.V929A|TDRD1_uc010qsc.1_Missense_Mutation_p.V542A|TDRD1_uc001lbj.2_Missense_Mutation_p.V647A	NM_198795	NP_942090	Q9BXT4	TDRD1_HUMAN	tudor domain containing 1	938					DNA methylation involved in gamete generation|gene silencing by RNA|germ cell development|meiosis|multicellular organismal development|piRNA metabolic process|spermatogenesis	pi-body	nucleic acid binding|protein binding|zinc ion binding				0		Colorectal(252;0.172)|Breast(234;0.188)		Epithelial(162;0.0343)|all cancers(201;0.0754)														---	---	---	---
GFRA1	2674	broad.mit.edu	37	10	118030602	118030602	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118030602G>A	uc001lcj.2	-	3	764	c.66C>T	c.(64-66)AGC>AGT	p.S22S	GFRA1_uc001lci.2_Silent_p.S22S|GFRA1_uc009xyr.2_Silent_p.S22S	NM_005264	NP_005255	P56159	GFRA1_HUMAN	GDNF family receptor alpha 1 isoform a	22					axon guidance	anchored to membrane|extrinsic to membrane|plasma membrane	glial cell-derived neurotrophic factor receptor activity			ovary(1)|pancreas(1)	2		Lung NSC(174;0.21)		all cancers(201;0.0337)														---	---	---	---
C10orf46	143384	broad.mit.edu	37	10	120460856	120460856	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:120460856G>A	uc001lds.1	-	5	1242	c.758C>T	c.(757-759)ACG>ATG	p.T253M	C10orf46_uc010qst.1_RNA	NM_153810	NP_722517	Q86Y37	CJ046_HUMAN	chromosome 10 open reading frame 46	253					ubiquitin-dependent protein catabolic process	cullin-RING ubiquitin ligase complex	ubiquitin protein ligase binding				0		Lung NSC(174;0.142)|all_lung(145;0.175)		all cancers(201;0.0131)														---	---	---	---
PRDX3	10935	broad.mit.edu	37	10	120928781	120928781	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:120928781C>T	uc001lec.2	-	6	668	c.625G>A	c.(625-627)GTG>ATG	p.V209M		NM_006793	NP_006784	P30048	PRDX3_HUMAN	peroxiredoxin 3 isoform a precursor	209	Thioredoxin.				cell redox homeostasis|hydrogen peroxide catabolic process|mitochondrion organization|myeloid cell differentiation|negative regulation of kinase activity|positive regulation of cell proliferation|positive regulation of NF-kappaB transcription factor activity|regulation of mitochondrial membrane potential|response to lipopolysaccharide	early endosome|mitochondrion	alkyl hydroperoxide reductase activity|caspase inhibitor activity|peroxidase activity|peroxiredoxin activity|protein C-terminus binding|protein kinase binding				0		Lung NSC(174;0.094)|all_lung(145;0.123)		all cancers(201;0.0245)														---	---	---	---
CPXM2	119587	broad.mit.edu	37	10	125601919	125601919	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:125601919C>T	uc001lhk.1	-	4	924	c.599G>A	c.(598-600)CGG>CAG	p.R200Q	CPXM2_uc001lhj.2_RNA	NM_198148	NP_937791	Q8N436	CPXM2_HUMAN	carboxypeptidase X (M14 family), member 2	200	F5/8 type C.				cell adhesion|proteolysis	extracellular space	metallocarboxypeptidase activity|zinc ion binding			ovary(2)	2		all_lung(145;0.174)|Colorectal(57;0.178)|Glioma(114;0.222)|all_neural(114;0.226)|Lung NSC(174;0.233)		COAD - Colon adenocarcinoma(40;0.212)|Colorectal(40;0.237)														---	---	---	---
CHST15	51363	broad.mit.edu	37	10	125805706	125805706	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:125805706C>T	uc001lhl.2	-	1	536	c.23G>A	c.(22-24)TGC>TAC	p.C8Y	CHST15_uc001lhm.2_Missense_Mutation_p.C8Y|CHST15_uc001lhn.2_Missense_Mutation_p.C8Y|CHST15_uc010que.1_Missense_Mutation_p.C8Y|CHST15_uc001lho.2_Missense_Mutation_p.C8Y	NM_015892	NP_056976	Q7LFX5	CHSTF_HUMAN	B cell RAG associated protein	8	Cytoplasmic (Potential).				hexose biosynthetic process	Golgi membrane|integral to membrane	3'-phosphoadenosine 5'-phosphosulfate binding|N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity			ovary(1)	1																		---	---	---	---
LHPP	64077	broad.mit.edu	37	10	126172753	126172753	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:126172753G>A	uc001lhs.1	+	2	191	c.171G>A	c.(169-171)TCG>TCA	p.S57S	LHPP_uc001lht.1_Silent_p.S57S|LHPP_uc009yai.1_Silent_p.S57S	NM_022126	NP_071409	Q9H008	LHPP_HUMAN	phospholysine phosphohistidine inorganic	57					protein dephosphorylation	cytosol|nucleus	inorganic diphosphatase activity|magnesium ion binding|phosphohistidine phosphatase activity|protein homodimerization activity				0		all_lung(145;0.174)|Colorectal(57;0.178)|Glioma(114;0.222)|all_neural(114;0.226)|Lung NSC(174;0.233)		COAD - Colon adenocarcinoma(40;0.163)|Colorectal(40;0.187)														---	---	---	---
C10orf137	26098	broad.mit.edu	37	10	127436239	127436239	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:127436239G>A	uc001liq.1	+	20	3242	c.2949G>A	c.(2947-2949)CCG>CCA	p.P983P	C10orf137_uc001lin.2_Silent_p.P949P|C10orf137_uc001lio.1_Silent_p.P949P|C10orf137_uc001lip.1_Silent_p.P687P|C10orf137_uc001lis.1_Silent_p.P309P|C10orf137_uc001lit.1_5'Flank	NM_015608	NP_056423	Q3B7T1	EDRF1_HUMAN	erythroid differentiation-related factor 1	983					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	binding			ovary(5)|large_intestine(3)|lung(2)	10		all_lung(145;0.0096)|Lung NSC(174;0.0145)|Colorectal(57;0.0846)|all_neural(114;0.0936)																---	---	---	---
FAM196A	642938	broad.mit.edu	37	10	128974523	128974523	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:128974523T>C	uc001lju.1	-	1	178	c.137A>G	c.(136-138)CAG>CGG	p.Q46R	DOCK1_uc001ljt.2_Intron|DOCK1_uc010qun.1_Intron|FAM196A_uc010quo.1_Missense_Mutation_p.Q46R|FAM196A_uc001ljv.1_Missense_Mutation_p.Q46R|FAM196A_uc009yap.1_Missense_Mutation_p.Q46R	NM_001039762	NP_001034851	Q6ZSG2	F196A_HUMAN	hypothetical protein LOC642938	46										ovary(2)	2																		---	---	---	---
CLRN3	119467	broad.mit.edu	37	10	129676427	129676427	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:129676427C>T	uc001lka.1	-	3	830	c.667G>A	c.(667-669)GGA>AGA	p.G223R	CLRN3_uc001ljz.1_Missense_Mutation_p.G155R	NM_152311	NP_689524	Q8NCR9	CLRN3_HUMAN	clarin 3	223						integral to membrane				skin(1)	1		all_epithelial(44;0.00168)|all_lung(145;0.0586)|Lung NSC(174;0.0765)|all_neural(114;0.201)|Glioma(114;0.222)|Colorectal(57;0.235)																---	---	---	---
MKI67	4288	broad.mit.edu	37	10	129904057	129904057	+	Missense_Mutation	SNP	C	T	T	rs150525316		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:129904057C>T	uc001lke.2	-	13	6242	c.6047G>A	c.(6046-6048)GGC>GAC	p.G2016D	MKI67_uc001lkf.2_Missense_Mutation_p.G1656D|MKI67_uc009yav.1_Missense_Mutation_p.G1591D|MKI67_uc009yaw.1_Missense_Mutation_p.G1166D	NM_002417	NP_002408	P46013	KI67_HUMAN	antigen identified by monoclonal antibody Ki-67	2016	16 X 122 AA approximate repeats.|9.				cell proliferation	nucleolus	ATP binding|protein C-terminus binding			ovary(4)|central_nervous_system(2)|skin(1)	7		all_epithelial(44;2.12e-05)|all_lung(145;0.00679)|Lung NSC(174;0.00998)|all_neural(114;0.0936)|Colorectal(57;0.14)|Breast(234;0.166)|Melanoma(40;0.203)																---	---	---	---
KNDC1	85442	broad.mit.edu	37	10	134996942	134996942	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:134996942C>T	uc001llz.1	+	4	456	c.455C>T	c.(454-456)GCG>GTG	p.A152V	KNDC1_uc001lma.1_Missense_Mutation_p.A87V	NM_152643	NP_689856	Q76NI1	VKIND_HUMAN	kinase non-catalytic C-lobe domain (KIND)	152	KIND 1.				regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction					upper_aerodigestive_tract(1)|ovary(1)	2		all_cancers(35;4.16e-10)|all_epithelial(44;2.07e-08)|Lung NSC(174;0.000845)|all_lung(145;0.00145)|all_neural(114;0.0299)|Melanoma(40;0.123)|Colorectal(31;0.173)|Glioma(114;0.203)		OV - Ovarian serous cystadenocarcinoma(35;8.77e-06)|Epithelial(32;1.13e-05)|all cancers(32;1.51e-05)														---	---	---	---
KNDC1	85442	broad.mit.edu	37	10	135026413	135026413	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:135026413C>T	uc001llz.1	+	24	4431	c.4430C>T	c.(4429-4431)ACG>ATG	p.T1477M		NM_152643	NP_689856	Q76NI1	VKIND_HUMAN	kinase non-catalytic C-lobe domain (KIND)	1477	Ras-GEF.				regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction					upper_aerodigestive_tract(1)|ovary(1)	2		all_cancers(35;4.16e-10)|all_epithelial(44;2.07e-08)|Lung NSC(174;0.000845)|all_lung(145;0.00145)|all_neural(114;0.0299)|Melanoma(40;0.123)|Colorectal(31;0.173)|Glioma(114;0.203)		OV - Ovarian serous cystadenocarcinoma(35;8.77e-06)|Epithelial(32;1.13e-05)|all cancers(32;1.51e-05)														---	---	---	---
RIC8A	60626	broad.mit.edu	37	11	214277	214277	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:214277C>T	uc001log.2	+	10	1848	c.1523C>T	c.(1522-1524)ACG>ATG	p.T508M	RIC8A_uc001lof.2_Missense_Mutation_p.T514M|RIC8A_uc001loh.2_Missense_Mutation_p.T501M	NM_021932	NP_068751	Q9NPQ8	RIC8A_HUMAN	resistance to inhibitors of cholinesterase 8	508						cytoplasm|plasma membrane	guanyl-nucleotide exchange factor activity				0		all_cancers(49;9.23e-07)|all_epithelial(84;0.000315)|Breast(177;0.00122)|Ovarian(85;0.0202)|Medulloblastoma(188;0.0321)|all_neural(188;0.0762)		all cancers(45;4.45e-27)|Epithelial(43;2.94e-26)|OV - Ovarian serous cystadenocarcinoma(40;5.86e-21)|BRCA - Breast invasive adenocarcinoma(625;3.57e-05)|Lung(200;0.105)|LUSC - Lung squamous cell carcinoma(625;0.122)														---	---	---	---
RIC8A	60626	broad.mit.edu	37	11	214326	214326	+	Silent	SNP	G	A	A	rs144729121	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:214326G>A	uc001log.2	+	10	1897	c.1572G>A	c.(1570-1572)TCG>TCA	p.S524S	RIC8A_uc001lof.2_Silent_p.S530S|RIC8A_uc001loh.2_Silent_p.S517S	NM_021932	NP_068751	Q9NPQ8	RIC8A_HUMAN	resistance to inhibitors of cholinesterase 8	524						cytoplasm|plasma membrane	guanyl-nucleotide exchange factor activity				0		all_cancers(49;9.23e-07)|all_epithelial(84;0.000315)|Breast(177;0.00122)|Ovarian(85;0.0202)|Medulloblastoma(188;0.0321)|all_neural(188;0.0762)		all cancers(45;4.45e-27)|Epithelial(43;2.94e-26)|OV - Ovarian serous cystadenocarcinoma(40;5.86e-21)|BRCA - Breast invasive adenocarcinoma(625;3.57e-05)|Lung(200;0.105)|LUSC - Lung squamous cell carcinoma(625;0.122)														---	---	---	---
CEND1	51286	broad.mit.edu	37	11	788202	788202	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:788202C>T	uc001lrh.1	-	2	554	c.375G>A	c.(373-375)CTG>CTA	p.L125L		NM_016564	NP_057648	Q8N111	CEND_HUMAN	cell cycle exit and neuronal differentiation 1	125	Cytoplasmic (Potential).					integral to membrane					0		all_cancers(49;1.13e-08)|all_epithelial(84;2.95e-05)|Breast(177;0.000286)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.159)|all_lung(207;0.198)		all cancers(45;6.27e-26)|Epithelial(43;4.84e-25)|OV - Ovarian serous cystadenocarcinoma(40;2.72e-19)|BRCA - Breast invasive adenocarcinoma(625;4.23e-05)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)														---	---	---	---
MUC6	4588	broad.mit.edu	37	11	1016104	1016104	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1016104C>T	uc001lsw.2	-	31	6748	c.6697G>A	c.(6697-6699)GTG>ATG	p.V2233M		NM_005961	NP_005952	Q6W4X9	MUC6_HUMAN	mucin 6, gastric	2233	Ser-rich.|Thr-rich.				maintenance of gastrointestinal epithelium	extracellular region	extracellular matrix structural constituent			ovary(1)	1		all_cancers(49;3.3e-08)|all_epithelial(84;5.08e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		all cancers(45;1.24e-24)|BRCA - Breast invasive adenocarcinoma(625;0.00031)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)														---	---	---	---
MUC6	4588	broad.mit.edu	37	11	1025025	1025025	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1025025G>A	uc001lsw.2	-	24	3095	c.3044C>T	c.(3043-3045)ACG>ATG	p.T1015M		NM_005961	NP_005952	Q6W4X9	MUC6_HUMAN	mucin 6, gastric	1015	VWFD 3.				maintenance of gastrointestinal epithelium	extracellular region	extracellular matrix structural constituent			ovary(1)	1		all_cancers(49;3.3e-08)|all_epithelial(84;5.08e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		all cancers(45;1.24e-24)|BRCA - Breast invasive adenocarcinoma(625;0.00031)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)														---	---	---	---
MUC2	4583	broad.mit.edu	37	11	1090915	1090915	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1090915C>A	uc001lsx.1	+	28	3837	c.3810C>A	c.(3808-3810)ACC>ACA	p.T1270T		NM_002457	NP_002448	Q02817	MUC2_HUMAN	mucin 2 precursor	1270						inner mucus layer|outer mucus layer	protein binding			lung(1)|breast(1)	2		all_cancers(49;1.08e-07)|all_epithelial(84;5.08e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.191)		BRCA - Breast invasive adenocarcinoma(625;0.000207)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)	Pranlukast(DB01411)													---	---	---	---
TNNI2	7136	broad.mit.edu	37	11	1862321	1862321	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1862321C>T	uc010qxe.1	+	5	359	c.337C>T	c.(337-339)CGG>TGG	p.R113W	TNNI2_uc010qxc.1_Missense_Mutation_p.R111W|TNNI2_uc010qxd.1_Missense_Mutation_p.R111W	NM_001145841	NP_001139313	P48788	TNNI2_HUMAN	fast-twitch skeletal muscle troponin I isoform	113	Involved in binding TNC and actin.				muscle filament sliding|positive regulation of transcription, DNA-dependent|skeletal muscle contraction	cytosol|nucleus|troponin complex	actin binding|troponin T binding				0		all_epithelial(84;0.000138)|Breast(177;0.000962)|Ovarian(85;0.0014)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		BRCA - Breast invasive adenocarcinoma(625;0.00136)|Lung(200;0.0681)|LUSC - Lung squamous cell carcinoma(625;0.082)														---	---	---	---
CD81	975	broad.mit.edu	37	11	2415337	2415337	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:2415337T>G	uc001lwf.1	+	3	427	c.194T>G	c.(193-195)CTC>CGC	p.L65R	CD81_uc001lwg.1_Missense_Mutation_p.L58R|CD81_uc001lwh.1_5'Flank	NM_004356	NP_004347	P60033	CD81_HUMAN	CD81 antigen	65	Helical; (Potential).				activation of MAPK activity|cell proliferation|phosphatidylinositol biosynthetic process|positive regulation of 1-phosphatidylinositol 4-kinase activity|positive regulation of cell proliferation|positive regulation of peptidyl-tyrosine phosphorylation|protein localization|regulation of immune response|virion attachment, binding of host cell surface receptor	integral to plasma membrane	protein binding				0		all_epithelial(84;0.000161)|Breast(177;0.000962)|Medulloblastoma(188;0.00106)|Ovarian(85;0.0014)|all_neural(188;0.0137)|Lung NSC(207;0.209)		BRCA - Breast invasive adenocarcinoma(625;0.000338)|LUSC - Lung squamous cell carcinoma(625;0.191)														---	---	---	---
KCNQ1	3784	broad.mit.edu	37	11	2798261	2798261	+	Silent	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:2798261A>C	uc001lwn.2	+	14	1839	c.1731A>C	c.(1729-1731)TCA>TCC	p.S577S	KCNQ1_uc009ydp.1_Silent_p.S361S|KCNQ1_uc001lwo.2_Silent_p.S450S	NM_000218	NP_000209	P51787	KCNQ1_HUMAN	potassium voltage-gated channel, KQT-like	577	Cytoplasmic (Potential).				blood circulation|membrane depolarization|muscle contraction|sensory perception of sound		delayed rectifier potassium channel activity|protein binding			ovary(1)	1		all_epithelial(84;3.26e-05)|Breast(177;0.001)|Medulloblastoma(188;0.00111)|Ovarian(85;0.00158)|all_neural(188;0.00725)|all_lung(207;0.11)|Lung NSC(207;0.159)		BRCA - Breast invasive adenocarcinoma(625;0.00251)|Lung(200;0.131)	Bepridil(DB01244)|Indapamide(DB00808)													---	---	---	---
MRGPRE	116534	broad.mit.edu	37	11	3249839	3249839	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:3249839T>C	uc001lxq.3	-	2	498	c.188A>G	c.(187-189)GAC>GGC	p.D63G		NM_001039165	NP_001034254	Q86SM8	MRGRE_HUMAN	MAS-related GPR, member E	63	Helical; Name=2; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			large_intestine(1)|ovary(1)	2		Medulloblastoma(188;0.00106)|all_epithelial(84;0.00111)|Breast(177;0.00328)|Ovarian(85;0.00556)|all_neural(188;0.00681)		BRCA - Breast invasive adenocarcinoma(625;0.00529)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---
OR51I1	390063	broad.mit.edu	37	11	5461995	5461995	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5461995C>T	uc010qze.1	-	1	750	c.750G>A	c.(748-750)GTG>GTA	p.V250V	HBG2_uc001mak.1_Intron|HBE1_uc001mam.1_Intron|OR51B5_uc001maq.1_Intron	NM_001005288	NP_001005288	Q9H343	O51I1_HUMAN	olfactory receptor, family 51, subfamily I,	250	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Medulloblastoma(188;0.0075)|all_neural(188;0.0572)|Breast(177;0.0675)		Epithelial(150;1.92e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---
OR52E8	390079	broad.mit.edu	37	11	5878912	5878912	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5878912C>T	uc010qzr.1	-	1	21	c.21G>A	c.(19-21)ACG>ACA	p.T7T	TRIM5_uc001mbq.1_Intron	NM_001005168	NP_001005168	Q6IFG1	O52E8_HUMAN	olfactory receptor, family 52, subfamily E,	7	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2		Medulloblastoma(188;0.0075)|all_neural(188;0.0577)|Breast(177;0.114)		Epithelial(150;2.37e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---
TRIM3	10612	broad.mit.edu	37	11	6477697	6477697	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6477697C>T	uc001mdh.2	-	7	1646	c.1259G>A	c.(1258-1260)CGT>CAT	p.R420H	TRIM3_uc001mdi.2_Missense_Mutation_p.R420H|TRIM3_uc010raj.1_Missense_Mutation_p.R301H|TRIM3_uc009yfd.2_Missense_Mutation_p.R420H|TRIM3_uc010rak.1_Missense_Mutation_p.R420H|TRIM3_uc001mdj.2_Missense_Mutation_p.R301H	NM_006458	NP_006449	O75382	TRIM3_HUMAN	tripartite motif-containing 3	420					nervous system development|protein transport	early endosome	protein C-terminus binding|zinc ion binding			central_nervous_system(2)|large_intestine(1)|ovary(1)|skin(1)	5		all_lung(207;9.97e-06)|Lung NSC(207;1.74e-05)|Medulloblastoma(188;0.00225)|Breast(177;0.0204)|all_neural(188;0.0212)		Epithelial(150;9.34e-10)|Lung(200;0.0234)|LUSC - Lung squamous cell carcinoma(625;0.133)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---
NLRP14	338323	broad.mit.edu	37	11	7065142	7065142	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:7065142C>T	uc001mfb.1	+	4	2208	c.1885C>T	c.(1885-1887)CGG>TGG	p.R629W		NM_176822	NP_789792	Q86W24	NAL14_HUMAN	NLR family, pyrin domain containing 14	629					cell differentiation|multicellular organismal development|spermatogenesis		ATP binding			ovary(3)|breast(2)|pancreas(1)|lung(1)|skin(1)	8				Epithelial(150;4.62e-08)|BRCA - Breast invasive adenocarcinoma(625;0.0871)														---	---	---	---
LMO1	4004	broad.mit.edu	37	11	8248584	8248584	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:8248584C>T	uc001mgg.1	-	3	800	c.303G>A	c.(301-303)GTG>GTA	p.V101V	LMO1_uc009yfo.1_RNA|LMO1_uc001mgh.1_Silent_p.V100V	NM_002315	NP_002306	P25800	RBTN1_HUMAN	LIM domain only 1	101	LIM zinc-binding 2.				cell proliferation|multicellular organismal development|positive regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding transcription factor activity|zinc ion binding				0				Epithelial(150;1.59e-07)|BRCA - Breast invasive adenocarcinoma(625;0.203)				T|A	TRD@	T-ALL|neuroblastoma	neuroblastoma							---	---	---	---
SWAP70	23075	broad.mit.edu	37	11	9746422	9746422	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:9746422T>C	uc001mhw.2	+	4	731	c.632T>C	c.(631-633)GTG>GCG	p.V211A	SWAP70_uc001mhv.2_Missense_Mutation_p.V211A|SWAP70_uc001mhx.2_Missense_Mutation_p.V153A	NM_015055	NP_055870	Q9UH65	SWP70_HUMAN	SWAP-70 protein	211	PH.					cytoplasm|lamellipodium|nucleus|plasma membrane	calcium ion binding|DNA binding			ovary(2)|central_nervous_system(1)	3				all cancers(16;1.21e-10)|Epithelial(150;2.81e-09)|BRCA - Breast invasive adenocarcinoma(625;0.00649)														---	---	---	---
CALCA	796	broad.mit.edu	37	11	14991505	14991505	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:14991505T>A	uc001mlt.1	-	3	278	c.203A>T	c.(202-204)CAG>CTG	p.Q68L	CALCA_uc001mlu.1_RNA|CALCA_uc001mlv.1_Missense_Mutation_p.Q68L|CALCA_uc001mlw.1_Missense_Mutation_p.Q68L	NM_001033953	NP_001029125	P06881	CALCA_HUMAN	calcitonin isoform CGRP preproprotein	68					activation of adenylate cyclase activity|cell-cell signaling|elevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger|endothelial cell migration|endothelial cell proliferation|leukocyte cell-cell adhesion|negative regulation of blood pressure|negative regulation of bone resorption|negative regulation of calcium ion transport into cytosol|negative regulation of osteoclast differentiation|neurological system process involved in regulation of systemic arterial blood pressure|positive regulation of interleukin-1 alpha production|positive regulation of interleukin-8 production|positive regulation of macrophage differentiation|positive regulation of vasodilation|regulation of blood pressure|vasculature development|vasodilation	cytosol|extracellular space	hormone activity			central_nervous_system(1)	1					Phentolamine(DB00692)											OREG0020791	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
SOX6	55553	broad.mit.edu	37	11	16071413	16071413	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:16071413C>T	uc001mme.2	-	11	1395	c.1362G>A	c.(1360-1362)ACG>ACA	p.T454T	SOX6_uc001mmd.2_Silent_p.T403T|SOX6_uc001mmf.2_Silent_p.T400T|SOX6_uc001mmg.2_Silent_p.T441T	NM_001145819	NP_001139291	P35712	SOX6_HUMAN	SRY (sex determining region Y)-box 6 isoform 4	441					muscle organ development	nucleus	sequence-specific DNA binding transcription factor activity			ovary(3)	3																		---	---	---	---
KCNC1	3746	broad.mit.edu	37	11	17793913	17793913	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17793913C>T	uc001mnk.3	+	2	1327	c.1272C>T	c.(1270-1272)GGC>GGT	p.G424G	KCNC1_uc009yhc.1_Silent_p.G424G	NM_004976	NP_004967	P48547	KCNC1_HUMAN	Shaw-related voltage-gated potassium channel	424	Helical; Name=Segment S6; (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity			upper_aerodigestive_tract(1)	1																		---	---	---	---
LDHC	3948	broad.mit.edu	37	11	18436832	18436832	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:18436832G>T	uc001mon.3	+	3	340	c.228G>T	c.(226-228)AAG>AAT	p.K76N	LDHC_uc001mom.3_Missense_Mutation_p.K76N|LDHC_uc009yhp.2_Missense_Mutation_p.K76N|LDHC_uc001moo.3_Intron|LDHC_uc009yhq.2_Intron|LDHC_uc009yhr.2_Intron	NM_017448	NP_059144	P07864	LDHC_HUMAN	L-lactate dehydrogenase C	76					glycolysis	cytoplasm	binding|L-lactate dehydrogenase activity				0					NADH(DB00157)													---	---	---	---
LIN7C	55327	broad.mit.edu	37	11	27520241	27520241	+	Silent	SNP	C	T	T	rs146421701		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:27520241C>T	uc001mrl.2	-	5	576	c.549G>A	c.(547-549)TCG>TCA	p.S183S	LIN7C_uc009yii.2_Silent_p.S159S	NM_018362	NP_060832	Q9NUP9	LIN7C_HUMAN	lin-7 homolog C	183					exocytosis|protein transport	basolateral plasma membrane|postsynaptic density|postsynaptic membrane|synaptosome|tight junction					0																		---	---	---	---
Unknown	0	broad.mit.edu	37	11	31086113	31086113	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31086113G>T	uc009yjk.1	-	8	907	c.838C>A	c.(838-840)CAT>AAT	p.H280N	uc009yjl.1_Missense_Mutation_p.H208N|DCDC1_uc001msu.1_Missense_Mutation_p.H451N					RecName: Full=Doublecortin domain-containing protein 5;																														---	---	---	---
ELP4	26610	broad.mit.edu	37	11	31625347	31625347	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31625347C>T	uc001mtb.2	+	5	581	c.546C>T	c.(544-546)CAC>CAT	p.H182H	ELP4_uc001mta.1_RNA|ELP4_uc001mtc.2_Silent_p.H182H|ELP4_uc010rdz.1_Silent_p.H183H	NM_019040	NP_061913	Q96EB1	ELP4_HUMAN	elongation protein 4 homolog	182					histone acetylation|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	cytoplasm|DNA-directed RNA polymerase II, holoenzyme|Elongator holoenzyme complex|transcription elongation factor complex	phosphorylase kinase regulator activity|protein binding			upper_aerodigestive_tract(1)|ovary(1)|prostate(1)	3	Lung SC(675;0.225)																	---	---	---	---
CHRM4	1132	broad.mit.edu	37	11	46407572	46407572	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46407572G>A	uc001nct.1	-	1	536	c.536C>T	c.(535-537)ACG>ATG	p.T179M		NM_000741	NP_000732	P08173	ACM4_HUMAN	cholinergic receptor, muscarinic 4	179	Extracellular (By similarity).				cell proliferation	cell junction|integral to plasma membrane|postsynaptic membrane	muscarinic acetylcholine receptor activity				0				GBM - Glioblastoma multiforme(35;0.0254)|Lung(87;0.14)	Atropine(DB00572)|Benzquinamide(DB00767)|Cryptenamine(DB00785)|Homatropine Methylbromide(DB00725)|Methotrimeprazine(DB01403)|Metixene(DB00340)|Olanzapine(DB00334)|Procyclidine(DB00387)|Promazine(DB00420)|Promethazine(DB01069)|Propiomazine(DB00777)|Thiethylperazine(DB00372)|Tropicamide(DB00809)													---	---	---	---
AMBRA1	55626	broad.mit.edu	37	11	46419425	46419425	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46419425C>A	uc010rgu.1	-	18	3832	c.3472G>T	c.(3472-3474)GGC>TGC	p.G1158C	AMBRA1_uc010rgt.1_3'UTR|AMBRA1_uc009ylc.1_Missense_Mutation_p.G1129C|AMBRA1_uc001ncu.1_Missense_Mutation_p.G1068C|AMBRA1_uc001ncv.2_Missense_Mutation_p.G1161C|AMBRA1_uc001ncw.2_Missense_Mutation_p.G1039C|AMBRA1_uc001ncx.2_Missense_Mutation_p.G1098C	NM_017749	NP_060219	Q9C0C7	AMRA1_HUMAN	activating molecule in beclin-1-regulated	1158					autophagy|cell differentiation|nervous system development	autophagic vacuole|cytoplasmic vesicle				large_intestine(1)|ovary(1)|central_nervous_system(1)	3				GBM - Glioblastoma multiforme(35;0.0435)|Lung(87;0.182)														---	---	---	---
MTCH2	23788	broad.mit.edu	37	11	47640459	47640459	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47640459G>A	uc010rho.1	-	13	1027	c.838C>T	c.(838-840)CGA>TGA	p.R280*	MTCH2_uc001nge.2_Nonsense_Mutation_p.R153*|MTCH2_uc010rhp.1_Nonsense_Mutation_p.R132*	NM_014342	NP_055157	Q9Y6C9	MTCH2_HUMAN	mitochondrial carrier 2	280					transport	integral to membrane|mitochondrial inner membrane					0																		---	---	---	---
AGBL2	79841	broad.mit.edu	37	11	47732033	47732033	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47732033G>A	uc001ngg.2	-	3	228	c.128C>T	c.(127-129)ACG>ATG	p.T43M	AGBL2_uc010rhq.1_Missense_Mutation_p.T43M|AGBL2_uc001ngh.1_Missense_Mutation_p.T43M	NM_024783	NP_079059	Q5U5Z8	CBPC2_HUMAN	carboxypeptidase 2, cytosolic	43					proteolysis	cytosol	metallocarboxypeptidase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
OR4B1	119765	broad.mit.edu	37	11	48238570	48238570	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48238570G>A	uc010rhs.1	+	1	209	c.209G>A	c.(208-210)AGT>AAT	p.S70N		NM_001005470	NP_001005470	Q8NGF8	OR4B1_HUMAN	olfactory receptor, family 4, subfamily B,	70	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)|pancreas(1)	4																		---	---	---	---
OR4X1	390113	broad.mit.edu	37	11	48286188	48286188	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48286188C>A	uc010rht.1	+	1	776	c.776C>A	c.(775-777)CCC>CAC	p.P259H		NM_001004726	NP_001004726	Q8NH49	OR4X1_HUMAN	olfactory receptor, family 4, subfamily X,	259	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3																		---	---	---	---
TRIM48	79097	broad.mit.edu	37	11	55035844	55035844	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55035844T>C	uc010rid.1	+	4	660	c.574T>C	c.(574-576)TAC>CAC	p.Y192H		NM_024114	NP_077019	Q8IWZ4	TRI48_HUMAN	tripartite motif-containing 48	176						intracellular	zinc ion binding				0																		---	---	---	---
OR5R1	219479	broad.mit.edu	37	11	56184864	56184864	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56184864A>G	uc010rji.1	-	1	845	c.845T>C	c.(844-846)ATC>ACC	p.I282T		NM_001004744	NP_001004744	Q8NH85	OR5R1_HUMAN	olfactory receptor, family 5, subfamily R,	282	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00448)																	---	---	---	---
TNKS1BP1	85456	broad.mit.edu	37	11	57088081	57088081	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57088081G>T	uc001njr.2	-	2	512	c.200C>A	c.(199-201)CCT>CAT	p.P67H	TNKS1BP1_uc001njs.2_Missense_Mutation_p.P67H|TNKS1BP1_uc009ymd.1_5'UTR	NM_033396	NP_203754	Q9C0C2	TB182_HUMAN	tankyrase 1-binding protein 1	67	Arg/Glu/Lys/Pro-rich (charged).				nuclear-transcribed mRNA poly(A) tail shortening|telomere maintenance via telomerase	cytoskeleton|cytosol|nuclear telomeric heterochromatin	ankyrin binding|enzyme binding			skin(1)	1		all_epithelial(135;0.21)																---	---	---	---
SLC43A1	8501	broad.mit.edu	37	11	57263584	57263584	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57263584G>A	uc001nkk.2	-	7	730	c.612C>T	c.(610-612)GGC>GGT	p.G204G	SLC43A1_uc001nkl.2_Silent_p.G204G	NM_003627	NP_003618	O75387	LAT3_HUMAN	solute carrier family 43, member 1	204	Helical; (Potential).				cellular nitrogen compound metabolic process|ion transport	integral to plasma membrane	neutral amino acid transmembrane transporter activity				0																		---	---	---	---
ZDHHC5	25921	broad.mit.edu	37	11	57460087	57460087	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57460087C>T	uc001nkx.1	+	7	1921	c.665C>T	c.(664-666)ACG>ATG	p.T222M	ZDHHC5_uc001nky.1_Missense_Mutation_p.T169M|ZDHHC5_uc001nkz.1_Missense_Mutation_p.T36M	NM_015457	NP_056272	Q9C0B5	ZDHC5_HUMAN	zinc finger, DHHC domain containing 5	222						integral to membrane	acyltransferase activity|zinc ion binding			skin(1)	1																		---	---	---	---
OR10Q1	219960	broad.mit.edu	37	11	57995632	57995632	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57995632C>T	uc010rkd.1	-	1	716	c.716G>A	c.(715-717)CGC>CAC	p.R239H		NM_001004471	NP_001004471	Q8NGQ4	O10Q1_HUMAN	olfactory receptor, family 10, subfamily Q,	239	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2		Breast(21;0.0589)																---	---	---	---
OR10Q1	219960	broad.mit.edu	37	11	57996170	57996170	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57996170G>A	uc010rkd.1	-	1	178	c.178C>T	c.(178-180)CGC>TGC	p.R60C		NM_001004471	NP_001004471	Q8NGQ4	O10Q1_HUMAN	olfactory receptor, family 10, subfamily Q,	60	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2		Breast(21;0.0589)																---	---	---	---
ASRGL1	80150	broad.mit.edu	37	11	62156702	62156702	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62156702G>A	uc001nte.3	+	5	873	c.589G>A	c.(589-591)GTT>ATT	p.V197I	ASRGL1_uc001ntf.3_Missense_Mutation_p.V197I|ASRGL1_uc001ntg.3_Missense_Mutation_p.V69I	NM_025080	NP_079356	Q7L266	ASGL1_HUMAN	asparaginase-like 1	197					asparagine catabolic process via L-aspartate|protein maturation	cytoplasm|microtubule cytoskeleton|nucleus	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity				0					L-Asparagine(DB00174)|L-Aspartic Acid(DB00128)													---	---	---	---
AHNAK	79026	broad.mit.edu	37	11	62284598	62284598	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62284598G>A	uc001ntl.2	-	5	17591	c.17291C>T	c.(17290-17292)CCG>CTG	p.P5764L	AHNAK_uc001ntk.1_Intron	NM_001620	NP_001611	Q09666	AHNK_HUMAN	AHNAK nucleoprotein isoform 1	5764					nervous system development	nucleus	protein binding			ovary(10)|pancreas(4)|skin(4)|upper_aerodigestive_tract(1)	19		Melanoma(852;0.155)																---	---	---	---
ATL3	25923	broad.mit.edu	37	11	63414021	63414021	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63414021G>A	uc001nxk.1	-	6	852	c.576C>T	c.(574-576)TAC>TAT	p.Y192Y	ATL3_uc010rms.1_Silent_p.Y174Y	NM_015459	NP_056274	Q6DD88	ATLA3_HUMAN	atlastin 3	192	Cytoplasmic.				endoplasmic reticulum organization|Golgi organization|protein homooligomerization	endoplasmic reticulum membrane|integral to membrane	GTP binding|GTPase activity|identical protein binding			pancreas(1)	1																		---	---	---	---
C11orf84	144097	broad.mit.edu	37	11	63585406	63585406	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63585406G>A	uc001nxt.2	+	2	493	c.257G>A	c.(256-258)AGC>AAC	p.S86N		NM_138471	NP_612480	Q9BUA3	CK084_HUMAN	hypothetical protein LOC144097	86											0																		---	---	---	---
PPP2R5B	5526	broad.mit.edu	37	11	64697985	64697985	+	Missense_Mutation	SNP	C	T	T	rs147891521	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64697985C>T	uc001oby.2	+	8	1400	c.815C>T	c.(814-816)ACG>ATG	p.T272M	PPP2R5B_uc001obz.2_Missense_Mutation_p.T272M	NM_006244	NP_006235	Q15173	2A5B_HUMAN	beta isoform of regulatory subunit B56, protein	272					signal transduction	cytoplasm|protein phosphatase type 2A complex	protein binding|protein phosphatase type 2A regulator activity			ovary(2)	2																		---	---	---	---
SLC25A45	283130	broad.mit.edu	37	11	65144509	65144509	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65144509C>A	uc001odp.1	-	5	800	c.378G>T	c.(376-378)CGG>CGT	p.R126R	SLC25A45_uc009yqi.1_Silent_p.R64R|SLC25A45_uc001odq.1_Silent_p.R102R|SLC25A45_uc001odr.1_Silent_p.R126R|SLC25A45_uc001ods.1_Silent_p.R84R|SLC25A45_uc001odt.1_Silent_p.R84R	NM_001077241	NP_001070709	Q8N413	S2545_HUMAN	solute carrier family 25, member 45 isoform b	126	Solcar 2.				transmembrane transport	integral to membrane|mitochondrial inner membrane	binding				0																		---	---	---	---
MAP3K11	4296	broad.mit.edu	37	11	65365885	65365885	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65365885C>T	uc001oew.2	-	10	2914	c.2421G>A	c.(2419-2421)CCG>CCA	p.P807P	KCNK7_uc001oeq.2_5'Flank|KCNK7_uc001oer.2_5'Flank|KCNK7_uc001oes.2_5'Flank|KCNK7_uc001oeu.2_5'Flank|MAP3K11_uc001oev.2_Silent_p.P223P|MAP3K11_uc010rol.1_Silent_p.P550P|MAP3K11_uc001oex.1_Silent_p.P296P	NM_002419	NP_002410	Q16584	M3K11_HUMAN	mitogen-activated protein kinase kinase kinase	807	Pro-rich.				activation of JUN kinase activity|cell proliferation|G1 phase of mitotic cell cycle|microtubule-based process|positive regulation of JNK cascade|protein autophosphorylation	centrosome|microtubule	ATP binding|JUN kinase kinase kinase activity|mitogen-activated protein kinase kinase kinase binding|protein homodimerization activity			breast(3)|lung(1)|central_nervous_system(1)|skin(1)	6																		---	---	---	---
PCNXL3	399909	broad.mit.edu	37	11	65390989	65390989	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65390989C>T	uc001oey.2	+	12	2385	c.2385C>T	c.(2383-2385)TTC>TTT	p.F795F	PCNXL3_uc009yqn.2_5'Flank	NM_032223	NP_115599	Q9H6A9	PCX3_HUMAN	pecanex-like 3	795	Helical; (Potential).					integral to membrane					0																		---	---	---	---
CTSF	8722	broad.mit.edu	37	11	66331420	66331420	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66331420G>A	uc001oip.2	-	13	1529	c.1439C>T	c.(1438-1440)TCG>TTG	p.S480L		NM_003793	NP_003784	Q9UBX1	CATF_HUMAN	cathepsin F precursor	480				SDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAV VD -> EFRCLSCIQPGHRQGWDHSISGPLEGK (in Ref. 9).	proteolysis	lysosome	cysteine-type endopeptidase activity				0																		---	---	---	---
RBM14	10432	broad.mit.edu	37	11	66392099	66392099	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66392099C>T	uc001oit.2	+	2	891	c.752C>T	c.(751-753)GCC>GTC	p.A251V	RBM14_uc009yrh.2_Intron|RBM14_uc009yri.2_Intron|RBM4_uc009yrj.2_Intron|RBM4_uc009yrk.2_Intron	NM_006328	NP_006319	Q96PK6	RBM14_HUMAN	RNA binding motif protein 14	251	Ala-rich.				DNA recombination|DNA repair|DNA replication|estrogen receptor signaling pathway|glucocorticoid receptor signaling pathway|histone deacetylation|positive regulation of transcription from RNA polymerase II promoter|response to hormone stimulus	mediator complex|ribonucleoprotein complex|transcription factor complex	ligand-dependent nuclear receptor transcription coactivator activity|nucleotide binding|protein binding, bridging|RNA binding|RNA polymerase II transcription cofactor activity			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
ADRBK1	156	broad.mit.edu	37	11	67051854	67051854	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67051854G>A	uc009yrn.1	+						ADRBK1_uc009yrm.1_Intron	NM_001619	NP_001610			beta-adrenergic receptor kinase 1						activation of phospholipase C activity|cardiac muscle contraction|desensitization of G-protein coupled receptor protein signaling pathway|muscarinic acetylcholine receptor signaling pathway|negative regulation of striated muscle contraction|negative regulation of the force of heart contraction by chemical signal|nerve growth factor receptor signaling pathway|peptidyl-serine phosphorylation|positive regulation of catecholamine secretion|tachykinin receptor signaling pathway	cytosol|soluble fraction	alpha-2A adrenergic receptor binding|ATP binding|beta-adrenergic receptor kinase activity|Edg-2 lysophosphatidic acid receptor binding|G-protein coupled receptor kinase activity|signal transducer activity			large_intestine(1)	1			BRCA - Breast invasive adenocarcinoma(15;2.26e-06)		Adenosine triphosphate(DB00171)													---	---	---	---
ANKRD13D	338692	broad.mit.edu	37	11	67068991	67068991	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67068991G>A	uc001okc.1	+	14	1631	c.1120G>A	c.(1120-1122)GTG>ATG	p.V374M	ANKRD13D_uc001okd.1_Missense_Mutation_p.V461M|ANKRD13D_uc001oke.1_Missense_Mutation_p.V374M|ANKRD13D_uc001okg.1_Missense_Mutation_p.V157M|ANKRD13D_uc001okh.1_Missense_Mutation_p.V157M|ANKRD13D_uc001oki.1_Missense_Mutation_p.V111M|SSH3_uc001okj.2_5'Flank|SSH3_uc001okk.2_5'Flank|SSH3_uc001okl.2_5'Flank	NM_207354	NP_997237	Q6ZTN6	AN13D_HUMAN	ankyrin repeat domain 13 family, member D	374										ovary(1)	1			BRCA - Breast invasive adenocarcinoma(15;2.26e-06)															---	---	---	---
NDUFV1	4723	broad.mit.edu	37	11	67379380	67379380	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67379380A>G	uc001omj.2	+	8	1246	c.1093A>G	c.(1093-1095)AAA>GAA	p.K365E	NDUFV1_uc010rpv.1_Missense_Mutation_p.K264E|NDUFV1_uc001oml.2_Missense_Mutation_p.K358E|NDUFV1_uc001omk.3_Missense_Mutation_p.K356E|NDUFV1_uc009yrz.1_Missense_Mutation_p.E224G|NDUFV1_uc010rpw.1_Missense_Mutation_p.K74E	NM_007103	NP_009034	P49821	NDUV1_HUMAN	NADH dehydrogenase ubiquinone flavoprotein 1	365					mitochondrial electron transport, NADH to ubiquinone|transport	mitochondrial respiratory chain complex I	4 iron, 4 sulfur cluster binding|FMN binding|metal ion binding|NAD binding|NADH dehydrogenase (ubiquinone) activity			skin(1)	1					NADH(DB00157)													---	---	---	---
ANO1	55107	broad.mit.edu	37	11	70009435	70009435	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70009435C>T	uc001opj.2	+	19	2244	c.1939C>T	c.(1939-1941)CGA>TGA	p.R647*	ANO1_uc001opk.1_Nonsense_Mutation_p.R589*|ANO1_uc001opl.1_RNA|ANO1_uc010rqk.1_Nonsense_Mutation_p.R356*	NM_018043	NP_060513	Q5XXA6	ANO1_HUMAN	anoctamin 1, calcium activated chloride channel	647	Extracellular (Potential).				multicellular organismal development	chloride channel complex|cytoplasm|plasma membrane	intracellular calcium activated chloride channel activity			ovary(1)|pancreas(1)	2																		---	---	---	---
INPPL1	3636	broad.mit.edu	37	11	71939254	71939254	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:71939254C>T	uc001osf.2	+	2	350	c.203C>T	c.(202-204)ACG>ATG	p.T68M	INPPL1_uc001osg.2_Translation_Start_Site	NM_001567	NP_001558	O15357	SHIP2_HUMAN	inositol polyphosphate phosphatase-like 1	68	SH2.				actin filament organization|cell adhesion|endocytosis	actin cortical patch|cytosol	actin binding|SH2 domain binding|SH3 domain binding			skin(2)|ovary(1)|breast(1)	4																		---	---	---	---
PDE2A	5138	broad.mit.edu	37	11	72290399	72290399	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72290399C>A	uc010rrc.1	-	27	2528	c.2285G>T	c.(2284-2286)CGG>CTG	p.R762L	PDE2A_uc001oso.2_Missense_Mutation_p.R741L|PDE2A_uc010rra.1_Missense_Mutation_p.R755L|PDE2A_uc001osn.2_Missense_Mutation_p.R506L|PDE2A_uc010rrb.1_Missense_Mutation_p.R753L|PDE2A_uc010rrd.1_Missense_Mutation_p.R647L	NM_002599	NP_002590	O00408	PDE2A_HUMAN	phosphodiesterase 2A isoform 1	762	Catalytic (By similarity).				platelet activation|signal transduction	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|3',5'-cyclic-GMP phosphodiesterase activity|cGMP binding|cGMP-stimulated cyclic-nucleotide phosphodiesterase activity|metal ion binding			ovary(2)|breast(1)|skin(1)	4			BRCA - Breast invasive adenocarcinoma(5;3.55e-05)		Sildenafil(DB00203)|Sulindac(DB00605)													---	---	---	---
PDE2A	5138	broad.mit.edu	37	11	72295930	72295930	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72295930C>T	uc010rrc.1	-	17	1588	c.1345G>A	c.(1345-1347)GTG>ATG	p.V449M	PDE2A_uc001oso.2_Missense_Mutation_p.V428M|PDE2A_uc010rra.1_Missense_Mutation_p.V442M|PDE2A_uc001osn.2_Missense_Mutation_p.V193M|PDE2A_uc010rrb.1_Missense_Mutation_p.V440M|PDE2A_uc010rrd.1_Missense_Mutation_p.V334M	NM_002599	NP_002590	O00408	PDE2A_HUMAN	phosphodiesterase 2A isoform 1	449	GAF 2.				platelet activation|signal transduction	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|3',5'-cyclic-GMP phosphodiesterase activity|cGMP binding|cGMP-stimulated cyclic-nucleotide phosphodiesterase activity|metal ion binding			ovary(2)|breast(1)|skin(1)	4			BRCA - Breast invasive adenocarcinoma(5;3.55e-05)		Sildenafil(DB00203)|Sulindac(DB00605)													---	---	---	---
CHRDL2	25884	broad.mit.edu	37	11	74441890	74441890	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:74441890G>A	uc001ovi.2	-	1	297	c.44C>T	c.(43-45)GCG>GTG	p.A15V	CHRDL2_uc001ovh.2_Missense_Mutation_p.A15V|CHRDL2_uc001ovk.1_Missense_Mutation_p.A15V			Q6WN34	CRDL2_HUMAN	RecName: Full=Chordin-like protein 2; AltName: Full=Chordin-related protein 2; AltName: Full=Breast tumor novel factor 1;          Short=BNF-1; Flags: Precursor;	15					cartilage development|cell differentiation|ossification	extracellular region|mitochondrion					0	Hepatocellular(1;0.098)																	---	---	---	---
MAP6	4135	broad.mit.edu	37	11	75379314	75379314	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:75379314G>A	uc001owu.2	-	1	166	c.101C>T	c.(100-102)TCG>TTG	p.S34L	MAP6_uc001owv.2_Missense_Mutation_p.S34L	NM_033063	NP_149052	Q96JE9	MAP6_HUMAN	microtubule-associated protein 6 isoform 1	34						Golgi apparatus|microtubule|perinuclear region of cytoplasm	calmodulin binding				0	Ovarian(111;0.11)																	---	---	---	---
USP35	57558	broad.mit.edu	37	11	77921181	77921181	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:77921181C>T	uc009yva.1	+	10	2526	c.2280C>T	c.(2278-2280)TCC>TCT	p.S760S	USP35_uc001oze.2_Silent_p.S516S|USP35_uc001ozc.2_Silent_p.S328S|USP35_uc010rsp.1_Silent_p.S192S|USP35_uc001ozd.2_Silent_p.S371S|USP35_uc001ozf.2_Silent_p.S491S	NM_020798	NP_065849	Q9P2H5	UBP35_HUMAN	ubiquitin specific protease 35	760					ubiquitin-dependent protein catabolic process		binding|cysteine-type peptidase activity|ubiquitin thiolesterase activity			lung(2)|ovary(1)	3	all_cancers(14;3.77e-18)|all_epithelial(13;6.16e-21)|Breast(9;5.6e-16)|Ovarian(111;0.152)		OV - Ovarian serous cystadenocarcinoma(8;1.04e-25)															---	---	---	---
PCF11	51585	broad.mit.edu	37	11	82877374	82877374	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:82877374C>T	uc001ozx.3	+	5	1780	c.1435C>T	c.(1435-1437)CGA>TGA	p.R479*	PCF11_uc010rsu.1_Nonsense_Mutation_p.R479*	NM_015885	NP_056969	O94913	PCF11_HUMAN	pre-mRNA cleavage complex II protein Pcf11	479					mRNA 3'-end processing|mRNA cleavage|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	mRNA cleavage factor complex				ovary(1)	1																		---	---	---	---
DLG2	1740	broad.mit.edu	37	11	83770433	83770433	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:83770433C>T	uc001paj.2	-	6	832	c.529G>A	c.(529-531)GTT>ATT	p.V177I	DLG2_uc001pai.2_Missense_Mutation_p.V126I|DLG2_uc010rsy.1_Missense_Mutation_p.V144I|DLG2_uc010rsz.1_Missense_Mutation_p.V177I|DLG2_uc010rta.1_Missense_Mutation_p.V177I|DLG2_uc001pak.2_Missense_Mutation_p.V282I|DLG2_uc010rtb.1_Missense_Mutation_p.V144I|DLG2_uc001pal.1_Missense_Mutation_p.V177I|DLG2_uc001pam.1_Missense_Mutation_p.V216I	NM_001364	NP_001355	Q15700	DLG2_HUMAN	chapsyn-110 isoform 2	177	PDZ 1.			V -> A (in Ref. 1; AAB04949).		cell junction|postsynaptic density|postsynaptic membrane	guanylate kinase activity|protein binding|protein binding			ovary(3)|pancreas(2)|skin(1)	6		all_cancers(6;0.00791)|Acute lymphoblastic leukemia(157;4.44e-05)|all_hematologic(158;0.0036)																---	---	---	---
GRM5	2915	broad.mit.edu	37	11	88780735	88780735	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:88780735C>T	uc001pcq.2	-	1	506	c.306G>A	c.(304-306)TCG>TCA	p.S102S	GRM5_uc009yvm.2_Silent_p.S102S|GRM5_uc009yvn.1_Silent_p.S102S	NM_001143831	NP_001137303	P41594	GRM5_HUMAN	glutamate receptor, metabotropic 5 isoform a	102	Extracellular (Potential).				activation of phospholipase C activity by metabotropic glutamate receptor signaling pathway|synaptic transmission	integral to plasma membrane	G-protein coupled receptor activity|glutamate receptor activity			central_nervous_system(4)|ovary(2)|lung(2)|breast(1)	9		Acute lymphoblastic leukemia(157;2.54e-05)|all_hematologic(158;0.00834)			Acamprosate(DB00659)													---	---	---	---
FAT3	120114	broad.mit.edu	37	11	92533495	92533495	+	Missense_Mutation	SNP	G	A	A	rs149993900	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92533495G>A	uc001pdj.3	+	9	7333	c.7316G>A	c.(7315-7317)CGG>CAG	p.R2439Q		NM_001008781	NP_001008781	Q8TDW7	FAT3_HUMAN	FAT tumor suppressor homolog 3	2439	Cadherin 22.|Extracellular (Potential).				homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|pancreas(1)	5		Acute lymphoblastic leukemia(157;3.01e-05)|all_hematologic(158;0.00858)													TCGA Ovarian(4;0.039)			---	---	---	---
FAT3	120114	broad.mit.edu	37	11	92613994	92613994	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92613994C>T	uc001pdj.3	+	22	12242	c.12225C>T	c.(12223-12225)TGC>TGT	p.C4075C	FAT3_uc001pdi.3_Silent_p.C515C	NM_001008781	NP_001008781	Q8TDW7	FAT3_HUMAN	FAT tumor suppressor homolog 3	4075	EGF-like 3.|Extracellular (Potential).				homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|pancreas(1)	5		Acute lymphoblastic leukemia(157;3.01e-05)|all_hematologic(158;0.00858)													TCGA Ovarian(4;0.039)			---	---	---	---
CCDC82	79780	broad.mit.edu	37	11	96117864	96117864	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:96117864G>A	uc009ywp.2	-	1	291	c.48C>T	c.(46-48)CAC>CAT	p.H16H	CCDC82_uc009ywq.2_Silent_p.H16H|CCDC82_uc001pfx.3_Silent_p.H16H|CCDC82_uc009ywr.2_Silent_p.H16H|CCDC82_uc009yws.2_Silent_p.H16H	NM_024725	NP_079001	Q8N4S0	CCD82_HUMAN	coiled-coil domain containing 82	16							protein binding			ovary(1)	1		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.0123)		BRCA - Breast invasive adenocarcinoma(274;0.154)														---	---	---	---
KIAA1377	57562	broad.mit.edu	37	11	101786106	101786106	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:101786106C>T	uc001pgm.2	+	1	361	c.91C>T	c.(91-93)CGG>TGG	p.R31W	ANGPTL5_uc001pgl.2_Intron	NM_020802	NP_065853	Q9P2H0	K1377_HUMAN	hypothetical protein LOC57562	31							protein binding			breast(2)|ovary(1)|central_nervous_system(1)	4	all_epithelial(12;0.0104)	Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.00931)		BRCA - Breast invasive adenocarcinoma(274;0.038)														---	---	---	---
PIH1D2	120379	broad.mit.edu	37	11	111941920	111941920	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:111941920T>C	uc001pmq.3	-	4	471	c.389A>G	c.(388-390)CAG>CGG	p.Q130R	PIH1D2_uc009yyl.2_Missense_Mutation_p.Q130R|PIH1D2_uc001pmp.3_Missense_Mutation_p.Q130R|PIH1D2_uc010rws.1_Missense_Mutation_p.Q130R	NM_138789	NP_620144	Q8WWB5	PIHD2_HUMAN	PIH1 domain containing 2 isoform 1	130										ovary(1)	1		all_cancers(61;1.09e-14)|all_epithelial(67;7.64e-09)|Melanoma(852;1.91e-06)|all_hematologic(158;0.000405)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0112)|all_neural(223;0.0281)|Medulloblastoma(222;0.0425)		Epithelial(105;3.19e-07)|BRCA - Breast invasive adenocarcinoma(274;6.17e-07)|all cancers(92;6.18e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.0508)														---	---	---	---
APOA4	337	broad.mit.edu	37	11	116691981	116691981	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:116691981G>A	uc001pps.1	-	3	897	c.793C>T	c.(793-795)CAG>TAG	p.Q265*		NM_000482	NP_000473			apolipoprotein A-IV precursor												0	all_hematologic(175;0.0487)	Breast(348;0.0126)|Medulloblastoma(222;0.0425)|all_hematologic(158;0.0564)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;8.54e-06)|Epithelial(105;1.62e-05)|all cancers(92;0.000165)|OV - Ovarian serous cystadenocarcinoma(223;0.148)														---	---	---	---
BACE1	23621	broad.mit.edu	37	11	117186283	117186283	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:117186283C>T	uc001pqz.2	-	1	690	c.229G>A	c.(229-231)GTG>ATG	p.V77M	BACE1_uc001pqw.2_Missense_Mutation_p.V77M|BACE1_uc001pqx.2_Missense_Mutation_p.V77M|BACE1_uc001pqy.2_Missense_Mutation_p.V77M|BACE1_uc001pra.1_Missense_Mutation_p.V77M	NM_012104	NP_036236	P56817	BACE1_HUMAN	beta-site APP-cleaving enzyme 1 isoform A	77	Extracellular (Potential).				beta-amyloid metabolic process|membrane protein ectodomain proteolysis	cell surface|cytoplasmic vesicle membrane|endoplasmic reticulum|endosome|integral to plasma membrane|trans-Golgi network	aspartic-type endopeptidase activity|beta-aspartyl-peptidase activity|protein binding			ovary(1)	1	all_hematologic(175;0.0487)	Breast(348;0.00908)|Medulloblastoma(222;0.0425)|all_hematologic(192;0.196)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;1.69e-05)|Epithelial(105;0.000563)|all cancers(92;0.0032)														---	---	---	---
DSCAML1	57453	broad.mit.edu	37	11	117387410	117387410	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:117387410C>T	uc001prh.1	-	8	1737	c.1735G>A	c.(1735-1737)GGG>AGG	p.G579R		NM_020693	NP_065744	Q8TD84	DSCL1_HUMAN	Down syndrome cell adhesion molecule like 1	519	Extracellular (Potential).|Ig-like C2-type 6.				axonogenesis|brain development|cell fate determination|dorsal/ventral pattern formation|embryonic skeletal system morphogenesis|homophilic cell adhesion	cell surface|integral to membrane|plasma membrane	protein homodimerization activity			ovary(3)|large_intestine(2)|skin(2)|upper_aerodigestive_tract(1)	8	all_hematologic(175;0.0487)	Breast(348;0.0424)|Medulloblastoma(222;0.0523)|all_hematologic(192;0.232)		BRCA - Breast invasive adenocarcinoma(274;9.12e-06)|Epithelial(105;0.00172)														---	---	---	---
DSCAML1	57453	broad.mit.edu	37	11	117651423	117651423	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:117651423G>A	uc001prh.1	-	2	331	c.329C>T	c.(328-330)GCG>GTG	p.A110V	DSCAML1_uc001pri.1_5'UTR	NM_020693	NP_065744	Q8TD84	DSCL1_HUMAN	Down syndrome cell adhesion molecule like 1	50	Extracellular (Potential).|Ig-like C2-type 1.				axonogenesis|brain development|cell fate determination|dorsal/ventral pattern formation|embryonic skeletal system morphogenesis|homophilic cell adhesion	cell surface|integral to membrane|plasma membrane	protein homodimerization activity			ovary(3)|large_intestine(2)|skin(2)|upper_aerodigestive_tract(1)	8	all_hematologic(175;0.0487)	Breast(348;0.0424)|Medulloblastoma(222;0.0523)|all_hematologic(192;0.232)		BRCA - Breast invasive adenocarcinoma(274;9.12e-06)|Epithelial(105;0.00172)														---	---	---	---
ATP5L	10632	broad.mit.edu	37	11	118279806	118279806	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118279806A>G	uc001psx.2	+	3	582	c.305A>G	c.(304-306)GAT>GGT	p.D102G		NM_006476	NP_006467	O75964	ATP5L_HUMAN	ATP synthase, H+ transporting, mitochondrial F0	102					ATP catabolic process|respiratory electron transport chain	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	hydrogen ion transmembrane transporter activity|protein binding				0	all_hematologic(175;0.046)	Medulloblastoma(222;0.0425)|Breast(348;0.181)|all_hematologic(192;0.196)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;3.07e-05)														---	---	---	---
PHLDB1	23187	broad.mit.edu	37	11	118499199	118499199	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118499199C>A	uc001ptr.1	+	7	2013	c.1660C>A	c.(1660-1662)CAG>AAG	p.Q554K	PHLDB1_uc001pts.2_Missense_Mutation_p.Q554K|PHLDB1_uc001ptt.2_Missense_Mutation_p.Q554K|PHLDB1_uc001ptu.1_Intron|PHLDB1_uc001ptv.1_Missense_Mutation_p.Q354K|PHLDB1_uc001ptw.1_5'Flank	NM_015157	NP_055972	Q86UU1	PHLB1_HUMAN	pleckstrin homology-like domain, family B,	554											0	all_hematologic(175;0.0839)	Medulloblastoma(222;0.0523)|all_hematologic(192;0.0735)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;3.4e-05)														---	---	---	---
DPAGT1	1798	broad.mit.edu	37	11	118972197	118972197	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118972197C>T	uc001pvi.2	-						DPAGT1_uc001pvj.2_Intron|DPAGT1_uc009zaq.2_Intron|DPAGT1_uc001pvk.2_5'UTR|DPAGT1_uc010ryz.1_Intron|DPAGT1_uc001pvm.1_5'Flank|DPAGT1_uc010rza.1_Intron	NM_001382	NP_001373			UDP-N-acetylglucosamine-dolichyl-phosphate						dolichol biosynthetic process|dolichol-linked oligosaccharide biosynthetic process|post-translational protein modification|protein N-linked glycosylation via asparagine|protein oligomerization	integral to endoplasmic reticulum membrane|microsome	phospho-N-acetylmuramoyl-pentapeptide-transferase activity|transferase activity, transferring glycosyl groups|UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase activity			breast(2)|ovary(1)	3	all_hematologic(175;0.0977)	Medulloblastoma(222;0.0425)|Breast(348;0.052)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;7.55e-05)												OREG0021396	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PDZD3	79849	broad.mit.edu	37	11	119058114	119058114	+	Missense_Mutation	SNP	C	T	T	rs140060249		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:119058114C>T	uc001pwb.2	+	3	1188	c.664C>T	c.(664-666)CGG>TGG	p.R222W	PDZD3_uc001pvy.2_Missense_Mutation_p.R156W|PDZD3_uc001pvz.2_Missense_Mutation_p.R156W|PDZD3_uc010rzd.1_Missense_Mutation_p.R143W|PDZD3_uc001pwa.2_5'UTR			Q86UT5	NHRF4_HUMAN	RecName: Full=Na(+)/H(+) exchange regulatory cofactor NHE-RF4;          Short=NHERF-4; AltName: Full=PDZ domain-containing protein 3; AltName: Full=PDZ domain-containing protein 2; AltName: Full=Intestinal and kidney-enriched PDZ protein; AltName: Full=Sodium-hydrogen exchanger regulatory factor 4;	222					cGMP-mediated signaling|ion transport|negative regulation of cGMP biosynthetic process|response to toxin|water transport	apical part of cell|brush border|cytosol|membrane fraction|subapical complex	guanylate cyclase inhibitor activity|ion channel inhibitor activity|protein C-terminus binding			breast(1)	1	all_hematologic(175;0.0977)	Medulloblastoma(222;0.0523)|Breast(348;0.174)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;7.52e-05)														---	---	---	---
MFRP	83552	broad.mit.edu	37	11	119210257	119210257	+	3'UTR	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:119210257G>A	uc001pwj.2	-	15					MFRP_uc010rzf.1_Intron	NM_031433	NP_113621			membrane frizzled-related protein							collagen					0		Medulloblastoma(222;0.0523)|Breast(348;0.174)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;3.84e-05)														---	---	---	---
TRIM29	23650	broad.mit.edu	37	11	120008304	120008304	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:120008304C>T	uc001pwz.2	-	1	560	c.436G>A	c.(436-438)GGG>AGG	p.G146R	TRIM29_uc001pxa.2_RNA	NM_012101	NP_036233	Q14134	TRI29_HUMAN	tripartite motif protein TRIM29	146					transcription from RNA polymerase II promoter	cytoplasm	protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|breast(1)|kidney(1)|skin(1)	4		Breast(109;0.00117)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;5.37e-06)														---	---	---	---
ARHGEF12	23365	broad.mit.edu	37	11	120350842	120350842	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:120350842C>T	uc001pxl.1	+	38	3947	c.3940C>T	c.(3940-3942)CCC>TCC	p.P1314S	ARHGEF12_uc009zat.2_Missense_Mutation_p.P1295S|ARHGEF12_uc009zau.1_Missense_Mutation_p.P1211S	NM_015313	NP_056128	Q9NZN5	ARHGC_HUMAN	Rho guanine nucleotide exchange factor (GEF) 12	1314					apoptosis|axon guidance|G-protein coupled receptor protein signaling pathway|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|membrane	G-protein-coupled receptor binding|GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			lung(2)|breast(2)|skin(2)|ovary(1)	7		Breast(109;0.000813)|Medulloblastoma(222;0.0425)|Hepatocellular(160;0.0831)|all_hematologic(192;0.107)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.231)				T	MLL	AML								---	---	---	---
GRIK4	2900	broad.mit.edu	37	11	120827592	120827592	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:120827592G>A	uc001pxn.2	+	16	2091	c.1804G>A	c.(1804-1806)GGG>AGG	p.G602R	GRIK4_uc009zav.1_Missense_Mutation_p.G602R|GRIK4_uc009zaw.1_Missense_Mutation_p.G602R|GRIK4_uc009zax.1_Missense_Mutation_p.G602R	NM_014619	NP_055434	Q16099	GRIK4_HUMAN	glutamate receptor KA1 precursor	602	Cytoplasmic (Potential).				glutamate signaling pathway|synaptic transmission	cell junction|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|kainate selective glutamate receptor activity			ovary(2)|central_nervous_system(1)	3		Breast(109;0.000868)|Medulloblastoma(222;0.0453)|all_neural(223;0.116)|all_hematologic(192;0.21)		BRCA - Breast invasive adenocarcinoma(274;1.24e-05)|OV - Ovarian serous cystadenocarcinoma(223;0.116)	L-Glutamic Acid(DB00142)													---	---	---	---
UBASH3B	84959	broad.mit.edu	37	11	122678801	122678801	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:122678801G>A	uc001pyi.3	+	13	2089	c.1729G>A	c.(1729-1731)GCA>ACA	p.A577T		NM_032873	NP_116262	Q8TF42	UBS3B_HUMAN	ubiquitin associated and SH3 domain containing,	577	Protein tyrosine phosphatase (By similarity).					cytoplasm|nucleus	protein tyrosine phosphatase activity			central_nervous_system(1)	1		Breast(109;0.00254)|Medulloblastoma(222;0.00877)|Lung NSC(97;0.0183)|all_lung(97;0.0186)|all_neural(223;0.0381)|all_hematologic(192;0.104)		BRCA - Breast invasive adenocarcinoma(274;1.37e-05)|OV - Ovarian serous cystadenocarcinoma(99;0.0463)														---	---	---	---
BSX	390259	broad.mit.edu	37	11	122848490	122848490	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:122848490C>T	uc010rzs.1	-	3	569	c.569G>A	c.(568-570)CGC>CAC	p.R190H		NM_001098169	NP_001091639	Q3C1V8	BSH_HUMAN	brain specific homeobox	190											0		Breast(109;0.00249)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0361)														---	---	---	---
NRGN	4900	broad.mit.edu	37	11	124615423	124615423	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124615423G>A	uc001qaq.2	+	2	192	c.40G>A	c.(40-42)GAC>AAC	p.D14N	NRGN_uc001qar.2_Missense_Mutation_p.D14N	NM_006176	NP_006167	Q92686	NEUG_HUMAN	neurogranin	14					nervous system development|signal transduction		calmodulin binding				0	all_hematologic(175;0.215)	Breast(109;0.00109)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.49e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0214)														---	---	---	---
VSIG2	23584	broad.mit.edu	37	11	124618378	124618378	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124618378C>T	uc001qas.2	-	6	835	c.759G>A	c.(757-759)GTG>GTA	p.V253V	VSIG2_uc001qat.2_Silent_p.V253V	NM_014312	NP_055127	Q96IQ7	VSIG2_HUMAN	V-set and immunoglobulin domain containing 2	253	Helical; (Potential).					integral to plasma membrane|membrane fraction				ovary(3)|central_nervous_system(1)	4	all_hematologic(175;0.215)	Breast(109;0.00663)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;1.49e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0215)														---	---	---	---
NFRKB	4798	broad.mit.edu	37	11	129754773	129754773	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:129754773C>T	uc001qfi.2	-						NFRKB_uc001qfg.2_Silent_p.T228T|NFRKB_uc001qfh.2_Intron|NFRKB_uc010sbw.1_Silent_p.T215T	NM_001143835	NP_001137307			nuclear factor related to kappaB binding protein						DNA recombination|DNA repair|inflammatory response|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	Ino80 complex	DNA binding|protease binding			ovary(3)	3	all_hematologic(175;0.0537)	Breast(109;0.00526)|Lung NSC(97;0.00901)|all_lung(97;0.018)|Medulloblastoma(222;0.0523)|all_neural(223;0.186)		OV - Ovarian serous cystadenocarcinoma(99;0.0167)|Lung(977;0.171)|LUSC - Lung squamous cell carcinoma(976;0.184)														---	---	---	---
ADAMTS8	11095	broad.mit.edu	37	11	130275467	130275467	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:130275467G>A	uc001qgg.3	-	9	3014	c.2656C>T	c.(2656-2658)CTG>TTG	p.L886L	ADAMTS8_uc001qgf.2_Silent_p.L367L	NM_007037	NP_008968	Q9UP79	ATS8_HUMAN	ADAM metallopeptidase with thrombospondin type 1	886	TSP type-1 2.				negative regulation of cell proliferation|proteolysis	proteinaceous extracellular matrix	heparin binding|integrin binding|low affinity phosphate transmembrane transporter activity|metalloendopeptidase activity|zinc ion binding			central_nervous_system(1)	1	all_hematologic(175;0.0429)	Lung NSC(97;0.000601)|Breast(109;0.000962)|all_lung(97;0.00125)|Medulloblastoma(222;0.0425)|all_neural(223;0.0837)		OV - Ovarian serous cystadenocarcinoma(99;0.039)|Lung(977;0.213)														---	---	---	---
NCAPD3	23310	broad.mit.edu	37	11	134051038	134051038	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:134051038G>A	uc001qhd.1	-	20	3099	c.2493C>T	c.(2491-2493)TGC>TGT	p.C831C	NCAPD3_uc010scm.1_RNA|NCAPD3_uc009zda.1_RNA	NM_015261	NP_056076	P42695	CNDD3_HUMAN	non-SMC condensin II complex, subunit D3	831					cell division|mitotic chromosome condensation	nuclear centromeric heterochromatin|nuclear condensin complex	methylated histone residue binding			ovary(2)|upper_aerodigestive_tract(1)|lung(1)|kidney(1)	5	all_hematologic(175;0.127)	all_cancers(12;1.68e-21)|all_epithelial(12;5.86e-16)|all_lung(97;1.19e-05)|Lung NSC(97;2.76e-05)|Breast(109;0.000182)|Medulloblastoma(222;0.0245)|all_neural(223;0.0505)|Esophageal squamous(93;0.0559)		Epithelial(10;8.74e-10)|BRCA - Breast invasive adenocarcinoma(10;1e-08)|all cancers(11;1.46e-08)|OV - Ovarian serous cystadenocarcinoma(99;0.00345)|Lung(977;0.227)														---	---	---	---
GLB1L2	89944	broad.mit.edu	37	11	134212846	134212846	+	Splice_Site	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:134212846G>A	uc001qhp.2	+	2	472	c.284_splice	c.e2+1	p.T95_splice		NM_138342	NP_612351			galactosidase, beta 1-like 2 precursor						carbohydrate metabolic process	extracellular region	cation binding|hydrolase activity, hydrolyzing O-glycosyl compounds			ovary(1)|pancreas(1)|skin(1)	3	all_hematologic(175;0.127)	all_cancers(12;2.85e-18)|all_epithelial(12;1.21e-12)|all_lung(97;0.000276)|Lung NSC(97;0.000518)|Breast(109;0.00122)|Medulloblastoma(222;0.0399)|all_neural(223;0.0412)|Esophageal squamous(93;0.0844)		Epithelial(10;1.37e-11)|all cancers(11;2.2e-10)|BRCA - Breast invasive adenocarcinoma(10;3.09e-10)|OV - Ovarian serous cystadenocarcinoma(99;0.000885)|Lung(977;0.223)														---	---	---	---
WNK1	65125	broad.mit.edu	37	12	1005427	1005427	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:1005427C>T	uc001qio.3	+	24	6281	c.5774C>T	c.(5773-5775)GCC>GTC	p.A1925V	WNK1_uc001qip.3_Missense_Mutation_p.A1677V|WNK1_uc001qir.3_Missense_Mutation_p.A1098V	NM_018979	NP_061852	Q9H4A3	WNK1_HUMAN	WNK lysine deficient protein kinase 1	1925					intracellular protein kinase cascade|ion transport|neuron development	cytoplasm	ATP binding|protein binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			stomach(6)|breast(6)|ovary(5)|lung(4)|large_intestine(1)|central_nervous_system(1)	23	all_cancers(10;0.00611)|all_epithelial(11;0.00825)|all_lung(10;0.0331)|Ovarian(42;0.0512)|Lung NSC(10;0.0632)		Epithelial(1;1.74e-08)|all cancers(1;7.04e-08)|OV - Ovarian serous cystadenocarcinoma(31;0.000423)|BRCA - Breast invasive adenocarcinoma(9;0.0149)|Colorectal(1;0.0197)															---	---	---	---
FKBP4	2288	broad.mit.edu	37	12	2906454	2906454	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:2906454C>T	uc001qkz.2	+							NM_002014	NP_002005			FK506 binding protein 52						negative regulation of microtubule polymerization or depolymerization|negative regulation of neuron projection development|protein folding	axonal growth cone|cytosol|membrane|microtubule|nucleus	FK506 binding|heat shock protein binding|peptidyl-prolyl cis-trans isomerase activity|protein binding, bridging				0			OV - Ovarian serous cystadenocarcinoma(31;0.00105)		Dimethyl sulfoxide(DB01093)													---	---	---	---
PARP11	57097	broad.mit.edu	37	12	3939057	3939057	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:3939057T>C	uc001qmk.1	-	1	180	c.125A>G	c.(124-126)CAG>CGG	p.Q42R	PARP11_uc001qml.2_Missense_Mutation_p.Q49R|PARP11_uc009zef.2_RNA|PARP11_uc001qmm.2_Silent_p.S8S|PARP11_uc001qmn.2_Silent_p.S8S	NM_020367	NP_065100	Q9NR21	PAR11_HUMAN	poly (ADP-ribose) polymerase family, member 11	42	WWE.						NAD+ ADP-ribosyltransferase activity			ovary(1)|central_nervous_system(1)	2			all cancers(3;1.58e-07)|OV - Ovarian serous cystadenocarcinoma(31;0.00287)|GBM - Glioblastoma multiforme(3;0.0141)|COAD - Colon adenocarcinoma(12;0.0264)															---	---	---	---
PLEKHG6	55200	broad.mit.edu	37	12	6425053	6425053	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6425053C>T	uc001qnr.2	+	6	722	c.574C>T	c.(574-576)CTG>TTG	p.L192L	PLEKHG6_uc001qns.2_Silent_p.L192L|PLEKHG6_uc010sew.1_Silent_p.L192L|PLEKHG6_uc010sex.1_Silent_p.L160L	NM_018173	NP_060643	Q3KR16	PKHG6_HUMAN	pleckstrin homology domain-containing family G	192	DH.				regulation of Rho protein signal transduction	cleavage furrow|cytoplasm|spindle pole	GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(1)|skin(1)	2																		---	---	---	---
M6PR	4074	broad.mit.edu	37	12	9094486	9094486	+	Silent	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9094486T>A	uc001qvf.2	-	7	932	c.762A>T	c.(760-762)GCA>GCT	p.A254A		NM_002355	NP_002346	P20645	MPRD_HUMAN	cation-dependent mannose-6-phosphate receptor	254	Cytoplasmic (Potential).				endosome to lysosome transport|receptor-mediated endocytosis	cell surface|endosome|integral to plasma membrane|lysosomal membrane	mannose binding|mannose transmembrane transporter activity|transmembrane receptor activity				0		Hepatocellular(102;0.137)		BRCA - Breast invasive adenocarcinoma(232;0.0146)														---	---	---	---
PZP	5858	broad.mit.edu	37	12	9349220	9349220	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9349220G>A	uc001qvl.2	-	9	958	c.929C>T	c.(928-930)ACG>ATG	p.T310M	PZP_uc009zgl.2_Missense_Mutation_p.T179M	NM_002864	NP_002855			pregnancy-zone protein precursor											ovary(3)|upper_aerodigestive_tract(1)|large_intestine(1)	5																		---	---	---	---
PRH2	5555	broad.mit.edu	37	12	11083297	11083297	+	Missense_Mutation	SNP	G	A	A	rs147911411	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:11083297G>A	uc009zhr.2	+	3	175	c.137G>A	c.(136-138)CGT>CAT	p.R46H	PRR4_uc009zhp.2_Intron|PRH1_uc001qzb.3_Intron|PRH1_uc001qzc.2_Intron|PRB4_uc001qzf.1_Intron|PRH2_uc001qzh.2_Missense_Mutation_p.R46H|PRH2_uc001qzi.3_Missense_Mutation_p.R46H	NM_001110213	NP_001103683	P02810	PRPC_HUMAN	proline-rich protein HaeIII subfamily 2	46	Inhibits hydroxyapatite formation, binds to hydroxyapatite and calcium.					extracellular space	protein binding				0																		---	---	---	---
WBP11	51729	broad.mit.edu	37	12	14940008	14940008	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14940008C>A	uc001rci.2	-	12	2078	c.1917G>T	c.(1915-1917)GGG>GGT	p.G639G		NM_016312	NP_057396	Q9Y2W2	WBP11_HUMAN	WW domain binding protein 11	639					mRNA processing|RNA splicing|rRNA processing	cytoplasm	single-stranded DNA binding|WW domain binding			ovary(1)|lung(1)	2																		---	---	---	---
C12orf71	728858	broad.mit.edu	37	12	27235417	27235417	+	5'UTR	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:27235417G>T	uc001rhq.2	-	1						NM_001080406	NP_001073875			hypothetical protein LOC728858												0																		---	---	---	---
TMTC1	83857	broad.mit.edu	37	12	29904657	29904657	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:29904657G>A	uc001rjb.2	-	5	1030	c.556C>T	c.(556-558)CCA>TCA	p.P186S	TMTC1_uc001rjc.1_Missense_Mutation_p.P186S	NM_175861	NP_787057	Q8IUR5	TMTC1_HUMAN	transmembrane and tetratricopeptide repeat	294						integral to membrane	binding				0	Lung NSC(12;7.61e-10)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.032)																	---	---	---	---
SFRS2IP	9169	broad.mit.edu	37	12	46322094	46322094	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46322094A>G	uc001rox.2	-	11	1677	c.1390T>C	c.(1390-1392)TAT>CAT	p.Y464H	SFRS2IP_uc001row.2_Missense_Mutation_p.Y149H|SFRS2IP_uc001roy.1_Missense_Mutation_p.Y538H	NM_004719	NP_004710	Q99590	SCAFB_HUMAN	splicing factor, arginine/serine-rich 2,	464					spliceosome assembly	nucleus	protein binding|zinc ion binding				0	Lung SC(27;0.192)|Renal(347;0.236)	Lung NSC(34;0.209)	OV - Ovarian serous cystadenocarcinoma(5;0.00691)	GBM - Glioblastoma multiforme(48;0.1)														---	---	---	---
HDAC7	51564	broad.mit.edu	37	12	48192418	48192418	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48192418C>T	uc009zkv.1	-	2	374	c.159G>A	c.(157-159)CCG>CCA	p.P53P	HDAC7_uc010slo.1_Silent_p.P92P|HDAC7_uc001rqj.3_Silent_p.P92P|HDAC7_uc001rqk.3_Silent_p.P75P			Q8WUI4	HDAC7_HUMAN	Synthetic construct DNA, clone: pF1KB0470, Homo sapiens HDAC7 gene for histone deacetylase 7, without stop codon, in Flexi system.	53	Interaction with MEF2A (By similarity).|Transcription repression 1 (By similarity).|Interaction with MEF2C (By similarity).				negative regulation of interleukin-2 production|negative regulation of osteoblast differentiation|positive regulation of cell migration involved in sprouting angiogenesis|transcription, DNA-dependent	cytoplasm|histone deacetylase complex	activating transcription factor binding|histone deacetylase activity (H3-K16 specific)|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|protein kinase C binding|repressing transcription factor binding			lung(1)|breast(1)	2				GBM - Glioblastoma multiforme(48;0.137)														---	---	---	---
DDX23	9416	broad.mit.edu	37	12	49237796	49237796	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49237796G>A	uc001rsm.2	-	3	338	c.247C>T	c.(247-249)CGG>TGG	p.R83W		NM_004818	NP_004809	Q9BUQ8	DDX23_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 23	83	Arg-rich.					catalytic step 2 spliceosome|nucleoplasm|U5 snRNP	ATP binding|ATP-dependent RNA helicase activity|nucleic acid binding|protein binding			kidney(3)|ovary(1)|lung(1)|skin(1)	6																		---	---	---	---
CSRNP2	81566	broad.mit.edu	37	12	51458168	51458168	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51458168C>A	uc001rxu.1	-	5	1291	c.993G>T	c.(991-993)GAG>GAT	p.E331D		NM_030809	NP_110436	Q9H175	CSRN2_HUMAN	TGF-beta induced apoptosis protein 12	331					apoptosis|positive regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
KRT5	3852	broad.mit.edu	37	12	52910981	52910981	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52910981G>A	uc001san.2	-	6	1291	c.1128C>T	c.(1126-1128)GGC>GGT	p.G376G	KRT5_uc009zmh.2_Silent_p.G376G	NM_000424	NP_000415	P13647	K2C5_HUMAN	keratin 5	376	Rod.|Coil 2.				epidermis development|hemidesmosome assembly	cytosol|keratin filament	protein binding|structural constituent of cytoskeleton				0				BRCA - Breast invasive adenocarcinoma(357;0.189)														---	---	---	---
KRT5	3852	broad.mit.edu	37	12	52913894	52913894	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52913894G>A	uc001san.2	-	1	350	c.187C>T	c.(187-189)CGG>TGG	p.R63W	KRT5_uc009zmh.2_Missense_Mutation_p.R63W	NM_000424	NP_000415	P13647	K2C5_HUMAN	keratin 5	63	Head.|Gly-rich.				epidermis development|hemidesmosome assembly	cytosol|keratin filament	protein binding|structural constituent of cytoskeleton				0				BRCA - Breast invasive adenocarcinoma(357;0.189)														---	---	---	---
TARBP2	6895	broad.mit.edu	37	12	53899445	53899445	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53899445C>T	uc001sdo.2	+	8	1242	c.754C>T	c.(754-756)CGC>TGC	p.R252C	TARBP2_uc001sdp.2_Missense_Mutation_p.R231C|TARBP2_uc001sdq.2_Missense_Mutation_p.R108C|TARBP2_uc001sdr.2_Missense_Mutation_p.R108C|TARBP2_uc001sds.2_Missense_Mutation_p.P209L|TARBP2_uc001sdt.2_Missense_Mutation_p.R231C|TARBP2_uc001sdu.2_Missense_Mutation_p.R108C|TARBP2_uc001sdv.2_RNA	NM_134323	NP_599150	Q15633	TRBP2_HUMAN	TAR RNA binding protein 2 isoform a	252	Sufficient for interaction with DICER1.				miRNA loading onto RISC involved in gene silencing by miRNA|negative regulation of defense response to virus by host|negative regulation of protein kinase activity|positive regulation of viral genome replication|pre-miRNA processing|production of siRNA involved in RNA interference|regulation of transcription from RNA polymerase II promoter|regulation of translation|regulation of viral transcription|targeting of mRNA for destruction involved in RNA interference	cytosol|nucleus|perinuclear region of cytoplasm|RNA-induced silencing complex	double-stranded RNA binding|protein homodimerization activity|siRNA binding			central_nervous_system(1)	1																		---	---	---	---
HOXC9	3225	broad.mit.edu	37	12	54396222	54396222	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54396222G>A	uc001sep.2	+	3	645	c.547G>A	c.(547-549)GTG>ATG	p.V183M	HOXC9_uc001seq.2_Missense_Mutation_p.V183M	NM_006897	NP_008828	P31274	HXC9_HUMAN	homeobox C9	183					multicellular organismal development	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			large_intestine(1)|pancreas(1)|skin(1)	3																		---	---	---	---
NCKAP1L	3071	broad.mit.edu	37	12	54925281	54925281	+	Missense_Mutation	SNP	G	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54925281G>C	uc001sgc.3	+	24	2690	c.2611G>C	c.(2611-2613)GTG>CTG	p.V871L	NCKAP1L_uc010sox.1_Missense_Mutation_p.V413L|NCKAP1L_uc010soy.1_Missense_Mutation_p.V821L	NM_005337	NP_005328	P55160	NCKPL_HUMAN	NCK-associated protein 1-like	871					actin polymerization-dependent cell motility|B cell homeostasis|B cell receptor signaling pathway|cortical actin cytoskeleton organization|erythrocyte development|maintenance of cell polarity|myeloid cell homeostasis|negative regulation of apoptosis|negative regulation of interleukin-17 production|negative regulation of interleukin-6 production|negative regulation of myosin-light-chain-phosphatase activity|neutrophil chemotaxis|positive regulation of actin filament polymerization|positive regulation of B cell differentiation|positive regulation of B cell proliferation|positive regulation of CD4-positive, alpha-beta T cell differentiation|positive regulation of CD8-positive, alpha-beta T cell differentiation|positive regulation of cell adhesion mediated by integrin|positive regulation of erythrocyte differentiation|positive regulation of gamma-delta T cell differentiation|positive regulation of neutrophil chemotaxis|positive regulation of phagocytosis, engulfment|positive regulation of T cell proliferation|protein complex assembly|response to drug|T cell homeostasis	cytosol|integral to plasma membrane|membrane fraction|SCAR complex	protein complex binding|protein kinase activator activity|Rac GTPase activator activity			ovary(3)|central_nervous_system(1)	4																		---	---	---	---
OR6C1	390321	broad.mit.edu	37	12	55714547	55714547	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:55714547C>T	uc010spi.1	+	1	164	c.164C>T	c.(163-165)ACC>ATC	p.T55I		NM_001005182	NP_001005182	Q96RD1	OR6C1_HUMAN	olfactory receptor, family 6, subfamily C,	55	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(1)|ovary(1)	2																		---	---	---	---
SMARCC2	6601	broad.mit.edu	37	12	56575376	56575376	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56575376G>A	uc001skb.2	-	10	952	c.846C>T	c.(844-846)AAC>AAT	p.N282N	SMARCC2_uc001skd.2_Silent_p.N282N|SMARCC2_uc001ska.2_Silent_p.N282N|SMARCC2_uc001skc.2_Silent_p.N282N|SMARCC2_uc010sqf.1_Silent_p.N171N	NM_003075	NP_003066	Q8TAQ2	SMRC2_HUMAN	SWI/SNF-related matrix-associated	282					chromatin remodeling|negative regulation of transcription, DNA-dependent|nervous system development|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nBAF complex|npBAF complex|nucleoplasm|SWI/SNF complex	DNA binding|protein binding|transcription coactivator activity			lung(2)|central_nervous_system(2)|ovary(1)|skin(1)	6			OV - Ovarian serous cystadenocarcinoma(18;0.123)															---	---	---	---
TIMELESS	8914	broad.mit.edu	37	12	56814799	56814799	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56814799C>A	uc001slf.2	-	24	3156	c.2988G>T	c.(2986-2988)CAG>CAT	p.Q996H		NM_003920	NP_003911	Q9UNS1	TIM_HUMAN	timeless homolog	996					cell division|circadian rhythm|detection of abiotic stimulus|mitosis|morphogenesis of an epithelium|negative regulation of transcription, DNA-dependent|regulation of S phase|response to DNA damage stimulus|transcription, DNA-dependent	nuclear chromatin				ovary(5)|breast(2)|pancreas(1)	8																		---	---	---	---
BAZ2A	11176	broad.mit.edu	37	12	56992956	56992956	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56992956G>A	uc001slq.1	-	27	5559	c.5365C>T	c.(5365-5367)CGA>TGA	p.R1789*	BAZ2A_uc001slp.1_Nonsense_Mutation_p.R1787*|BAZ2A_uc001slo.1_Nonsense_Mutation_p.R595*|BAZ2A_uc009zov.1_Nonsense_Mutation_p.R755*|BAZ2A_uc009zow.1_Nonsense_Mutation_p.R1757*	NM_013449	NP_038477	Q9UIF9	BAZ2A_HUMAN	bromodomain adjacent to zinc finger domain, 2A	1789					chromatin silencing at rDNA|DNA methylation|transcription, DNA-dependent	chromatin silencing complex|nucleolus|rDNA heterochromatin	DNA binding|histone acetyl-lysine binding|ligand-dependent nuclear receptor binding|RNA binding|zinc ion binding				0																		---	---	---	---
LRP1	4035	broad.mit.edu	37	12	57574480	57574480	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57574480C>T	uc001snd.2	+	33	5883	c.5417C>T	c.(5416-5418)TCG>TTG	p.S1806L		NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	1806	Extracellular (Potential).				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)													---	---	---	---
METTL1	4234	broad.mit.edu	37	12	58163079	58163079	+	Intron	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:58163079T>G	uc010ssd.1	-						CYP27B1_uc001spz.1_5'Flank|CYP27B1_uc001sqa.1_5'Flank|METTL1_uc009zqc.2_Intron	NM_005371	NP_005362			methyltransferase-like protein 1 isoform a							cytoplasm|nucleus	protein binding|tRNA (guanine-N7-)-methyltransferase activity|tRNA binding				0	all_cancers(7;6.73e-81)|Lung NSC(6;1.07e-25)|all_lung(6;8.25e-24)|all_epithelial(6;4.6e-17)|Glioma(12;6.95e-05)|all_neural(12;0.00016)|Melanoma(17;0.122)		BRCA - Breast invasive adenocarcinoma(9;0.211)															---	---	---	---
C12orf66	144577	broad.mit.edu	37	12	64615816	64615816	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:64615816A>C	uc001srw.3	-	1	261	c.202T>G	c.(202-204)TAT>GAT	p.Y68D	uc001srx.2_5'Flank|C12orf66_uc009zql.2_Intron	NM_152440	NP_689653	Q96MD2	CL066_HUMAN	hypothetical protein LOC144577	68										ovary(1)	1																		---	---	---	---
C12orf66	144577	broad.mit.edu	37	12	64615836	64615836	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:64615836A>C	uc001srw.3	-	1	241	c.182T>G	c.(181-183)CTG>CGG	p.L61R	uc001srx.2_5'Flank|C12orf66_uc009zql.2_Intron	NM_152440	NP_689653	Q96MD2	CL066_HUMAN	hypothetical protein LOC144577	61										ovary(1)	1																		---	---	---	---
LEMD3	23592	broad.mit.edu	37	12	65639549	65639549	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:65639549C>T	uc001ssl.1	+	11	2494	c.2488C>T	c.(2488-2490)CGT>TGT	p.R830C	LEMD3_uc009zqo.1_Missense_Mutation_p.R829C	NM_014319	NP_055134	Q9Y2U8	MAN1_HUMAN	LEM domain containing 3	830	Interaction with SMAD1, SMAD2, SMAD3 and SMAD5.				negative regulation of activin receptor signaling pathway|negative regulation of BMP signaling pathway|negative regulation of transforming growth factor beta receptor signaling pathway	integral to nuclear inner membrane|membrane fraction	DNA binding|nucleotide binding|protein binding			central_nervous_system(3)|ovary(1)	4			LUAD - Lung adenocarcinoma(6;0.0234)|LUSC - Lung squamous cell carcinoma(43;0.0975)	GBM - Glioblastoma multiforme(28;0.0104)														---	---	---	---
CAPS2	84698	broad.mit.edu	37	12	75692742	75692742	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:75692742C>T	uc001sxk.3	-	11	1113	c.916G>A	c.(916-918)GGA>AGA	p.G306R	CAPS2_uc001sxm.3_Missense_Mutation_p.G74R|CAPS2_uc009zsa.2_Intron|CAPS2_uc001sxi.3_Intron|CAPS2_uc001sxj.3_Intron|CAPS2_uc001sxl.3_Missense_Mutation_p.G287R	NM_032606	NP_115995	Q9BXY5	CAYP2_HUMAN	calcyphosine 2	306							calcium ion binding			ovary(2)	2																		---	---	---	---
CEP290	80184	broad.mit.edu	37	12	88477714	88477714	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:88477714C>T	uc001tar.2	-	36	5066	c.4722G>A	c.(4720-4722)GTG>GTA	p.V1574V	CEP290_uc001taq.2_Silent_p.V634V	NM_025114	NP_079390	O15078	CE290_HUMAN	centrosomal protein 290kDa	1574	Potential.				cilium assembly|eye photoreceptor cell development|G2/M transition of mitotic cell cycle|hindbrain development|otic vesicle formation|positive regulation of transcription, DNA-dependent|pronephros development|protein transport	cell surface|centrosome|cytosol|nucleus|photoreceptor connecting cilium	protein binding			ovary(5)|breast(1)|pancreas(1)	7																		---	---	---	---
CDK17	5128	broad.mit.edu	37	12	96692660	96692660	+	Silent	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:96692660T>G	uc001tep.1	-	7	1191	c.702A>C	c.(700-702)ACA>ACC	p.T234T	CDK17_uc009ztk.2_Silent_p.T234T|CDK17_uc010svb.1_Silent_p.T181T	NM_002595	NP_002586	Q00537	CDK17_HUMAN	PCTAIRE protein kinase 2	234	Protein kinase.						ATP binding|cyclin-dependent protein kinase activity			ovary(3)|lung(2)|kidney(1)|central_nervous_system(1)	7																		---	---	---	---
MYBPC1	4604	broad.mit.edu	37	12	102036190	102036190	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:102036190C>T	uc001tii.2	+						MYBPC1_uc001tif.1_Intron|MYBPC1_uc001tig.2_Intron|MYBPC1_uc010svq.1_Intron|MYBPC1_uc001tih.2_Intron|MYBPC1_uc001tij.2_Intron|MYBPC1_uc010svr.1_Intron|MYBPC1_uc010svs.1_Intron|MYBPC1_uc010svt.1_Intron|MYBPC1_uc010svu.1_Intron|MYBPC1_uc001tik.2_Intron	NM_206820	NP_996556			myosin binding protein C, slow type isoform 3						cell adhesion|muscle filament sliding	cytosol|myofibril|myosin filament	actin binding|structural constituent of muscle|titin binding			ovary(2)|liver(1)|skin(1)	4																		---	---	---	---
TXNRD1	7296	broad.mit.edu	37	12	104705167	104705167	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104705167T>C	uc010swk.1	+	5	536	c.514T>C	c.(514-516)TCA>CCA	p.S172P	TXNRD1_uc010swl.1_Missense_Mutation_p.S22P|TXNRD1_uc010swm.1_Missense_Mutation_p.S74P|TXNRD1_uc010swn.1_Missense_Mutation_p.S22P|TXNRD1_uc010swo.1_Missense_Mutation_p.S22P|TXNRD1_uc010swp.1_Intron|TXNRD1_uc010swq.1_Missense_Mutation_p.S72P|TXNRD1_uc001tku.2_RNA|TXNRD1_uc009zun.2_Missense_Mutation_p.S88P|TXNRD1_uc001tko.1_RNA|TXNRD1_uc001tkp.1_RNA|TXNRD1_uc001tkv.1_RNA	NM_001093771	NP_001087240	Q16881	TRXR1_HUMAN	thioredoxin reductase 1 isoform 3	172					cell redox homeostasis|cellular lipid metabolic process|electron transport chain|nucleobase, nucleoside and nucleotide interconversion|signal transduction|transport	cytosol|nucleolus	electron carrier activity|flavin adenine dinucleotide binding|NADP binding|protein disulfide oxidoreductase activity|thioredoxin-disulfide reductase activity				0																		---	---	---	---
ALDH1L2	160428	broad.mit.edu	37	12	105464436	105464436	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:105464436T>C	uc001tlc.2	-	3	467	c.340A>G	c.(340-342)ATG>GTG	p.M114V	ALDH1L2_uc009zup.2_RNA	NM_001034173	NP_001029345	Q3SY69	AL1L2_HUMAN	aldehyde dehydrogenase 1 family, member L2	114	GART.				10-formyltetrahydrofolate catabolic process|biosynthetic process	mitochondrion	acyl carrier activity|cofactor binding|formyltetrahydrofolate dehydrogenase activity|hydroxymethyl-, formyl- and related transferase activity|methyltransferase activity|phosphopantetheine binding			skin(1)	1																		---	---	---	---
KIAA1033	23325	broad.mit.edu	37	12	105540264	105540264	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:105540264A>G	uc001tld.2	+	23	2456	c.2369A>G	c.(2368-2370)CAT>CGT	p.H790R	KIAA1033_uc010swr.1_Missense_Mutation_p.H791R|KIAA1033_uc010sws.1_Missense_Mutation_p.H602R	NM_015275	NP_056090	Q2M389	WAHS7_HUMAN	hypothetical protein LOC23325	790					endosome transport	WASH complex				kidney(1)|central_nervous_system(1)	2																		---	---	---	---
CKAP4	10970	broad.mit.edu	37	12	106633328	106633328	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:106633328G>A	uc001tlk.2	-	2	1367	c.1283C>T	c.(1282-1284)GCG>GTG	p.A428V		NM_006825	NP_006816	Q07065	CKAP4_HUMAN	cytoskeleton-associated protein 4	428	Potential.					ER-Golgi intermediate compartment membrane|integral to membrane|membrane fraction					0																		---	---	---	---
MYO1H	283446	broad.mit.edu	37	12	109876365	109876365	+	5'Flank	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109876365G>A	uc010sxo.1	+						MYO1H_uc010sxn.1_Missense_Mutation_p.R729H					SubName: Full=cDNA FLJ54829, moderately similar to Myosin Ic; SubName: Full=Myosin IH, isoform CRA_a;							myosin complex	motor activity				0																		---	---	---	---
CUX2	23316	broad.mit.edu	37	12	111779614	111779614	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:111779614G>A	uc001tsa.1	+	21	3569	c.3416G>A	c.(3415-3417)AGC>AAC	p.S1139N		NM_015267	NP_056082	O14529	CUX2_HUMAN	cut-like 2	1139						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(3)|skin(2)|breast(1)	6																		---	---	---	---
BRAP	8315	broad.mit.edu	37	12	112121078	112121078	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112121078G>A	uc001tsn.3	-	2	310	c.116C>T	c.(115-117)ACG>ATG	p.T39M	BRAP_uc010syh.1_5'Flank|BRAP_uc009zvv.2_Missense_Mutation_p.T9M|ACAD10_uc009zvw.2_5'Flank|ACAD10_uc001tso.3_5'Flank|ACAD10_uc001tsp.2_5'Flank|ACAD10_uc009zvx.2_5'Flank|ACAD10_uc001tsq.2_5'Flank	NM_006768	NP_006759	Q7Z569	BRAP_HUMAN	BRCA1 associated protein	39					MAPKKK cascade|negative regulation of signal transduction|Ras protein signal transduction	cytoplasm|ubiquitin ligase complex	identical protein binding|nuclear localization sequence binding|nucleotide binding|ubiquitin-protein ligase activity|zinc ion binding			lung(1)	1																		---	---	---	---
ACAD10	80724	broad.mit.edu	37	12	112182668	112182668	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112182668C>T	uc001tsq.2	+	13	2136	c.1936C>T	c.(1936-1938)CAT>TAT	p.H646Y	ACAD10_uc001tsp.2_Missense_Mutation_p.H646Y|ACAD10_uc009zvx.2_Missense_Mutation_p.H677Y|ACAD10_uc001tss.1_RNA	NM_025247	NP_079523	Q6JQN1	ACD10_HUMAN	acyl-Coenzyme A dehydrogenase family, member 10	646							acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding|hydrolase activity|transferase activity, transferring phosphorus-containing groups			ovary(2)	2																		---	---	---	---
ALDH2	217	broad.mit.edu	37	12	112221101	112221101	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112221101C>T	uc001tst.2	+	3	800	c.359C>T	c.(358-360)GCG>GTG	p.A120V	ALDH2_uc010syi.1_Intron|ALDH2_uc009zvy.2_Missense_Mutation_p.A120V	NM_000690	NP_000681	P05091	ALDH2_HUMAN	mitochondrial aldehyde dehydrogenase 2	120					carbohydrate metabolic process|ethanol oxidation|neurotransmitter biosynthetic process|xenobiotic metabolic process	mitochondrial matrix	aldehyde dehydrogenase (NAD) activity|aldehyde dehydrogenase|electron carrier activity			skin(2)|ovary(1)|central_nervous_system(1)	4					Disulfiram(DB00822)|Guanidine(DB00536)|NADH(DB00157)|Nitroglycerin(DB00727)			T	HMGA2	leiomyoma								---	---	---	---
IQCD	115811	broad.mit.edu	37	12	113633445	113633445	+	Missense_Mutation	SNP	C	A	A	rs117969623	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:113633445C>A	uc001tuu.2	-	3	1151	c.979G>T	c.(979-981)GGC>TGC	p.G327C		NM_138451	NP_612460	Q96DY2	IQCD_HUMAN	IQ motif containing D	Error:Variant_position_missing_in_Q96DY2_after_alignment										ovary(1)	1																		---	---	---	---
PLBD2	196463	broad.mit.edu	37	12	113821994	113821994	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:113821994C>T	uc001tve.2	+	7	1077	c.1042C>T	c.(1042-1044)CGC>TGC	p.R348C	PLBD2_uc001tvf.2_Missense_Mutation_p.R348C	NM_173542	NP_775813	Q8NHP8	PLBL2_HUMAN	phospholipase B domain containing 2 isoform 1	348					lipid catabolic process	lysosomal lumen	hydrolase activity				0																		---	---	---	---
TAOK3	51347	broad.mit.edu	37	12	118636867	118636867	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:118636867C>T	uc001twx.2	-	13	1478	c.1183G>A	c.(1183-1185)GTG>ATG	p.V395M	TAOK3_uc001tww.2_Missense_Mutation_p.V225M|TAOK3_uc001twy.3_Missense_Mutation_p.V395M	NM_016281	NP_057365	Q9H2K8	TAOK3_HUMAN	TAO kinase 3	395					MAPKKK cascade|negative regulation of JNK cascade|positive regulation of JNK cascade|protein autophosphorylation	mitochondrion|plasma membrane	ATP binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			lung(5)|central_nervous_system(1)	6	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---
SUDS3	64426	broad.mit.edu	37	12	118852224	118852224	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:118852224C>T	uc001twz.2	+	12	1112	c.973C>T	c.(973-975)CGC>TGC	p.R325C		NM_022491	NP_071936	Q9H7L9	SDS3_HUMAN	suppressor of defective silencing 3	325					chromatin modification|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	Sin3 complex	histone deacetylase binding				0	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---
CIT	11113	broad.mit.edu	37	12	120128233	120128233	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:120128233G>A	uc001txi.1	-	46	5836	c.5783C>T	c.(5782-5784)ACG>ATG	p.T1928M	CIT_uc001txh.1_Missense_Mutation_p.T1446M|CIT_uc001txj.1_Missense_Mutation_p.T1970M	NM_007174	NP_009105	O14578	CTRO_HUMAN	citron	1928					intracellular signal transduction		ATP binding|metal ion binding|protein serine/threonine kinase activity|SH3 domain binding|small GTPase regulator activity			ovary(6)|urinary_tract(1)|lung(1)|breast(1)|skin(1)	10	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)	Myeloproliferative disorder(1001;0.0255)		BRCA - Breast invasive adenocarcinoma(302;0.211)														---	---	---	---
GCN1L1	10985	broad.mit.edu	37	12	120591043	120591043	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:120591043C>T	uc001txo.2	-	33	4049	c.4036G>A	c.(4036-4038)GCT>ACT	p.A1346T		NM_006836	NP_006827	Q92616	GCN1L_HUMAN	GCN1 general control of amino-acid synthesis	1346	HEAT 6.				regulation of translation	ribosome	protein binding|translation factor activity, nucleic acid binding			ovary(4)	4	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---
CCDC62	84660	broad.mit.edu	37	12	123286259	123286259	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123286259A>G	uc001udc.2	+	9	1711	c.1566A>G	c.(1564-1566)ATA>ATG	p.I522M	CCDC62_uc010tah.1_RNA|CCDC62_uc001udf.2_Missense_Mutation_p.I522M|CCDC62_uc001ude.2_Missense_Mutation_p.I283M	NM_201435	NP_958843	Q6P9F0	CCD62_HUMAN	coiled-coil domain containing 62 isoform b	522						cytoplasm|nucleus				ovary(2)|large_intestine(1)|pancreas(1)|skin(1)	5	all_neural(191;0.0837)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;6.51e-06)|Epithelial(86;2.65e-05)|BRCA - Breast invasive adenocarcinoma(302;0.206)														---	---	---	---
ABCB9	23457	broad.mit.edu	37	12	123433334	123433334	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123433334C>T	uc001udm.3	-	5	1200	c.890G>A	c.(889-891)AGC>AAC	p.S297N	ABCB9_uc009zxr.2_Intron|ABCB9_uc001udo.3_Missense_Mutation_p.S297N|ABCB9_uc010taj.1_Missense_Mutation_p.S297N|ABCB9_uc001udp.2_Missense_Mutation_p.S297N|ABCB9_uc001udq.2_Missense_Mutation_p.S79N|ABCB9_uc001udr.2_Missense_Mutation_p.S297N	NM_019625	NP_062571	Q9NP78	ABCB9_HUMAN	ATP-binding cassette, sub-family B (MDR/TAP),	297	ABC transmembrane type-1.				positive regulation of T cell mediated cytotoxicity|protein transport	lysosomal membrane|plasma membrane|TAP complex	ATP binding|MHC class I protein binding|oligopeptide-transporting ATPase activity|peptide antigen binding|protein homodimerization activity|TAP1 binding|TAP2 binding|tapasin binding				0	all_neural(191;0.0837)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;6.84e-05)|Epithelial(86;0.000152)|BRCA - Breast invasive adenocarcinoma(302;0.111)														---	---	---	---
MPHOSPH9	10198	broad.mit.edu	37	12	123687402	123687402	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123687402G>A	uc001uel.2	-	6	1201	c.1094C>T	c.(1093-1095)CCG>CTG	p.P365L	MPHOSPH9_uc010tal.1_Intron|MPHOSPH9_uc010tam.1_RNA|MPHOSPH9_uc001uem.2_Intron	NM_022782	NP_073619	Q99550	MPP9_HUMAN	M-phase phosphoprotein 9	365					M phase of mitotic cell cycle	centriole|Golgi membrane					0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000182)|Epithelial(86;0.00046)|BRCA - Breast invasive adenocarcinoma(302;0.169)														---	---	---	---
C12orf65	91574	broad.mit.edu	37	12	123741554	123741554	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123741554G>T	uc001uen.2	+	3	743	c.477G>T	c.(475-477)TGG>TGT	p.W159C	C12orf65_uc001ueo.2_RNA|C12orf65_uc010tan.1_Missense_Mutation_p.W159C	NM_152269	NP_689482	Q9H3J6	CL065_HUMAN	hypothetical protein LOC91574	159	Potential.					mitochondrion	translation release factor activity				0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000595)|Epithelial(86;0.00199)														---	---	---	---
DDX55	57696	broad.mit.edu	37	12	124102324	124102324	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124102324G>A	uc001ufi.2	+	11	1093	c.1069G>A	c.(1069-1071)GGT>AGT	p.G357S	DDX55_uc001ufh.2_Missense_Mutation_p.G210S|DDX55_uc001ufj.1_Missense_Mutation_p.G210S|DDX55_uc001ufk.2_Missense_Mutation_p.G210S|DDX55_uc001ufl.2_5'Flank	NM_020936	NP_065987	Q8NHQ9	DDX55_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 55	357	Helicase C-terminal.						ATP binding|ATP-dependent helicase activity|RNA binding			ovary(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000142)|Epithelial(86;0.000637)|all cancers(50;0.00772)														---	---	---	---
NCOR2	9612	broad.mit.edu	37	12	124812140	124812140	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124812140G>A	uc010tay.1	-	47	7184	c.7028C>T	c.(7027-7029)GCC>GTC	p.A2343V	NCOR2_uc010taz.1_Missense_Mutation_p.A2327V|NCOR2_uc010tax.1_Intron	NM_006312	NP_006303	Q9Y618	NCOR2_HUMAN	nuclear receptor co-repressor 2 isoform 1	2344					cellular lipid metabolic process|negative regulation of transcription from RNA polymerase II promoter|regulation of cellular ketone metabolic process by negative regulation of transcription from an RNA polymerase II promoter|transcription, DNA-dependent	nuclear body|nucleus|transcriptional repressor complex	DNA binding|histone deacetylase binding|Notch binding|protein N-terminus binding|transcription corepressor activity			skin(3)|ovary(1)	4	all_neural(191;0.0804)|Medulloblastoma(191;0.163)			Epithelial(86;3.99e-05)|OV - Ovarian serous cystadenocarcinoma(86;9.14e-05)|all cancers(50;0.000402)|BRCA - Breast invasive adenocarcinoma(302;0.0764)														---	---	---	---
SCARB1	949	broad.mit.edu	37	12	125292364	125292364	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:125292364C>T	uc001ugo.3	-	7	1205	c.952G>A	c.(952-954)GAA>AAA	p.E318K	SCARB1_uc001ugn.3_Missense_Mutation_p.E318K|SCARB1_uc001ugm.3_Missense_Mutation_p.E318K|SCARB1_uc010tbd.1_Missense_Mutation_p.E318K|SCARB1_uc010tbe.1_Missense_Mutation_p.E277K|SCARB1_uc001ugp.3_Missense_Mutation_p.E318K	NM_005505	NP_005496	Q8WTV0	SCRB1_HUMAN	scavenger receptor class B, member 1 isoform 1	318	Extracellular (Potential).				adhesion to symbiont|cell adhesion|cholesterol efflux|cholesterol homeostasis|cholesterol import|detection of lipopolysaccharide|high-density lipoprotein particle clearance|high-density lipoprotein particle remodeling|lipopolysaccharide transport|lipoprotein metabolic process|positive regulation of cholesterol storage|positive regulation of endothelial cell migration|positive regulation of nitric-oxide synthase activity|recognition of apoptotic cell|reverse cholesterol transport|triglyceride homeostasis|wound healing	caveola	1-phosphatidylinositol binding|apolipoprotein A-I binding|high-density lipoprotein particle receptor activity|lipopolysaccharide receptor activity|low-density lipoprotein particle binding|phosphatidylserine binding|transporter activity			kidney(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000116)|Epithelial(86;0.000415)|all cancers(50;0.00395)	Phosphatidylserine(DB00144)													---	---	---	---
BRI3BP	140707	broad.mit.edu	37	12	125509930	125509930	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:125509930G>A	uc001uha.1	+	3	853	c.710G>A	c.(709-711)CGT>CAT	p.R237H		NM_080626	NP_542193	Q8WY22	BRI3B_HUMAN	BRI3-binding protein	237	Potential.					integral to membrane|mitochondrial outer membrane				ovary(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;7.35e-05)|Epithelial(86;0.000426)|all cancers(50;0.00576)														---	---	---	---
TMEM132B	114795	broad.mit.edu	37	12	126137090	126137090	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:126137090T>C	uc001uhe.1	+	8	2011	c.2003T>C	c.(2002-2004)ATG>ACG	p.M668T	TMEM132B_uc001uhf.1_Missense_Mutation_p.M180T	NM_052907	NP_443139	Q14DG7	T132B_HUMAN	transmembrane protein 132B	668	Extracellular (Potential).					integral to membrane				skin(11)|ovary(5)|large_intestine(1)|pancreas(1)|breast(1)	19	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000423)|Epithelial(86;0.00394)|all cancers(50;0.0362)														---	---	---	---
GLT1D1	144423	broad.mit.edu	37	12	129383782	129383782	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:129383782T>G	uc010tbh.1	+	4	301	c.292T>G	c.(292-294)TTT>GTT	p.F98V	GLT1D1_uc001uhx.1_Missense_Mutation_p.F109V|GLT1D1_uc001uhy.1_Intron	NM_144669	NP_653270	Q96MS3	GL1D1_HUMAN	glycosyltransferase 1 domain containing 1	109					biosynthetic process	extracellular region	transferase activity, transferring glycosyl groups				0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;3.97e-06)|Epithelial(86;3.97e-05)|all cancers(50;0.00019)														---	---	---	---
TMEM132D	121256	broad.mit.edu	37	12	130184752	130184752	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:130184752G>A	uc009zyl.1	-	2	899	c.571C>T	c.(571-573)CTG>TTG	p.L191L		NM_133448	NP_597705	Q14C87	T132D_HUMAN	transmembrane protein 132D precursor	191	Extracellular (Potential).					integral to membrane				ovary(10)|pancreas(2)|upper_aerodigestive_tract(1)|skin(1)	14	all_neural(191;0.101)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0934)|Breast(359;0.133)		OV - Ovarian serous cystadenocarcinoma(86;0.000288)|Epithelial(86;0.0116)|all cancers(50;0.0246)														---	---	---	---
GPR133	283383	broad.mit.edu	37	12	131569208	131569208	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:131569208G>T	uc001uit.3	+	15	2230	c.1671G>T	c.(1669-1671)GAG>GAT	p.E557D	GPR133_uc010tbm.1_Missense_Mutation_p.E589D|GPR133_uc009zyo.2_Missense_Mutation_p.E7D|GPR133_uc001uiv.1_Missense_Mutation_p.E76D	NM_198827	NP_942122	Q6QNK2	GP133_HUMAN	G protein-coupled receptor 133 precursor	557	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			pancreas(5)|ovary(3)|skin(2)	10	all_neural(191;0.0982)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;1.68e-06)|all cancers(50;2.71e-06)|Epithelial(86;6.75e-06)														---	---	---	---
ULK1	8408	broad.mit.edu	37	12	132394519	132394519	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132394519C>T	uc001uje.2	+	10	1049	c.781C>T	c.(781-783)CGC>TGC	p.R261C		NM_003565	NP_003556	O75385	ULK1_HUMAN	Unc-51-like kinase 1	261	Protein kinase.				autophagy|protein localization|regulation of autophagy	autophagic vacuole|cytosol|pre-autophagosomal structure|ULK1-ATG13-FIP200 complex	ATP binding|protein complex binding|protein serine/threonine kinase activity			ovary(1)|lung(1)|central_nervous_system(1)|skin(1)	4	all_neural(191;0.0982)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;2.07e-08)|Epithelial(86;2.56e-07)|all cancers(50;3.01e-07)														---	---	---	---
EP400	57634	broad.mit.edu	37	12	132547001	132547001	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132547001C>A	uc001ujn.2	+						EP400_uc001ujl.2_Intron|EP400_uc001ujm.2_Intron|EP400_uc001ujp.2_5'Flank	NM_015409	NP_056224			E1A binding protein p400						histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent	NuA4 histone acetyltransferase complex|nuclear speck	ATP binding|DNA binding|helicase activity			central_nervous_system(4)|ovary(3)|breast(3)|skin(2)	12	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.198)		OV - Ovarian serous cystadenocarcinoma(86;3.01e-08)|Epithelial(86;3.43e-07)|all cancers(50;2.01e-06)														---	---	---	---
P2RX2	22953	broad.mit.edu	37	12	133195509	133195509	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:133195509T>C	uc001ukj.1	+	1	107	c.107T>C	c.(106-108)GTG>GCG	p.V36A	P2RX2_uc001uki.1_Missense_Mutation_p.V36A|P2RX2_uc001ukk.1_Missense_Mutation_p.V36A|P2RX2_uc001ukl.1_Missense_Mutation_p.V36A|P2RX2_uc001ukm.1_Splice_Site_p.V35_splice|P2RX2_uc001ukn.1_Splice_Site_p.V35_splice|P2RX2_uc009zyt.1_Missense_Mutation_p.V36A|P2RX2_uc001uko.1_Missense_Mutation_p.V36A	NM_170682	NP_733782	Q9UBL9	P2RX2_HUMAN	purinergic receptor P2X2 isoform A	36	Cytoplasmic (Potential).				positive regulation of calcium ion transport into cytosol|positive regulation of calcium-mediated signaling|protein homooligomerization	integral to membrane	ATP binding|extracellular ATP-gated cation channel activity|identical protein binding|purinergic nucleotide receptor activity				0	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0767)		OV - Ovarian serous cystadenocarcinoma(86;2.32e-08)|Epithelial(86;8.62e-08)|all cancers(50;4.5e-06)														---	---	---	---
POLE	5426	broad.mit.edu	37	12	133257271	133257271	+	Silent	SNP	G	A	A	rs146986360	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:133257271G>A	uc001uks.1	-	3	251	c.207C>T	c.(205-207)ACC>ACT	p.T69T	POLE_uc010tbq.1_RNA|POLE_uc009zyu.1_Intron	NM_006231	NP_006222	Q07864	DPOE1_HUMAN	DNA-directed DNA polymerase epsilon	69					base-excision repair, gap-filling|DNA synthesis involved in DNA repair|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|nucleotide-excision repair, DNA gap filling|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication|transcription-coupled nucleotide-excision repair	nucleoplasm	chromatin binding|DNA binding|DNA-directed DNA polymerase activity|nucleotide binding|protein binding|zinc ion binding			ovary(3)|skin(3)|lung(1)|central_nervous_system(1)	8	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0416)		OV - Ovarian serous cystadenocarcinoma(86;5.22e-08)|Epithelial(86;4.03e-07)|all cancers(50;1.18e-05)									DNA_polymerases_(catalytic_subunits)|Direct_reversal_of_damage					---	---	---	---
ATP12A	479	broad.mit.edu	37	13	25262530	25262530	+	Missense_Mutation	SNP	C	T	T	rs146927457		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25262530C>T	uc001upp.2	+	4	489	c.302C>T	c.(301-303)ACG>ATG	p.T101M	ATP12A_uc010aaa.2_Missense_Mutation_p.T101M	NM_001676	NP_001667	P54707	AT12A_HUMAN	hydrogen/potassium-exchanging ATPase 12A	101	Cytoplasmic (Potential).				ATP biosynthetic process	hydrogen:potassium-exchanging ATPase complex	ATP binding|hydrogen:potassium-exchanging ATPase activity|metal ion binding			ovary(2)|central_nervous_system(2)|large_intestine(1)|breast(1)	6		Lung SC(185;0.0225)|Breast(139;0.077)		all cancers(112;0.0307)|Epithelial(112;0.086)|OV - Ovarian serous cystadenocarcinoma(117;0.228)	Esomeprazole(DB00736)|Pantoprazole(DB00213)													---	---	---	---
ATP12A	479	broad.mit.edu	37	13	25265317	25265317	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25265317C>A	uc001upp.2	+	8	1184	c.997C>A	c.(997-999)CTG>ATG	p.L333M	ATP12A_uc010aaa.2_Missense_Mutation_p.L339M	NM_001676	NP_001667	P54707	AT12A_HUMAN	hydrogen/potassium-exchanging ATPase 12A	333	Lumenal (Potential).				ATP biosynthetic process	hydrogen:potassium-exchanging ATPase complex	ATP binding|hydrogen:potassium-exchanging ATPase activity|metal ion binding			ovary(2)|central_nervous_system(2)|large_intestine(1)|breast(1)	6		Lung SC(185;0.0225)|Breast(139;0.077)		all cancers(112;0.0307)|Epithelial(112;0.086)|OV - Ovarian serous cystadenocarcinoma(117;0.228)	Esomeprazole(DB00736)|Pantoprazole(DB00213)													---	---	---	---
ATP12A	479	broad.mit.edu	37	13	25266681	25266681	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25266681A>G	uc001upp.2	+	9	1370	c.1183A>G	c.(1183-1185)ACA>GCA	p.T395A	ATP12A_uc010aaa.2_Missense_Mutation_p.T401A	NM_001676	NP_001667	P54707	AT12A_HUMAN	hydrogen/potassium-exchanging ATPase 12A	395	Cytoplasmic (Potential).				ATP biosynthetic process	hydrogen:potassium-exchanging ATPase complex	ATP binding|hydrogen:potassium-exchanging ATPase activity|metal ion binding			ovary(2)|central_nervous_system(2)|large_intestine(1)|breast(1)	6		Lung SC(185;0.0225)|Breast(139;0.077)		all cancers(112;0.0307)|Epithelial(112;0.086)|OV - Ovarian serous cystadenocarcinoma(117;0.228)	Esomeprazole(DB00736)|Pantoprazole(DB00213)													---	---	---	---
CENPJ	55835	broad.mit.edu	37	13	25478079	25478079	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25478079G>A	uc001upt.3	-	8	3063	c.2810C>T	c.(2809-2811)GCC>GTC	p.A937V	CENPJ_uc010tdf.1_RNA|CENPJ_uc010aae.2_RNA|CENPJ_uc010aaf.2_RNA|CENPJ_uc001upu.2_5'UTR	NM_018451	NP_060921	Q9HC77	CENPJ_HUMAN	centromere protein J	937					cell division|centriole replication|G2/M transition of mitotic cell cycle|microtubule nucleation|microtubule polymerization	centriole|cytosol|gamma-tubulin small complex|microtubule	protein domain specific binding|tubulin binding			ovary(2)	2		Lung SC(185;0.0225)|Breast(139;0.0602)		all cancers(112;0.00793)|Epithelial(112;0.0411)|OV - Ovarian serous cystadenocarcinoma(117;0.139)														---	---	---	---
RASL11A	387496	broad.mit.edu	37	13	27845850	27845850	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:27845850G>A	uc001urd.1	+	3	874	c.256G>A	c.(256-258)GTC>ATC	p.V86I		NM_206827	NP_996563	Q6T310	RSLBA_HUMAN	RAS-like, family 11, member A	86	Small GTPase-like.				positive regulation of transcription from RNA polymerase I promoter|small GTPase mediated signal transduction|transcription, DNA-dependent	membrane|nucleolus	GTP binding|GTPase activity			breast(1)	1		Lung SC(185;0.0161)	Colorectal(13;0.00042)|READ - Rectum adenocarcinoma(15;0.105)	all cancers(112;0.0173)|GBM - Glioblastoma multiforme(144;0.0557)|OV - Ovarian serous cystadenocarcinoma(117;0.152)|Epithelial(112;0.164)												OREG0022312	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
MTUS2	23281	broad.mit.edu	37	13	30003042	30003042	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:30003042C>T	uc001usl.3	+						MTUS2_uc001usm.3_Intron|MTUS2_uc010aau.2_Intron	NM_001033602	NP_001028774			hypothetical protein LOC23281 isoform a							cytoplasm|microtubule	microtubule binding|protein homodimerization activity				0																		---	---	---	---
UBL3	5412	broad.mit.edu	37	13	30341433	30341433	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:30341433G>A	uc001usp.2	-	5	1458	c.313C>T	c.(313-315)CGT>TGT	p.R105C		NM_007106	NP_009037	O95164	UBL3_HUMAN	ubiquitin-like 3 precursor	105						intracellular|plasma membrane					0		Lung SC(185;0.0281)		all cancers(112;0.0598)|GBM - Glioblastoma multiforme(144;0.142)|OV - Ovarian serous cystadenocarcinoma(117;0.147)														---	---	---	---
HSPH1	10808	broad.mit.edu	37	13	31712653	31712653	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:31712653G>T	uc001utj.2	-	17	2659	c.2261C>A	c.(2260-2262)TCT>TAT	p.S754Y	HSPH1_uc001utk.2_Missense_Mutation_p.S710Y|HSPH1_uc010aaw.2_Missense_Mutation_p.S713Y|HSPH1_uc001utl.2_Missense_Mutation_p.S756Y|HSPH1_uc010tds.1_Missense_Mutation_p.S678Y	NM_006644	NP_006635	Q92598	HS105_HUMAN	heat shock 105kD	754					positive regulation of MHC class I biosynthetic process|positive regulation of NK T cell activation|response to unfolded protein	cytoplasm|extracellular region	ATP binding				0		Lung SC(185;0.0257)		all cancers(112;0.00385)|Epithelial(112;0.0328)|OV - Ovarian serous cystadenocarcinoma(117;0.0375)|GBM - Glioblastoma multiforme(144;0.125)														---	---	---	---
FRY	10129	broad.mit.edu	37	13	32868495	32868495	+	Intron	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:32868495T>C	uc001utx.2	+						FRY_uc010tdw.1_Intron|FRY_uc001utz.2_Intron|FRY_uc010tdx.1_Intron	NM_023037	NP_075463			furry homolog						regulation of transcription, DNA-dependent|transcription, DNA-dependent	integral to membrane				ovary(5)|large_intestine(1)|skin(1)	7		Lung SC(185;0.0271)		all cancers(112;4.81e-05)|Epithelial(112;0.000656)|OV - Ovarian serous cystadenocarcinoma(117;0.0123)|BRCA - Breast invasive adenocarcinoma(63;0.0295)|GBM - Glioblastoma multiforme(144;0.104)														---	---	---	---
STARD13	90627	broad.mit.edu	37	13	33685010	33685010	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:33685010G>A	uc001uuw.2	-	11	2768	c.2642C>T	c.(2641-2643)TCG>TTG	p.S881L	STARD13_uc001uuu.2_Missense_Mutation_p.S873L|STARD13_uc001uuv.2_Missense_Mutation_p.S763L|STARD13_uc001uux.2_Missense_Mutation_p.S846L|STARD13_uc010tec.1_RNA	NM_178006	NP_821074	Q9Y3M8	STA13_HUMAN	StAR-related lipid transfer (START) domain	881					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|lipid particle|mitochondrial membrane	GTPase activator activity|protein binding			ovary(2)|pancreas(1)|skin(1)	4	all_epithelial(80;0.155)	Lung SC(185;0.0367)		all cancers(112;1.31e-05)|Epithelial(112;0.000142)|BRCA - Breast invasive adenocarcinoma(63;0.00936)|OV - Ovarian serous cystadenocarcinoma(117;0.0533)|Lung(94;0.143)|GBM - Glioblastoma multiforme(144;0.143)														---	---	---	---
SLC25A15	10166	broad.mit.edu	37	13	41381560	41381560	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:41381560C>A	uc001uxn.2	+	5	905	c.583C>A	c.(583-585)CGG>AGG	p.R195R	SUGT1L1_uc001uxp.1_Intron|SLC25A15_uc010tfb.1_Silent_p.R101R|SUGT1L1_uc001uxo.1_RNA	NM_014252	NP_055067	Q9Y619	ORNT1_HUMAN	mitochondrial ornithine transporter 1	195	Solcar 2.				cellular amino acid metabolic process|mitochondrial ornithine transport|urea cycle	integral to membrane|mitochondrial inner membrane	L-ornithine transmembrane transporter activity				0		Lung NSC(96;3.55e-06)|Breast(139;0.00394)|Prostate(109;0.0181)|Lung SC(185;0.0262)|Hepatocellular(188;0.194)		all cancers(112;1.48e-08)|Epithelial(112;7.51e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.000191)|GBM - Glioblastoma multiforme(144;0.00231)|BRCA - Breast invasive adenocarcinoma(63;0.0704)	L-Ornithine(DB00129)													---	---	---	---
ZC3H13	23091	broad.mit.edu	37	13	46541933	46541933	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:46541933G>A	uc010tfw.1	-	14	4033	c.4027C>T	c.(4027-4029)CGA>TGA	p.R1343*	ZC3H13_uc001vaq.2_Translation_Start_Site|ZC3H13_uc001vas.1_Nonsense_Mutation_p.R1343*	NM_015070	NP_055885	Q5T200	ZC3HD_HUMAN	zinc finger CCCH-type containing 13	1343	Potential.						nucleic acid binding|zinc ion binding			ovary(1)|lung(1)	2		Lung NSC(96;7.26e-05)|Breast(56;0.000118)|Prostate(109;0.00217)|Hepatocellular(98;0.0207)|Lung SC(185;0.0262)	KIRC - Kidney renal clear cell carcinoma(16;0.234)	GBM - Glioblastoma multiforme(144;4.18e-05)														---	---	---	---
CCDC70	83446	broad.mit.edu	37	13	52439918	52439918	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:52439918T>G	uc001vfu.3	+	2	700	c.404T>G	c.(403-405)TTC>TGC	p.F135C	uc010tgr.1_RNA	NM_031290	NP_112580	Q6NSX1	CCD70_HUMAN	coiled-coil domain containing 70 precursor	135						extracellular region|plasma membrane					0		Breast(56;0.000207)|Lung NSC(96;0.00145)|Prostate(109;0.0107)|Hepatocellular(98;0.065)|all_neural(104;0.19)		GBM - Glioblastoma multiforme(99;2.4e-08)														---	---	---	---
UTP14C	9724	broad.mit.edu	37	13	52603136	52603136	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:52603136G>T	uc001vgb.2	+	2	731	c.196G>T	c.(196-198)GCT>TCT	p.A66S	UTP14C_uc001vga.2_3'UTR|UTP14C_uc001vgc.2_RNA	NM_021645	NP_067677	Q5TAP6	UT14C_HUMAN	UTP14, U3 small nucleolar ribonucleoprotein,	66					cell differentiation|meiosis|multicellular organismal development|rRNA processing|spermatogenesis	nucleolus|small-subunit processome				ovary(3)|large_intestine(1)|breast(1)	5		Breast(56;0.00173)|Lung NSC(96;0.0108)|Prostate(109;0.0412)|Hepatocellular(98;0.152)|Glioma(44;0.236)		GBM - Glioblastoma multiforme(99;2.3e-08)														---	---	---	---
SLITRK1	114798	broad.mit.edu	37	13	84455202	84455202	+	Silent	SNP	C	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:84455202C>G	uc001vlk.2	-	1	1327	c.441G>C	c.(439-441)CCG>CCC	p.P147P		NM_052910	NP_443142	Q96PX8	SLIK1_HUMAN	slit and trk like 1 protein precursor	147	LRR 4.|Extracellular (Potential).					integral to membrane				ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	5	Medulloblastoma(90;0.18)	Breast(118;0.212)		GBM - Glioblastoma multiforme(99;0.07)														---	---	---	---
UGGT2	55757	broad.mit.edu	37	13	96536762	96536762	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:96536762T>C	uc001vmt.2	-	27	3381	c.3211A>G	c.(3211-3213)AAT>GAT	p.N1071D	UGGT2_uc001vmu.1_Missense_Mutation_p.N158D	NM_020121	NP_064506	Q9NYU1	UGGG2_HUMAN	UDP-glucose ceramide glucosyltransferase-like 2	1071					post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine	endoplasmic reticulum lumen|ER-Golgi intermediate compartment	UDP-glucose:glycoprotein glucosyltransferase activity			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
NALCN	259232	broad.mit.edu	37	13	101720335	101720335	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101720335G>A	uc001vox.1	-	39	4570	c.4381C>T	c.(4381-4383)CTT>TTT	p.L1461F		NM_052867	NP_443099	Q8IZF0	NALCN_HUMAN	voltage gated channel like 1	1461	Cytoplasmic (Potential).					integral to membrane	sodium channel activity|voltage-gated ion channel activity			ovary(8)|breast(4)|skin(2)|pancreas(1)|central_nervous_system(1)	16	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---
COL4A2	1284	broad.mit.edu	37	13	111077160	111077160	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:111077160A>G	uc001vqx.2	+	5	549	c.260A>G	c.(259-261)AAA>AGA	p.K87R		NM_001846	NP_001837	P08572	CO4A2_HUMAN	alpha 2 type IV collagen preproprotein	87					angiogenesis|axon guidance|extracellular matrix organization|negative regulation of angiogenesis	collagen type IV	extracellular matrix structural constituent|protein binding			skin(3)|central_nervous_system(2)|ovary(1)	6	all_cancers(4;2.21e-12)|all_epithelial(4;2.63e-07)|all_lung(23;5.81e-06)|Lung NSC(43;0.000274)|Colorectal(4;0.00323)|all_neural(89;0.0565)|Lung SC(71;0.0753)|Medulloblastoma(90;0.0922)	Breast(118;0.212)	BRCA - Breast invasive adenocarcinoma(86;0.11)|all cancers(43;0.151)															---	---	---	---
LAMP1	3916	broad.mit.edu	37	13	113974719	113974719	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:113974719C>T	uc001vtm.1	+	6	1091	c.810C>T	c.(808-810)GGC>GGT	p.G270G	LAMP1_uc010tka.1_Silent_p.G217G	NM_005561	NP_005552	P11279	LAMP1_HUMAN	lysosomal-associated membrane protein 1	270	Lumenal (Potential).|Second lumenal domain.					endosome membrane|integral to plasma membrane|lysosomal membrane|membrane fraction				central_nervous_system(2)	2	Lung NSC(43;0.0161)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)|Lung SC(71;0.218)	all_cancers(25;0.0482)|all_epithelial(44;0.0148)|all_lung(25;0.0271)|Lung NSC(25;0.0977)|Breast(118;0.188)	all cancers(43;0.025)|GBM - Glioblastoma multiforme(44;0.206)|Epithelial(84;0.246)															---	---	---	---
GAS6	2621	broad.mit.edu	37	13	114535710	114535710	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:114535710C>T	uc001vud.2	-	9	1003	c.850G>A	c.(850-852)GTG>ATG	p.V284M	GAS6_uc001vug.2_Translation_Start_Site|GAS6_uc001vuf.2_Missense_Mutation_p.V11M	NM_000820	NP_000811	Q14393	GAS6_HUMAN	growth arrest-specific 6 isoform 1 precursor	327					cell proliferation|leukocyte migration|peptidyl-glutamic acid carboxylation|platelet activation|platelet degranulation|positive regulation of ERK1 and ERK2 cascade|positive regulation of fibroblast proliferation|post-translational protein modification|proteolysis|regulation of growth	endoplasmic reticulum lumen|extracellular space|Golgi lumen|platelet alpha granule lumen	calcium ion binding|receptor agonist activity			central_nervous_system(4)	4	Lung NSC(43;0.00976)|all_neural(89;0.0337)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)|Lung SC(71;0.218)	all_cancers(25;0.0176)|all_epithelial(44;0.0104)|all_lung(25;0.0249)|Lung NSC(25;0.0908)|Breast(118;0.188)																---	---	---	---
OR4Q3	441669	broad.mit.edu	37	14	20216082	20216082	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20216082C>A	uc010tkt.1	+	1	496	c.496C>A	c.(496-498)CAG>AAG	p.Q166K		NM_172194	NP_751944	Q8NH05	OR4Q3_HUMAN	olfactory receptor, family 4, subfamily Q,	166	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			breast(3)	3	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;2.95e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---
Unknown	0	broad.mit.edu	37	14	22938326	22938326	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:22938326C>T	uc001wbw.2	+						uc010aja.1_Intron|uc010tmk.1_Intron|uc010tmo.1_Intron|uc001wco.2_Intron|uc010aje.1_Intron|uc001wcp.2_Intron|uc001wcr.1_Intron|uc001wcs.1_Intron|uc010ajf.1_Intron|uc001wcx.3_Intron|uc001wdd.2_Intron|uc010ajj.1_Intron|uc001wde.1_Intron|uc001wdf.2_Intron|uc010ajk.1_Intron|uc001wdg.1_Intron|uc010ajl.1_Intron|uc001wdj.2_Intron|uc010ajo.1_Intron|uc010ajp.1_Intron|uc001wds.1_Intron|uc001wdv.3_Intron|uc001web.1_Silent_p.T16T					SubName: Full=Alpha-chain C region; Flags: Fragment;																														---	---	---	---
C14orf93	60686	broad.mit.edu	37	14	23467754	23467754	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23467754C>T	uc001wib.1	-	2	789	c.479G>A	c.(478-480)CGG>CAG	p.R160Q	C14orf93_uc001wic.1_5'UTR|C14orf93_uc001wid.1_Missense_Mutation_p.R160Q|C14orf93_uc001wig.2_Missense_Mutation_p.R160Q|C14orf93_uc001wih.2_Missense_Mutation_p.R160Q|C14orf93_uc001wie.2_Missense_Mutation_p.R160Q|C14orf93_uc001wia.3_Missense_Mutation_p.R160Q|C14orf93_uc001wif.2_5'UTR	NM_021944	NP_068763	Q9H972	CN093_HUMAN	hypothetical protein LOC60686 precursor	160						extracellular region				ovary(1)	1	all_cancers(95;3.3e-05)			GBM - Glioblastoma multiforme(265;0.0127)														---	---	---	---
HOMEZ	57594	broad.mit.edu	37	14	23745515	23745515	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23745515G>A	uc001wja.2	-	2	1070	c.922C>T	c.(922-924)CCA>TCA	p.P308S	HOMEZ_uc001wjb.2_Missense_Mutation_p.P310S	NM_020834	NP_065885	Q8IX15	HOMEZ_HUMAN	homeodomain leucine zipper protein	308						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0	all_cancers(95;5.54e-06)			GBM - Glioblastoma multiforme(265;0.00643)														---	---	---	---
MYH7	4625	broad.mit.edu	37	14	23898213	23898213	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23898213C>T	uc001wjx.2	-	14	1464	c.1358G>A	c.(1357-1359)CGC>CAC	p.R453H		NM_000257	NP_000248	P12883	MYH7_HUMAN	myosin, heavy chain 7, cardiac muscle, beta	453	Myosin head-like.		R -> C (in CMH1).|R -> H (in CMH1).		adult heart development|muscle filament sliding|regulation of heart rate|ventricular cardiac muscle tissue morphogenesis	focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(3)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00725)														---	---	---	---
LRRC16B	90668	broad.mit.edu	37	14	24523631	24523631	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24523631G>T	uc001wlj.2	+	5	430	c.273G>T	c.(271-273)ATG>ATT	p.M91I		NM_138360	NP_612369	Q8ND23	LR16B_HUMAN	leucine rich repeat containing 16B	91										ovary(2)|breast(2)|pancreas(1)	5				GBM - Glioblastoma multiforme(265;0.019)														---	---	---	---
NOVA1	4857	broad.mit.edu	37	14	26917185	26917185	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:26917185T>C	uc001wpy.2	-	5	1822	c.1504A>G	c.(1504-1506)AAT>GAT	p.N502D	NOVA1_uc001wpz.2_Missense_Mutation_p.N478D|NOVA1_uc001wqa.2_Missense_Mutation_p.N380D	NM_002515	NP_002506	P51513	NOVA1_HUMAN	neuro-oncological ventral antigen 1 isoform 1	505					locomotory behavior|RNA splicing|synaptic transmission	nucleus	RNA binding			skin(2)|upper_aerodigestive_tract(1)|breast(1)|liver(1)	5				GBM - Glioblastoma multiforme(265;0.0135)														---	---	---	---
MIPOL1	145282	broad.mit.edu	37	14	37838737	37838737	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:37838737C>T	uc001wuc.2	+	11	1347	c.844C>T	c.(844-846)CAG>TAG	p.Q282*	MIPOL1_uc010amr.2_Intron|MIPOL1_uc001wub.3_Nonsense_Mutation_p.Q251*|MIPOL1_uc001wud.2_Nonsense_Mutation_p.Q282*|MIPOL1_uc010ams.2_Nonsense_Mutation_p.Q282*|MIPOL1_uc001wue.2_Nonsense_Mutation_p.Q251*|MIPOL1_uc010amt.2_Nonsense_Mutation_p.Q101*	NM_138731	NP_620059	Q8TD10	MIPO1_HUMAN	mirror-image polydactyly 1	282	Potential.									ovary(1)|central_nervous_system(1)	2	Breast(36;0.119)|Esophageal squamous(585;0.164)|Hepatocellular(127;0.213)		Lung(238;6.03e-07)|LUAD - Lung adenocarcinoma(48;2.48e-05)|Epithelial(34;0.047)|all cancers(34;0.0953)|LUSC - Lung squamous cell carcinoma(13;0.0975)|BRCA - Breast invasive adenocarcinoma(188;0.196)	GBM - Glioblastoma multiforme(112;0.0358)														---	---	---	---
L2HGDH	79944	broad.mit.edu	37	14	50734531	50734531	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50734531C>T	uc001wxu.2	-	8	1083	c.1004G>A	c.(1003-1005)CGA>CAA	p.R335Q	L2HGDH_uc010tqn.1_Missense_Mutation_p.R335Q|L2HGDH_uc010tqo.1_Missense_Mutation_p.R335Q	NM_024884	NP_079160	Q9H9P8	L2HDH_HUMAN	L-2-hydroxyglutarate dehydrogenase precursor	335					2-oxoglutarate metabolic process|cellular protein metabolic process	integral to mitochondrial inner membrane	2-hydroxyglutarate dehydrogenase activity			ovary(2)	2	all_epithelial(31;0.000599)|Breast(41;0.0102)																	---	---	---	---
DHRS7	51635	broad.mit.edu	37	14	60616061	60616061	+	Intron	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:60616061T>A	uc001xes.2	-						C14orf135_uc001xeq.2_Intron|DHRS7_uc001xet.2_Intron|DHRS7_uc001xeu.2_Missense_Mutation_p.I328F	NM_016029	NP_057113			dehydrogenase/reductase (SDR family) member 7								binding|oxidoreductase activity			ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(108;0.121)														---	---	---	---
SYNE2	23224	broad.mit.edu	37	14	64488030	64488030	+	Intron	SNP	C	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64488030C>G	uc001xgm.2	+						SYNE2_uc001xgl.2_Intron	NM_015180	NP_055995			spectrin repeat containing, nuclear envelope 2						centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)														---	---	---	---
SYNE2	23224	broad.mit.edu	37	14	64653220	64653220	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64653220G>A	uc001xgm.2	+	97	17865	c.17635G>A	c.(17635-17637)GTT>ATT	p.V5879I	SYNE2_uc001xgl.2_Missense_Mutation_p.V5879I|SYNE2_uc010apy.2_Missense_Mutation_p.V2264I|SYNE2_uc001xgn.2_Missense_Mutation_p.V841I|SYNE2_uc001xgo.2_RNA|SYNE2_uc010aqa.2_5'UTR|SYNE2_uc001xgq.2_Missense_Mutation_p.V244I	NM_015180	NP_055995	Q8WXH0	SYNE2_HUMAN	spectrin repeat containing, nuclear envelope 2	5879	Spectrin 4.|Cytoplasmic (Potential).				centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)														---	---	---	---
PLEK2	26499	broad.mit.edu	37	14	67862233	67862233	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:67862233C>T	uc001xjh.1	-	3	327	c.275G>A	c.(274-276)CGG>CAG	p.R92Q		NM_016445	NP_057529	Q9NYT0	PLEK2_HUMAN	pleckstrin 2	92	PH 1.				actin cytoskeleton organization|intracellular signal transduction	cytoplasm|cytoskeleton|lamellipodium membrane				ovary(1)|pancreas(1)	2				all cancers(60;0.000728)|OV - Ovarian serous cystadenocarcinoma(108;0.00593)|BRCA - Breast invasive adenocarcinoma(234;0.00953)														---	---	---	---
SIPA1L1	26037	broad.mit.edu	37	14	72056033	72056033	+	Missense_Mutation	SNP	G	A	A	rs148152996		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:72056033G>A	uc001xms.2	+	2	1792	c.1444G>A	c.(1444-1446)GTG>ATG	p.V482M	SIPA1L1_uc001xmt.2_Missense_Mutation_p.V482M|SIPA1L1_uc001xmu.2_Missense_Mutation_p.V482M|SIPA1L1_uc001xmv.2_Missense_Mutation_p.V482M	NM_015556	NP_056371	O43166	SI1L1_HUMAN	signal-induced proliferation-associated 1 like	482					actin cytoskeleton reorganization|activation of Rap GTPase activity|regulation of dendritic spine morphogenesis	cell junction|cytoplasm|dendritic spine|postsynaptic density|postsynaptic membrane|synaptosome	GTPase activator activity			ovary(3)|breast(1)	4				all cancers(60;0.00169)|BRCA - Breast invasive adenocarcinoma(234;0.00912)|OV - Ovarian serous cystadenocarcinoma(108;0.0109)														---	---	---	---
LTBP2	4053	broad.mit.edu	37	14	75078312	75078312	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75078312C>T	uc001xqa.2	-	1	723	c.336G>A	c.(334-336)TCG>TCA	p.S112S		NM_000428	NP_000419	Q14767	LTBP2_HUMAN	latent transforming growth factor beta binding	112					protein secretion|protein targeting|transforming growth factor beta receptor signaling pathway	extracellular space|proteinaceous extracellular matrix	calcium ion binding|growth factor binding			liver(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(234;0.00219)|READ - Rectum adenocarcinoma(1;0.0649)														---	---	---	---
TTLL5	23093	broad.mit.edu	37	14	76219283	76219283	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:76219283G>A	uc001xrx.2	+	18	1740	c.1535G>A	c.(1534-1536)CGC>CAC	p.R512H	TTLL5_uc010ask.1_Missense_Mutation_p.R526H|TTLL5_uc001xrz.2_Missense_Mutation_p.R74H|TTLL5_uc001xry.1_RNA	NM_015072	NP_055887	Q6EMB2	TTLL5_HUMAN	tubulin tyrosine ligase-like family, member 5	512					protein modification process|transcription, DNA-dependent	centrosome|cilium|microtubule basal body|nucleus	tubulin-tyrosine ligase activity			ovary(2)|central_nervous_system(1)	3				BRCA - Breast invasive adenocarcinoma(234;0.029)														---	---	---	---
C14orf145	145508	broad.mit.edu	37	14	80993231	80993231	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:80993231G>A	uc001xux.2	-	22	3225	c.3054C>T	c.(3052-3054)TAC>TAT	p.Y1018Y	C14orf145_uc010asz.1_RNA	NM_152446	NP_689659	Q6ZU80	CE128_HUMAN	hypothetical protein LOC145508	1018						centriole|spindle pole					0				BRCA - Breast invasive adenocarcinoma(234;0.0586)														---	---	---	---
FLRT2	23768	broad.mit.edu	37	14	86089507	86089507	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:86089507C>T	uc001xvr.2	+	2	2416	c.1649C>T	c.(1648-1650)GCG>GTG	p.A550V	FLRT2_uc010atd.2_Missense_Mutation_p.A550V	NM_013231	NP_037363	O43155	FLRT2_HUMAN	fibronectin leucine rich transmembrane protein 2	550	Helical; (Potential).				cell adhesion	integral to plasma membrane|proteinaceous extracellular matrix	protein binding, bridging|receptor signaling protein activity			ovary(3)|haematopoietic_and_lymphoid_tissue(1)	4				BRCA - Breast invasive adenocarcinoma(234;0.0319)														---	---	---	---
TTC7B	145567	broad.mit.edu	37	14	91142956	91142956	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:91142956G>A	uc001xyp.2	-	9	1185	c.1063C>T	c.(1063-1065)CGC>TGC	p.R355C	TTC7B_uc010ats.2_RNA	NM_001010854	NP_001010854	Q86TV6	TTC7B_HUMAN	tetratricopeptide repeat domain 7B	355							binding			ovary(2)	2		Melanoma(154;0.222)																---	---	---	---
SLC24A4	123041	broad.mit.edu	37	14	92920308	92920308	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:92920308C>T	uc001yak.2	+	11	918	c.894C>T	c.(892-894)AGC>AGT	p.S298S	SLC24A4_uc001yai.2_Silent_p.S251S|SLC24A4_uc010twm.1_Silent_p.S296S|SLC24A4_uc001yaj.2_Silent_p.S279S|SLC24A4_uc010auj.2_Silent_p.S187S|SLC24A4_uc010twn.1_Silent_p.S71S|SLC24A4_uc001yan.2_Silent_p.S9S	NM_153646	NP_705932	Q8NFF2	NCKX4_HUMAN	solute carrier family 24 member 4 isoform 1	315	Extracellular (Potential).					integral to membrane|plasma membrane	calcium, potassium:sodium antiporter activity|symporter activity			breast(2)|ovary(1)	3		all_cancers(154;0.0347)|all_epithelial(191;0.163)		Colorectal(1;0.00242)|COAD - Colon adenocarcinoma(157;0.047)|Epithelial(152;0.0781)|READ - Rectum adenocarcinoma(1;0.176)|all cancers(159;0.182)														---	---	---	---
KIAA1409	57578	broad.mit.edu	37	14	94173133	94173133	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94173133G>A	uc001ybv.1	+	48	7409	c.7326G>A	c.(7324-7326)TCG>TCA	p.S2442S	KIAA1409_uc001ybs.1_Silent_p.S2420S	NM_020818	NP_065869	Q9P2D8	UNC79_HUMAN	hypothetical protein LOC57578	2597						integral to membrane				ovary(10)|skin(4)|large_intestine(3)	17		all_cancers(154;0.0354)|all_epithelial(191;0.216)		Epithelial(152;0.188)														---	---	---	---
PAPOLA	10914	broad.mit.edu	37	14	97026977	97026977	+	Intron	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:97026977T>A	uc001yfq.2	+						PAPOLA_uc001yfr.2_Intron|PAPOLA_uc010twv.1_Intron|PAPOLA_uc010avp.2_Intron	NM_032632	NP_116021			poly(A) polymerase alpha						mRNA polyadenylation|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	cytoplasm|nucleoplasm	ATP binding|magnesium ion binding|manganese ion binding|polynucleotide adenylyltransferase activity|RNA binding				0		all_cancers(154;0.0555)|all_epithelial(191;0.149)|Melanoma(154;0.155)		COAD - Colon adenocarcinoma(157;0.213)														---	---	---	---
EML1	2009	broad.mit.edu	37	14	100405583	100405583	+	Silent	SNP	G	T	T	rs61986043		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:100405583G>T	uc001ygs.2	+	21	2310	c.2241G>T	c.(2239-2241)CGG>CGT	p.R747R	EML1_uc010tww.1_Silent_p.R735R|EML1_uc001ygr.2_Silent_p.R766R	NM_004434	NP_004425	O00423	EMAL1_HUMAN	echinoderm microtubule associated protein like 1	747	WD 10.					cytoplasm|microtubule|microtubule associated complex	calcium ion binding|protein binding			large_intestine(2)|pancreas(1)|ovary(1)|skin(1)	5		Melanoma(154;0.0879)|all_epithelial(191;0.216)																---	---	---	---
CDC42BPB	9578	broad.mit.edu	37	14	103435030	103435030	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103435030C>T	uc001ymi.1	-	15	2251	c.2019G>A	c.(2017-2019)GCG>GCA	p.A673A		NM_006035	NP_006026	Q9Y5S2	MRCKB_HUMAN	CDC42-binding protein kinase beta	673	Potential.				actin cytoskeleton reorganization|establishment or maintenance of cell polarity|intracellular signal transduction	cell leading edge|cell-cell junction|cytoplasm|cytoskeleton	ATP binding|magnesium ion binding|protein serine/threonine kinase activity|small GTPase regulator activity			large_intestine(3)|skin(3)|lung(2)|stomach(1)|breast(1)|ovary(1)	11		Melanoma(154;0.155)		Colorectal(3;0.0129)|READ - Rectum adenocarcinoma(2;0.0419)|Epithelial(152;0.0474)|all cancers(159;0.199)														---	---	---	---
ADSSL1	122622	broad.mit.edu	37	14	105196313	105196313	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:105196313G>A	uc001ypd.2	+						INF2_uc010tyi.1_Intron|ADSSL1_uc001ype.2_Silent_p.S28S|ADSSL1_uc001ypf.2_RNA	NM_152328	NP_689541			adenylosuccinate synthase like 1 isoform 2						AMP biosynthetic process|immune system process|purine base metabolic process	cytosol	adenylosuccinate synthase activity|GTP binding|magnesium ion binding|phosphate binding			ovary(1)|central_nervous_system(1)	2		all_cancers(154;0.0896)|Melanoma(154;0.155)|all_epithelial(191;0.172)	all cancers(16;0.00153)|OV - Ovarian serous cystadenocarcinoma(23;0.0148)|Epithelial(46;0.0396)|GBM - Glioblastoma multiforme(11;0.116)	Epithelial(152;0.18)	L-Aspartic Acid(DB00128)													---	---	---	---
JAG2	3714	broad.mit.edu	37	14	105634420	105634420	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:105634420C>T	uc001yqg.2	-	2	495	c.91G>A	c.(91-93)GAG>AAG	p.E31K	JAG2_uc001yqh.2_Missense_Mutation_p.E31K	NM_002226	NP_002217	Q9Y219	JAG2_HUMAN	jagged 2 isoform a precursor	31	Extracellular (Potential).				auditory receptor cell fate commitment|cell communication|cell cycle|Notch receptor processing|Notch signaling pathway|regulation of cell migration|regulation of cell proliferation|spermatogenesis|thymic T cell selection	integral to plasma membrane	calcium ion binding|growth factor activity|Notch binding			lung(3)|breast(2)	5		all_cancers(154;0.0336)|all_epithelial(191;0.0729)|Melanoma(154;0.155)	OV - Ovarian serous cystadenocarcinoma(23;0.00989)|all cancers(16;0.0114)|Epithelial(46;0.0272)	Epithelial(152;0.047)|OV - Ovarian serous cystadenocarcinoma(161;0.148)|all cancers(159;0.208)														---	---	---	---
ATP10A	57194	broad.mit.edu	37	15	25959016	25959016	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25959016G>A	uc010ayu.2	-	10	2255	c.2149C>T	c.(2149-2151)CGG>TGG	p.R717W		NM_024490	NP_077816	O60312	AT10A_HUMAN	ATPase, class V, type 10A	717	Cytoplasmic (Potential).				ATP biosynthetic process|regulation of cell shape	integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			pancreas(2)|ovary(1)|breast(1)|liver(1)	5		all_cancers(20;5.16e-25)|all_lung(180;1.51e-14)|Acute lymphoblastic leukemia(1;2.53e-05)|all_hematologic(1;0.000267)|Breast(32;0.00125)		all cancers(64;9.48e-07)|Epithelial(43;1.69e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0252)|Lung(196;0.244)														---	---	---	---
OCA2	4948	broad.mit.edu	37	15	28230313	28230313	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28230313G>A	uc001zbh.3	-	13	1371	c.1261C>T	c.(1261-1263)CGG>TGG	p.R421W	OCA2_uc010ayv.2_Missense_Mutation_p.R397W	NM_000275	NP_000266	Q04671	P_HUMAN	oculocutaneous albinism II	421	Cytoplasmic (Potential).				eye pigment biosynthetic process	endoplasmic reticulum membrane|endosome membrane|integral to membrane|lysosomal membrane|melanosome membrane	arsenite transmembrane transporter activity|citrate transmembrane transporter activity|L-tyrosine transmembrane transporter activity|protein binding			ovary(3)|breast(1)|pancreas(1)	5		all_lung(180;2.93e-12)|Breast(32;0.000315)|Colorectal(260;0.234)		all cancers(64;5.03e-07)|Epithelial(43;2.13e-06)|BRCA - Breast invasive adenocarcinoma(123;0.045)										Oculocutaneous_Albinism				---	---	---	---
HERC2	8924	broad.mit.edu	37	15	28386591	28386591	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28386591G>A	uc001zbj.2	-	78	12108	c.12002C>T	c.(12001-12003)ACG>ATG	p.T4001M		NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2	4001	RCC1 13.				DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)														---	---	---	---
HERC2	8924	broad.mit.edu	37	15	28482137	28482137	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28482137C>T	uc001zbj.2	-	26	4081	c.3975G>A	c.(3973-3975)CCG>CCA	p.P1325P		NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2	1325					DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)														---	---	---	---
TJP1	7082	broad.mit.edu	37	15	30092850	30092850	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:30092850C>A	uc001zcr.2	-	2	558	c.83G>T	c.(82-84)AGG>ATG	p.R28M	TJP1_uc010azl.2_Missense_Mutation_p.R16M|TJP1_uc001zcq.2_Missense_Mutation_p.R32M|TJP1_uc001zcs.2_Missense_Mutation_p.R28M	NM_003257	NP_003248	Q07157	ZO1_HUMAN	tight junction protein 1 isoform a	28	PDZ 1.				cell-cell junction assembly|cellular component disassembly involved in apoptosis	basolateral plasma membrane|cell-cell adherens junction|Golgi apparatus|tight junction				ovary(4)|central_nervous_system(1)|pancreas(1)	6		all_lung(180;7.48e-11)|Breast(32;0.000153)		all cancers(64;3.29e-10)|Epithelial(43;5.34e-09)|BRCA - Breast invasive adenocarcinoma(123;0.0034)|GBM - Glioblastoma multiforme(186;0.0139)|Lung(196;0.186)														---	---	---	---
RYR3	6263	broad.mit.edu	37	15	34040421	34040421	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34040421G>A	uc001zhi.2	+	54	8166	c.8096G>A	c.(8095-8097)CGG>CAG	p.R2699Q	RYR3_uc010bar.2_Missense_Mutation_p.R2699Q	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	2699	3.|Cytoplasmic (By similarity).|4 X approximate repeats.				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---
C15orf55	256646	broad.mit.edu	37	15	34642991	34642991	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34642991C>T	uc001zif.2	+	3	967	c.812C>T	c.(811-813)ACC>ATC	p.T271I	C15orf55_uc010ucc.1_Missense_Mutation_p.T299I|C15orf55_uc010ucd.1_Missense_Mutation_p.T289I	NM_175741	NP_786883	Q86Y26	NUT_HUMAN	nuclear protein in testis	271						cytoplasm|nucleus			BRD4_ENST00000263377/C15orf55(24)|BRD3/C15orf55(3)	midline_organs(25)|ovary(2)|lung(2)|skin(1)	30		all_lung(180;2.78e-08)		all cancers(64;4.53e-18)|GBM - Glioblastoma multiforme(113;8.29e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0249)				T	BRD3|BRD4	lethal midline carcinoma								---	---	---	---
VPS18	57617	broad.mit.edu	37	15	41191772	41191772	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41191772G>A	uc001zne.2	+	4	1095	c.756G>A	c.(754-756)ACG>ACA	p.T252T		NM_020857	NP_065908	Q9P253	VPS18_HUMAN	vacuolar protein sorting 18	252					endosome organization|lysosome organization|protein transport	HOPS complex|late endosome membrane|lysosomal membrane	metal ion binding|protein binding			ovary(2)|large_intestine(1)	3		all_cancers(109;1.35e-17)|all_epithelial(112;3.78e-15)|Lung NSC(122;9.68e-11)|all_lung(180;2.25e-09)|Melanoma(134;0.0574)|Ovarian(310;0.0822)|Colorectal(260;0.0946)		GBM - Glioblastoma multiforme(113;1.07e-05)|COAD - Colon adenocarcinoma(120;0.15)|BRCA - Breast invasive adenocarcinoma(123;0.164)														---	---	---	---
INO80	54617	broad.mit.edu	37	15	41277580	41277580	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41277580G>A	uc001zni.2	-	32	4090	c.3877C>T	c.(3877-3879)CGA>TGA	p.R1293*	INO80_uc010ucu.1_RNA	NM_017553	NP_060023	Q9ULG1	INO80_HUMAN	INO80 complex homolog 1	1293	Assembles INO80 complex module consisting of conserved components INO80B, INO80C, ACTR5, RVBL1, RVBL2.				cell division|cellular response to ionizing radiation|cellular response to UV|chromatin remodeling|double-strand break repair via homologous recombination|mitotic sister chromatid segregation|positive regulation of cell growth|positive regulation of DNA replication involved in S phase|positive regulation of transcription from RNA polymerase II promoter|regulation of G1/S transition of mitotic cell cycle|spindle assembly|UV-damage excision repair	Ino80 complex|microtubule	actin binding|alpha-tubulin binding|ATP binding|ATPase activity|DNA binding|DNA helicase activity			ovary(2)|pancreas(1)|skin(1)	4																		---	---	---	---
ITPKA	3706	broad.mit.edu	37	15	41794590	41794590	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41794590C>A	uc001znz.2	+							NM_002220	NP_002211			1D-myo-inositol-trisphosphate 3-kinase A						signal transduction		ATP binding|calmodulin binding|inositol trisphosphate 3-kinase activity				0		all_cancers(109;1.89e-19)|all_epithelial(112;2.28e-16)|Lung NSC(122;5.34e-11)|all_lung(180;1.33e-09)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.172)		OV - Ovarian serous cystadenocarcinoma(18;7.63e-17)|GBM - Glioblastoma multiforme(113;1.34e-06)|Colorectal(105;0.0148)|BRCA - Breast invasive adenocarcinoma(123;0.113)														---	---	---	---
MAPKBP1	23005	broad.mit.edu	37	15	42105142	42105142	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42105142G>A	uc001zok.3	+	8	948	c.662G>A	c.(661-663)GGC>GAC	p.G221D	MAPKBP1_uc001zoj.3_Missense_Mutation_p.G221D|MAPKBP1_uc010bcj.2_5'UTR|MAPKBP1_uc010bci.2_Missense_Mutation_p.G221D|MAPKBP1_uc010udb.1_Missense_Mutation_p.G109D|MAPKBP1_uc010bck.2_5'UTR|MAPKBP1_uc010bcl.2_5'UTR	NM_001128608	NP_001122080	O60336	MABP1_HUMAN	mitogen-activated protein kinase binding protein	221										central_nervous_system(5)|breast(2)|upper_aerodigestive_tract(1)|pancreas(1)|skin(1)	10		all_cancers(109;7.71e-14)|all_epithelial(112;5.15e-12)|Lung NSC(122;3.74e-08)|all_lung(180;1.81e-07)|Melanoma(134;0.0262)		OV - Ovarian serous cystadenocarcinoma(18;3.95e-17)|GBM - Glioblastoma multiforme(94;5.71e-07)|Lung(196;0.0436)|BRCA - Breast invasive adenocarcinoma(123;0.203)|LUSC - Lung squamous cell carcinoma(244;0.225)														---	---	---	---
JMJD7-PLA2G4B	8681	broad.mit.edu	37	15	42134087	42134087	+	Silent	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42134087T>A	uc010bco.2	+	8	662	c.561T>A	c.(559-561)ACT>ACA	p.T187T	JMJD7-PLA2G4B_uc001zoo.3_Silent_p.T418T|JMJD7-PLA2G4B_uc010bcn.2_Silent_p.T418T|JMJD7-PLA2G4B_uc001zoq.3_5'UTR|JMJD7-PLA2G4B_uc001zor.1_5'Flank	NM_001114633	NP_001108105	P0C869	PA24B_HUMAN	phospholipase A2, group IVB	187					arachidonic acid metabolic process|calcium-mediated signaling|glycerophospholipid catabolic process|inflammatory response|parturition	cytosol|early endosome membrane|extracellular region|mitochondrial membrane	calcium ion binding|calcium-dependent phospholipase A2 activity|calcium-dependent phospholipid binding|lysophospholipase activity			large_intestine(1)	1																		---	---	---	---
CDAN1	146059	broad.mit.edu	37	15	43028259	43028259	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43028259C>A	uc001zql.2	-	3	704	c.587G>T	c.(586-588)AGG>ATG	p.R196M	CDAN1_uc001zqk.2_5'Flank|CDAN1_uc010bcx.1_5'Flank|uc001zqm.2_5'Flank	NM_138477	NP_612486	Q8IWY9	CDAN1_HUMAN	codanin 1	196						integral to membrane	protein binding			ovary(2)	2		all_cancers(109;5.4e-16)|all_epithelial(112;2.97e-14)|Lung NSC(122;1.75e-08)|all_lung(180;5.99e-08)|Melanoma(134;0.0179)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;2.49e-07)														---	---	---	---
TUBGCP4	27229	broad.mit.edu	37	15	43675579	43675579	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43675579T>C	uc001zro.2	+	7	840	c.600T>C	c.(598-600)CAT>CAC	p.H200H	TUBGCP4_uc001zrn.2_Silent_p.H200H|TUBGCP4_uc010bdh.2_RNA	NM_014444	NP_055259	Q9UGJ1	GCP4_HUMAN	tubulin, gamma complex associated protein 4	200					G2/M transition of mitotic cell cycle|microtubule nucleation|protein complex assembly	centrosome|cytosol|gamma-tubulin ring complex|microtubule|spindle pole	structural constituent of cytoskeleton			ovary(3)	3		all_cancers(109;1.27e-10)|all_epithelial(112;4.82e-09)|Lung NSC(122;1.72e-06)|all_lung(180;1.59e-05)|Melanoma(134;0.0728)		GBM - Glioblastoma multiforme(94;3.53e-07)														---	---	---	---
MAP1A	4130	broad.mit.edu	37	15	43815140	43815140	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43815140G>A	uc001zrt.2	+	4	1936	c.1469G>A	c.(1468-1470)CGT>CAT	p.R490H		NM_002373	NP_002364	P78559	MAP1A_HUMAN	microtubule-associated protein 1A	490	Lys-rich (basic).|9 X 3 AA repeats of K-K-[DE].					cytoplasm|microtubule|microtubule associated complex	protein binding|structural molecule activity			ovary(3)|breast(3)|pancreas(2)|skin(1)	9		all_cancers(109;1.03e-14)|all_epithelial(112;2.23e-12)|Lung NSC(122;2.76e-08)|all_lung(180;3.1e-07)|Melanoma(134;0.0476)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;3.05e-06)	Estramustine(DB01196)													---	---	---	---
DUOX2	50506	broad.mit.edu	37	15	45404834	45404834	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45404834C>T	uc010bea.2	-	4	446	c.243G>A	c.(241-243)CCG>CCA	p.P81P	DUOX2_uc001zun.2_Silent_p.P81P|DUOXA2_uc001zuo.2_5'Flank|DUOXA2_uc010beb.2_5'Flank	NM_014080	NP_054799	Q9NRD8	DUOX2_HUMAN	dual oxidase 2 precursor	81	Extracellular (Potential).|Peroxidase-like; mediates peroxidase activity (By similarity).				cuticle development|cytokine-mediated signaling pathway|hormone biosynthetic process|hydrogen peroxide catabolic process|response to cAMP|response to virus	apical plasma membrane|integral to membrane	calcium ion binding|electron carrier activity|flavin adenine dinucleotide binding|heme binding|NAD(P)H oxidase activity|peroxidase activity			ovary(2)|skin(2)|pancreas(1)	5		all_cancers(109;3.79e-11)|all_epithelial(112;2.92e-09)|Lung NSC(122;3.55e-06)|all_lung(180;2.56e-05)|Melanoma(134;0.027)		all cancers(107;1.05e-18)|GBM - Glioblastoma multiforme(94;4.23e-07)|COAD - Colon adenocarcinoma(120;0.0668)|Colorectal(133;0.068)														---	---	---	---
DUOXA2	405753	broad.mit.edu	37	15	45409435	45409435	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45409435C>T	uc001zuo.2	+	5	981	c.701C>T	c.(700-702)CCG>CTG	p.P234L	DUOXA2_uc010beb.2_RNA	NM_207581	NP_997464	Q1HG44	DOXA2_HUMAN	dual oxidase activator 2	234	Extracellular (Potential).				protein transport	endoplasmic reticulum membrane|integral to membrane					0		all_cancers(109;5.7e-11)|all_epithelial(112;4.65e-09)|Lung NSC(122;3.55e-06)|all_lung(180;2.56e-05)|Melanoma(134;0.027)		all cancers(107;2.88e-18)|GBM - Glioblastoma multiforme(94;3.95e-07)|COAD - Colon adenocarcinoma(120;0.0652)|Colorectal(133;0.0659)														---	---	---	---
GATM	2628	broad.mit.edu	37	15	45660384	45660384	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45660384G>A	uc001zvc.2	-	4	888	c.559C>T	c.(559-561)CGT>TGT	p.R187C	GATM_uc001zvb.2_Missense_Mutation_p.R58C|GATM_uc010uev.1_Missense_Mutation_p.R240C	NM_001482	NP_001473	P50440	GATM_HUMAN	L-arginine:glycine amidinotransferase precursor	187					creatine biosynthetic process	mitochondrial inner membrane|mitochondrial intermembrane space	glycine amidinotransferase activity|protein binding				0		all_cancers(109;1.25e-09)|all_epithelial(112;5.56e-08)|Lung NSC(122;3.55e-06)|all_lung(180;2.56e-05)|Melanoma(134;0.027)		all cancers(107;4.87e-16)|GBM - Glioblastoma multiforme(94;1.97e-06)	Creatine(DB00148)|Glycine(DB00145)|L-Ornithine(DB00129)													---	---	---	---
SEMA6D	80031	broad.mit.edu	37	15	48052032	48052032	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48052032C>T	uc010bek.2	+	2	397	c.37C>T	c.(37-39)CTG>TTG	p.L13L	SEMA6D_uc001zvw.2_Silent_p.L13L|SEMA6D_uc001zvx.1_Silent_p.L13L|SEMA6D_uc001zvy.2_Silent_p.L13L|SEMA6D_uc001zvz.2_Silent_p.L13L|SEMA6D_uc001zwa.2_Silent_p.L13L|SEMA6D_uc001zwb.2_Silent_p.L13L|SEMA6D_uc001zwc.2_Silent_p.L13L	NM_153618	NP_705871	Q8NFY4	SEM6D_HUMAN	semaphorin 6D isoform 4 precursor	13					axon guidance	cytoplasm|integral to membrane|plasma membrane	receptor activity			skin(3)|breast(1)	4		all_lung(180;0.000635)|Myeloproliferative disorder(241;0.116)|Melanoma(134;0.18)		all cancers(107;1.2e-11)|GBM - Glioblastoma multiforme(94;1.2e-06)														---	---	---	---
FBN1	2200	broad.mit.edu	37	15	48782150	48782150	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48782150C>T	uc001zwx.1	-	25	3308	c.2980G>A	c.(2980-2982)GAG>AAG	p.E994K		NM_000138	NP_000129	P35555	FBN1_HUMAN	fibrillin 1 precursor	994	TB 5.				heart development|negative regulation of BMP signaling pathway by extracellular sequestering of BMP|negative regulation of transforming growth factor beta receptor signaling pathway by extracellular sequestering of TGFbeta|skeletal system development	basement membrane|extracellular space|microfibril	calcium ion binding|extracellular matrix structural constituent|protein binding			ovary(2)|large_intestine(1)	3		all_lung(180;0.00279)		all cancers(107;4.24e-07)|GBM - Glioblastoma multiforme(94;1.41e-05)														---	---	---	---
C15orf33	196951	broad.mit.edu	37	15	49907322	49907322	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:49907322G>T	uc001zxl.2	-	2	341	c.47C>A	c.(46-48)CCC>CAC	p.P16H	C15orf33_uc001zxm.2_Missense_Mutation_p.P16H	NM_152647	NP_689860	Q96M60	CO033_HUMAN	hypothetical protein LOC196951	16										ovary(1)	1		all_lung(180;0.00187)		all cancers(107;3.45e-08)|GBM - Glioblastoma multiforme(94;0.000124)														---	---	---	---
SLC27A2	11001	broad.mit.edu	37	15	50474821	50474821	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:50474821C>T	uc001zxw.2	+	1	429	c.197C>T	c.(196-198)ACG>ATG	p.T66M	SLC27A2_uc010bes.2_Missense_Mutation_p.T66M	NM_003645	NP_003636	O14975	S27A2_HUMAN	solute carrier family 27 (fatty acid	66	Cytoplasmic (Potential).				bile acid biosynthetic process|fatty acid alpha-oxidation	endoplasmic reticulum membrane|integral to membrane|peroxisomal matrix|peroxisomal membrane	ATP binding|long-chain fatty acid-CoA ligase activity|phytanate-CoA ligase activity|pristanate-CoA ligase activity			ovary(1)|skin(1)	2		all_lung(180;0.00177)		all cancers(107;1.16e-06)|GBM - Glioblastoma multiforme(94;0.000113)														---	---	---	---
GABPB1	2553	broad.mit.edu	37	15	50570857	50570857	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:50570857C>T	uc001zyb.2	-	9	1584	c.1160G>A	c.(1159-1161)CGT>CAT	p.R387H	GABPB1_uc001zya.2_Missense_Mutation_p.R375H|GABPB1_uc010ufg.1_Missense_Mutation_p.R311H	NM_005254	NP_005245	Q06547	GABP1_HUMAN	GA binding protein transcription factor, beta	387					positive regulation of transcription from RNA polymerase II promoter	nucleus	protein binding|protein heterodimerization activity|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			large_intestine(1)	1																		---	---	---	---
SCG3	29106	broad.mit.edu	37	15	52011689	52011689	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:52011689C>T	uc002abh.2	+	12	1781	c.1373C>T	c.(1372-1374)GCC>GTC	p.A458V	SCG3_uc010ufz.1_Missense_Mutation_p.A226V	NM_013243	NP_037375	Q8WXD2	SCG3_HUMAN	secretogranin III isoform 1 precursor	458					platelet activation|platelet degranulation	extracellular region|stored secretory granule				ovary(1)	1				all cancers(107;0.00488)														---	---	---	---
BCL2L10	10017	broad.mit.edu	37	15	52402180	52402180	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:52402180G>A	uc002abq.2	-							NM_020396	NP_065129			BCL2-like 10 (apoptosis facilitator)						activation of caspase activity|anti-apoptosis|female gamete generation|spermatogenesis	cytosol|integral to membrane|membrane fraction|mitochondrion|nuclear membrane	protein binding				0				all cancers(107;0.0148)														---	---	---	---
PRTG	283659	broad.mit.edu	37	15	55971645	55971645	+	Splice_Site	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:55971645T>C	uc002adg.2	-	7	1022	c.974_splice	c.e7-1	p.A325_splice		NM_173814	NP_776175			protogenin precursor						multicellular organismal development	integral to membrane				large_intestine(1)|ovary(1)|skin(1)	3				all cancers(107;0.00891)|GBM - Glioblastoma multiforme(80;0.135)														---	---	---	---
RFX7	64864	broad.mit.edu	37	15	56386864	56386864	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:56386864C>A	uc010bfn.2	-	9	3062	c.3062G>T	c.(3061-3063)AGG>ATG	p.R1021M	RFX7_uc010ugk.1_RNA|RFX7_uc002adn.1_Missense_Mutation_p.R835M	NM_022841	NP_073752	Q2KHR2	RFX7_HUMAN	regulatory factor X domain containing 2	924					regulation of transcription, DNA-dependent	nucleus	DNA binding				0																		---	---	---	---
FAM63B	54629	broad.mit.edu	37	15	59080107	59080107	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59080107G>A	uc002afj.2	+	2	1045	c.843G>A	c.(841-843)GTG>GTA	p.V281V	FAM63B_uc002afi.2_Silent_p.V281V|FAM63B_uc002afk.2_RNA|FAM63B_uc002afl.2_RNA	NM_001040450	NP_001035540	Q8NBR6	FA63B_HUMAN	hypothetical protein LOC54629 isoform a	281										central_nervous_system(1)	1																		---	---	---	---
FOXB1	27023	broad.mit.edu	37	15	60297902	60297902	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:60297902C>T	uc002agj.1	+	2	1219	c.740C>T	c.(739-741)CCG>CTG	p.P247L	FOXB1_uc010bgh.1_Intron	NM_012182	NP_036314	Q99853	FOXB1_HUMAN	forkhead box B1	247					axon target recognition|cell migration in diencephalon|epithelial cell differentiation involved in mammary gland alveolus development|floor plate development|hypothalamus cell migration|inferior colliculus development|lactation|mammillothalamic axonal tract development|negative regulation of neuron apoptosis|regulation of sequence-specific DNA binding transcription factor activity|somitogenesis|telencephalon cell migration|visual learning	transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
TLN2	83660	broad.mit.edu	37	15	63004189	63004189	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63004189C>T	uc002alb.3	+	19	2547	c.2547C>T	c.(2545-2547)GCC>GCT	p.A849A		NM_015059	NP_055874	Q9Y4G6	TLN2_HUMAN	talin 2	849					cell adhesion|cell-cell junction assembly|cytoskeletal anchoring at plasma membrane	actin cytoskeleton|cytoplasm|focal adhesion|ruffle|synapse	actin binding|insulin receptor binding|structural constituent of cytoskeleton			ovary(5)|upper_aerodigestive_tract(2)|lung(2)|breast(2)	11																		---	---	---	---
LACTB	114294	broad.mit.edu	37	15	63433525	63433525	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63433525G>A	uc002alw.2	+	6	1204	c.1165G>A	c.(1165-1167)GTG>ATG	p.V389M		NM_032857	NP_116246	P83111	LACTB_HUMAN	lactamase, beta isoform a	389						mitochondrion	hydrolase activity				0																		---	---	---	---
HERC1	8925	broad.mit.edu	37	15	63918223	63918223	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63918223G>A	uc002amp.2	-	71	13384	c.13236C>T	c.(13234-13236)TAC>TAT	p.Y4412Y		NM_003922	NP_003913	Q15751	HERC1_HUMAN	hect domain and RCC1-like domain 1	4412					protein modification process|transport	cytosol|Golgi apparatus|membrane	acid-amino acid ligase activity|ARF guanyl-nucleotide exchange factor activity			ovary(6)|breast(6)|lung(5)|central_nervous_system(2)	19																		---	---	---	---
SNX1	6642	broad.mit.edu	37	15	64419453	64419453	+	Splice_Site	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:64419453T>C	uc002amv.2	+	7	767	c.731_splice	c.e7+2	p.R244_splice	SNX1_uc010bgv.2_Splice_Site|SNX1_uc010uio.1_Splice_Site_p.R244_splice|SNX1_uc002amw.2_Splice_Site_p.R244_splice|SNX1_uc002amx.2_Splice_Site_p.R179_splice|SNX1_uc002amy.2_Splice_Site_p.R173_splice|SNX1_uc010bgw.2_Splice_Site_p.R146_splice	NM_003099	NP_003090			sorting nexin 1 isoform a						cell communication|early endosome to Golgi transport|endocytosis|intracellular protein transport	early endosome membrane|Golgi apparatus	phosphatidylinositol binding|protein binding|protein transporter activity				0																		---	---	---	---
RASL12	51285	broad.mit.edu	37	15	65360092	65360092	+	Missense_Mutation	SNP	G	A	A	rs138402311	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65360092G>A	uc002aoi.1	-	1	297	c.82C>T	c.(82-84)CGC>TGC	p.R28C	RASL12_uc002aoj.1_Missense_Mutation_p.R28C|RASL12_uc010uir.1_Intron	NM_016563	NP_057647	Q9NYN1	RASLC_HUMAN	RAS-like, family 12 protein	28	GTP (By similarity).				small GTPase mediated signal transduction	membrane	GTP binding|GTPase activity			skin(1)	1																		---	---	---	---
LCTL	197021	broad.mit.edu	37	15	66845477	66845477	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:66845477A>G	uc002aqc.2	-	9	1174	c.1042T>C	c.(1042-1044)TAC>CAC	p.Y348H	LCTL_uc002aqd.3_Missense_Mutation_p.Y175H|LCTL_uc010bhw.2_Missense_Mutation_p.Y46H	NM_207338	NP_997221	Q6UWM7	LCTL_HUMAN	lactase-like precursor	348	Extracellular (Potential).				carbohydrate metabolic process	endoplasmic reticulum membrane|integral to membrane	cation binding|hydrolase activity, hydrolyzing O-glycosyl compounds			ovary(2)	2																		---	---	---	---
NOX5	79400	broad.mit.edu	37	15	69223065	69223065	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:69223065C>T	uc002arp.1	+						NOX5_uc002arq.1_Intron|NOX5_uc010bid.1_Intron|NOX5_uc002aro.2_Intron|SPESP1_uc002arn.1_Intron	NM_024505	NP_078781			NADPH oxidase, EF-hand calcium binding domain 5						angiogenesis|angiogenesis|cytokine secretion|cytokinesis|electron transport chain|endothelial cell proliferation|induction of apoptosis|positive regulation of reactive oxygen species metabolic process|regulation of fusion of sperm to egg plasma membrane|regulation of proton transport|superoxide anion generation	endoplasmic reticulum|endoplasmic reticulum|integral to membrane	calcium ion binding|electron carrier activity|flavin adenine dinucleotide binding|heme binding|hydrogen ion channel activity|NADP binding|superoxide-generating NADPH oxidase activity			breast(1)|pancreas(1)	2																		---	---	---	---
UACA	55075	broad.mit.edu	37	15	70961645	70961645	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:70961645G>A	uc002asr.2	-	16	1482	c.1378C>T	c.(1378-1380)CGA>TGA	p.R460*	UACA_uc010uke.1_Nonsense_Mutation_p.R351*|UACA_uc002asq.2_Nonsense_Mutation_p.R447*|UACA_uc010bin.1_Nonsense_Mutation_p.R435*	NM_018003	NP_060473	Q9BZF9	UACA_HUMAN	uveal autoantigen with coiled-coil domains and	460	Potential.					cytoskeleton|extracellular region				ovary(2)|pancreas(1)|skin(1)	4																		---	---	---	---
NEO1	4756	broad.mit.edu	37	15	73418762	73418762	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:73418762T>C	uc002avm.3	+	4	871	c.729T>C	c.(727-729)CCT>CCC	p.P243P	NEO1_uc010ukx.1_Silent_p.P243P|NEO1_uc010uky.1_Silent_p.P243P|NEO1_uc010ukz.1_5'UTR	NM_002499	NP_002490	Q92859	NEO1_HUMAN	neogenin homolog 1 precursor	243	Extracellular (Potential).|Ig-like C2-type 3.				axon guidance|cell adhesion|positive regulation of muscle cell differentiation	Golgi apparatus|integral to plasma membrane|nucleus				pancreas(1)	1																		---	---	---	---
TMC3	342125	broad.mit.edu	37	15	81631013	81631013	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:81631013G>A	uc002bgo.1	-	18	2064	c.2064C>T	c.(2062-2064)CCC>CCT	p.P688P	TMC3_uc010blr.1_RNA|TMC3_uc002bgp.2_Silent_p.P688P	NM_001080532	NP_001074001	Q7Z5M5	TMC3_HUMAN	transmembrane channel-like 3	688	Helical; (Potential).					integral to membrane				ovary(1)|liver(1)	2																		---	---	---	---
MEX3B	84206	broad.mit.edu	37	15	82336392	82336392	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:82336392C>T	uc002bgq.1	-	2	1134	c.819G>A	c.(817-819)ACG>ACA	p.T273T		NM_032246	NP_115622	Q6ZN04	MEX3B_HUMAN	mex-3 homolog B	273					protein autophosphorylation	cytoplasmic mRNA processing body|nucleus	calcium ion binding|RNA binding|zinc ion binding			breast(1)|kidney(1)	2																		---	---	---	---
BTBD1	53339	broad.mit.edu	37	15	83735743	83735743	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:83735743G>A	uc002bjn.2	-	1	364	c.161C>T	c.(160-162)TCG>TTG	p.S54L	BTBD1_uc002bjo.2_Missense_Mutation_p.S54L	NM_025238	NP_079514	Q9H0C5	BTBD1_HUMAN	BTB (POZ) domain containing 1 isoform 1	54						cytoplasmic mRNA processing body|protein complex	protein binding			ovary(1)|central_nervous_system(1)	2				all cancers(203;0.000186)														---	---	---	---
WDR73	84942	broad.mit.edu	37	15	85191826	85191826	+	Missense_Mutation	SNP	G	A	A	rs150818024	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:85191826G>A	uc002bkw.2	-	4	245	c.229C>T	c.(229-231)CGC>TGC	p.R77C	WDR73_uc002bkv.2_RNA|WDR73_uc002bkx.2_RNA|WDR73_uc010upa.1_Missense_Mutation_p.R77C	NM_032856	NP_116245	Q6P4I2	WDR73_HUMAN	WD repeat domain 73	77											0																		---	---	---	---
AGBL1	123624	broad.mit.edu	37	15	86838491	86838491	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:86838491T>C	uc002blz.1	+	16	2168	c.2088T>C	c.(2086-2088)CAT>CAC	p.H696H	AGBL1_uc002bma.1_Silent_p.H427H|AGBL1_uc002bmb.1_Silent_p.H390H	NM_152336	NP_689549	Q96MI9	CBPC4_HUMAN	ATP/GTP binding protein-like 1	696					C-terminal protein deglutamylation|protein side chain deglutamylation|proteolysis	cytosol	metallocarboxypeptidase activity|tubulin binding|zinc ion binding				0																		---	---	---	---
DET1	55070	broad.mit.edu	37	15	89074530	89074530	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:89074530T>C	uc002bmr.2	-	2	559	c.407A>G	c.(406-408)AAT>AGT	p.N136S	DET1_uc002bmp.3_RNA|DET1_uc010bnk.2_RNA|DET1_uc002bmq.2_Missense_Mutation_p.N147S	NM_001144074	NP_001137546	Q7L5Y6	DET1_HUMAN	de-etiolated 1 isoform 2	136						nucleus				lung(1)|pancreas(1)	2	Lung NSC(78;0.105)|all_lung(78;0.182)		BRCA - Breast invasive adenocarcinoma(143;0.188)															---	---	---	---
ANPEP	290	broad.mit.edu	37	15	90346503	90346503	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:90346503G>A	uc002bop.3	-	10	1828	c.1536C>T	c.(1534-1536)ACC>ACT	p.T512T		NM_001150	NP_001141	P15144	AMPN_HUMAN	membrane alanine aminopeptidase precursor	512	Extracellular.|Metalloprotease.				angiogenesis|cell differentiation|interspecies interaction between organisms	cytosol|ER-Golgi intermediate compartment|integral to plasma membrane	aminopeptidase activity|metallopeptidase activity|receptor activity|zinc ion binding			ovary(3)|skin(1)	4	Lung NSC(78;0.0221)|all_lung(78;0.0448)		BRCA - Breast invasive adenocarcinoma(143;0.0146)|KIRC - Kidney renal clear cell carcinoma(17;0.0286)|Kidney(142;0.0514)|STAD - Stomach adenocarcinoma(125;0.169)		Ezetimibe(DB00973)													---	---	---	---
CRTC3	64784	broad.mit.edu	37	15	91161107	91161107	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91161107C>T	uc002bpp.2	+						CRTC3_uc002bpo.2_Intron	NM_022769	NP_073606			transducer of regulated CREB protein 3 isoform						interspecies interaction between organisms|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus			CRTC3/MAML2(26)	salivary_gland(26)|ovary(1)	27	Melanoma(11;0.00551)|Lung NSC(78;0.0931)|all_lung(78;0.163)		BRCA - Breast invasive adenocarcinoma(143;0.0745)					T	MAML2	salivary gland mucoepidermoid								---	---	---	---
BLM	641	broad.mit.edu	37	15	91346819	91346819	+	Missense_Mutation	SNP	G	A	A	rs140387675		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91346819G>A	uc002bpr.2	+	18	3524	c.3427G>A	c.(3427-3429)GAA>AAA	p.E1143K	BLM_uc010uqh.1_Missense_Mutation_p.E1143K|BLM_uc010uqi.1_Missense_Mutation_p.E768K|BLM_uc010bnx.2_Intron|BLM_uc002bpt.2_Missense_Mutation_p.E118K	NM_000057	NP_000048	P54132	BLM_HUMAN	Bloom syndrome protein	1143					double-strand break repair via homologous recombination|G2 phase of mitotic cell cycle|G2/M transition DNA damage checkpoint|negative regulation of cell division|positive regulation of transcription, DNA-dependent|protein oligomerization|regulation of cyclin-dependent protein kinase activity|replication fork processing|replication fork protection|response to X-ray	cytoplasm|lateral element|nuclear matrix|nucleolus|PML body	ATP binding|bubble DNA binding|DNA strand annealing activity|four-way junction helicase activity|G-quadruplex DNA binding|p53 binding			ovary(3)|skin(2)|breast(1)	6	Lung NSC(78;0.0875)|all_lung(78;0.109)		Lung(145;0.189)					Mis|N|F			leukemia|lymphoma|skin squamous cell |other cancers		Genes_defective_in_diseases_associated_with_sensitivity_to_DNA_damaging_agents	Bloom_syndrome				---	---	---	---
IGF1R	3480	broad.mit.edu	37	15	99434589	99434589	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:99434589G>A	uc002bul.2	+	3	726	c.676G>A	c.(676-678)GAG>AAG	p.E226K	IGF1R_uc010urq.1_Missense_Mutation_p.E226K|IGF1R_uc010bon.2_Missense_Mutation_p.E226K	NM_000875	NP_000866	P08069	IGF1R_HUMAN	insulin-like growth factor 1 receptor precursor	226					anti-apoptosis|immune response|insulin receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of DNA replication|protein autophosphorylation|protein tetramerization	microsome	ATP binding|identical protein binding|insulin binding|insulin receptor binding|insulin receptor substrate binding|insulin-like growth factor I binding|insulin-like growth factor receptor activity|metal ion binding|phosphatidylinositol 3-kinase binding			lung(3)|kidney(3)|ovary(1)|central_nervous_system(1)	8	all_cancers(4;4.17e-14)|all_epithelial(3;4.34e-15)|Lung NSC(78;0.00175)|all_lung(78;0.00351)|Melanoma(26;0.00505)|Medulloblastoma(229;0.163)		Epithelial(2;1.94e-12)|all cancers(5;6.83e-11)|BRCA - Breast invasive adenocarcinoma(2;2.88e-09)|OV - Ovarian serous cystadenocarcinoma(32;0.00261)		Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Mecasermin(DB01277)													---	---	---	---
SYNM	23336	broad.mit.edu	37	15	99670476	99670476	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:99670476C>T	uc002bup.2	+	6	2031	c.1911C>T	c.(1909-1911)ACC>ACT	p.T637T	SYNM_uc002buo.2_Silent_p.T637T|SYNM_uc002buq.2_Intron	NM_145728	NP_663780	O15061	SYNEM_HUMAN	desmuslin isoform A	637	Tail.				intermediate filament cytoskeleton organization	adherens junction|costamere|intermediate filament|neurofilament cytoskeleton	intermediate filament binding|structural constituent of cytoskeleton|structural constituent of muscle|vinculin binding			ovary(3)|central_nervous_system(1)	4																		---	---	---	---
SOLH	6650	broad.mit.edu	37	16	603450	603450	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:603450C>A	uc002chi.2	+	14	3558	c.3195C>A	c.(3193-3195)TCC>TCA	p.S1065S	SOLH_uc002chj.2_Silent_p.S125S	NM_005632	NP_005623	O75808	CAN15_HUMAN	small optic lobes	1065					proteolysis	intracellular	calcium-dependent cysteine-type endopeptidase activity|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|breast(1)	2		Hepatocellular(780;0.00335)																---	---	---	---
RAB40C	57799	broad.mit.edu	37	16	675439	675439	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:675439T>G	uc002chr.2	+	4	388	c.272T>G	c.(271-273)CTC>CGC	p.L91R	RAB40C_uc002chq.2_Missense_Mutation_p.L91R	NM_021168	NP_066991	Q96S21	RB40C_HUMAN	RAB40C, member RAS oncogene family	91					protein transport|small GTPase mediated signal transduction	plasma membrane	GTP binding				0		Hepatocellular(780;0.0218)																---	---	---	---
BAIAP3	8938	broad.mit.edu	37	16	1396487	1396487	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1396487G>A	uc002clk.1	+	26	2643	c.2643G>A	c.(2641-2643)TCG>TCA	p.S881S	BAIAP3_uc002clj.2_Silent_p.S863S|BAIAP3_uc010uuz.1_Silent_p.S846S|BAIAP3_uc010uva.1_Silent_p.S818S|BAIAP3_uc010uvc.1_Silent_p.S810S	NM_003933	NP_003924	O94812	BAIP3_HUMAN	BAI1-associated protein 3	881					G-protein coupled receptor protein signaling pathway|neurotransmitter secretion		protein C-terminus binding			pancreas(1)	1		Hepatocellular(780;0.0893)																---	---	---	---
HAGH	3029	broad.mit.edu	37	16	1867196	1867196	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1867196C>A	uc002cna.2	-	6	1025	c.618G>T	c.(616-618)GAG>GAT	p.E206D	HAGH_uc002cmz.2_Missense_Mutation_p.E158D|HAGH_uc010uvp.1_Missense_Mutation_p.R170M|HAGH_uc002cnb.1_Missense_Mutation_p.E158D	NM_005326	NP_005317	Q16775	GLO2_HUMAN	hydroxyacylglutathione hydrolase isoform 1	206					glutathione biosynthetic process	cytoplasm|mitochondrial matrix|mitochondrial matrix	hydroxyacylglutathione hydrolase activity|zinc ion binding			ovary(1)	1		Hepatocellular(780;0.00335)			Glutathione(DB00143)													---	---	---	---
CCNF	899	broad.mit.edu	37	16	2487153	2487153	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2487153G>A	uc002cqd.1	+	5	458	c.370G>A	c.(370-372)GCA>ACA	p.A124T	CCNF_uc002cqe.1_5'UTR	NM_001761	NP_001752	P41002	CCNF_HUMAN	cyclin F	124					cell division|mitosis|negative regulation of centrosome duplication|protein ubiquitination|SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	centriole|nucleus|SCF ubiquitin ligase complex	protein binding			central_nervous_system(1)|kidney(1)	2		Ovarian(90;0.17)																---	---	---	---
AMDHD2	51005	broad.mit.edu	37	16	2577820	2577820	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2577820G>A	uc002cqq.2	+	5	559	c.462G>A	c.(460-462)GCG>GCA	p.A154A	AMDHD2_uc002cqp.2_Silent_p.A154A|AMDHD2_uc010uwc.1_Silent_p.A154A|AMDHD2_uc010uwd.1_5'UTR	NM_015944	NP_057028	Q9Y303	NAGA_HUMAN	amidohydrolase domain containing 2 isoform 1	154				A -> T (in Ref. 1; AAD27723).	N-acetylglucosamine metabolic process		N-acetylglucosamine-6-phosphate deacetylase activity			skin(2)|large_intestine(1)|breast(1)	4																		---	---	---	---
SRRM2	23524	broad.mit.edu	37	16	2818182	2818182	+	Silent	SNP	G	C	C	rs149616150	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2818182G>C	uc002crk.2	+	11	8202	c.7653G>C	c.(7651-7653)TCG>TCC	p.S2551S	SRRM2_uc002crj.1_Silent_p.S2455S|SRRM2_uc002crl.1_Silent_p.S2551S|SRRM2_uc010bsu.1_Silent_p.S2455S	NM_016333	NP_057417	Q9UQ35	SRRM2_HUMAN	splicing coactivator subunit SRm300	2551	Ser-rich.					Cajal body|catalytic step 2 spliceosome|nuclear speck	C2H2 zinc finger domain binding|protein N-terminus binding|RNA binding			ovary(1)|pancreas(1)|central_nervous_system(1)|skin(1)	4																		---	---	---	---
ZSCAN10	84891	broad.mit.edu	37	16	3140201	3140201	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3140201G>A	uc002ctv.1	-	5	1157	c.1069C>T	c.(1069-1071)CGC>TGC	p.R357C	ZSCAN10_uc002cty.1_Missense_Mutation_p.R18C|ZSCAN10_uc002ctw.1_Missense_Mutation_p.R275C|ZSCAN10_uc002ctx.1_Missense_Mutation_p.R285C	NM_032805	NP_116194	Q96SZ4	ZSC10_HUMAN	zinc finger and SCAN domain containing 10	357	C2H2-type 3.				negative regulation of transcription, DNA-dependent|viral reproduction	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1																		---	---	---	---
ZNF597	146434	broad.mit.edu	37	16	3487250	3487250	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3487250T>A	uc002cvd.2	-	4	633	c.449A>T	c.(448-450)GAA>GTA	p.E150V		NM_152457	NP_689670	Q96LX8	ZN597_HUMAN	zinc finger protein 597	150					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
CLUAP1	23059	broad.mit.edu	37	16	3558347	3558347	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3558347C>T	uc002cvk.1	+	4	383	c.278C>T	c.(277-279)GCG>GTG	p.A93V	CLUAP1_uc002cvj.1_Missense_Mutation_p.A93V|CLUAP1_uc002cvl.1_Missense_Mutation_p.A93V|CLUAP1_uc002cvm.1_5'Flank	NM_015041	NP_055856	Q96AJ1	CLUA1_HUMAN	clusterin associated protein 1 isoform 1	93						nucleus	protein binding			ovary(1)|breast(1)|pancreas(1)	3																		---	---	---	---
TFAP4	7023	broad.mit.edu	37	16	4308193	4308193	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:4308193G>A	uc010uxg.1	-	7	1134	c.880C>T	c.(880-882)CGA>TGA	p.R294*		NM_003223	NP_003214	Q01664	TFAP4_HUMAN	transcription factor AP-4 (activating enhancer	294					DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|negative regulation by host of viral transcription|negative regulation of cell cycle arrest|negative regulation of cell proliferation|negative regulation of cyclin-dependent protein kinase activity|negative regulation of DNA binding|negative regulation of transcription, DNA-dependent|positive regulation by host of viral transcription|positive regulation of apoptosis|positive regulation of transcription from RNA polymerase II promoter|protein complex assembly|regulation of S phase of mitotic cell cycle	transcriptional repressor complex	E-box binding|histone deacetylase binding|protein homodimerization activity|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity			ovary(1)	1																		---	---	---	---
A2BP1	54715	broad.mit.edu	37	16	7703854	7703854	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:7703854C>T	uc002cys.2	+	12	1783	c.795C>T	c.(793-795)GCC>GCT	p.A265A	A2BP1_uc010buf.1_Silent_p.A265A|A2BP1_uc002cyr.1_Silent_p.A264A|A2BP1_uc002cyt.2_Silent_p.A238A|A2BP1_uc010uxz.1_Silent_p.A308A|A2BP1_uc010uya.1_Silent_p.A222A|A2BP1_uc002cyv.1_Silent_p.A265A|A2BP1_uc010uyb.1_Silent_p.A265A|A2BP1_uc002cyw.2_Silent_p.A285A|A2BP1_uc002cyy.2_Silent_p.A285A|A2BP1_uc002cyx.2_Silent_p.A285A|A2BP1_uc010uyc.1_Silent_p.A258A	NM_018723	NP_061193	Q9NWB1	RFOX1_HUMAN	ataxin 2-binding protein 1 isoform 4	265					mRNA processing|RNA splicing|RNA transport	nucleus|trans-Golgi network	nucleotide binding|protein C-terminus binding|RNA binding				0		all_cancers(2;4.54e-52)|Colorectal(2;6.95e-44)|all_epithelial(2;1.15e-37)|Lung NSC(2;0.000289)|all_lung(2;0.00148)|Myeloproliferative disorder(2;0.0122)|Medulloblastoma(2;0.0354)|all_neural(2;0.0381)|all_hematologic(2;0.0749)|Renal(2;0.0758)|Melanoma(2;0.211)		Colorectal(1;3.55e-51)|COAD - Colon adenocarcinoma(2;1.92e-46)|all cancers(1;5.36e-16)|Epithelial(1;3.98e-15)|READ - Rectum adenocarcinoma(2;3.71e-05)|GBM - Glioblastoma multiforme(1;0.0499)														---	---	---	---
TMEM186	25880	broad.mit.edu	37	16	8889880	8889880	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:8889880G>A	uc002cze.2	-	2	605	c.571C>T	c.(571-573)CTG>TTG	p.L191L	PMM2_uc002czf.3_5'Flank|PMM2_uc010uyf.1_5'Flank|PMM2_uc010uyg.1_5'Flank|PMM2_uc010uyh.1_5'Flank|PMM2_uc010buj.2_5'Flank|PMM2_uc010uyi.1_5'Flank|PMM2_uc010uye.1_5'Flank	NM_015421	NP_056236	Q96B77	TM186_HUMAN	transmembrane protein 186	191						integral to membrane|mitochondrion				ovary(1)	1																		---	---	---	---
CIITA	4261	broad.mit.edu	37	16	11001797	11001797	+	Silent	SNP	C	T	T	rs112250421	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11001797C>T	uc002dai.3	+	11	2581	c.2448C>T	c.(2446-2448)GCC>GCT	p.A816A	CIITA_uc002daj.3_Silent_p.A817A|CIITA_uc002dak.3_Intron|CIITA_uc002dag.2_Silent_p.A816A|CIITA_uc002dah.2_Silent_p.A768A|CIITA_uc010bup.1_Intron	NM_000246	NP_000237	P33076	C2TA_HUMAN	class II transactivator	816					interferon-gamma-mediated signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of MHC class I biosynthetic process|positive regulation of transcription from RNA polymerase II promoter|response to antibiotic|transcription, DNA-dependent	nucleus	activating transcription factor binding|ATP binding|protein C-terminus binding|protein complex binding|transcription coactivator activity|transcription regulatory region DNA binding			central_nervous_system(1)	1								T	FLJ27352|CD274|CD273|RALGDS|RUNDC2A|C16orf75	PMBL|Hodgkin Lymphona|								---	---	---	---
TNFRSF17	608	broad.mit.edu	37	16	12061469	12061469	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:12061469G>A	uc002dbv.2	+	3	538	c.320G>A	c.(319-321)AGC>AAC	p.S107N	TNFRSF17_uc010buy.2_3'UTR|TNFRSF17_uc010buz.2_Missense_Mutation_p.S58N	NM_001192	NP_001183	Q02223	TNR17_HUMAN	tumor necrosis factor receptor superfamily,	107	Cytoplasmic (Potential).				cell proliferation|multicellular organismal development	endomembrane system|integral to membrane|plasma membrane					0								T	IL2	intestinal T-cell lymphoma								---	---	---	---
SMG1	23049	broad.mit.edu	37	16	18844470	18844470	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:18844470G>A	uc002dfm.2	-	51	8947	c.8584C>T	c.(8584-8586)CGG>TGG	p.R2862W	SMG1_uc010bwb.2_Missense_Mutation_p.R2722W|SMG1_uc010bwa.2_Missense_Mutation_p.R1593W	NM_015092	NP_055907	Q96Q15	SMG1_HUMAN	PI-3-kinase-related kinase SMG-1	2862					DNA repair|mRNA export from nucleus|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|peptidyl-serine phosphorylation|phosphatidylinositol phosphorylation|protein autophosphorylation	cytoplasm|nucleus	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			breast(5)|stomach(4)|lung(4)|kidney(2)|ovary(1)	16																		---	---	---	---
SYT17	51760	broad.mit.edu	37	16	19195148	19195148	+	Silent	SNP	C	T	T	rs143824200		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19195148C>T	uc002dfw.2	+	5	961	c.630C>T	c.(628-630)GAC>GAT	p.D210D	SYT17_uc002dfx.2_Silent_p.D149D|SYT17_uc002dfy.2_Silent_p.D206D|SYT17_uc002dfv.1_Silent_p.D149D	NM_016524	NP_057608	Q9BSW7	SYT17_HUMAN	B/K protein	210	C2 1.					membrane|synaptic vesicle	transporter activity			ovary(1)	1																		---	---	---	---
TMC5	79838	broad.mit.edu	37	16	19501878	19501878	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19501878C>A	uc002dgc.3	+	18	3484	c.2735C>A	c.(2734-2736)ACC>AAC	p.T912N	TMC5_uc010vaq.1_Missense_Mutation_p.T860N|TMC5_uc002dgb.3_Intron|TMC5_uc010var.1_Missense_Mutation_p.T912N|TMC5_uc002dgd.1_Missense_Mutation_p.T666N|TMC5_uc002dge.3_Missense_Mutation_p.T666N|TMC5_uc002dgf.3_Missense_Mutation_p.T595N|TMC5_uc002dgg.3_Missense_Mutation_p.T553N	NM_001105248	NP_001098718	Q6UXY8	TMC5_HUMAN	transmembrane channel-like 5 isoform a	912	Helical; (Potential).					integral to membrane				skin(1)	1																		---	---	---	---
ACSM2A	123876	broad.mit.edu	37	16	20482476	20482476	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20482476T>C	uc010bwe.2	+	6	917	c.678T>C	c.(676-678)GGT>GGC	p.G226G	ACSM2A_uc010bwd.1_Intron|ACSM2A_uc010vax.1_Silent_p.G147G|ACSM2A_uc002dhf.3_Silent_p.G226G|ACSM2A_uc002dhg.3_Silent_p.G226G|ACSM2A_uc010vay.1_Silent_p.G147G	NM_001010845	NP_001010845	Q08AH3	ACS2A_HUMAN	acyl-CoA synthetase medium-chain family member	226	ATP.				fatty acid metabolic process	mitochondrial matrix	ATP binding|butyrate-CoA ligase activity|metal ion binding			skin(2)|breast(1)	3																		---	---	---	---
DNAH3	55567	broad.mit.edu	37	16	20975756	20975756	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20975756T>C	uc010vbe.1	-	53	9450	c.9450A>G	c.(9448-9450)CAA>CAG	p.Q3150Q	DNAH3_uc010vbd.1_Silent_p.Q585Q	NM_017539	NP_060009	Q8TD57	DYH3_HUMAN	dynein, axonemal, heavy chain 3	3150	AAA 5 (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(10)|skin(3)|large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)	18				GBM - Glioblastoma multiforme(48;0.207)														---	---	---	---
NPIPL3	23117	broad.mit.edu	37	16	21416178	21416178	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21416178G>T	uc002dix.1	-	9	1261	c.1079C>A	c.(1078-1080)CCC>CAC	p.P360H	uc002diq.3_Intron|NPIPL3_uc010bws.2_Missense_Mutation_p.P360H|uc010bwt.1_RNA|NPIPL3_uc010vbg.1_Missense_Mutation_p.P341H|LOC100271836_uc002diu.1_RNA|NPIPL3_uc010bwu.1_Missense_Mutation_p.P177H	NM_130464	NP_569731	Q92617	NPPL3_HUMAN	nuclear pore complex interacting protein-like 3	360						integral to membrane					0																		---	---	---	---
HS3ST2	9956	broad.mit.edu	37	16	22826074	22826074	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:22826074G>A	uc002dli.2	+	1	215	c.143G>A	c.(142-144)CGC>CAC	p.R48H	HS3ST2_uc002dlj.2_RNA	NM_006043	NP_006034	Q9Y278	HS3S2_HUMAN	heparan sulfate D-glucosaminyl	48	Lumenal (Potential).					Golgi membrane|integral to membrane	[heparan sulfate]-glucosamine 3-sulfotransferase 2 activity			ovary(1)|pancreas(1)	2				GBM - Glioblastoma multiforme(48;0.0299)														---	---	---	---
UBFD1	56061	broad.mit.edu	37	16	23573599	23573599	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23573599C>T	uc002dlv.2	+							NM_019116	NP_061989			ubiquitin-binding protein homolog												0				GBM - Glioblastoma multiforme(48;0.0331)														---	---	---	---
CHP2	63928	broad.mit.edu	37	16	23767738	23767738	+	Missense_Mutation	SNP	G	A	A	rs79455352	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23767738G>A	uc002dmb.1	+	5	805	c.382G>A	c.(382-384)GAT>AAT	p.D128N		NM_022097	NP_071380	O43745	CHP2_HUMAN	hepatocellular carcinoma antigen gene 520	128	EF-hand 3.|1 (Potential).						calcium ion binding			central_nervous_system(1)	1				GBM - Glioblastoma multiforme(48;0.0144)														---	---	---	---
GTF3C1	2975	broad.mit.edu	37	16	27514179	27514179	+	Splice_Site	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:27514179C>T	uc002dov.1	-	11	1947	c.1907_splice	c.e11+1	p.T636_splice	GTF3C1_uc002dou.2_Splice_Site_p.T636_splice	NM_001520	NP_001511			general transcription factor IIIC, polypeptide							transcription factor TFIIIC complex	DNA binding|protein binding			ovary(2)|pancreas(1)|breast(1)|skin(1)	5																		---	---	---	---
XPO6	23214	broad.mit.edu	37	16	28167579	28167579	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28167579G>A	uc002dpa.1	-	7	1414	c.913C>T	c.(913-915)CGC>TGC	p.R305C	XPO6_uc002dpb.1_Missense_Mutation_p.R291C|XPO6_uc010vcp.1_Missense_Mutation_p.R305C	NM_015171	NP_055986	Q96QU8	XPO6_HUMAN	exportin 6	305					protein export from nucleus		protein binding|protein transporter activity			ovary(1)|skin(1)	2																		---	---	---	---
PRSS53	339105	broad.mit.edu	37	16	31106893	31106893	+	5'Flank	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31106893G>A	uc002ear.2	-						VKORC1_uc002eas.2_5'Flank|VKORC1_uc002eat.2_5'Flank|VKORC1_uc002eau.2_5'Flank	NM_001039503	NP_001034592			polyserase 3 precursor						proteolysis	extracellular region	serine-type endopeptidase activity				0																		---	---	---	---
ITGAD	3681	broad.mit.edu	37	16	31434704	31434704	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31434704T>C	uc002ebv.1	+	25	2940	c.2891T>C	c.(2890-2892)ATC>ACC	p.I964T	ITGAD_uc010cap.1_Missense_Mutation_p.I965T	NM_005353	NP_005344	Q13349	ITAD_HUMAN	integrin, alpha D precursor	964	Extracellular (Potential).				cell-cell adhesion|cell-matrix adhesion|immune response|integrin-mediated signaling pathway	integrin complex	receptor activity			skin(1)	1																		---	---	---	---
PHKB	5257	broad.mit.edu	37	16	47683124	47683124	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:47683124G>A	uc002eev.3	+						PHKB_uc002eeu.3_Intron	NM_000293	NP_000284			phosphorylase kinase, beta isoform a						glucose metabolic process|glycogen catabolic process	cytosol|plasma membrane	calmodulin binding|glucan 1,4-alpha-glucosidase activity			ovary(1)|large_intestine(1)|breast(1)	3		all_cancers(37;0.00447)|all_lung(18;0.00616)|Lung NSC(13;0.0418)|Breast(268;0.203)																---	---	---	---
ABCC12	94160	broad.mit.edu	37	16	48174686	48174686	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:48174686G>A	uc002efc.1	-	4	915	c.569C>T	c.(568-570)ACG>ATG	p.T190M	ABCC12_uc002eey.1_RNA|ABCC12_uc002eez.1_RNA|ABCC12_uc002efa.1_RNA|ABCC12_uc002efb.1_RNA|ABCC12_uc002efd.1_RNA|ABCC12_uc002efe.1_Missense_Mutation_p.T190M|ABCC12_uc010vgj.1_RNA	NM_033226	NP_150229	Q96J65	MRP9_HUMAN	ATP-binding cassette protein C12	190	ABC transmembrane type-1 1.					integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(2)|skin(1)	3		all_cancers(37;0.0474)|all_lung(18;0.047)																---	---	---	---
NKD1	85407	broad.mit.edu	37	16	50667286	50667286	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:50667286G>A	uc002egg.1	+	10	1231	c.1007G>A	c.(1006-1008)CGG>CAG	p.R336Q		NM_033119	NP_149110	Q969G9	NKD1_HUMAN	naked cuticle homolog 1	336					Wnt receptor signaling pathway	cytoplasm|plasma membrane	calcium ion binding|protein binding				0		all_cancers(37;0.229)		GBM - Glioblastoma multiforme(240;0.243)														---	---	---	---
CHD9	80205	broad.mit.edu	37	16	53358011	53358011	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:53358011G>A	uc002ehb.2	+	38	8062	c.7898G>A	c.(7897-7899)CGG>CAG	p.R2633Q	CHD9_uc002egy.2_Missense_Mutation_p.R2617Q|CHD9_uc002ehc.2_Missense_Mutation_p.R2618Q|CHD9_uc002ehf.2_Missense_Mutation_p.R1731Q|CHD9_uc010cbw.2_Missense_Mutation_p.R699Q	NM_025134	NP_079410	Q3L8U1	CHD9_HUMAN	chromodomain helicase DNA binding protein 9	2633					cellular lipid metabolic process|chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleoplasm	ATP binding|DNA binding|helicase activity|protein binding			lung(2)|central_nervous_system(1)|breast(1)|skin(1)|ovary(1)|kidney(1)	7		all_cancers(37;0.0212)																---	---	---	---
NUDT21	11051	broad.mit.edu	37	16	56485017	56485017	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:56485017A>C	uc002eja.2	-	1	245	c.98T>G	c.(97-99)CTG>CGG	p.L33R	OGFOD1_uc002ejb.2_5'Flank|OGFOD1_uc002ejc.2_5'Flank	NM_007006	NP_008937	O43809	CPSF5_HUMAN	cleavage and polyadenylation specific factor 5	33	Necessary for RNA-binding.				mRNA polyadenylation|nuclear mRNA splicing, via spliceosome|protein tetramerization|termination of RNA polymerase II transcription	centrosome|mRNA cleavage factor complex|paraspeckles	AU-rich element binding|histone deacetylase binding|hydrolase activity|mRNA binding|protein homodimerization activity				0																		---	---	---	---
BBS2	583	broad.mit.edu	37	16	56536265	56536265	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:56536265C>T	uc002ejd.2	-	9	1278	c.1044G>A	c.(1042-1044)CTG>CTA	p.L348L	BBS2_uc010ccg.2_3'UTR	NM_031885	NP_114091	Q9BXC9	BBS2_HUMAN	Bardet-Biedl syndrome 2 protein	348					adult behavior|brain morphogenesis|cerebral cortex development|cilium morphogenesis|fat cell differentiation|hippocampus development|melanosome transport|negative regulation of multicellular organism growth|photoreceptor cell maintenance|protein localization to organelle|regulation of cilium beat frequency involved in ciliary motility|sperm axoneme assembly|striatum development	BBSome|cilium membrane|microtubule basal body|motile cilium	protein binding			ovary(1)	1														Bardet-Biedl_syndrome				---	---	---	---
CX3CL1	6376	broad.mit.edu	37	16	57416231	57416231	+	Missense_Mutation	SNP	G	A	A	rs138964688	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57416231G>A	uc002eli.2	+	3	548	c.481G>A	c.(481-483)GTG>ATG	p.V161M		NM_002996	NP_002987	P78423	X3CL1_HUMAN	chemokine (C-X3-C motif) ligand 1 precursor	161	Mucin-like stalk.|Extracellular (Potential).				cell adhesion|cytokine-mediated signaling pathway|defense response|immune response|leukocyte adhesive activation|positive regulation of calcium-independent cell-cell adhesion|positive regulation of inflammatory response	cell surface|extracellular space|integral to membrane|plasma membrane	chemokine activity				0																		---	---	---	---
GPR97	222487	broad.mit.edu	37	16	57712075	57712075	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57712075G>A	uc002emh.2	+						GPR97_uc010cdc.2_Intron|GPR97_uc010vhv.1_Intron|GPR97_uc010cdd.2_Intron|GPR97_uc010cde.2_5'Flank	NM_170776	NP_740746			G protein-coupled receptor 97 precursor						neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(1)	1																		---	---	---	---
CCDC135	84229	broad.mit.edu	37	16	57760170	57760170	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57760170C>T	uc002emi.2	+	13	2038	c.1949C>T	c.(1948-1950)ACG>ATG	p.T650M	CCDC135_uc002emj.2_Missense_Mutation_p.T650M|CCDC135_uc002emk.2_Missense_Mutation_p.T585M	NM_032269	NP_115645	Q8IY82	CC135_HUMAN	coiled-coil domain containing 135	650						cytoplasm				central_nervous_system(1)	1																		---	---	---	---
CCDC113	29070	broad.mit.edu	37	16	58296349	58296349	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:58296349G>A	uc002ene.2	+	6	767	c.688G>A	c.(688-690)GCT>ACT	p.A230T	CCDC113_uc010vid.1_Missense_Mutation_p.A176T	NM_014157	NP_054876	Q9H0I3	CC113_HUMAN	coiled-coil domain containing 113 isoform 1	230	Potential.					protein complex					0																		---	---	---	---
CDH11	1009	broad.mit.edu	37	16	65005898	65005898	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:65005898T>A	uc002eoi.2	-	10	1894	c.1460A>T	c.(1459-1461)AAG>ATG	p.K487M	CDH11_uc010cdn.2_Intron|CDH11_uc002eoj.2_Missense_Mutation_p.K487M|CDH11_uc010vin.1_Missense_Mutation_p.K361M	NM_001797	NP_001788	P55287	CAD11_HUMAN	cadherin 11, type 2 preproprotein	487	Cadherin 5.|Extracellular (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion|ossification|skeletal system development	integral to membrane|plasma membrane	calcium ion binding|protein binding			lung(10)|ovary(3)|skin(1)	14		Ovarian(137;0.0973)		OV - Ovarian serous cystadenocarcinoma(108;0.205)				T	USP6	aneurysmal bone cysts					TSP Lung(24;0.17)			---	---	---	---
CDH16	1014	broad.mit.edu	37	16	66948222	66948222	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:66948222G>A	uc002eql.2	-	7	750	c.677C>T	c.(676-678)ACT>ATT	p.T226I	CDH16_uc010cdy.2_Missense_Mutation_p.T226I|CDH16_uc002eqm.2_Missense_Mutation_p.T129I	NM_004062	NP_004053	O75309	CAD16_HUMAN	cadherin 16 precursor	226	Extracellular (Potential).|Cadherin 2.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)|upper_aerodigestive_tract(1)	3		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0877)|Epithelial(162;0.203)														---	---	---	---
B3GNT9	84752	broad.mit.edu	37	16	67184159	67184159	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67184159G>A	uc002erf.2	-	2	551	c.230C>T	c.(229-231)ACG>ATG	p.T77M	uc002erg.1_3'UTR	NM_033309	NP_171608	Q6UX72	B3GN9_HUMAN	UDP-GlcNAc:betaGal	77	Lumenal (Potential).				protein glycosylation	Golgi membrane|integral to membrane	galactosyltransferase activity				0																		---	---	---	---
ZDHHC1	29800	broad.mit.edu	37	16	67428899	67428899	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67428899G>A	uc010vjm.1	-						TPPP3_uc002eta.2_5'Flank|TPPP3_uc002etb.2_5'Flank	NM_013304	NP_037436			zinc finger, DHHC-type containing 1							integral to membrane	DNA binding|zinc ion binding				0		Ovarian(137;0.223)		UCEC - Uterine corpus endometrioid carcinoma (183;0.0178)|all cancers(182;5.71e-53)|Epithelial(162;4.73e-52)|OV - Ovarian serous cystadenocarcinoma(108;1.53e-29)|Kidney(780;4.37e-05)|BRCA - Breast invasive adenocarcinoma(181;5.8e-05)|GBM - Glioblastoma multiforme(240;0.0022)														---	---	---	---
ACD	65057	broad.mit.edu	37	16	67692931	67692931	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67692931T>C	uc002etq.3	-	7	1140	c.803A>G	c.(802-804)CAG>CGG	p.Q268R	ACD_uc002etp.3_Missense_Mutation_p.Q265R|ACD_uc002etr.3_Missense_Mutation_p.Q265R|ACD_uc010vjt.1_3'UTR|PARD6A_uc002ets.2_5'Flank|PARD6A_uc002ett.2_5'Flank|PARD6A_uc002etu.2_5'Flank	NM_001082486	NP_001075955	Q96AP0	ACD_HUMAN	adrenocortical dysplasia homolog isoform 1	268	Interaction with POT1.				intracellular protein transport|negative regulation of telomere maintenance via telomerase|positive regulation of single-stranded telomeric DNA binding|positive regulation of telomerase activity|protection from non-homologous end joining at telomere|protein localization to chromosome, telomeric region|telomere assembly	nuclear telomere cap complex|nucleoplasm	DNA binding|DNA polymerase binding			pancreas(1)	1		Acute lymphoblastic leukemia(13;3.76e-06)|all_hematologic(13;0.000303)|Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0143)|Epithelial(162;0.047)|all cancers(182;0.228)														---	---	---	---
DUS2L	54920	broad.mit.edu	37	16	68104974	68104974	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68104974G>A	uc002evi.2	+	12	922	c.773G>A	c.(772-774)CGG>CAG	p.R258Q	DUS2L_uc002evj.2_Missense_Mutation_p.R258Q|DUS2L_uc010vkk.1_Missense_Mutation_p.R223Q|DUS2L_uc010cez.2_Missense_Mutation_p.R171Q	NM_017803	NP_060273	Q9NX74	DUS2L_HUMAN	dihydrouridine synthase 2-like, SMM1 homolog	258					tRNA processing	endoplasmic reticulum	double-stranded RNA binding|flavin adenine dinucleotide binding|tRNA dihydrouridine synthase activity				0		Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0131)|Epithelial(162;0.0564)														---	---	---	---
NOB1	28987	broad.mit.edu	37	16	69782198	69782198	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:69782198G>A	uc002exs.2	-	7	777	c.761C>T	c.(760-762)GCG>GTG	p.A254V		NM_014062	NP_054781	Q9ULX3	NOB1_HUMAN	nin one binding protein	254						nucleus	metal ion binding|protein binding				0																		---	---	---	---
COG4	25839	broad.mit.edu	37	16	70514920	70514920	+	Missense_Mutation	SNP	C	T	T	rs142971847		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70514920C>T	uc002ezc.2	-	19	2374	c.2363G>A	c.(2362-2364)CGC>CAC	p.R788H	COG4_uc002eza.2_Missense_Mutation_p.R125H|COG4_uc002ezb.2_Missense_Mutation_p.R244H|COG4_uc010cfu.2_RNA|COG4_uc002ezd.2_Missense_Mutation_p.R767H|COG4_uc002eze.2_Missense_Mutation_p.R482H	NM_015386	NP_056201	Q9H9E3	COG4_HUMAN	component of oligomeric golgi complex 4	784	E domain; essential for proper cell surface glycosylation.				Golgi organization|Golgi vesicle prefusion complex stabilization|protein transport|retrograde vesicle-mediated transport, Golgi to ER	Golgi membrane|Golgi transport complex	protein binding				0		Ovarian(137;0.0694)																---	---	---	---
IL34	146433	broad.mit.edu	37	16	70693588	70693588	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70693588A>T	uc002ezh.1	+	5	853	c.470A>T	c.(469-471)AAG>ATG	p.K157M	IL34_uc002ezi.1_Missense_Mutation_p.K156M	NM_152456	NP_689669	Q6ZMJ4	IL34_HUMAN	interleukin 34 precursor	157					positive regulation of cell proliferation|positive regulation of protein phosphorylation	extracellular space	cytokine activity|growth factor activity|macrophage colony-stimulating factor receptor binding			central_nervous_system(1)|skin(1)	2																		---	---	---	---
MTSS1L	92154	broad.mit.edu	37	16	70697624	70697624	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70697624G>A	uc002ezj.2	-	15	2460	c.2200C>T	c.(2200-2202)CGC>TGC	p.R734C		NM_138383	NP_612392	Q765P7	MTSSL_HUMAN	metastasis suppressor 1-like	734	WH2.				filopodium assembly|signal transduction		actin binding|cytoskeletal adaptor activity|SH3 domain binding			central_nervous_system(1)	1																		---	---	---	---
HYDIN	54768	broad.mit.edu	37	16	70993727	70993727	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70993727C>A	uc002ezr.2	-							NM_032821	NP_116210			hydrocephalus inducing isoform a											ovary(1)|skin(1)	2		Ovarian(137;0.0654)																---	---	---	---
PHLPP2	23035	broad.mit.edu	37	16	71715761	71715761	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71715761G>A	uc002fax.2	-	5	789	c.783C>T	c.(781-783)CTC>CTT	p.L261L	PHLPP2_uc002fav.2_RNA|PHLPP2_uc010cgf.2_Silent_p.L261L|PHLPP2_uc002fay.1_Silent_p.L261L	NM_015020	NP_055835	Q6ZVD8	PHLP2_HUMAN	PH domain and leucine rich repeat protein	261	LRR 1.					cytoplasm|membrane|nucleus	metal ion binding|phosphoprotein phosphatase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
WDR59	79726	broad.mit.edu	37	16	74976648	74976648	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:74976648T>C	uc002fdh.1	-	7	624	c.522A>G	c.(520-522)ATA>ATG	p.I174M	WDR59_uc002fdi.2_Missense_Mutation_p.I174M|WDR59_uc002fdj.2_Missense_Mutation_p.I174M	NM_030581	NP_085058	Q6PJI9	WDR59_HUMAN	WD repeat domain 59	174	WD 3.									ovary(1)|breast(1)	2																		---	---	---	---
TERF2IP	54386	broad.mit.edu	37	16	75681991	75681991	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:75681991C>T	uc002fet.1	+	1	308	c.211C>T	c.(211-213)CTG>TTG	p.L71L	KARS_uc002fer.2_5'Flank|KARS_uc002feq.2_5'Flank|KARS_uc002fes.2_5'Flank|KARS_uc010cha.1_Intron	NM_018975	NP_061848	Q9NYB0	TE2IP_HUMAN	telomeric repeat binding factor 2, interacting	71					negative regulation of DNA recombination at telomere|negative regulation of telomere maintenance|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|protection from non-homologous end joining at telomere|protein localization to chromosome, telomeric region|regulation of double-strand break repair via homologous recombination|telomere maintenance via telomerase|transcription, DNA-dependent	cytoplasm|nuclear telomere cap complex|nucleoplasm	DNA binding|protein binding			central_nervous_system(1)	1																		---	---	---	---
CDYL2	124359	broad.mit.edu	37	16	80718806	80718806	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:80718806C>T	uc002ffs.2	-	2	350	c.245G>A	c.(244-246)CGA>CAA	p.R82Q		NM_152342	NP_689555	Q8N8U2	CDYL2_HUMAN	chromodomain protein, Y-like 2	82						nucleus	catalytic activity|protein binding			central_nervous_system(1)	1																		---	---	---	---
PKD1L2	114780	broad.mit.edu	37	16	81211460	81211460	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:81211460C>T	uc002fgh.1	-	14	2389	c.2389G>A	c.(2389-2391)GCC>ACC	p.A797T	PKD1L2_uc002fgg.1_RNA|PKD1L2_uc002fgi.2_Missense_Mutation_p.A112T|PKD1L2_uc002fgj.2_Missense_Mutation_p.A797T|PKD1L2_uc002fgk.1_5'UTR|PKD1L2_uc002fgl.1_Intron	NM_052892	NP_443124	Q7Z442	PK1L2_HUMAN	polycystin 1-like 2 isoform a	797	REJ.|Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane	calcium ion binding|ion channel activity|sugar binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3																		---	---	---	---
KCNG4	93107	broad.mit.edu	37	16	84256030	84256030	+	Silent	SNP	C	T	T	rs113215329	byFrequency;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84256030C>T	uc010voc.1	-	3	1474	c.1353G>A	c.(1351-1353)ACG>ACA	p.T451T		NM_172347	NP_758857	Q8TDN1	KCNG4_HUMAN	potassium voltage-gated channel, subfamily G,	451	Helical; Name=Segment S6; (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity			breast(3)	3																		---	---	---	---
FOXC2	2303	broad.mit.edu	37	16	86601603	86601603	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:86601603C>T	uc002fjq.2	+	1	747	c.662C>T	c.(661-663)GCG>GTG	p.A221V		NM_005251	NP_005242	Q99958	FOXC2_HUMAN	forkhead box C2	221					anti-apoptosis|artery morphogenesis|blood vessel remodeling|camera-type eye development|cardiac muscle cell proliferation|collagen fibril organization|embryonic heart tube development|embryonic viscerocranium morphogenesis|insulin receptor signaling pathway|lymphangiogenesis|metanephros development|negative regulation of transcription from RNA polymerase II promoter|neural crest cell fate commitment|Notch signaling pathway|ossification|paraxial mesodermal cell fate commitment|patterning of blood vessels|positive regulation of cell adhesion mediated by integrin|positive regulation of cell migration involved in sprouting angiogenesis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of vascular wound healing|regulation of blood vessel size|regulation of organ growth|regulation of sequence-specific DNA binding transcription factor activity|somitogenesis|ureteric bud development|vascular endothelial growth factor receptor signaling pathway|vasculogenesis|ventricular cardiac muscle tissue morphogenesis	transcription factor complex	chromatin DNA binding|DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription factor binding|transcription regulatory region DNA binding				0														Late-onset_Hereditary_Lymphedema				---	---	---	---
ZCCHC14	23174	broad.mit.edu	37	16	87445714	87445714	+	Silent	SNP	C	T	T	rs142665318		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:87445714C>T	uc002fjz.1	-	12	2229	c.2202G>A	c.(2200-2202)GCG>GCA	p.A734A	ZCCHC14_uc002fka.1_RNA|ZCCHC14_uc002fkb.2_Silent_p.A510A	NM_015144	NP_055959	Q8WYQ9	ZCH14_HUMAN	zinc finger, CCHC domain containing 14	734	Ser-rich.				cell communication		nucleic acid binding|phosphatidylinositol binding|zinc ion binding			upper_aerodigestive_tract(1)|breast(1)	2				BRCA - Breast invasive adenocarcinoma(80;0.0285)														---	---	---	---
ZC3H18	124245	broad.mit.edu	37	16	88643530	88643530	+	5'UTR	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88643530C>T	uc002fky.2	+	2					ZC3H18_uc010voy.1_5'UTR|ZC3H18_uc010voz.1_5'UTR|ZC3H18_uc010vpa.1_5'UTR	NM_144604	NP_653205			zinc finger CCCH-type containing 18							nucleus	nucleic acid binding|zinc ion binding			skin(1)	1				BRCA - Breast invasive adenocarcinoma(80;0.0542)														---	---	---	---
PABPN1L	390748	broad.mit.edu	37	16	88931440	88931440	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88931440G>A	uc010vpe.1	-	4	556	c.556C>T	c.(556-558)CAC>TAC	p.H186Y	PABPN1L_uc010vpd.1_Missense_Mutation_p.H186Y|PABPN1L_uc002fmi.2_Missense_Mutation_p.H186Y|PABPN1L_uc002fmj.2_Intron	NM_001080487	NP_001073956	A6NDY0	EPAB2_HUMAN	similar to poly(A)binding protein nuclear-like	186	RRM.					cytoplasm	nucleotide binding|RNA binding				0																		---	---	---	---
C16orf7	9605	broad.mit.edu	37	16	89783024	89783024	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89783024G>A	uc002fom.1	-	4	402	c.277C>T	c.(277-279)CGC>TGC	p.R93C	C16orf7_uc002fol.1_Missense_Mutation_p.R23C|uc002fon.1_RNA|uc002foo.1_Translation_Start_Site	NM_004913	NP_004904	Q9Y2B5	CP007_HUMAN	chromosome 16 open reading frame 7	93					ATP synthesis coupled proton transport		GTPase activator activity|transporter activity				0		Lung NSC(15;2.19e-05)|all_lung(18;3.07e-05)|all_hematologic(23;0.0256)		BRCA - Breast invasive adenocarcinoma(80;0.0273)														---	---	---	---
ZNF276	92822	broad.mit.edu	37	16	89789790	89789790	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89789790G>A	uc002fos.3	+	4	776	c.679G>A	c.(679-681)GTC>ATC	p.V227I	C16orf7_uc002fom.1_5'Flank|ZNF276_uc010ciq.2_Silent_p.A23A|ZNF276_uc002fop.2_Silent_p.A145A|ZNF276_uc002foq.3_Missense_Mutation_p.V152I|ZNF276_uc010cir.2_RNA|ZNF276_uc002for.3_Silent_p.A23A|ZNF276_uc010cis.2_5'UTR|ZNF276_uc002fot.3_RNA|ZNF276_uc010vpm.1_Missense_Mutation_p.V65I|ZNF276_uc010cit.1_5'UTR	NM_001113525	NP_001106997	Q8N554	ZN276_HUMAN	zinc finger protein 276 isoform a	227					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Lung NSC(15;2.19e-05)|all_lung(18;3.07e-05)|all_hematologic(23;0.0256)		BRCA - Breast invasive adenocarcinoma(80;0.0278)														---	---	---	---
TUBB3	10381	broad.mit.edu	37	16	90001343	90001343	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:90001343C>T	uc002fph.1	+	4	549	c.484C>T	c.(484-486)CGC>TGC	p.R162C	TUBB3_uc002fpf.2_Missense_Mutation_p.R509C|TUBB3_uc010ciz.1_Missense_Mutation_p.R90C|TUBB3_uc002fpg.1_Missense_Mutation_p.R16C|TUBB3_uc002fpi.1_Missense_Mutation_p.R90C|TUBB3_uc002fpj.1_Missense_Mutation_p.R90C|TUBB3_uc010cjb.1_Missense_Mutation_p.R16C|TUBB3_uc002fpk.1_Missense_Mutation_p.R16C	NM_006086	NP_006077	Q13509	TBB3_HUMAN	tubulin, beta, 4	162					'de novo' posttranslational protein folding|axon guidance|microtubule-based movement|protein polymerization	cytoplasm|microtubule	GTP binding|GTPase activity|structural molecule activity			ovary(2)|pancreas(1)	3		all_cancers(9;1.69e-11)|Lung NSC(15;8.94e-06)|all_lung(18;1.39e-05)|all_neural(9;0.00581)|all_hematologic(23;0.0194)		BRCA - Breast invasive adenocarcinoma(80;0.0273)														---	---	---	---
C16orf3	750	broad.mit.edu	37	16	90095641	90095641	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:90095641C>T	uc002fqk.1	-	1	669	c.110G>A	c.(109-111)TGC>TAC	p.C37Y	GAS8_uc010vps.1_Intron|GAS8_uc002fqh.2_Intron|GAS8_uc010vpt.1_Intron|GAS8_uc010vpu.1_Intron|GAS8_uc010vpv.1_Intron|GAS8_uc010cjc.1_Intron|GAS8_uc002fqi.1_Intron|GAS8_uc010vpw.1_Intron|GAS8_uc002fqj.1_Intron	NM_001214	NP_001205	O95177	CP003_HUMAN	hypothetical protein LOC750	37											0		all_cancers(9;9.01e-08)|Hepatocellular(780;0.000325)|Lung NSC(15;0.0104)|all_lung(18;0.0239)		BRCA - Breast invasive adenocarcinoma(80;0.0272)														---	---	---	---
GEMIN4	50628	broad.mit.edu	37	17	649966	649966	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:649966G>T	uc002frs.1	-	2	1436	c.1317C>A	c.(1315-1317)GCC>GCA	p.A439A	GEMIN4_uc010vqa.1_3'UTR	NM_015721	NP_056536	P57678	GEMI4_HUMAN	gemin 4	439					rRNA processing|spliceosomal snRNP assembly	Cajal body|cytosol|nucleolus|small nuclear ribonucleoprotein complex|spliceosomal complex	protein binding			ovary(2)|kidney(1)|skin(1)	4		Myeloproliferative disorder(207;0.204)		UCEC - Uterine corpus endometrioid carcinoma (25;0.022)														---	---	---	---
TUSC5	286753	broad.mit.edu	37	17	1183346	1183346	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1183346C>T	uc002fsi.1	+	1	390	c.51C>T	c.(49-51)TCC>TCT	p.S17S		NM_172367	NP_758955	Q8IXB3	TUSC5_HUMAN	LOST1	17					response to biotic stimulus	integral to membrane				skin(2)	2				UCEC - Uterine corpus endometrioid carcinoma (25;0.0822)														---	---	---	---
YWHAE	7531	broad.mit.edu	37	17	1248762	1248762	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1248762G>A	uc002fsj.2	-	6	899	c.747C>T	c.(745-747)GAC>GAT	p.D249D	YWHAE_uc002fsk.2_Silent_p.D227D|YWHAE_uc010vqh.1_RNA|YWHAE_uc010vqi.1_RNA	NM_006761	NP_006752	P62258	1433E_HUMAN	tyrosine 3/tryptophan 5 -monooxygenase	249					apoptosis|G2/M transition of mitotic cell cycle|induction of apoptosis by extracellular signals|interspecies interaction between organisms|intracellular signal transduction|nerve growth factor receptor signaling pathway	cytosol|melanosome	histone deacetylase binding|phosphoserine binding			lung(2)|ovary(1)	3			OV - Ovarian serous cystadenocarcinoma(18;0.203)	UCEC - Uterine corpus endometrioid carcinoma (25;0.0887)														---	---	---	---
CRK	1398	broad.mit.edu	37	17	1359408	1359408	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1359408C>T	uc002fsl.2	-	1	137	c.4G>A	c.(4-6)GCG>ACG	p.A2T	CRK_uc002fsm.2_Missense_Mutation_p.A2T	NM_016823	NP_058431	P46108	CRK_HUMAN	v-crk sarcoma virus CT10 oncogene homolog	2					actin cytoskeleton organization|activation of MAPKK activity|blood coagulation|insulin receptor signaling pathway|nerve growth factor receptor signaling pathway|regulation of transcription from RNA polymerase II promoter	cytosol|endosome|nucleus|plasma membrane	protein binding|SH2 domain binding			lung(2)|central_nervous_system(1)	3				UCEC - Uterine corpus endometrioid carcinoma (25;0.083)														---	---	---	---
KIAA0753	9851	broad.mit.edu	37	17	6510238	6510238	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:6510238A>C	uc002gde.3	-	12	2323	c.1964T>G	c.(1963-1965)CTG>CGG	p.L655R	KIAA0753_uc010vtd.1_Missense_Mutation_p.L111R|KIAA0753_uc010clo.2_Missense_Mutation_p.L356R|KIAA0753_uc010vte.1_Missense_Mutation_p.L356R	NM_014804	NP_055619	Q2KHM9	K0753_HUMAN	hypothetical protein LOC9851	655						centrosome					0				COAD - Colon adenocarcinoma(228;0.157)														---	---	---	---
SLC16A13	201232	broad.mit.edu	37	17	6940102	6940102	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:6940102G>A	uc002geh.2	+	2	564	c.256G>A	c.(256-258)GGA>AGA	p.G86R		NM_201566	NP_963860	Q7RTY0	MOT13_HUMAN	monocarboxylate transporter 13	86	Helical; (Potential).					integral to membrane|plasma membrane	symporter activity			ovary(1)|skin(1)	2																		---	---	---	---
DLG4	1742	broad.mit.edu	37	17	7095236	7095236	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7095236C>T	uc002get.3	-	20	3282	c.2081G>A	c.(2080-2082)CGC>CAC	p.R694H	DLG4_uc010vtm.1_Intron|DLG4_uc010vtn.1_Missense_Mutation_p.R591H|DLG4_uc010cly.2_Missense_Mutation_p.R648H|DLG4_uc010vto.1_Missense_Mutation_p.R691H	NM_001365	NP_001356	P78352	DLG4_HUMAN	post-synaptic density protein 95 isoform 1	651	Guanylate kinase-like.				axon guidance|learning|protein complex assembly|protein localization to synapse|signal transduction|synaptic transmission	cell junction|cortical cytoskeleton|endocytic vesicle membrane|neuron spine|postsynaptic density|postsynaptic membrane|synaptosome	protein binding|protein C-terminus binding			ovary(1)|breast(1)	2																		---	---	---	---
DVL2	1856	broad.mit.edu	37	17	7131322	7131322	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7131322G>T	uc002gez.1	-	10	1358	c.1076C>A	c.(1075-1077)CCT>CAT	p.P359H	DVL2_uc010vtr.1_Missense_Mutation_p.P353H	NM_004422	NP_004413	O14641	DVL2_HUMAN	dishevelled 2	359					canonical Wnt receptor signaling pathway involved in regulation of cell proliferation|intracellular signal transduction|neural tube closure|positive regulation of JUN kinase activity|positive regulation of protein phosphorylation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription, DNA-dependent|segment specification|transcription from RNA polymerase II promoter	cytosol|nucleus|plasma membrane	frizzled binding|identical protein binding|signal transducer activity			lung(1)|kidney(1)	2																		---	---	---	---
DVL2	1856	broad.mit.edu	37	17	7132917	7132917	+	Missense_Mutation	SNP	C	T	T	rs142190934		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7132917C>T	uc002gez.1	-	6	1019	c.737G>A	c.(736-738)CGC>CAC	p.R246H	DVL2_uc010vtr.1_Missense_Mutation_p.R240H|DVL2_uc010vts.1_Missense_Mutation_p.R148H|DVL2_uc010clz.1_3'UTR	NM_004422	NP_004413	O14641	DVL2_HUMAN	dishevelled 2	246					canonical Wnt receptor signaling pathway involved in regulation of cell proliferation|intracellular signal transduction|neural tube closure|positive regulation of JUN kinase activity|positive regulation of protein phosphorylation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription, DNA-dependent|segment specification|transcription from RNA polymerase II promoter	cytosol|nucleus|plasma membrane	frizzled binding|identical protein binding|signal transducer activity			lung(1)|kidney(1)	2																		---	---	---	---
TNK1	8711	broad.mit.edu	37	17	7287908	7287908	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7287908G>T	uc002ggi.3	+	7	1132	c.972G>T	c.(970-972)TGG>TGT	p.W324C	TNK1_uc002ggj.3_Missense_Mutation_p.W324C|TNK1_uc010cmf.2_RNA|TNK1_uc002ggk.3_5'Flank	NM_003985	NP_003976	Q13470	TNK1_HUMAN	tyrosine kinase, non-receptor, 1	324	Protein kinase.				protein autophosphorylation	membrane	ATP binding|non-membrane spanning protein tyrosine kinase activity|protein binding|signal transducer activity			lung(1)|central_nervous_system(1)|pancreas(1)	3		Prostate(122;0.157)																---	---	---	---
KDM6B	23135	broad.mit.edu	37	17	7749498	7749498	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7749498T>C	uc002giw.1	+	6	715	c.339T>C	c.(337-339)CTT>CTC	p.L113L	KDM6B_uc002gix.2_5'Flank	NM_001080424	NP_001073893	O15054	KDM6B_HUMAN	lysine (K)-specific demethylase 6B	113					inflammatory response	nucleus	metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			central_nervous_system(1)|pancreas(1)	2																		---	---	---	---
ALOX12B	242	broad.mit.edu	37	17	7976509	7976509	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7976509G>A	uc002gjy.1	-	14	2144	c.1883C>T	c.(1882-1884)ACG>ATG	p.T628M		NM_001139	NP_001130	O75342	LX12B_HUMAN	arachidonate 12-lipoxygenase, 12R type	628	Lipoxygenase.				epidermis development|leukotriene biosynthetic process		arachidonate 12-lipoxygenase activity|iron ion binding|lipoxygenase activity				0															Multiple Myeloma(8;0.094)			---	---	---	---
ALOX12B	242	broad.mit.edu	37	17	7980427	7980427	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7980427G>A	uc002gjy.1	-	9	1417	c.1156C>T	c.(1156-1158)CGC>TGC	p.R386C	uc010cnq.1_5'Flank	NM_001139	NP_001130	O75342	LX12B_HUMAN	arachidonate 12-lipoxygenase, 12R type	386	Lipoxygenase.				epidermis development|leukotriene biosynthetic process		arachidonate 12-lipoxygenase activity|iron ion binding|lipoxygenase activity				0															Multiple Myeloma(8;0.094)			---	---	---	---
MYH10	4628	broad.mit.edu	37	17	8409646	8409646	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8409646C>T	uc002gll.2	-	25	3379	c.3283G>A	c.(3283-3285)GCA>ACA	p.A1095T	MYH10_uc002glm.2_Missense_Mutation_p.A1126T|MYH10_uc010cnx.2_Missense_Mutation_p.A1104T	NM_005964	NP_005955	P35580	MYH10_HUMAN	myosin, heavy polypeptide 10, non-muscle	1095	Potential.				actin filament-based movement|axon guidance|cytokinesis after mitosis|regulation of cell shape	cell cortex|cleavage furrow|midbody|myosin complex|stress fiber	actin filament binding|actin-dependent ATPase activity|ADP binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(2)	2																		---	---	---	---
MFSD6L	162387	broad.mit.edu	37	17	8701914	8701914	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8701914G>A	uc002glp.1	-	1	673	c.525C>T	c.(523-525)TCC>TCT	p.S175S		NM_152599	NP_689812	Q8IWD5	MFS6L_HUMAN	major facilitator superfamily domain containing	175						integral to membrane				central_nervous_system(1)	1																		---	---	---	---
GLP2R	9340	broad.mit.edu	37	17	9760756	9760756	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:9760756C>T	uc002gmd.1	+	6	628	c.628C>T	c.(628-630)CGC>TGC	p.R210C		NM_004246	NP_004237	O95838	GLP2R_HUMAN	glucagon-like peptide 2 receptor precursor	210	Cytoplasmic (Potential).				G-protein signaling, coupled to cAMP nucleotide second messenger|positive regulation of cell proliferation	integral to membrane|plasma membrane				lung(2)|ovary(1)	3					Glucagon recombinant(DB00040)													---	---	---	---
MYH13	8735	broad.mit.edu	37	17	10216027	10216027	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10216027G>A	uc002gmk.1	-	31	4319	c.4229C>T	c.(4228-4230)ACG>ATG	p.T1410M		NM_003802	NP_003793	Q9UKX3	MYH13_HUMAN	myosin, heavy polypeptide 13, skeletal muscle	1410	Potential.				muscle contraction	muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(4)|skin(2)	6																		---	---	---	---
MYH4	4622	broad.mit.edu	37	17	10360811	10360811	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10360811A>G	uc002gmn.2	-	16	1934	c.1823T>C	c.(1822-1824)GTG>GCG	p.V608A	uc002gml.1_Intron	NM_017533	NP_060003	Q9Y623	MYH4_HUMAN	myosin, heavy polypeptide 4, skeletal muscle	608	Myosin head-like.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(10)|skin(2)|central_nervous_system(1)	13																		---	---	---	---
NCOR1	9611	broad.mit.edu	37	17	16075241	16075241	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:16075241A>G	uc002gpo.2	-	4	551	c.311T>C	c.(310-312)CTG>CCG	p.L104P	NCOR1_uc002gpn.2_Missense_Mutation_p.L104P|NCOR1_uc002gpp.1_Intron|NCOR1_uc002gpr.2_Intron|NCOR1_uc002gps.1_Missense_Mutation_p.L104P|NCOR1_uc010coz.1_5'UTR|NCOR1_uc010cpb.1_Missense_Mutation_p.L104P|NCOR1_uc010cpa.1_Missense_Mutation_p.L104P|NCOR1_uc002gpu.2_Missense_Mutation_p.L104P	NM_006311	NP_006302	O75376	NCOR1_HUMAN	nuclear receptor co-repressor 1	104	Interaction with ZBTB33 and HEXIM1.				cellular lipid metabolic process|chromatin modification|negative regulation of JNK cascade|regulation of glycolysis by negative regulation of transcription from an RNA polymerase II promoter|regulation of lipid transport by negative regulation of transcription from an RNA polymerase II promoter|spindle assembly|transcription from RNA polymerase II promoter	nuclear chromatin|spindle microtubule|transcriptional repressor complex	histone deacetylase binding|transcription corepressor activity|transcription regulatory region DNA binding			upper_aerodigestive_tract(2)|ovary(1)|central_nervous_system(1)|kidney(1)	5				UCEC - Uterine corpus endometrioid carcinoma (92;0.101)														---	---	---	---
LLGL1	3996	broad.mit.edu	37	17	18140801	18140801	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18140801G>A	uc002gsp.2	+	14	1679	c.1618G>A	c.(1618-1620)GTA>ATA	p.V540I		NM_004140	NP_004131	Q15334	L2GL1_HUMAN	lethal giant larvae homolog 1	540	WD 9.				cortical actin cytoskeleton organization|exocytosis|protein complex assembly	cortical actin cytoskeleton	protein kinase binding|structural molecule activity			breast(2)|skin(2)|ovary(1)|haematopoietic_and_lymphoid_tissue(1)	6	all_neural(463;0.228)																	---	---	---	---
SLC5A10	125206	broad.mit.edu	37	17	18880290	18880290	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18880290G>A	uc002guu.1	+	9	1011	c.970G>A	c.(970-972)GCA>ACA	p.A324T	SLC5A10_uc002gur.1_Missense_Mutation_p.A241T|SLC5A10_uc002gut.1_Missense_Mutation_p.A324T|SLC5A10_uc002guv.1_Missense_Mutation_p.A297T|SLC5A10_uc010vyl.1_Missense_Mutation_p.A324T|FAM83G_uc002guw.2_Intron	NM_001042450	NP_001035915	A0PJK1	SC5AA_HUMAN	solute carrier family 5 (sodium/glucose	324	Extracellular (Potential).				sodium ion transport|transmembrane transport	integral to membrane	transporter activity			ovary(1)	1																		---	---	---	---
ULK2	9706	broad.mit.edu	37	17	19685239	19685239	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:19685239C>T	uc002gwm.3	-	23	3111	c.2602G>A	c.(2602-2604)GTG>ATG	p.V868M	ULK2_uc002gwn.2_Missense_Mutation_p.V868M	NM_001142610	NP_001136082	Q8IYT8	ULK2_HUMAN	unc-51-like kinase 2	868					signal transduction		ATP binding|protein binding|protein serine/threonine kinase activity			skin(2)|large_intestine(1)|stomach(1)	4	all_cancers(12;4.97e-05)|all_epithelial(12;0.00362)|Breast(13;0.186)																	---	---	---	---
LGALS9B	284194	broad.mit.edu	37	17	20354922	20354922	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:20354922C>T	uc002gxa.1	-	10	861	c.796G>A	c.(796-798)GCC>ACC	p.A266T	LGALS9B_uc002gwz.1_Missense_Mutation_p.A265T|LGALS9B_uc010vzh.1_Missense_Mutation_p.A178T	NM_001042685	NP_001036150	Q3B8N2	LEG9B_HUMAN	galectin-9 like	266	Galectin 2.						sugar binding			skin(1)	1																		---	---	---	---
LGALS9B	284194	broad.mit.edu	37	17	20356361	20356361	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:20356361G>A	uc002gxa.1	-	7	661	c.596C>T	c.(595-597)ACG>ATG	p.T199M	LGALS9B_uc002gwz.1_Missense_Mutation_p.T199M|LGALS9B_uc010vzh.1_Missense_Mutation_p.T111M	NM_001042685	NP_001036150	Q3B8N2	LEG9B_HUMAN	galectin-9 like	199							sugar binding			skin(1)	1																		---	---	---	---
KIAA0100	9703	broad.mit.edu	37	17	26960634	26960634	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26960634C>T	uc002hbu.2	-	18	3497	c.3398G>A	c.(3397-3399)CGT>CAT	p.R1133H		NM_014680	NP_055495	Q14667	K0100_HUMAN	hypothetical protein LOC9703 precursor	1133						extracellular region				ovary(2)|breast(1)|skin(1)	4	Lung NSC(42;0.00431)																	---	---	---	---
TP53I13	90313	broad.mit.edu	37	17	27899562	27899562	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27899562C>T	uc002hee.2	+	6	954	c.916C>T	c.(916-918)CGC>TGC	p.R306C		NM_138349	NP_612358	Q8NBR0	P5I13_HUMAN	tumor protein p53 inducible protein 13	306	Extracellular (Potential).					cytoplasm|integral to membrane|plasma membrane					0				READ - Rectum adenocarcinoma(3;0.236)														---	---	---	---
NLE1	54475	broad.mit.edu	37	17	33464048	33464048	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:33464048C>T	uc002hiy.1	-	7	828	c.800G>A	c.(799-801)CGC>CAC	p.R267H	NLE1_uc010ctn.1_5'UTR|NLE1_uc002hiz.1_5'UTR	NM_018096	NP_060566	Q9NVX2	NLE1_HUMAN	Notchless gene homolog isoform a	267	WD 4.					nucleolus				breast(3)|ovary(1)	4		Ovarian(249;0.17)																---	---	---	---
AP2B1	163	broad.mit.edu	37	17	33963434	33963434	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:33963434A>G	uc002hjr.2	+	10	1419	c.1230A>G	c.(1228-1230)GCA>GCG	p.A410A	AP2B1_uc002hjq.2_Silent_p.A410A|AP2B1_uc010wci.1_Silent_p.A372A|AP2B1_uc002hjs.2_Silent_p.A353A|AP2B1_uc002hjt.2_Silent_p.A410A|AP2B1_uc010ctv.2_Silent_p.A410A|AP2B1_uc010wcj.1_Silent_p.A147A	NM_001282	NP_001273	P63010	AP2B1_HUMAN	adaptor-related protein complex 2, beta 1	410					axon guidance|epidermal growth factor receptor signaling pathway|intracellular protein transport|negative regulation of epidermal growth factor receptor signaling pathway|nerve growth factor receptor signaling pathway|regulation of defense response to virus by virus|synaptic transmission|vesicle-mediated transport|viral reproduction	clathrin adaptor complex|coated pit|cytosol|endocytic vesicle membrane|plasma membrane	clathrin binding|protein transporter activity			ovary(1)	1		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0227)														---	---	---	---
TAF15	8148	broad.mit.edu	37	17	34171771	34171771	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:34171771C>T	uc002hkd.2	+	15	1554	c.1468C>T	c.(1468-1470)CGA>TGA	p.R490*	TAF15_uc002hkc.2_Nonsense_Mutation_p.R487*	NM_139215	NP_631961	Q92804	RBP56_HUMAN	TBP-associated factor 15 isoform 1	490	Arg/Gly-rich.|11.|21 X approximate tandem repeats of D-R- [S,G](0,3)-G-G-Y-G-G.				positive regulation of transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|nucleotide binding|protein binding|RNA binding|zinc ion binding		TAF15/NR4A3(33)	bone(33)|lung(1)|skin(1)	35		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0193)				T	TEC|CHN1|ZNF384	extraskeletal myxoid chondrosarcomas|ALL								---	---	---	---
MRM1	79922	broad.mit.edu	37	17	34964141	34964141	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:34964141G>A	uc002hne.2	+	3	887	c.672G>A	c.(670-672)ACG>ACA	p.T224T	MRM1_uc002hnf.2_Silent_p.T29T	NM_024864	NP_079140	Q6IN84	MRM1_HUMAN	mitochondrial rRNA methyltransferase 1 homolog	224					RNA processing	mitochondrion	RNA binding|RNA methyltransferase activity				0		Breast(25;0.00957)|Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0184)														---	---	---	---
CACNB1	782	broad.mit.edu	37	17	37343783	37343783	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37343783C>T	uc002hrm.1	-	4	516	c.363G>A	c.(361-363)GTG>GTA	p.V121V	CACNB1_uc002hrl.1_5'UTR|CACNB1_uc002hrn.2_Silent_p.V121V|CACNB1_uc002hro.2_Silent_p.V121V|CACNB1_uc002hrp.1_Silent_p.V121V|CACNB1_uc010web.1_Silent_p.V74V	NM_000723	NP_000714	Q02641	CACB1_HUMAN	calcium channel, voltage-dependent, beta 1	121	SH3.				axon guidance	voltage-gated calcium channel complex				large_intestine(1)|ovary(1)	2					Ibutilide(DB00308)|Magnesium Sulfate(DB00653)|Mibefradil(DB01388)|Verapamil(DB00661)													---	---	---	---
PNMT	5409	broad.mit.edu	37	17	37826239	37826239	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37826239C>T	uc002hsi.1	+	3	668	c.446C>T	c.(445-447)GCC>GTC	p.A149V		NM_002686	NP_002677	P11086	PNMT_HUMAN	phenylethanolamine N-methyltransferase	149					catecholamine biosynthetic process|hormone biosynthetic process	cytosol	phenylethanolamine N-methyltransferase activity			ovary(1)	1	all_cancers(6;6.59e-85)|all_epithelial(6;2.89e-103)|Breast(7;1.05e-86)|Lung NSC(9;1.15e-09)|all_lung(9;6.24e-09)|Colorectal(19;0.000442)|Esophageal squamous(10;0.052)		UCEC - Uterine corpus endometrioid carcinoma (11;0.000126)|BRCA - Breast invasive adenocarcinoma(8;3.87e-45)|Lung(15;0.00193)|LUAD - Lung adenocarcinoma(14;0.0664)|LUSC - Lung squamous cell carcinoma(15;0.171)															---	---	---	---
KRT20	54474	broad.mit.edu	37	17	39034577	39034577	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39034577C>T	uc002hvl.2	-	6	1001	c.959G>A	c.(958-960)CGT>CAT	p.R320H		NM_019010	NP_061883	P35900	K1C20_HUMAN	keratin 20	320	Rod.|Coil 2.				apoptosis|intermediate filament organization	Golgi apparatus|intermediate filament	protein binding|structural constituent of cytoskeleton			large_intestine(1)|kidney(1)|skin(1)	3		Breast(137;0.000301)|Ovarian(249;0.15)																---	---	---	---
CCR10	2826	broad.mit.edu	37	17	40832446	40832446	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40832446C>T	uc002iax.3	-	2	218	c.214G>A	c.(214-216)GCA>ACA	p.A72T	CNTNAP1_uc002iay.2_5'Flank|CNTNAP1_uc010wgs.1_5'Flank	NM_016602	NP_057686	P46092	CCR10_HUMAN	CC chemokine receptor 10	72	Cytoplasmic (Potential).					integral to plasma membrane					0		Breast(137;0.000153)		BRCA - Breast invasive adenocarcinoma(366;0.14)														---	---	---	---
CNTNAP1	8506	broad.mit.edu	37	17	40836173	40836173	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40836173G>A	uc002iay.2	+	3	505	c.289G>A	c.(289-291)GTC>ATC	p.V97I	CCR10_uc002iax.3_5'Flank|CNTNAP1_uc010wgs.1_RNA	NM_003632	NP_003623	P78357	CNTP1_HUMAN	contactin associated protein 1 precursor	97	Extracellular (Potential).|F5/8 type C.				axon guidance|cell adhesion	paranode region of axon	receptor activity|receptor binding|SH3 domain binding|SH3/SH2 adaptor activity			ovary(3)|breast(3)|upper_aerodigestive_tract(1)|lung(1)	8		Breast(137;0.000143)		BRCA - Breast invasive adenocarcinoma(366;0.143)														---	---	---	---
BRCA1	672	broad.mit.edu	37	17	41244466	41244466	+	Missense_Mutation	SNP	G	A	A	rs80357049		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:41244466G>A	uc002icq.2	-	10	3314	c.3082C>T	c.(3082-3084)CGT>TGT	p.R1028C	BRCA1_uc010whp.1_Intron|BRCA1_uc010whl.1_Intron|BRCA1_uc010whm.1_Intron|BRCA1_uc002icp.3_Missense_Mutation_p.R957C|BRCA1_uc002icu.2_Intron|BRCA1_uc010cyx.2_Missense_Mutation_p.R981C|BRCA1_uc002ict.2_Missense_Mutation_p.R1028C|BRCA1_uc010whn.1_Intron|BRCA1_uc010who.1_Intron|BRCA1_uc010whq.1_Intron|BRCA1_uc002idc.1_Intron|BRCA1_uc010whr.1_Intron|BRCA1_uc002idd.2_Missense_Mutation_p.R1028C|BRCA1_uc002ide.1_Missense_Mutation_p.R859C|BRCA1_uc010cyy.1_Missense_Mutation_p.R1028C|BRCA1_uc010whs.1_Missense_Mutation_p.R1028C|BRCA1_uc010cyz.2_Missense_Mutation_p.R981C|BRCA1_uc010cza.2_Missense_Mutation_p.R1002C|BRCA1_uc010wht.1_Missense_Mutation_p.R732C	NM_007294	NP_009225	P38398	BRCA1_HUMAN	breast cancer 1, early onset isoform 1	1028					androgen receptor signaling pathway|apoptosis|cellular response to indole-3-methanol|chromosome segregation|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|DNA damage response, signal transduction resulting in induction of apoptosis|double-strand break repair via homologous recombination|fatty acid biosynthetic process|G2/M transition DNA damage checkpoint|negative regulation of centriole replication|negative regulation of fatty acid biosynthetic process|negative regulation of histone H3-K9 methylation|negative regulation of transcription, DNA-dependent|positive regulation of cell cycle arrest|positive regulation of DNA repair|positive regulation of histone acetylation|positive regulation of histone H3-K4 methylation|positive regulation of histone H4-K20 methylation|positive regulation of protein ubiquitination|positive regulation of transcription from RNA polymerase II promoter|postreplication repair|protein autoubiquitination|protein K6-linked ubiquitination|regulation of cell motility|regulation of cell proliferation|regulation of transcription from RNA polymerase III promoter|response to estrogen stimulus|response to ionizing radiation|substrate adhesion-dependent cell spreading	BRCA1-A complex|BRCA1-BARD1 complex|gamma-tubulin ring complex|nucleoplasm|plasma membrane|ribonucleoprotein complex|ruffle	androgen receptor binding|identical protein binding|protein binding|RNA binding|transcription coactivator activity|transcription regulatory region DNA binding|tubulin binding|ubiquitin protein ligase binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(24)|breast(21)|lung(4)|central_nervous_system(1)|endometrium(1)|urinary_tract(1)	52		Breast(137;0.000717)		BRCA - Breast invasive adenocarcinoma(366;0.126)				D|Mis|N|F|S		ovarian	breast|ovarian		Homologous_recombination	Hereditary_Breast-Ovarian_Cancer_BRCA1_type	TCGA Ovarian(2;0.000030)			---	---	---	---
MPP2	4355	broad.mit.edu	37	17	41958160	41958160	+	Missense_Mutation	SNP	C	T	T	rs149942811		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:41958160C>T	uc010wip.1	-	10	1241	c.1184G>A	c.(1183-1185)CGG>CAG	p.R395Q	MPP2_uc002ien.1_Missense_Mutation_p.R367Q|MPP2_uc010wim.1_Missense_Mutation_p.R339Q|MPP2_uc002ieo.1_Missense_Mutation_p.R350Q|MPP2_uc010win.1_Missense_Mutation_p.R211Q|MPP2_uc010wio.1_Missense_Mutation_p.R339Q	NM_005374	NP_005365	Q14168	MPP2_HUMAN	palmitoylated membrane protein 2	374	Guanylate kinase-like.				signal transduction	cell surface|integral to plasma membrane|membrane fraction	guanylate kinase activity				0		Breast(137;0.00314)		BRCA - Breast invasive adenocarcinoma(366;0.12)												OREG0024443	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
SLC4A1	6521	broad.mit.edu	37	17	42330716	42330716	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42330716C>T	uc002igf.3	-	17	2230	c.2081G>A	c.(2080-2082)CGC>CAC	p.R694H		NM_000342	NP_000333	P02730	B3AT_HUMAN	solute carrier family 4, anion exchanger, member	694	Membrane (anion exchange).				bicarbonate transport|cellular ion homeostasis	basolateral plasma membrane|cortical cytoskeleton|integral to plasma membrane|Z disc	ankyrin binding|chloride transmembrane transporter activity|inorganic anion exchanger activity|protein anchor|protein homodimerization activity			ovary(1)|central_nervous_system(1)|skin(1)	3		Breast(137;0.014)|Prostate(33;0.0181)		BRCA - Breast invasive adenocarcinoma(366;0.115)														---	---	---	---
FZD2	2535	broad.mit.edu	37	17	42636530	42636530	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42636530C>T	uc002igx.1	+	1	1606	c.1474C>T	c.(1474-1476)CGC>TGC	p.R492C		NM_001466	NP_001457	Q14332	FZD2_HUMAN	frizzled 2 precursor	492	Extracellular (Potential).				axonogenesis|brain development|canonical Wnt receptor signaling pathway|epithelial cell differentiation|G-protein signaling, coupled to cGMP nucleotide second messenger|gonad development|positive regulation of cGMP metabolic process|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription, DNA-dependent|vasculature development|Wnt receptor signaling pathway, calcium modulating pathway	apical part of cell|cytoplasm|integral to membrane|neuron projection membrane	G-protein coupled receptor activity|PDZ domain binding|Wnt receptor activity|Wnt-protein binding			ovary(2)|lung(1)	3		Prostate(33;0.0181)		BRCA - Breast invasive adenocarcinoma(366;0.189)														---	---	---	---
C1QL1	10882	broad.mit.edu	37	17	43037677	43037677	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43037677C>T	uc002ihv.2	-	2	884	c.656G>A	c.(655-657)AGC>AAC	p.S219N		NM_006688	NP_006679	O75973	C1QRF_HUMAN	complement component 1, q subcomponent-like 1	219	C1q.				locomotory behavior	collagen					0		Prostate(33;0.155)																---	---	---	---
PLCD3	113026	broad.mit.edu	37	17	43196290	43196290	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43196290C>T	uc002iib.2	-	5	919	c.805G>A	c.(805-807)GTG>ATG	p.V269M		NM_133373	NP_588614	Q8N3E9	PLCD3_HUMAN	phospholipase C delta 3	269	EF-hand 3.				intracellular signal transduction|lipid catabolic process	cleavage furrow|cytoplasm|membrane	calcium ion binding|phosphatidylinositol phospholipase C activity|signal transducer activity			breast(2)|lung(1)	3					Phosphatidylserine(DB00144)													---	---	---	---
ARHGAP27	201176	broad.mit.edu	37	17	43474387	43474387	+	Missense_Mutation	SNP	C	T	T	rs147050844		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43474387C>T	uc002iix.2	-	11	1272	c.823G>A	c.(823-825)GCA>ACA	p.A275T	ARHGAP27_uc010dak.2_Missense_Mutation_p.A248T	NM_199282	NP_954976	Q6ZUM4	RHG27_HUMAN	Rho GTPase activating protein 27 isoform a	616					positive regulation of Cdc42 GTPase activity|receptor-mediated endocytosis|signal transduction	cytoplasm|membrane	Rac GTPase activator activity|SH3 domain binding				0	Renal(3;0.0405)																	---	---	---	---
HOXB4	3214	broad.mit.edu	37	17	46654330	46654330	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:46654330C>T	uc002inp.2	-	2	572	c.510G>A	c.(508-510)ACG>ACA	p.T170T	HOXB3_uc010wlm.1_Intron|HOXB3_uc010dbf.2_Intron|HOXB3_uc010dbg.2_Intron|HOXB3_uc002ino.2_5'Flank|HOXB3_uc010wlk.1_5'Flank|HOXB3_uc010wll.1_Intron	NM_024015	NP_076920	P17483	HXB4_HUMAN	homeobox B4	170	Homeobox.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1																		---	---	---	---
SPOP	8405	broad.mit.edu	37	17	47696653	47696653	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:47696653G>A	uc010dbk.2	-	5	927	c.295C>T	c.(295-297)CGG>TGG	p.R99W	SPOP_uc002ipb.2_Missense_Mutation_p.R99W|SPOP_uc002ipc.2_Missense_Mutation_p.R99W|SPOP_uc002ipd.2_Missense_Mutation_p.R99W|SPOP_uc002ipe.2_Missense_Mutation_p.R99W|SPOP_uc002ipf.2_Missense_Mutation_p.R99W|SPOP_uc002ipg.2_Missense_Mutation_p.R99W	NM_003563	NP_003554	O43791	SPOP_HUMAN	speckle-type POZ protein	99	MATH.|Required for nuclear localization.				mRNA processing	nucleus	protein binding			prostate(2)|ovary(2)|lung(2)	6															Prostate(2;0.17)			---	---	---	---
SPOP	8405	broad.mit.edu	37	17	47700149	47700149	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:47700149T>C	uc010dbk.2	-	3	656	c.24A>G	c.(22-24)CCA>CCG	p.P8P	SPOP_uc002ipb.2_Silent_p.P8P|SPOP_uc002ipc.2_Silent_p.P8P|SPOP_uc002ipd.2_Silent_p.P8P|SPOP_uc002ipe.2_Silent_p.P8P|SPOP_uc002ipf.2_Silent_p.P8P|SPOP_uc002ipg.2_Silent_p.P8P|SPOP_uc010wlx.1_RNA	NM_003563	NP_003554	O43791	SPOP_HUMAN	speckle-type POZ protein	8					mRNA processing	nucleus	protein binding			prostate(2)|ovary(2)|lung(2)	6															Prostate(2;0.17)			---	---	---	---
SPATA20	64847	broad.mit.edu	37	17	48627597	48627597	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48627597A>G	uc002irf.2	+	8	1115	c.974A>G	c.(973-975)CAG>CGG	p.Q325R	SPATA20_uc002irc.2_5'UTR|SPATA20_uc002ire.2_Missense_Mutation_p.Q281R|SPATA20_uc002ird.2_Missense_Mutation_p.Q341R|SPATA20_uc010wmv.1_Missense_Mutation_p.S382G|SPATA20_uc002irg.2_RNA	NM_022827	NP_073738	Q8TB22	SPT20_HUMAN	spermatogenesis associated 20	325					cell differentiation|mannose metabolic process|multicellular organismal development|spermatogenesis	extracellular region	mannose-6-phosphate isomerase activity|protein binding				0	Breast(11;1.23e-18)		BRCA - Breast invasive adenocarcinoma(22;9.38e-09)													OREG0024568	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
WFIKKN2	124857	broad.mit.edu	37	17	48917620	48917620	+	Missense_Mutation	SNP	C	T	T	rs141860715	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48917620C>T	uc002isv.3	+	2	1665	c.971C>T	c.(970-972)CCG>CTG	p.P324L	WFIKKN2_uc010dbu.2_Missense_Mutation_p.P231L	NM_175575	NP_783165	Q8TEU8	WFKN2_HUMAN	WFIKKN2 protein	324						extracellular region	metalloendopeptidase inhibitor activity|protein binding|serine-type endopeptidase inhibitor activity			ovary(2)|skin(1)	3			BRCA - Breast invasive adenocarcinoma(22;1.09e-08)															---	---	---	---
SPAG9	9043	broad.mit.edu	37	17	49067155	49067155	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:49067155G>A	uc002itc.2	-	21	2905	c.2696C>T	c.(2695-2697)GCG>GTG	p.A899V	SPAG9_uc002itb.2_Missense_Mutation_p.A885V|SPAG9_uc002itd.2_Missense_Mutation_p.A889V|SPAG9_uc002itf.2_Missense_Mutation_p.A720V|SPAG9_uc002ita.2_Missense_Mutation_p.A742V|SPAG9_uc002ite.2_Missense_Mutation_p.A729V	NM_001130528	NP_001124000	O60271	JIP4_HUMAN	sperm associated antigen 9 isoform 1	899					positive regulation of cell migration|positive regulation of muscle cell differentiation|retrograde transport, endosome to Golgi|spermatogenesis	acrosomal vesicle|integral to membrane|perinuclear region of cytoplasm				lung(4)|breast(1)	5			BRCA - Breast invasive adenocarcinoma(22;4.24e-07)															---	---	---	---
TEX14	56155	broad.mit.edu	37	17	56738924	56738924	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56738924G>A	uc010dcz.1	-						TEX14_uc002iwr.1_Intron|TEX14_uc002iws.1_Intron|TEX14_uc010dda.1_Intron|TEX14_uc010wnz.1_Missense_Mutation_p.R13W	NM_198393	NP_938207			testis expressed sequence 14 isoform a							cytoplasm	ATP binding|protein kinase activity			stomach(4)|lung(3)|breast(3)|ovary(3)|upper_aerodigestive_tract(1)|large_intestine(1)|skin(1)|pancreas(1)	17	Medulloblastoma(34;0.127)|all_neural(34;0.237)																	---	---	---	---
C17orf71	55181	broad.mit.edu	37	17	57288418	57288418	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57288418G>A	uc002ixi.2	+	1	1048	c.1006G>A	c.(1006-1008)GTG>ATG	p.V336M		NM_018149	NP_060619	Q8ND04	SMG8_HUMAN	SMG8 protein	336					nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|regulation of protein kinase activity		protein binding				0	all_neural(34;0.0837)|Medulloblastoma(34;0.0922)																	---	---	---	---
TUBD1	51174	broad.mit.edu	37	17	57968180	57968180	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57968180G>A	uc002ixw.1	-						TUBD1_uc010ddf.1_Intron|TUBD1_uc010ddg.1_Intron|TUBD1_uc010ddh.1_Intron|TUBD1_uc010wok.1_Intron|TUBD1_uc002ixx.1_Intron|TUBD1_uc010wol.1_Intron|TUBD1_uc010ddi.1_Intron|RPS6KB1_uc010ddj.1_5'Flank|RPS6KB1_uc002ixy.2_5'Flank|RPS6KB1_uc010wom.1_5'Flank|RPS6KB1_uc010won.1_5'Flank	NM_016261	NP_057345			delta-tubulin						cell differentiation|microtubule-based movement|multicellular organismal development|protein polymerization|spermatogenesis	centriole|microtubule|nucleus	GTP binding|GTPase activity|structural molecule activity			ovary(1)	1	all_cancers(5;3.18e-13)|Breast(5;2.91e-25)|all_neural(34;0.0878)|Medulloblastoma(34;0.0922)		Epithelial(12;9.34e-13)|all cancers(12;1.91e-11)															---	---	---	---
HEATR6	63897	broad.mit.edu	37	17	58121371	58121371	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:58121371G>A	uc002iyk.1	-	20	3116	c.3099C>T	c.(3097-3099)TAC>TAT	p.Y1033Y	HEATR6_uc010ddk.1_Silent_p.Y572Y|HEATR6_uc010wos.1_Silent_p.Y753Y	NM_022070	NP_071353	Q6AI08	HEAT6_HUMAN	HEAT repeat containing 6	1033							binding			ovary(1)|skin(1)	2	all_cancers(5;2.25e-13)|Breast(5;4.84e-25)|all_neural(34;0.0878)|Medulloblastoma(34;0.0922)		BRCA - Breast invasive adenocarcinoma(1;5.93e-19)|Epithelial(12;7.59e-12)|all cancers(12;1.26e-10)															---	---	---	---
GH2	2689	broad.mit.edu	37	17	61957720	61957720	+	Missense_Mutation	SNP	G	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61957720G>C	uc002jco.1	-	5	677	c.615C>G	c.(613-615)ATC>ATG	p.I205M	GH2_uc002jcj.2_Intron|CSH2_uc002jck.2_Intron|GH2_uc002jcl.1_3'UTR|GH2_uc002jcm.1_Missense_Mutation_p.S204W|GH2_uc002jcn.1_Missense_Mutation_p.I190M	NM_002059	NP_002050	P01242	SOM2_HUMAN	growth hormone 2 isoform 1	205						extracellular region	hormone activity			upper_aerodigestive_tract(2)|pancreas(1)	3																		---	---	---	---
SCN4A	6329	broad.mit.edu	37	17	62036661	62036661	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:62036661G>A	uc002jds.1	-	12	2060	c.1983C>T	c.(1981-1983)AAC>AAT	p.N661N		NM_000334	NP_000325	P35499	SCN4A_HUMAN	voltage-gated sodium channel type 4 alpha	661	II.				muscle contraction	voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(1)|pancreas(1)|skin(1)	3					Lamotrigine(DB00555)													---	---	---	---
NOL11	25926	broad.mit.edu	37	17	65720282	65720282	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:65720282C>T	uc002jgd.1	+	6	640	c.637C>T	c.(637-639)CGG>TGG	p.R213W	NOL11_uc010wql.1_Missense_Mutation_p.R31W|NOL11_uc010deu.1_5'UTR	NM_015462	NP_056277	Q9H8H0	NOL11_HUMAN	nucleolar protein 11	213						nucleolus					0	all_cancers(12;1.54e-10)		BRCA - Breast invasive adenocarcinoma(8;7.48e-08)|Colorectal(3;0.0518)|COAD - Colon adenocarcinoma(4;0.0977)|LUSC - Lung squamous cell carcinoma(166;0.24)															---	---	---	---
ABCA9	10350	broad.mit.edu	37	17	66982438	66982438	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66982438C>T	uc002jhu.2	-	32	4218	c.4075G>A	c.(4075-4077)GAA>AAA	p.E1359K	ABCA9_uc010dez.2_Missense_Mutation_p.E1321K	NM_080283	NP_525022	Q8IUA7	ABCA9_HUMAN	ATP-binding cassette, sub-family A, member 9	1359	ABC transporter 2.				transport	integral to membrane	ATP binding|ATPase activity			ovary(4)|upper_aerodigestive_tract(1)|central_nervous_system(1)	6	Breast(10;1.47e-12)																	---	---	---	---
SSTR2	6752	broad.mit.edu	37	17	71166486	71166486	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:71166486G>A	uc002jje.2	+	2	1388	c.1028G>A	c.(1027-1029)AGT>AAT	p.S343N		NM_001050	NP_001041	P30874	SSR2_HUMAN	somatostatin receptor 2	343	Cytoplasmic (Potential).				digestion|negative regulation of cell proliferation|response to nutrient	integral to plasma membrane	PDZ domain binding|somatostatin receptor activity				0			LUSC - Lung squamous cell carcinoma(166;0.197)															---	---	---	---
SLC16A5	9121	broad.mit.edu	37	17	73096287	73096287	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73096287G>A	uc002jmr.2	+	5	901	c.529G>A	c.(529-531)GGG>AGG	p.G177R	SLC16A5_uc002jms.1_Missense_Mutation_p.G177R|SLC16A5_uc002jmt.2_Missense_Mutation_p.G177R|SLC16A5_uc002jmu.2_Missense_Mutation_p.G177R|SLC16A5_uc010wrt.1_Missense_Mutation_p.G217R	NM_004695	NP_004686	O15375	MOT6_HUMAN	solute carrier family 16, member 5	177	Helical; (Potential).				organic anion transport	integral to plasma membrane|membrane fraction	secondary active monocarboxylate transmembrane transporter activity|symporter activity			central_nervous_system(1)	1	all_lung(278;0.226)		LUSC - Lung squamous cell carcinoma(166;0.162)|Lung(188;0.235)		Pyruvic acid(DB00119)													---	---	---	---
NUP85	79902	broad.mit.edu	37	17	73230741	73230741	+	Missense_Mutation	SNP	G	A	A	rs147921665		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73230741G>A	uc002jng.1	+	17	1885	c.1625G>A	c.(1624-1626)CGC>CAC	p.R542H	NUP85_uc010dgd.1_Missense_Mutation_p.R497H|NUP85_uc010wrv.1_Missense_Mutation_p.R496H|NUP85_uc002jnh.1_Missense_Mutation_p.R145H	NM_024844	NP_079120	Q9BW27	NUP85_HUMAN	nucleoporin 85	542					carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytosol|nuclear membrane|Nup107-160 complex|spindle	protein binding			ovary(1)	1	all_lung(278;0.14)|Lung NSC(278;0.168)		all cancers(21;3.45e-06)															---	---	---	---
LLGL2	3993	broad.mit.edu	37	17	73539557	73539557	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73539557A>G	uc002joh.2	+	2	204	c.50A>G	c.(49-51)AAG>AGG	p.K17R	LLGL2_uc002jog.1_Missense_Mutation_p.K17R|LLGL2_uc010dgf.1_Missense_Mutation_p.K17R|LLGL2_uc002joi.2_Missense_Mutation_p.K17R|LLGL2_uc010dgg.1_Missense_Mutation_p.K17R	NM_001031803	NP_001026973	Q6P1M3	L2GL2_HUMAN	lethal giant larvae homolog 2 isoform c	17					cell cycle|cell division|exocytosis|regulation of establishment or maintenance of cell polarity	cytoplasm|intracellular membrane-bounded organelle	PDZ domain binding			ovary(2)	2	all_cancers(13;3.15e-09)|all_epithelial(9;5.78e-10)|Breast(9;5.8e-10)|all_lung(278;0.246)		all cancers(21;1.8e-07)|Epithelial(20;1.38e-06)|Lung(188;0.0696)|LUSC - Lung squamous cell carcinoma(166;0.112)															---	---	---	---
ITGB4	3691	broad.mit.edu	37	17	73723340	73723340	+	Missense_Mutation	SNP	G	A	A	rs146966502		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73723340G>A	uc002jpg.2	+	3	332	c.145G>A	c.(145-147)GCC>ACC	p.A49T	ITGB4_uc002jph.2_Missense_Mutation_p.A49T|ITGB4_uc010dgo.2_Missense_Mutation_p.A49T|ITGB4_uc002jpi.3_Missense_Mutation_p.A49T|ITGB4_uc010dgp.1_Missense_Mutation_p.A49T|ITGB4_uc002jpj.2_Missense_Mutation_p.A49T	NM_000213	NP_000204	P16144	ITB4_HUMAN	integrin beta 4 isoform 1 precursor	49	PSI.|Extracellular (Potential).				cell communication|cell motility|cell-matrix adhesion|hemidesmosome assembly|integrin-mediated signaling pathway|multicellular organismal development|response to wounding	cell leading edge|cell surface|hemidesmosome|integrin complex	protein binding|receptor activity			lung(4)	4	all_cancers(13;1.5e-07)		all cancers(21;8.32e-07)|Epithelial(20;1.92e-06)|BRCA - Breast invasive adenocarcinoma(9;0.00194)|Lung(188;0.132)|LUSC - Lung squamous cell carcinoma(166;0.154)															---	---	---	---
ITGB4	3691	broad.mit.edu	37	17	73733432	73733432	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73733432C>T	uc002jpg.2	+	17	2207	c.2020C>T	c.(2020-2022)CGG>TGG	p.R674W	ITGB4_uc002jph.2_Missense_Mutation_p.R674W|ITGB4_uc010dgo.2_Missense_Mutation_p.R674W|ITGB4_uc002jpi.3_Missense_Mutation_p.R674W|ITGB4_uc010dgp.1_Missense_Mutation_p.R674W|ITGB4_uc002jpj.2_Missense_Mutation_p.R674W	NM_000213	NP_000204	P16144	ITB4_HUMAN	integrin beta 4 isoform 1 precursor	674	Extracellular (Potential).			IHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDEL KRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHK KK -> STRASARTYAPACSARRGAPARRRGARVRNATSRS RWWTSLREARRWWCAAPSGTRMTTAPTATPWKVTAPLGPTA LSWCTRRR (in Ref. 5; CAB61345).	cell communication|cell motility|cell-matrix adhesion|hemidesmosome assembly|integrin-mediated signaling pathway|multicellular organismal development|response to wounding	cell leading edge|cell surface|hemidesmosome|integrin complex	protein binding|receptor activity			lung(4)	4	all_cancers(13;1.5e-07)		all cancers(21;8.32e-07)|Epithelial(20;1.92e-06)|BRCA - Breast invasive adenocarcinoma(9;0.00194)|Lung(188;0.132)|LUSC - Lung squamous cell carcinoma(166;0.154)															---	---	---	---
JMJD6	23210	broad.mit.edu	37	17	74719969	74719969	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74719969G>A	uc002jso.2	-	3	1014	c.690C>T	c.(688-690)GAC>GAT	p.D230D	JMJD6_uc002jsn.1_Silent_p.D230D|JMJD6_uc010dgz.2_Silent_p.D230D|C17orf95_uc002jsp.2_5'Flank|C17orf95_uc002jsq.2_5'Flank|C17orf95_uc002jsr.2_5'Flank|C17orf95_uc002jss.2_5'Flank|C17orf95_uc002jst.2_5'Flank	NM_015167	NP_055982	Q6NYC1	JMJD6_HUMAN	jumonji domain containing 6 isoform 2	230	JmjC.				mRNA processing|peptidyl-lysine hydroxylation to 5-hydroxy-L-lysine|regulation of nuclear mRNA splicing, via spliceosome|regulation of transcription, DNA-dependent|RNA splicing|sprouting angiogenesis|transcription, DNA-dependent	nucleolus|nucleoplasm	histone demethylase activity (H3-R2 specific)|histone demethylase activity (H4-R3 specific)|identical protein binding|iron ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|peptidyl-lysine 5-dioxygenase activity|single-stranded RNA binding			skin(2)|ovary(1)	3																		---	---	---	---
SEC14L1	6397	broad.mit.edu	37	17	75196739	75196739	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:75196739G>A	uc002jto.2	+	9	1260	c.993G>A	c.(991-993)TGG>TGA	p.W331*	SEC14L1_uc010dhc.2_Nonsense_Mutation_p.W331*|SEC14L1_uc010wth.1_Nonsense_Mutation_p.W331*|SEC14L1_uc002jtm.2_Nonsense_Mutation_p.W331*|SEC14L1_uc010wti.1_Nonsense_Mutation_p.W297*	NM_003003	NP_002994	Q92503	S14L1_HUMAN	SEC14 (S. cerevisiae)-like 1 isoform a	331	CRAL-TRIO.				transport	Golgi apparatus|integral to membrane	binding			ovary(2)	2																		---	---	---	---
DNAH17	8632	broad.mit.edu	37	17	76503643	76503643	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:76503643C>T	uc010wtu.1	-	2	533	c.356G>A	c.(355-357)CGA>CAA	p.R119Q						full-length cDNA clone CS0DJ002YI14 of T cells (Jurkat cell line) Cot 10-normalized of Homo sapiens (human).											ovary(6)|breast(2)|skin(1)	9			BRCA - Breast invasive adenocarcinoma(99;0.00294)|OV - Ovarian serous cystadenocarcinoma(97;0.0656)															---	---	---	---
CBX8	57332	broad.mit.edu	37	17	77770056	77770056	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:77770056C>G	uc002jxd.1	-	3	265	c.172G>C	c.(172-174)GAG>CAG	p.E58Q		NM_020649	NP_065700	Q9HC52	CBX8_HUMAN	chromobox homolog 8	58	Chromo.				negative regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nuclear chromatin|PcG protein complex	methylated histone residue binding				0			OV - Ovarian serous cystadenocarcinoma(97;0.0102)|BRCA - Breast invasive adenocarcinoma(99;0.0224)															---	---	---	---
AZI1	22994	broad.mit.edu	37	17	79173615	79173615	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79173615G>A	uc002jzp.1	-	9	1127	c.927C>T	c.(925-927)GGC>GGT	p.G309G	AZI1_uc002jzm.1_5'Flank|AZI1_uc002jzn.1_Silent_p.G309G|AZI1_uc002jzo.1_Silent_p.G309G|AZI1_uc010wum.1_Silent_p.G309G	NM_014984	NP_055799	Q9UPN4	AZI1_HUMAN	5-azacytidine induced 1 isoform a	309					cell differentiation|G2/M transition of mitotic cell cycle|multicellular organismal development|spermatogenesis	centrosome|cytosol|intracellular membrane-bounded organelle				central_nervous_system(2)|large_intestine(1)|ovary(1)	4	all_neural(118;0.0804)|Melanoma(429;0.242)		BRCA - Breast invasive adenocarcinoma(99;0.0272)|OV - Ovarian serous cystadenocarcinoma(97;0.117)															---	---	---	---
TBCD	6904	broad.mit.edu	37	17	80863898	80863898	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80863898G>A	uc002kfz.2	+	20	2021	c.1891G>A	c.(1891-1893)GCC>ACC	p.A631T	TBCD_uc002kfx.1_Missense_Mutation_p.A614T|TBCD_uc002kfy.1_Missense_Mutation_p.A631T|TBCD_uc002kgb.1_5'UTR	NM_005993	NP_005984	Q9BTW9	TBCD_HUMAN	beta-tubulin cofactor D	631	HEAT 3.				'de novo' posttranslational protein folding|adherens junction assembly|negative regulation of cell-substrate adhesion|negative regulation of microtubule polymerization|post-chaperonin tubulin folding pathway|tight junction assembly	adherens junction|cytoplasm|lateral plasma membrane|microtubule|tight junction	beta-tubulin binding|chaperone binding|GTPase activator activity				0	Breast(20;0.000523)|all_neural(118;0.0779)	all_cancers(8;0.0266)|all_epithelial(8;0.0696)	OV - Ovarian serous cystadenocarcinoma(97;0.0868)|BRCA - Breast invasive adenocarcinoma(99;0.18)															---	---	---	---
METRNL	284207	broad.mit.edu	37	17	81052065	81052065	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:81052065G>A	uc002kgh.2	+	4	806	c.681G>A	c.(679-681)CTG>CTA	p.L227L	METRNL_uc002kgi.2_Silent_p.L145L	NM_001004431	NP_001004431	Q641Q3	METRL_HUMAN	meteorin, glial cell differentiation	227						extracellular region					0	Breast(20;0.000443)|all_neural(118;0.0779)		BRCA - Breast invasive adenocarcinoma(99;0.0517)|OV - Ovarian serous cystadenocarcinoma(97;0.0868)															---	---	---	---
PTPRM	5797	broad.mit.edu	37	18	8379271	8379271	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:8379271G>T	uc002knn.3	+	26	4183	c.3680G>T	c.(3679-3681)CGC>CTC	p.R1227L	PTPRM_uc010dkv.2_Missense_Mutation_p.R1240L|PTPRM_uc010wzl.1_Missense_Mutation_p.R1014L	NM_002845	NP_002836	P28827	PTPRM_HUMAN	protein tyrosine phosphatase, receptor type, M	1227	Tyrosine-protein phosphatase 2.|Cytoplasmic (Potential).				homophilic cell adhesion|negative regulation of angiogenesis|negative regulation of endothelial cell migration|negative regulation of endothelial cell proliferation|response to drug|retina layer formation|retinal ganglion cell axon guidance	cell-cell adherens junction|integral to plasma membrane|lamellipodium|perinuclear region of cytoplasm	cadherin binding|transmembrane receptor protein tyrosine phosphatase activity			lung(3)|ovary(2)|central_nervous_system(1)	6		Colorectal(10;0.234)																---	---	---	---
MIB1	57534	broad.mit.edu	37	18	19383856	19383856	+	Intron	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:19383856T>A	uc002ktq.2	+						MIB1_uc002ktp.2_Intron	NM_020774	NP_065825			mindbomb homolog 1						Notch signaling pathway	centrosome|nuclear membrane|plasma membrane	ubiquitin-protein ligase activity|zinc ion binding			ovary(4)	4			STAD - Stomach adenocarcinoma(5;0.212)															---	---	---	---
RIOK3	8780	broad.mit.edu	37	18	21056996	21056996	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21056996T>C	uc002kui.3	+	10	1817	c.1200T>C	c.(1198-1200)TGT>TGC	p.C400C	RIOK3_uc010dls.2_Silent_p.C400C|RIOK3_uc010xas.1_Silent_p.C384C|RIOK3_uc010xat.1_Silent_p.C144C	NM_003831	NP_003822	O14730	RIOK3_HUMAN	sudD suppressor of bimD6 homolog	400	Protein kinase.				chromosome segregation		ATP binding|protein binding|protein serine/threonine kinase activity			ovary(2)|central_nervous_system(1)	3	all_cancers(21;0.000106)|all_epithelial(16;6.74e-07)|Lung NSC(20;0.00171)|all_lung(20;0.0055)|Colorectal(14;0.0202)|Ovarian(20;0.127)																	---	---	---	---
NPC1	4864	broad.mit.edu	37	18	21112182	21112182	+	Missense_Mutation	SNP	C	T	T	rs151305963		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21112182C>T	uc002kum.3	-	25	4095	c.3821G>A	c.(3820-3822)CGG>CAG	p.R1274Q	NPC1_uc010dlu.1_Intron|NPC1_uc010xaz.1_Missense_Mutation_p.R1007Q	NM_000271	NP_000262	O15118	NPC1_HUMAN	Niemann-Pick disease, type C1 precursor	1274					autophagy|bile acid metabolic process|cholesterol efflux|cholesterol homeostasis|lysosomal transport	endoplasmic reticulum|integral to plasma membrane|late endosome membrane|lysosomal membrane|nuclear envelope|perinuclear region of cytoplasm	hedgehog receptor activity|protein binding|sterol transporter activity			ovary(2)	2	all_cancers(21;0.000106)|all_epithelial(16;6.57e-07)|Lung NSC(20;0.00166)|all_lung(20;0.00536)|Colorectal(14;0.0202)|Ovarian(20;0.127)																	---	---	---	---
DSC3	1825	broad.mit.edu	37	18	28612232	28612232	+	Missense_Mutation	SNP	C	T	T	rs145242863		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:28612232C>T	uc002kwj.3	-	2	235	c.80G>A	c.(79-81)CGT>CAT	p.R27H	DSC3_uc002kwi.3_Missense_Mutation_p.R27H	NM_001941	NP_001932	Q14574	DSC3_HUMAN	desmocollin 3 isoform Dsc3a preproprotein	27					homophilic cell adhesion|protein stabilization	desmosome|integral to membrane|membrane fraction	calcium ion binding|gamma-catenin binding			ovary(2)|skin(2)	4			OV - Ovarian serous cystadenocarcinoma(10;0.125)															---	---	---	---
KLHL14	57565	broad.mit.edu	37	18	30275442	30275442	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:30275442G>A	uc002kxm.1	-	4	1531	c.1143C>T	c.(1141-1143)GAC>GAT	p.D381D	KLHL14_uc010dmd.1_5'UTR	NM_020805	NP_065856	Q9P2G3	KLH14_HUMAN	kelch-like 14	381	Kelch 2.					cytosol|endoplasmic reticulum membrane				ovary(1)	1																		---	---	---	---
ASXL3	80816	broad.mit.edu	37	18	31323088	31323088	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:31323088G>T	uc010dmg.1	+	12	3331	c.3276G>T	c.(3274-3276)GAG>GAT	p.E1092D	ASXL3_uc002kxq.2_Missense_Mutation_p.E799D	NM_030632	NP_085135	Q9C0F0	ASXL3_HUMAN	additional sex combs like 3	1092					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	metal ion binding			ovary(2)|pancreas(1)	3																		---	---	---	---
SLC14A2	8170	broad.mit.edu	37	18	43262376	43262376	+	Silent	SNP	G	A	A	rs143610580		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:43262376G>A	uc010dnj.2	+	21	2976	c.2655G>A	c.(2653-2655)CCG>CCA	p.P885P	SLC14A2_uc002lbe.2_Silent_p.P885P	NM_007163	NP_009094	Q15849	UT2_HUMAN	solute carrier family 14 (urea transporter),	885						apical plasma membrane|integral to membrane|membrane fraction	protein binding|urea transmembrane transporter activity	p.P885P(1)		upper_aerodigestive_tract(1)|ovary(1)|central_nervous_system(1)|skin(1)	4																		---	---	---	---
KIAA1632	57724	broad.mit.edu	37	18	43446800	43446800	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:43446800G>A	uc002lbm.2	-	38	6684	c.6584C>T	c.(6583-6585)GCG>GTG	p.A2195V	KIAA1632_uc010xcq.1_Missense_Mutation_p.A749V|KIAA1632_uc010xcr.1_RNA|KIAA1632_uc010xcs.1_RNA|KIAA1632_uc002lbn.2_Missense_Mutation_p.A1070V	NM_020964	NP_066015	Q9HCE0	EPG5_HUMAN	hypothetical protein LOC57724	2195					autophagy						0																		---	---	---	---
TCEB3B	51224	broad.mit.edu	37	18	44561181	44561181	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:44561181C>A	uc002lcr.1	-	1	808	c.455G>T	c.(454-456)AGA>ATA	p.R152I	KATNAL2_uc010dnq.1_Intron|KATNAL2_uc002lco.2_Intron|KATNAL2_uc002lcp.3_Intron	NM_016427	NP_057511	Q8IYF1	ELOA2_HUMAN	elongin A2	152					regulation of transcription elongation, DNA-dependent|transcription from RNA polymerase II promoter	integral to membrane|nucleus	DNA binding			ovary(2)|large_intestine(1)|pancreas(1)	4																		---	---	---	---
MYO5B	4645	broad.mit.edu	37	18	47390531	47390531	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:47390531G>A	uc002leb.2	-	28	4111	c.3823C>T	c.(3823-3825)CGA>TGA	p.R1275*	MYO5B_uc002lea.2_Nonsense_Mutation_p.R416*	NM_001080467	NP_001073936	Q9ULV0	MYO5B_HUMAN	myosin VB	1275					protein transport	myosin complex	actin binding|ATP binding|calmodulin binding|motor activity			ovary(2)|skin(2)|central_nervous_system(1)	5				READ - Rectum adenocarcinoma(32;0.103)														---	---	---	---
CCDC11	220136	broad.mit.edu	37	18	47778135	47778135	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:47778135G>A	uc002lee.2	-	4	584	c.493C>T	c.(493-495)CGT>TGT	p.R165C		NM_145020	NP_659457	Q96M91	CCD11_HUMAN	coiled-coil domain containing 11	165										ovary(1)|pancreas(1)|skin(1)	3				STAD - Stomach adenocarcinoma(97;2.66e-05)|Colorectal(21;7.57e-05)|Lung(128;0.00932)|READ - Rectum adenocarcinoma(32;0.164)														---	---	---	---
RAB27B	5874	broad.mit.edu	37	18	52551560	52551560	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:52551560G>A	uc002lfr.2	+							NM_004163	NP_004154			RAB27B, member RAS oncogene family						protein transport|small GTPase mediated signal transduction	Golgi apparatus|plasma membrane	GTP binding|GTPase activity				0				Colorectal(16;0.0273)|READ - Rectum adenocarcinoma(59;0.219)														---	---	---	---
ALPK2	115701	broad.mit.edu	37	18	56204716	56204716	+	Silent	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:56204716T>G	uc002lhj.3	-	5	2917	c.2703A>C	c.(2701-2703)ACA>ACC	p.T901T	ALPK2_uc002lhk.1_Silent_p.T232T	NM_052947	NP_443179	Q86TB3	ALPK2_HUMAN	heart alpha-kinase	901							ATP binding|protein serine/threonine kinase activity			ovary(7)|skin(5)|lung(1)|central_nervous_system(1)	14																		---	---	---	---
CPLX4	339302	broad.mit.edu	37	18	56963955	56963955	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:56963955G>A	uc002lhy.2	-	3	645	c.458C>T	c.(457-459)GCG>GTG	p.A153V		NM_181654	NP_857637	Q7Z7G2	CPLX4_HUMAN	complexin 4 precursor	153					exocytosis|neurotransmitter transport	cell junction|synapse	syntaxin binding			ovary(1)	1		Colorectal(73;0.175)																---	---	---	---
CDH20	28316	broad.mit.edu	37	18	59221671	59221671	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:59221671G>A	uc010dps.1	+	11	2161	c.2149G>A	c.(2149-2151)GCA>ACA	p.A717T	CDH20_uc002lif.2_Missense_Mutation_p.A711T	NM_031891	NP_114097	Q9HBT6	CAD20_HUMAN	cadherin 20, type 2 preproprotein	717	Cytoplasmic (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			breast(3)|ovary(1)|pancreas(1)	5		Colorectal(73;0.186)																---	---	---	---
PHLPP1	23239	broad.mit.edu	37	18	60646006	60646006	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:60646006C>T	uc002lis.2	+	18	3138	c.2960C>T	c.(2959-2961)CCG>CTG	p.P987L		NM_194449	NP_919431	O60346	PHLP1_HUMAN	PH domain and leucine rich repeat protein	1499					apoptosis|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling	cytosol|membrane|nucleus	metal ion binding|protein serine/threonine phosphatase activity				0																		---	---	---	---
SOCS6	9306	broad.mit.edu	37	18	67992102	67992102	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:67992102C>T	uc002lkr.1	+	2	514	c.198C>T	c.(196-198)AAC>AAT	p.N66N	SOCS6_uc010dqq.2_Silent_p.N66N	NM_004232	NP_004223	O14544	SOCS6_HUMAN	suppressor of cytokine signaling 6	66					defense response|JAK-STAT cascade|negative regulation of signal transduction|regulation of growth	cytoplasm				large_intestine(1)|lung(1)	2		Esophageal squamous(42;0.129)|Colorectal(73;0.152)																---	---	---	---
ATP9B	374868	broad.mit.edu	37	18	77067118	77067118	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77067118A>G	uc002lmx.2	+	15	1671	c.1657A>G	c.(1657-1659)AAC>GAC	p.N553D	ATP9B_uc002lmv.1_RNA|ATP9B_uc002lmw.1_Missense_Mutation_p.N553D|ATP9B_uc002lmz.1_Missense_Mutation_p.N247D	NM_198531	NP_940933	O43861	ATP9B_HUMAN	ATPase, class II, type 9B	553	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	aminophospholipid transporter activity|ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|cation-transporting ATPase activity|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(3)	3		Esophageal squamous(42;0.018)|Melanoma(33;0.0964)|Prostate(75;0.171)		OV - Ovarian serous cystadenocarcinoma(15;1.44e-07)|BRCA - Breast invasive adenocarcinoma(31;0.0405)														---	---	---	---
CTDP1	9150	broad.mit.edu	37	18	77477825	77477825	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77477825G>A	uc002lnh.1	+	10	2373	c.2226G>A	c.(2224-2226)GCG>GCA	p.A742A	CTDP1_uc002lni.1_Silent_p.A742A|CTDP1_uc010drd.1_Silent_p.A742A	NM_004715	NP_004706	Q9Y5B0	CTDP1_HUMAN	CTD (carboxy-terminal domain, RNA polymerase II,	742					positive regulation of viral transcription|protein dephosphorylation|transcription elongation from RNA polymerase II promoter|viral reproduction	nucleoplasm	CTD phosphatase activity|DNA-directed RNA polymerase activity				0		Esophageal squamous(42;0.0157)|Melanoma(33;0.144)		OV - Ovarian serous cystadenocarcinoma(15;5.2e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0277)														---	---	---	---
PQLC1	80148	broad.mit.edu	37	18	77679406	77679406	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77679406G>A	uc002lnl.2	-						PQLC1_uc010dre.2_Intron|PQLC1_uc002lnk.2_Intron|PQLC1_uc010xfm.1_Intron	NM_025078	NP_079354			PQ loop repeat containing 1 isoform 1							integral to membrane				large_intestine(1)|ovary(1)	2		Esophageal squamous(42;0.0212)|Melanoma(33;0.2)		OV - Ovarian serous cystadenocarcinoma(15;8.2e-07)|BRCA - Breast invasive adenocarcinoma(31;0.0258)														---	---	---	---
C18orf22	79863	broad.mit.edu	37	18	77798609	77798609	+	Silent	SNP	G	A	A	rs143262320	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77798609G>A	uc002lns.2	+	4	621	c.483G>A	c.(481-483)GCG>GCA	p.A161A	C18orf22_uc010drh.2_Silent_p.A161A|C18orf22_uc010dri.1_Intron|C18orf22_uc002lnt.2_5'Flank	NM_024805	NP_079081	Q8N0V3	RBFA_HUMAN	hypothetical protein LOC79863 precursor	161					rRNA processing	mitochondrion					0		all_cancers(4;3.21e-14)|all_epithelial(4;7.11e-09)|all_lung(4;0.00366)|Lung NSC(4;0.00683)|Esophageal squamous(42;0.0212)|Ovarian(4;0.0545)|all_hematologic(56;0.15)|Melanoma(33;0.2)		OV - Ovarian serous cystadenocarcinoma(15;6.46e-08)|BRCA - Breast invasive adenocarcinoma(31;0.00376)														---	---	---	---
SHC2	25759	broad.mit.edu	37	19	422256	422256	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:422256C>T	uc002loq.3	-	11	1510	c.1510G>A	c.(1510-1512)GAC>AAC	p.D504N	SHC2_uc002lop.3_Missense_Mutation_p.D245N	NM_012435	NP_036567	P98077	SHC2_HUMAN	SHC (Src homology 2 domain containing)	504	SH2.				insulin receptor signaling pathway|nerve growth factor receptor signaling pathway|Ras protein signal transduction	cytosol					0		all_cancers(10;1.13e-36)|all_epithelial(18;1.46e-23)|Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.1e-06)|all_lung(49;1.55e-06)|Breast(49;4.08e-05)|Hepatocellular(1079;0.137)|Renal(1328;0.228)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
ABCA7	10347	broad.mit.edu	37	19	1048922	1048922	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1048922T>A	uc002lqw.3	+	17	2529	c.2298T>A	c.(2296-2298)AAT>AAA	p.N766K	ABCA7_uc010dsb.1_Missense_Mutation_p.N628K	NM_019112	NP_061985	Q8IZY2	ABCA7_HUMAN	ATP-binding cassette, sub-family A, member 7	766					phagocytosis|transmembrane transport	ATP-binding cassette (ABC) transporter complex|endosome membrane|Golgi membrane|integral to membrane|plasma membrane	ATP binding|ATPase activity|transporter activity			pancreas(7)|ovary(1)|central_nervous_system(1)	9		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.04e-05)|all_lung(49;1.53e-05)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
MIDN	90007	broad.mit.edu	37	19	1251656	1251656	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1251656G>A	uc002lrp.2	+							NM_177401	NP_796375			midnolin							nucleolus					0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;7.93e-06)|all_lung(49;1.25e-05)|Breast(49;0.000172)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
APC2	10297	broad.mit.edu	37	19	1455462	1455462	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1455462G>A	uc002lsr.1	+	6	810	c.602G>A	c.(601-603)CGC>CAC	p.R201H	APC2_uc002lss.1_5'UTR|APC2_uc002lst.1_Missense_Mutation_p.R201H|APC2_uc002lsu.1_Missense_Mutation_p.R200H	NM_005883	NP_005874	O95996	APC2_HUMAN	adenomatosis polyposis coli 2	201					negative regulation of canonical Wnt receptor signaling pathway|negative regulation of catenin import into nucleus|Wnt receptor signaling pathway	actin filament|catenin complex|cytoplasmic microtubule|Golgi membrane|lamellipodium membrane|perinuclear region of cytoplasm	beta-catenin binding|microtubule binding			breast(3)|pancreas(1)	4		Acute lymphoblastic leukemia(61;3.02e-13)|all_hematologic(61;4.32e-09)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
TMEM146	257062	broad.mit.edu	37	19	5745968	5745968	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5745968G>T	uc002mda.2	+	9	763	c.702G>T	c.(700-702)GGG>GGT	p.G234G	TMEM146_uc010duj.1_5'UTR	NM_152784	NP_689997	Q86XM0	TM146_HUMAN	transmembrane protein 146 precursor	234	Extracellular (Potential).					integral to membrane				ovary(1)|central_nervous_system(1)|pancreas(1)	3																		---	---	---	---
RANBP3	8498	broad.mit.edu	37	19	5933443	5933443	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5933443C>T	uc002mdw.2	-	6	681	c.454G>A	c.(454-456)GGC>AGC	p.G152S	RANBP3_uc002mdv.2_5'UTR|RANBP3_uc002mdx.2_Missense_Mutation_p.G152S|RANBP3_uc002mdy.2_Missense_Mutation_p.G84S|RANBP3_uc002mdz.2_Missense_Mutation_p.G84S|RANBP3_uc010duq.2_Missense_Mutation_p.G62S|RANBP3_uc002mea.2_Missense_Mutation_p.G24S|RANBP3_uc010xix.1_Missense_Mutation_p.G24S	NM_007322	NP_015561	Q9H6Z4	RANB3_HUMAN	RAN binding protein 3 isoform RANBP3-d	152					intracellular transport|protein transport	cytoplasm|nucleus	Ran GTPase binding			breast(1)	1																		---	---	---	---
CD209	30835	broad.mit.edu	37	19	7810788	7810788	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7810788C>T	uc002mht.2	-	4	431	c.364G>A	c.(364-366)GAG>AAG	p.E122K	CD209_uc010xju.1_Intron|CD209_uc010dvp.2_Missense_Mutation_p.E98K|CD209_uc002mhr.2_Missense_Mutation_p.E98K|CD209_uc002mhs.2_Missense_Mutation_p.E98K|CD209_uc002mhu.2_Missense_Mutation_p.E122K|CD209_uc010dvq.2_Missense_Mutation_p.E122K|CD209_uc002mhq.2_Missense_Mutation_p.E122K|CD209_uc002mhv.2_Missense_Mutation_p.E98K|CD209_uc002mhx.2_Missense_Mutation_p.E78K|CD209_uc002mhw.2_Missense_Mutation_p.E78K|CD209_uc010dvr.2_Intron	NM_021155	NP_066978	Q9NNX6	CD209_HUMAN	CD209 molecule isoform 1	122	Extracellular (Probable).|2.|7 X approximate tandem repeats.				cell-cell recognition|endocytosis|heterophilic cell-cell adhesion|innate immune response|intracellular signal transduction|intracellular virion transport|leukocyte cell-cell adhesion|peptide antigen transport|viral genome replication|virion attachment to host cell surface receptor	cytoplasm|extracellular region|integral to membrane|plasma membrane	mannose binding|metal ion binding|peptide antigen binding|receptor activity|virion binding			skin(1)	1																		---	---	---	---
MUC16	94025	broad.mit.edu	37	19	9019283	9019283	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9019283C>T	uc002mkp.2	-	23	37808	c.37604G>A	c.(37603-37605)AGC>AAC	p.S12535N		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	12537	Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---
MUC16	94025	broad.mit.edu	37	19	9061718	9061718	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9061718G>A	uc002mkp.2	-	3	25932	c.25728C>T	c.(25726-25728)TTC>TTT	p.F8576F		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	8578	Ser-rich.|Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---
COL5A3	50509	broad.mit.edu	37	19	10076989	10076989	+	Splice_Site	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10076989C>T	uc002mmq.1	-	64	4868	c.4782_splice	c.e64+1	p.I1594_splice		NM_015719	NP_056534			collagen, type V, alpha 3 preproprotein						collagen fibril organization|skin development	collagen type V	collagen binding|extracellular matrix structural constituent			ovary(7)|lung(1)|central_nervous_system(1)|skin(1)	10			Epithelial(33;7.11e-05)															---	---	---	---
ILF3	3609	broad.mit.edu	37	19	10793817	10793817	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10793817G>T	uc002mpn.2	+	14	1870	c.1553G>T	c.(1552-1554)GGG>GTG	p.G518V	ILF3_uc002mpm.2_Missense_Mutation_p.G522V|ILF3_uc002mpl.2_Missense_Mutation_p.G518V|ILF3_uc002mpk.2_Missense_Mutation_p.G518V|ILF3_uc010xli.1_Missense_Mutation_p.G116V|ILF3_uc002mpo.2_Missense_Mutation_p.G522V|ILF3_uc002mpp.2_Missense_Mutation_p.G343V|ILF3_uc002mpq.2_5'Flank	NM_012218	NP_036350	Q12906	ILF3_HUMAN	interleukin enhancer binding factor 3 isoform a	518					M phase|negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	mitochondrion|nucleolus|ribonucleoprotein complex	DNA binding|double-stranded RNA binding|protein binding|protein binding			ovary(3)	3			Epithelial(33;6.86e-06)|all cancers(31;1.65e-05)															---	---	---	---
ILF3	3609	broad.mit.edu	37	19	10798154	10798154	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10798154C>A	uc002mpn.2	+	18	2509	c.2192C>A	c.(2191-2193)GCT>GAT	p.A731D	ILF3_uc002mpo.2_Missense_Mutation_p.A735D|ILF3_uc002mpq.2_Missense_Mutation_p.L34M	NM_012218	NP_036350	Q12906	ILF3_HUMAN	interleukin enhancer binding factor 3 isoform a	731	Interaction with PRMT1.				M phase|negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	mitochondrion|nucleolus|ribonucleoprotein complex	DNA binding|double-stranded RNA binding|protein binding|protein binding			ovary(3)	3			Epithelial(33;6.86e-06)|all cancers(31;1.65e-05)															---	---	---	---
LOC55908	55908	broad.mit.edu	37	19	11350389	11350389	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11350389G>A	uc010dxx.2	+	2	237	c.235G>A	c.(235-237)GGC>AGC	p.G79S	DOCK6_uc010xlq.1_5'Flank|DOCK6_uc002mqs.3_Intron|LOC55908_uc010dxw.2_Intron	NM_018687	NP_061157	Q6UXH0	TD26_HUMAN	hepatocellular carcinoma-associated gene TD26	26						extracellular region					0																		---	---	---	---
ZNF440	126070	broad.mit.edu	37	19	11943295	11943295	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11943295A>C	uc002msp.1	+	4	1460	c.1304A>C	c.(1303-1305)TAT>TCT	p.Y435S		NM_152357	NP_689570	Q8IYI8	ZN440_HUMAN	zinc finger protein 440	435	C2H2-type 11.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
ZNF440	126070	broad.mit.edu	37	19	11943375	11943375	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11943375A>C	uc002msp.1	+	4	1540	c.1384A>C	c.(1384-1386)ATA>CTA	p.I462L		NM_152357	NP_689570	Q8IYI8	ZN440_HUMAN	zinc finger protein 440	462	C2H2-type 12.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
ZNF440	126070	broad.mit.edu	37	19	11943410	11943410	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11943410T>G	uc002msp.1	+	4	1575	c.1419T>G	c.(1417-1419)TTT>TTG	p.F473L		NM_152357	NP_689570	Q8IYI8	ZN440_HUMAN	zinc finger protein 440	473	C2H2-type 12.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
GCDH	2639	broad.mit.edu	37	19	13008623	13008623	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:13008623G>A	uc002mvq.2	+	11	1266	c.1189G>A	c.(1189-1191)GAG>AAG	p.E397K	GCDH_uc010xms.1_3'UTR|GCDH_uc002mvp.2_Missense_Mutation_p.E397K|GCDH_uc010xmt.1_Missense_Mutation_p.E231K|GCDH_uc010xmu.1_Missense_Mutation_p.E353K	NM_000159	NP_000150	Q92947	GCDH_HUMAN	glutaryl-Coenzyme A dehydrogenase isoform a	397					lysine catabolic process	mitochondrial matrix	flavin adenine dinucleotide binding|glutaryl-CoA dehydrogenase activity|protein binding				0																		---	---	---	---
IER2	9592	broad.mit.edu	37	19	13264528	13264528	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:13264528C>T	uc002mwr.2	+	2	856	c.528C>T	c.(526-528)CGC>CGT	p.R176R		NM_004907	NP_004898	Q9BTL4	IER2_HUMAN	immediate early response 2	176								p.A175fs*42(1)		kidney(1)	1			OV - Ovarian serous cystadenocarcinoma(19;3.41e-21)															---	---	---	---
NOTCH3	4854	broad.mit.edu	37	19	15278099	15278099	+	Missense_Mutation	SNP	C	T	T	rs139983430		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15278099C>T	uc002nan.2	-	29	5399	c.5323G>A	c.(5323-5325)GCA>ACA	p.A1775T		NM_000435	NP_000426	Q9UM47	NOTC3_HUMAN	Notch homolog 3 precursor	1775	Cytoplasmic (Potential).				Notch receptor processing|Notch signaling pathway|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to membrane|nucleoplasm|plasma membrane	calcium ion binding|protein binding|receptor activity			lung(8)|ovary(5)|skin(4)|prostate(2)|central_nervous_system(1)|breast(1)	21			OV - Ovarian serous cystadenocarcinoma(3;2.6e-20)|Epithelial(3;1.34e-16)|all cancers(3;5.13e-15)															---	---	---	---
NOTCH3	4854	broad.mit.edu	37	19	15302604	15302604	+	Missense_Mutation	SNP	C	T	T	rs115836330	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15302604C>T	uc002nan.2	-	5	830	c.754G>A	c.(754-756)GTG>ATG	p.V252M	NOTCH3_uc002nao.1_Missense_Mutation_p.V252M	NM_000435	NP_000426	Q9UM47	NOTC3_HUMAN	Notch homolog 3 precursor	252	Extracellular (Potential).|EGF-like 6; calcium-binding (Potential).		Missing (in CADASIL).		Notch receptor processing|Notch signaling pathway|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to membrane|nucleoplasm|plasma membrane	calcium ion binding|protein binding|receptor activity			lung(8)|ovary(5)|skin(4)|prostate(2)|central_nervous_system(1)|breast(1)	21			OV - Ovarian serous cystadenocarcinoma(3;2.6e-20)|Epithelial(3;1.34e-16)|all cancers(3;5.13e-15)															---	---	---	---
ZNF101	94039	broad.mit.edu	37	19	19790942	19790942	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19790942C>A	uc002nni.1	+	4	1254	c.1144C>A	c.(1144-1146)CGA>AGA	p.R382R	ZNF101_uc010ecg.1_Silent_p.R262R|ZNF101_uc002nnj.1_Silent_p.R262R	NM_033204	NP_149981	Q8IZC7	ZN101_HUMAN	zinc finger protein 101	382	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2																		---	---	---	---
ZNF100	163227	broad.mit.edu	37	19	21909815	21909815	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:21909815T>C	uc002nqi.2	-	5	1498	c.1299A>G	c.(1297-1299)GAA>GAG	p.E433E	ZNF100_uc002nqh.2_Silent_p.E369E	NM_173531	NP_775802	Q8IYN0	ZN100_HUMAN	zinc finger protein 100	433	C2H2-type 10.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
C19orf2	8725	broad.mit.edu	37	19	30505891	30505891	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:30505891G>A	uc002nsr.2	+	11	1553	c.1523G>A	c.(1522-1524)CGA>CAA	p.R508Q	C19orf2_uc002nsq.2_Intron|C19orf2_uc002nss.2_Missense_Mutation_p.R468Q|C19orf2_uc002nst.2_Missense_Mutation_p.R432Q	NM_003796	NP_003787	O94763	RMP_HUMAN	RPB5-mediating protein isoform a	508					protein folding|regulation of transcription from RNA polymerase II promoter|response to virus	DNA-directed RNA polymerase II, core complex|prefoldin complex	transcription corepressor activity|unfolded protein binding			ovary(1)|kidney(1)	2	Ovarian(5;0.000902)|Breast(6;0.0203)|Esophageal squamous(110;0.195)	Hepatocellular(1079;0.137)|Renal(1328;0.228)	STAD - Stomach adenocarcinoma(5;5.36e-06)|Lung(7;0.0144)|LUAD - Lung adenocarcinoma(5;0.115)	STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
PEPD	5184	broad.mit.edu	37	19	33968993	33968993	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33968993G>A	uc002nur.3	-	7	642	c.507C>T	c.(505-507)TTC>TTT	p.F169F	PEPD_uc010xrr.1_Silent_p.F169F|PEPD_uc010xrs.1_Silent_p.F105F	NM_000285	NP_000276	P12955	PEPD_HUMAN	prolidase isoform 1	169					cellular amino acid metabolic process|collagen catabolic process|proteolysis		aminopeptidase activity|dipeptidase activity|manganese ion binding|metallocarboxypeptidase activity			ovary(2)	2	Esophageal squamous(110;0.137)																	---	---	---	---
PEPD	5184	broad.mit.edu	37	19	33980958	33980958	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33980958G>A	uc002nur.3	-	6	582	c.447C>T	c.(445-447)GGC>GGT	p.G149G	PEPD_uc010xrr.1_Silent_p.G149G|PEPD_uc010xrs.1_Silent_p.G85G	NM_000285	NP_000276	P12955	PEPD_HUMAN	prolidase isoform 1	149					cellular amino acid metabolic process|collagen catabolic process|proteolysis		aminopeptidase activity|dipeptidase activity|manganese ion binding|metallocarboxypeptidase activity	p.G149G(1)		ovary(2)	2	Esophageal squamous(110;0.137)																	---	---	---	---
HPN	3249	broad.mit.edu	37	19	35550661	35550661	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35550661A>G	uc002nxq.1	+	6	490	c.245A>G	c.(244-246)AAC>AGC	p.N82S	HPN_uc002nxr.1_Missense_Mutation_p.N82S|HPN_uc002nxs.1_Missense_Mutation_p.N34S|HPN_uc010xsh.1_Missense_Mutation_p.N51S|HPN_uc002nxt.1_5'UTR|LOC100128675_uc010xsi.1_Silent_p.L82L	NM_002151	NP_002142	P05981	HEPS_HUMAN	hepsin	82	SRCR.|Extracellular (Potential).				cell growth|proteolysis	cytoplasm|integral to plasma membrane	scavenger receptor activity|serine-type endopeptidase activity			ovary(1)|central_nervous_system(1)	2	all_lung(56;5.38e-08)|Lung NSC(56;8.61e-08)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0849)		Coagulation factor VIIa(DB00036)													---	---	---	---
MAG	4099	broad.mit.edu	37	19	35801452	35801452	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35801452C>T	uc002nyy.1	+	9	1671	c.1522C>T	c.(1522-1524)CGA>TGA	p.R508*	MAG_uc002nyx.1_Nonsense_Mutation_p.R508*|MAG_uc010eds.1_Nonsense_Mutation_p.R483*|MAG_uc002nyz.1_Nonsense_Mutation_p.R508*	NM_002361	NP_002352	P20916	MAG_HUMAN	myelin associated glycoprotein isoform a	508	Ig-like C2-type 4.|Extracellular (Potential).				blood coagulation|cell adhesion|leukocyte migration|negative regulation of axonogenesis|nerve growth factor receptor signaling pathway	integral to membrane|plasma membrane	sugar binding			breast(3)|lung(2)|central_nervous_system(1)|skin(1)	7	all_lung(56;2.37e-08)|Lung NSC(56;3.66e-08)|Esophageal squamous(110;0.162)	Renal(1328;0.242)	Epithelial(14;3.14e-19)|OV - Ovarian serous cystadenocarcinoma(14;1.5e-18)|all cancers(14;1.5e-16)|LUSC - Lung squamous cell carcinoma(66;0.0417)															---	---	---	---
FFAR1	2864	broad.mit.edu	37	19	35842942	35842942	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35842942C>T	uc002nzc.2	+	1	498	c.488C>T	c.(487-489)CCG>CTG	p.P163L		NM_005303	NP_005294	O14842	FFAR1_HUMAN	free fatty acid receptor 1	163	Extracellular (Potential).				energy reserve metabolic process|regulation of insulin secretion	integral to plasma membrane	G-protein coupled receptor activity|guanyl-nucleotide exchange factor activity|lipid binding			central_nervous_system(1)	1	all_lung(56;9.78e-09)|Lung NSC(56;1.46e-08)|Esophageal squamous(110;0.162)		Epithelial(14;4.58e-20)|OV - Ovarian serous cystadenocarcinoma(14;6.67e-19)|all cancers(14;2.01e-17)|LUSC - Lung squamous cell carcinoma(66;0.0417)		Icosapent(DB00159)													---	---	---	---
MLL4	9757	broad.mit.edu	37	19	36229028	36229028	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36229028A>C	uc010eei.2	+	37	7808	c.7808A>C	c.(7807-7809)GAG>GCG	p.E2603A		NM_014727	NP_055542	Q9UMN6	MLL4_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 4	2603	SET.				chromatin-mediated maintenance of transcription		DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			central_nervous_system(6)|breast(2)|ovary(1)|kidney(1)|skin(1)	11	all_lung(56;3.33e-07)|Lung NSC(56;5.02e-07)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0515)															---	---	---	---
ARHGAP33	115703	broad.mit.edu	37	19	36279193	36279193	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36279193C>T	uc002obs.1	+	21	3328	c.3243C>T	c.(3241-3243)TAC>TAT	p.Y1081Y	ARHGAP33_uc002obt.1_Silent_p.Y1078Y|ARHGAP33_uc010eel.2_Intron|ARHGAP33_uc002obv.1_Silent_p.Y830Y	NM_052948	NP_443180	O14559	RHG33_HUMAN	sorting nexin 26	1242					cell communication|protein transport|signal transduction	intracellular	GTPase activator activity|phosphatidylinositol binding|protein binding			skin(2)|ovary(1)|pancreas(1)	4																		---	---	---	---
LRFN3	79414	broad.mit.edu	37	19	36430659	36430659	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36430659C>T	uc002oco.2	+	2	784	c.332C>T	c.(331-333)GCC>GTC	p.A111V		NM_024509	NP_078785	Q9BTN0	LRFN3_HUMAN	leucine rich repeat and fibronectin type III	111	LRR 3.|Extracellular (Potential).				cell adhesion	axon|cell junction|dendrite|integral to membrane|postsynaptic membrane|presynaptic membrane					0	all_lung(56;7.14e-07)|Lung NSC(56;1.12e-06)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.06)															---	---	---	---
ZNF461	92283	broad.mit.edu	37	19	37130820	37130820	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37130820C>T	uc002oem.2	-	6	655	c.427G>A	c.(427-429)GCT>ACT	p.A143T	ZNF461_uc002oen.2_Missense_Mutation_p.A112T|ZNF461_uc010xtj.1_Missense_Mutation_p.A120T	NM_153257	NP_694989	Q8TAF7	ZN461_HUMAN	gonadotropin inducible transcription repressor	143					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	Esophageal squamous(110;0.198)		COAD - Colon adenocarcinoma(19;0.0454)|Colorectal(19;0.065)															---	---	---	---
ZNF793	390927	broad.mit.edu	37	19	38027882	38027882	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38027882T>A	uc010efm.2	+	8	764	c.322T>A	c.(322-324)TTG>ATG	p.L108M	ZNF793_uc010xts.1_Missense_Mutation_p.L108M|ZNF793_uc010efo.2_Missense_Mutation_p.L108M	NM_001013659	NP_001013681	Q6ZN11	ZN793_HUMAN	zinc finger protein 793	108					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0			COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)															---	---	---	---
SPINT2	10653	broad.mit.edu	37	19	38780920	38780920	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38780920C>T	uc002ohr.1	+	5	884	c.553C>T	c.(553-555)CGC>TGC	p.R185C	SPINT2_uc002ohs.1_Missense_Mutation_p.R128C	NM_021102	NP_066925	O43291	SPIT2_HUMAN	serine protease inhibitor, Kunitz type, 2	185	Extracellular (Potential).				cellular component movement	cytoplasm|extracellular region|integral to membrane|soluble fraction	serine-type endopeptidase inhibitor activity				0	all_cancers(60;6.83e-07)		Lung(45;0.000246)|LUSC - Lung squamous cell carcinoma(53;0.000292)															---	---	---	---
RYR1	6261	broad.mit.edu	37	19	38980003	38980003	+	Nonsense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38980003G>T	uc002oit.2	+	35	5864	c.5734G>T	c.(5734-5736)GAG>TAG	p.E1912*	RYR1_uc002oiu.2_Nonsense_Mutation_p.E1912*	NM_000540	NP_000531	P21817	RYR1_HUMAN	skeletal muscle ryanodine receptor isoform 1	1912	Glu-rich (acidic).|Cytoplasmic.|6 X approximate repeats.				muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)													---	---	---	---
RYR1	6261	broad.mit.edu	37	19	39019617	39019617	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39019617G>A	uc002oit.2	+	76	11191	c.11061G>A	c.(11059-11061)GAG>GAA	p.E3687E	RYR1_uc002oiu.2_Silent_p.E3682E|RYR1_uc002oiv.1_Silent_p.E602E|RYR1_uc010xuf.1_Silent_p.E607E	NM_000540	NP_000531	P21817	RYR1_HUMAN	skeletal muscle ryanodine receptor isoform 1	3687					muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)													---	---	---	---
HNRNPL	3191	broad.mit.edu	37	19	39329144	39329144	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39329144G>T	uc010xul.1	-	10	1461	c.1450C>A	c.(1450-1452)CGG>AGG	p.R484R	HNRNPL_uc010ege.1_Intron|HNRNPL_uc002ojj.1_Silent_p.R140R|HNRNPL_uc002ojo.1_Silent_p.R62R|HNRNPL_uc002ojk.2_Silent_p.R140R|HNRNPL_uc002ojl.2_Silent_p.R140R|HNRNPL_uc010xum.1_Silent_p.R351R	NM_001533	NP_001524	P14866	HNRPL_HUMAN	heterogeneous nuclear ribonucleoprotein L	484					nuclear mRNA splicing, via spliceosome	cytoplasm|heterogeneous nuclear ribonucleoprotein complex|nucleoplasm	nucleotide binding|protein binding|RNA binding|transcription regulatory region DNA binding				0	all_cancers(60;6.83e-06)|Ovarian(47;0.0454)		Lung(45;0.00342)|LUSC - Lung squamous cell carcinoma(53;0.00575)															---	---	---	---
LRFN1	57622	broad.mit.edu	37	19	39805733	39805733	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39805733G>A	uc002okw.2	-	1	244	c.244C>T	c.(244-246)CGC>TGC	p.R82C		NM_020862	NP_065913	Q9P244	LRFN1_HUMAN	leucine rich repeat and fibronectin type III	82	LRR 1.|Extracellular (Potential).					cell junction|integral to membrane|postsynaptic density|postsynaptic membrane				ovary(2)	2	all_cancers(60;1.85e-07)|all_lung(34;4.03e-08)|Lung NSC(34;4.66e-08)|all_epithelial(25;6.4e-07)|Ovarian(47;0.0512)		Epithelial(26;1.96e-27)|all cancers(26;2.05e-24)|Lung(45;0.000278)|LUSC - Lung squamous cell carcinoma(53;0.000335)															---	---	---	---
PLEKHG2	64857	broad.mit.edu	37	19	39914611	39914611	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39914611T>C	uc010xuz.1	+	19	3163	c.2838T>C	c.(2836-2838)CAT>CAC	p.H946H	PLEKHG2_uc010xuy.1_Silent_p.H887H|PLEKHG2_uc002olj.2_Intron|PLEKHG2_uc010xva.1_Silent_p.H724H	NM_022835	NP_073746	Q9H7P9	PKHG2_HUMAN	common-site lymphoma/leukemia guanine nucleotide	946					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	Rho guanyl-nucleotide exchange factor activity			skin(2)|pancreas(1)|breast(1)	4	all_cancers(60;3.08e-07)|all_lung(34;2.66e-08)|Lung NSC(34;3e-08)|all_epithelial(25;6.57e-07)|Ovarian(47;0.0569)		Epithelial(26;2.92e-26)|all cancers(26;2.01e-23)|Lung(45;0.000499)|LUSC - Lung squamous cell carcinoma(53;0.000657)															---	---	---	---
SUPT5H	6829	broad.mit.edu	37	19	39961140	39961140	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39961140C>T	uc002olo.3	+	18	1833	c.1654C>T	c.(1654-1656)CGA>TGA	p.R552*	SUPT5H_uc002olp.3_Nonsense_Mutation_p.R552*|SUPT5H_uc002olq.3_Nonsense_Mutation_p.R548*|SUPT5H_uc002oln.3_Nonsense_Mutation_p.R552*|SUPT5H_uc002olr.3_Nonsense_Mutation_p.R552*|SUPT5H_uc002ols.1_Nonsense_Mutation_p.R175*|SUPT5H_uc010egp.1_5'Flank	NM_001111020	NP_001104490	O00267	SPT5H_HUMAN	suppressor of Ty 5 homolog isoform a	552					cell cycle|chromatin remodeling|mRNA capping|negative regulation of transcription elongation, DNA-dependent|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription elongation from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|positive regulation of viral transcription|response to organic substance|retroviral genome replication|transcription elongation from RNA polymerase II promoter	nucleoplasm	enzyme binding|protein heterodimerization activity			ovary(3)|pancreas(1)	4	all_cancers(60;6.69e-07)|all_lung(34;2.66e-08)|Lung NSC(34;3e-08)|all_epithelial(25;1.57e-06)|Ovarian(47;0.159)		Epithelial(26;3.9e-26)|all cancers(26;1.35e-23)|LUSC - Lung squamous cell carcinoma(53;0.000657)															---	---	---	---
DLL3	10683	broad.mit.edu	37	19	39995921	39995921	+	Missense_Mutation	SNP	G	A	A	rs141671275	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39995921G>A	uc002olx.2	+	6	981	c.923G>A	c.(922-924)CGG>CAG	p.R308Q	DLL3_uc010egq.2_Missense_Mutation_p.R308Q|DLL3_uc002olw.2_Missense_Mutation_p.R308Q	NM_016941	NP_058637	Q9NYJ7	DLL3_HUMAN	delta-like 3 protein isoform 1 precursor	308	EGF-like 2.|Extracellular (Potential).				Notch signaling pathway|skeletal system development	integral to membrane	Notch binding			central_nervous_system(2)|breast(1)	3	all_cancers(60;4.04e-06)|all_lung(34;1.77e-07)|Lung NSC(34;2.09e-07)|all_epithelial(25;1.13e-05)|Ovarian(47;0.159)		Epithelial(26;5.89e-26)|all cancers(26;1.96e-23)|LUSC - Lung squamous cell carcinoma(53;0.000657)															---	---	---	---
FCGBP	8857	broad.mit.edu	37	19	40384036	40384036	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40384036C>T	uc002omp.3	-	21	9582	c.9574G>A	c.(9574-9576)GCG>ACG	p.A3192T		NM_003890	NP_003881	Q9Y6R7	FCGBP_HUMAN	Fc fragment of IgG binding protein precursor	3192	TIL 7.					extracellular region	protein binding			ovary(4)|skin(4)|central_nervous_system(1)	9	all_cancers(60;6.03e-06)|all_lung(34;5.58e-08)|Lung NSC(34;6.62e-08)|Ovarian(47;0.06)		Epithelial(26;6.25e-23)|all cancers(26;1.13e-20)															---	---	---	---
ZNF780A	284323	broad.mit.edu	37	19	40581529	40581529	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40581529C>T	uc002omy.2	-	6	1045	c.820G>A	c.(820-822)GTA>ATA	p.V274I	ZNF780A_uc002omw.3_Intron|ZNF780A_uc002omz.2_Missense_Mutation_p.V274I|ZNF780A_uc010xvh.1_Missense_Mutation_p.V275I	NM_001010880	NP_001010880	O75290	Z780A_HUMAN	zinc finger protein 780A isoform b	274					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(60;9.55e-06)|all_lung(34;1.17e-07)|Lung NSC(34;1.41e-07)|Ovarian(47;0.0925)																	---	---	---	---
MAP3K10	4294	broad.mit.edu	37	19	40710471	40710471	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40710471G>A	uc002ona.2	+	3	1231	c.943G>A	c.(943-945)GTG>ATG	p.V315M	MAP3K10_uc002onb.2_Translation_Start_Site	NM_002446	NP_002437	Q02779	M3K10_HUMAN	mitogen-activated protein kinase kinase kinase	315	Protein kinase.				activation of JUN kinase activity|induction of apoptosis|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of transcription, DNA-dependent|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|positive regulation of JNK cascade|protein autophosphorylation|smoothened signaling pathway	cytoplasm	ATP binding|bHLH transcription factor binding|JUN kinase kinase kinase activity|protein homodimerization activity|transcription corepressor activity			ovary(2)|lung(2)|skin(1)|pancreas(1)	6																		---	---	---	---
HIPK4	147746	broad.mit.edu	37	19	40887032	40887032	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40887032T>C	uc002onp.2	-	3	1151	c.866A>G	c.(865-867)GAC>GGC	p.D289G		NM_144685	NP_653286	Q8NE63	HIPK4_HUMAN	homeodomain interacting protein kinase 4	289	Protein kinase.					cytoplasm	ATP binding|protein serine/threonine kinase activity			ovary(1)|stomach(1)	2			Lung(22;4.95e-05)|LUSC - Lung squamous cell carcinoma(20;0.000292)															---	---	---	---
PRX	57716	broad.mit.edu	37	19	40901531	40901531	+	Missense_Mutation	SNP	C	T	T	rs145203783		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40901531C>T	uc002onr.2	-	7	2997	c.2728G>A	c.(2728-2730)GCC>ACC	p.A910T	PRX_uc002onq.2_Missense_Mutation_p.A771T|PRX_uc002ons.2_3'UTR	NM_181882	NP_870998	Q9BXM0	PRAX_HUMAN	periaxin isoform 2	910					axon ensheathment	cytoplasm|nucleus|plasma membrane	protein binding			ovary(2)	2			Lung(22;6.24e-05)|LUSC - Lung squamous cell carcinoma(20;0.000384)															---	---	---	---
SHKBP1	92799	broad.mit.edu	37	19	41094670	41094670	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41094670G>A	uc002oob.2	+	14	1526	c.1477G>A	c.(1477-1479)GCT>ACT	p.A493T	SHKBP1_uc002ooc.2_Missense_Mutation_p.A468T|SHKBP1_uc002ood.2_Missense_Mutation_p.A493T|SHKBP1_uc010xvl.1_Missense_Mutation_p.A416T|SHKBP1_uc002ooe.2_Missense_Mutation_p.A330T|SHKBP1_uc002oof.2_Missense_Mutation_p.A330T|SHKBP1_uc010xvm.1_Missense_Mutation_p.A273T|SHKBP1_uc010xvn.1_Missense_Mutation_p.A371T	NM_138392	NP_612401	Q8TBC3	SHKB1_HUMAN	SH3KBP1 binding protein 1	493						voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(1)|pancreas(1)	2			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)															---	---	---	---
HNRNPUL1	11100	broad.mit.edu	37	19	41782099	41782099	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41782099C>T	uc002oqb.3	+	5	971	c.682C>T	c.(682-684)CGG>TGG	p.R228W	CYP2F1_uc010xvw.1_Intron|HNRNPUL1_uc002opz.3_Missense_Mutation_p.R128W|HNRNPUL1_uc002oqa.3_Missense_Mutation_p.R128W|HNRNPUL1_uc010ehm.2_Missense_Mutation_p.R228W|HNRNPUL1_uc002oqc.3_Missense_Mutation_p.R185W|HNRNPUL1_uc002oqe.3_Intron|HNRNPUL1_uc002oqd.3_Missense_Mutation_p.R128W|HNRNPUL1_uc010ehn.2_Missense_Mutation_p.R128W|HNRNPUL1_uc010eho.2_Missense_Mutation_p.R128W|HNRNPUL1_uc010xvy.1_Missense_Mutation_p.R128W|HNRNPUL1_uc010ehp.2_Missense_Mutation_p.R84W|HNRNPUL1_uc010ehl.1_Missense_Mutation_p.R128W	NM_007040	NP_008971	Q9BUJ2	HNRL1_HUMAN	heterogeneous nuclear ribonucleoprotein U-like 1	228	B30.2/SPRY.|Necessary for interaction with TP53.				nuclear mRNA splicing, via spliceosome|regulation of transcription, DNA-dependent|response to virus|transcription, DNA-dependent	heterogeneous nuclear ribonucleoprotein complex|nucleoplasm	enzyme binding|RNA binding			central_nervous_system(1)|skin(1)	2																		---	---	---	---
B3GNT8	374907	broad.mit.edu	37	19	41931674	41931674	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41931674G>A	uc002oqs.2	-	3	1464	c.1010C>T	c.(1009-1011)ACT>ATT	p.T337I	CYP2F1_uc010xvw.1_Intron|B3GNT8_uc002oqt.1_Intron	NM_198540	NP_940942	Q7Z7M8	B3GN8_HUMAN	UDP-GlcNAc:betaGal	337	Lumenal (Potential).				poly-N-acetyllactosamine biosynthetic process|protein glycosylation	Golgi membrane|integral to membrane	galactosyltransferase activity|protein N-acetylglucosaminyltransferase activity				0																		---	---	---	---
ATP1A3	478	broad.mit.edu	37	19	42486241	42486241	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42486241G>A	uc002osg.2	-	9	1165	c.1011C>T	c.(1009-1011)ACC>ACT	p.T337T	ATP1A3_uc010xwf.1_Silent_p.T348T|ATP1A3_uc010xwg.1_Silent_p.T307T|ATP1A3_uc010xwh.1_Silent_p.T350T|ATP1A3_uc002osh.2_Silent_p.T337T	NM_152296	NP_689509	P13637	AT1A3_HUMAN	Na+/K+ -ATPase alpha 3 subunit	337	Cytoplasmic (Potential).				ATP biosynthetic process	endoplasmic reticulum|Golgi apparatus	ATP binding|metal ion binding|sodium:potassium-exchanging ATPase activity			ovary(1)|pancreas(1)	2																		---	---	---	---
CEACAM1	634	broad.mit.edu	37	19	43023168	43023168	+	Missense_Mutation	SNP	G	A	A	rs138618516	by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43023168G>A	uc002otv.2	-	5	1291	c.1178C>T	c.(1177-1179)ACG>ATG	p.T393M	uc010eif.1_Intron|uc002ott.1_Intron|uc010eig.1_Intron|uc010eih.1_Intron|CEACAM1_uc010eii.2_Intron|CEACAM1_uc002otw.2_Missense_Mutation_p.T393M|CEACAM1_uc010eij.2_Missense_Mutation_p.T393M|CEACAM1_uc002otx.2_Intron|CEACAM1_uc002oty.2_Intron|CEACAM1_uc002otz.2_Intron|CEACAM1_uc010eik.2_Intron|CEACAM1_uc002oua.2_Missense_Mutation_p.T393M|CEACAM1_uc002oub.2_Silent_p.D348D	NM_001712	NP_001703	P13688	CEAM1_HUMAN	carcinoembryonic antigen-related cell adhesion	393	Ig-like C2-type 3.|Extracellular (Potential).				angiogenesis|cell migration|homophilic cell adhesion|integrin-mediated signaling pathway	extracellular region|integral to plasma membrane|membrane fraction				ovary(1)|central_nervous_system(1)	2		Prostate(69;0.00682)		GBM - Glioblastoma multiforme(486;0.00148)	Arcitumomab(DB00113)													---	---	---	---
PSG3	5671	broad.mit.edu	37	19	43233450	43233450	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43233450C>T	uc002oue.2	-	5	1200	c.1068G>A	c.(1066-1068)GCG>GCA	p.A356A	PSG3_uc002ouf.2_Intron|PSG1_uc002oug.1_Silent_p.A356A|PSG3_uc010eil.2_Silent_p.A378A	NM_021016	NP_066296	Q16557	PSG3_HUMAN	pregnancy specific beta-1-glycoprotein 3	356	Ig-like C2-type 3.			Missing (in Ref. 9).	defense response|female pregnancy	extracellular region				ovary(1)|skin(1)	2		Prostate(69;0.00682)																---	---	---	---
IRGC	56269	broad.mit.edu	37	19	44223611	44223611	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44223611T>C	uc002oxh.2	+	2	1048	c.901T>C	c.(901-903)TAC>CAC	p.Y301H		NM_019612	NP_062558	Q6NXR0	IIGP5_HUMAN	immunity-related GTPase family, cinema	301						membrane	GTP binding|hydrolase activity, acting on acid anhydrides			ovary(1)|central_nervous_system(1)|skin(1)	3		Prostate(69;0.0435)																---	---	---	---
BCL3	602	broad.mit.edu	37	19	45259478	45259478	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45259478C>A	uc010xxe.1	+							NM_005178	NP_005169			B-cell CLL/lymphoma 3						DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|I-kappaB kinase/NF-kappaB cascade|maintenance of protein location in nucleus|negative regulation of apoptosis|negative regulation of interleukin-8 biosynthetic process|negative regulation of transcription, DNA-dependent|positive regulation of translation|protein import into nucleus, translocation|regulation of DNA binding|regulation of NF-kappaB import into nucleus|response to UV-C|response to virus	Bcl3-Bcl10 complex|Bcl3/NF-kappaB2 complex|nucleus|perinuclear region of cytoplasm	protein binding, bridging|transcription factor binding			ovary(1)|lung(1)	2	Lung NSC(12;0.000698)|all_lung(12;0.002)	Ovarian(192;0.0728)						T	IGH@	CLL 								---	---	---	---
SFRS16	11129	broad.mit.edu	37	19	45556099	45556099	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45556099G>A	uc002pak.2	+	4	346	c.248G>A	c.(247-249)CGT>CAT	p.R83H	SFRS16_uc002pal.2_RNA|SFRS16_uc010xxh.1_Intron|SFRS16_uc002pam.2_Missense_Mutation_p.R83H|SFRS16_uc002pan.1_RNA	NM_007056	NP_008987	Q8N2M8	CLASR_HUMAN	splicing factor, arginine/serine-rich 16	83					mRNA processing|RNA splicing	nucleus					0		Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0102)														---	---	---	---
ERCC2	2068	broad.mit.edu	37	19	45867584	45867584	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45867584C>T	uc002pbj.2	-	9	771	c.724G>A	c.(724-726)GTC>ATC	p.V242I	ERCC2_uc002pbi.2_5'Flank|ERCC2_uc010ejz.2_Missense_Mutation_p.V164I|ERCC2_uc002pbk.2_Missense_Mutation_p.V218I|ERCC2_uc002pbl.3_Missense_Mutation_p.V218I|ERCC2_uc010xxj.1_RNA	NM_000400	NP_000391	P18074	ERCC2_HUMAN	excision repair cross-complementing rodent	242	Helicase ATP-binding.				cell cycle checkpoint|chromosome segregation|hair cell differentiation|induction of apoptosis|interspecies interaction between organisms|mRNA capping|nucleotide-excision repair, DNA damage removal|nucleotide-excision repair, DNA incision|positive regulation of transcription from RNA polymerase II promoter|positive regulation of viral transcription|protein phosphorylation|response to oxidative stress|termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase I promoter|transcription initiation from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair|UV protection|viral reproduction	cytoplasm|holo TFIIH complex|MMXD complex	5'-3' DNA helicase activity|ATP binding|ATP-dependent DNA helicase activity|DNA binding|iron-sulfur cluster binding|metal ion binding|protein C-terminus binding|protein N-terminus binding			lung(2)|pancreas(1)	3		Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0226)				Mis|N|F|S			skin basal cell|skin squamous cell|melanoma		Direct_reversal_of_damage|NER	Xeroderma_Pigmentosum				---	---	---	---
FBXO46	23403	broad.mit.edu	37	19	46215641	46215641	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46215641C>T	uc002pcy.2	-	2	1238	c.1113G>A	c.(1111-1113)ACG>ACA	p.T371T	FBXO46_uc002pcz.2_Silent_p.T371T	NM_001080469	NP_001073938	Q6PJ61	FBX46_HUMAN	F-box protein 46	371							protein binding			ovary(1)|lung(1)|breast(1)	3		Ovarian(192;0.179)|all_neural(266;0.224)		OV - Ovarian serous cystadenocarcinoma(262;0.00568)|GBM - Glioblastoma multiforme(486;0.0844)|Epithelial(262;0.201)														---	---	---	---
FBXO46	23403	broad.mit.edu	37	19	46215859	46215859	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46215859G>T	uc002pcy.2	-	2	1020	c.895C>A	c.(895-897)CGA>AGA	p.R299R	FBXO46_uc002pcz.2_Silent_p.R299R	NM_001080469	NP_001073938	Q6PJ61	FBX46_HUMAN	F-box protein 46	299							protein binding			ovary(1)|lung(1)|breast(1)	3		Ovarian(192;0.179)|all_neural(266;0.224)		OV - Ovarian serous cystadenocarcinoma(262;0.00568)|GBM - Glioblastoma multiforme(486;0.0844)|Epithelial(262;0.201)														---	---	---	---
RSPH6A	81492	broad.mit.edu	37	19	46314009	46314009	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46314009G>A	uc002pdm.2	-	2	883	c.740C>T	c.(739-741)ACG>ATG	p.T247M	RSPH6A_uc002pdl.2_Translation_Start_Site	NM_030785	NP_110412	Q9H0K4	RSH6A_HUMAN	radial spokehead-like 1	247						intracellular				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
PNMAL1	55228	broad.mit.edu	37	19	46973245	46973245	+	Missense_Mutation	SNP	C	T	T	rs144904720	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46973245C>T	uc002peq.3	-	2	1354	c.1048G>A	c.(1048-1050)GTG>ATG	p.V350M	PNMAL1_uc002per.3_Missense_Mutation_p.V350M	NM_018215	NP_060685	Q86V59	PNML1_HUMAN	PNMA-like 1 isoform a	350											0		Ovarian(192;0.00965)|all_neural(266;0.0459)		OV - Ovarian serous cystadenocarcinoma(262;0.000166)|all cancers(93;0.0014)|GBM - Glioblastoma multiforme(486;0.0421)|Epithelial(262;0.0427)														---	---	---	---
PNMAL2	57469	broad.mit.edu	37	19	46998617	46998617	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46998617C>T	uc002pes.2	-	1	553	c.106G>A	c.(106-108)GAA>AAA	p.E36K	uc002peu.1_3'UTR	NM_020709	NP_065760	Q9ULN7	PNML2_HUMAN	PNMA-like 2	36										central_nervous_system(1)	1		Ovarian(192;0.00965)|all_neural(266;0.0459)		OV - Ovarian serous cystadenocarcinoma(262;0.000322)|all cancers(93;0.00233)|GBM - Glioblastoma multiforme(486;0.0421)|Epithelial(262;0.0427)														---	---	---	---
GLTSCR1	29998	broad.mit.edu	37	19	48201924	48201924	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:48201924C>T	uc002phh.3	+	12	3476	c.3282C>T	c.(3280-3282)TCC>TCT	p.S1094S	GLTSCR1_uc002phi.3_Silent_p.S852S	NM_015711	NP_056526	Q9NZM4	GSCR1_HUMAN	glioma tumor suppressor candidate region gene 1	1094							protein binding			pancreas(3)	3		all_cancers(25;1.8e-07)|all_lung(116;5.73e-06)|Lung NSC(112;9.69e-06)|all_epithelial(76;2.42e-05)|all_neural(266;0.0332)|Ovarian(192;0.086)		all cancers(93;0.000358)|OV - Ovarian serous cystadenocarcinoma(262;0.000576)|Epithelial(262;0.0212)|GBM - Glioblastoma multiforme(486;0.0355)												OREG0025594	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PLEKHA4	57664	broad.mit.edu	37	19	49340665	49340665	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49340665G>A	uc002pkx.2	-	20	2772	c.2221C>T	c.(2221-2223)CGT>TGT	p.R741C	HSD17B14_uc002pkv.1_5'Flank|HSD17B14_uc010emk.1_5'Flank|PLEKHA4_uc002pkw.1_3'UTR|PLEKHA4_uc010eml.2_3'UTR	NM_020904	NP_065955	Q9H4M7	PKHA4_HUMAN	pleckstrin homology domain containing family A	741						cytoplasm|membrane	1-phosphatidylinositol binding			ovary(1)|central_nervous_system(1)|skin(1)	3		all_lung(116;4.89e-05)|Lung NSC(112;8.3e-05)|all_epithelial(76;0.000108)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.00027)|all cancers(93;0.00084)|GBM - Glioblastoma multiforme(486;0.0244)|Epithelial(262;0.0364)														---	---	---	---
PLEKHA4	57664	broad.mit.edu	37	19	49341262	49341262	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49341262C>A	uc002pkx.2	-						HSD17B14_uc002pkv.1_5'Flank|HSD17B14_uc010emk.1_5'Flank|PLEKHA4_uc002pkw.1_Intron|PLEKHA4_uc010eml.2_Intron	NM_020904	NP_065955			pleckstrin homology domain containing family A							cytoplasm|membrane	1-phosphatidylinositol binding			ovary(1)|central_nervous_system(1)|skin(1)	3		all_lung(116;4.89e-05)|Lung NSC(112;8.3e-05)|all_epithelial(76;0.000108)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.00027)|all cancers(93;0.00084)|GBM - Glioblastoma multiforme(486;0.0244)|Epithelial(262;0.0364)														---	---	---	---
NUCB1	4924	broad.mit.edu	37	19	49404120	49404120	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49404120G>A	uc002plb.3	+	2	139	c.67G>A	c.(67-69)GCC>ACC	p.A23T	NUCB1_uc002pla.2_Missense_Mutation_p.A23T|NUCB1_uc002plc.2_Missense_Mutation_p.A23T|TULP2_uc002pkz.2_5'Flank	NM_006184	NP_006175	Q02818	NUCB1_HUMAN	nucleobindin 1 precursor	23						ER-Golgi intermediate compartment|extracellular space|Golgi apparatus|membrane|microtubule cytoskeleton	calcium ion binding|DNA binding				0		all_lung(116;4.89e-05)|Lung NSC(112;8.3e-05)|all_epithelial(76;8.64e-05)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.000171)|all cancers(93;0.000333)|Epithelial(262;0.0174)|GBM - Glioblastoma multiforme(486;0.0244)														---	---	---	---
DHDH	27294	broad.mit.edu	37	19	49439393	49439393	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49439393G>A	uc002ple.1	+	3	347	c.307G>A	c.(307-309)GCG>ACG	p.A103T		NM_014475	NP_055290	Q9UQ10	DHDH_HUMAN	dimeric dihydrodiol dehydrogenase	103					carbohydrate metabolic process		binding|D-xylose 1-dehydrogenase (NADP+) activity|electron carrier activity|NAD(P)+ transhydrogenase activity|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity				0		all_epithelial(76;5.29e-07)|all_lung(116;1.7e-06)|Lung NSC(112;3.55e-06)|all_neural(266;0.0189)|Ovarian(192;0.0261)		OV - Ovarian serous cystadenocarcinoma(262;0.000158)|all cancers(93;0.000258)|Epithelial(262;0.0173)|GBM - Glioblastoma multiforme(486;0.0179)														---	---	---	---
NUP62	23636	broad.mit.edu	37	19	50412220	50412220	+	Missense_Mutation	SNP	G	C	C	rs149572563	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50412220G>C	uc002pqx.2	-	2	949	c.845C>G	c.(844-846)ACC>AGC	p.T282S	IL4I1_uc002pqv.1_Intron|IL4I1_uc010eno.1_Intron|IL4I1_uc002pqw.1_Intron|IL4I1_uc002pqu.1_Intron|NUP62_uc002pqy.2_Missense_Mutation_p.T282S|NUP62_uc002pqz.2_Missense_Mutation_p.T282S|NUP62_uc002pra.2_Missense_Mutation_p.T282S|NUP62_uc002prb.2_Missense_Mutation_p.T282S|NUP62_uc002prc.2_Intron	NM_153719	NP_714941	P37198	NUP62_HUMAN	nucleoporin 62kDa	282	15 X 9 AA approximate repeats.|Ala-rich.|Thr-rich.				carbohydrate metabolic process|cell death|cell surface receptor linked signaling pathway|glucose transport|hormone-mediated signaling pathway|mRNA transport|negative regulation of apoptosis|negative regulation of cell proliferation|nucleocytoplasmic transport|positive regulation of epidermal growth factor receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of transcription, DNA-dependent|protein transport|regulation of glucose transport|transcription, DNA-dependent|transmembrane transport|viral reproduction	cytoplasm|nuclear membrane|nuclear pore|nucleocytoplasmic shuttling complex|ribonucleoprotein complex|spindle pole	chromatin binding|protein serine/threonine kinase activity|receptor signaling complex scaffold activity|SH2 domain binding|structural constituent of nuclear pore|thyroid hormone receptor binding|ubiquitin binding				0		all_lung(116;1.47e-05)|all_neural(266;0.0459)|Ovarian(192;0.0481)		GBM - Glioblastoma multiforme(134;0.00242)|OV - Ovarian serous cystadenocarcinoma(262;0.0177)														---	---	---	---
SIGLEC5	8778	broad.mit.edu	37	19	52115550	52115550	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52115550C>T	uc002pxe.2	-	9	1729	c.1590G>A	c.(1588-1590)TCG>TCA	p.S530S		NM_003830	NP_003821	O15389	SIGL5_HUMAN	sialic acid binding Ig-like lectin 5 precursor	530	Cytoplasmic (Potential).				cell adhesion	integral to membrane	sugar binding			skin(2)|breast(1)|central_nervous_system(1)	4		all_neural(266;0.0726)		GBM - Glioblastoma multiforme(134;0.00124)|OV - Ovarian serous cystadenocarcinoma(262;0.0218)														---	---	---	---
ZNF880	400713	broad.mit.edu	37	19	52888041	52888041	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52888041C>T	uc002pzc.2	+	4	1257	c.1208C>T	c.(1207-1209)ACG>ATG	p.T403M		NM_001145434	NP_001138906	Q6PDB4	ZN880_HUMAN	zinc finger protein LOC400713	403					regulation of transcription, DNA-dependent	intracellular	nucleic acid binding|zinc ion binding				0																		---	---	---	---
LILRB2	10288	broad.mit.edu	37	19	54783692	54783692	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54783692G>A	uc002qfb.2	-	4	575	c.309C>T	c.(307-309)CGC>CGT	p.R103R	LILRA6_uc002qew.1_Intron|LILRB2_uc010eri.2_Silent_p.R103R|LILRB2_uc010erj.2_RNA|LILRB2_uc002qfc.2_Silent_p.R103R|LILRB2_uc010yet.1_5'UTR|LILRB2_uc010yeu.1_RNA	NM_005874	NP_005865	Q8N423	LIRB2_HUMAN	leukocyte immunoglobulin-like receptor,	103	Extracellular (Potential).|Ig-like C2-type 1.				cell surface receptor linked signaling pathway|cell-cell signaling|cellular defense response|immune response|regulation of immune response	integral to plasma membrane|membrane fraction	receptor activity			skin(1)	1	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.105)														---	---	---	---
LILRB4	11006	broad.mit.edu	37	19	55177749	55177749	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55177749C>T	uc002qgp.2	+	8	1295	c.933C>T	c.(931-933)GAC>GAT	p.D311D	LILRB4_uc002qgq.2_Silent_p.D311D|LILRB4_uc002qgr.2_Silent_p.D352D|LILRB4_uc010ert.2_Silent_p.D352D|LILRB4_uc010eru.2_Silent_p.D340D	NM_006847	NP_006838	Q8NHJ6	LIRB4_HUMAN	leukocyte immunoglobulin-like receptor,	311	Cytoplasmic (Potential).					integral to membrane|plasma membrane	antigen binding|receptor activity			ovary(3)	3				GBM - Glioblastoma multiforme(193;0.035)														---	---	---	---
KIR2DL1	3802	broad.mit.edu	37	19	55286823	55286823	+	Missense_Mutation	SNP	G	A	A	rs147043371	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55286823G>A	uc002qhb.1	+	4	615	c.577G>A	c.(577-579)GGA>AGA	p.G193R	KIR2DS4_uc010yfj.1_Intron|KIR2DS4_uc010yfk.1_Intron|KIR2DL3_uc010erw.1_Intron|KIR2DL1_uc002qgz.1_Intron|KIR2DL3_uc002qha.1_RNA|KIR3DP1_uc010yfi.1_Intron|KIR2DL1_uc010erz.1_Missense_Mutation_p.G193R	NM_014218	NP_055033	P43626	KI2L1_HUMAN	killer cell immunoglobulin-like receptor, two	193	Extracellular (Potential).|Ig-like C2-type 2.				immune response|natural killer cell inhibitory signaling pathway	integral to plasma membrane	protein binding|receptor activity				0				GBM - Glioblastoma multiforme(193;0.0192)														---	---	---	---
ZNF579	163033	broad.mit.edu	37	19	56090051	56090051	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56090051C>T	uc002qlh.2	-	2	1008	c.955G>A	c.(955-957)GTC>ATC	p.V319I		NM_152600	NP_689813	Q8NAF0	ZN579_HUMAN	zinc finger protein 579	319	C2H2-type 5.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0			BRCA - Breast invasive adenocarcinoma(297;0.18)	GBM - Glioblastoma multiforme(193;0.106)														---	---	---	---
FIZ1	84922	broad.mit.edu	37	19	56104559	56104559	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56104559G>A	uc002qli.3	-	3	838	c.748C>T	c.(748-750)CAC>TAC	p.H250Y	FIZ1_uc002qlj.3_Missense_Mutation_p.H250Y	NM_032836	NP_116225	Q96SL8	FIZ1_HUMAN	FLT3-interacting zinc finger 1	250	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	nucleic acid binding|protein kinase binding|receptor binding|zinc ion binding				0			BRCA - Breast invasive adenocarcinoma(297;0.18)	GBM - Glioblastoma multiforme(193;0.107)														---	---	---	---
NLRP5	126206	broad.mit.edu	37	19	56538862	56538862	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56538862C>A	uc002qmj.2	+	7	1263	c.1263C>A	c.(1261-1263)GTC>GTA	p.V421V	NLRP5_uc002qmi.2_Silent_p.V402V	NM_153447	NP_703148	P59047	NALP5_HUMAN	NACHT, LRR and PYD containing protein 5	421	NACHT.					mitochondrion|nucleolus	ATP binding			ovary(3)|skin(2)|kidney(1)|central_nervous_system(1)	7		Colorectal(82;3.46e-05)|Ovarian(87;0.0481)|Renal(1328;0.157)		GBM - Glioblastoma multiforme(193;0.0326)														---	---	---	---
ZNF71	58491	broad.mit.edu	37	19	57133352	57133352	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57133352G>A	uc002qnm.3	+	3	935	c.697G>A	c.(697-699)GAG>AAG	p.E233K		NM_021216	NP_067039	Q9NQZ8	ZNF71_HUMAN	zinc finger protein 71	233	C2H2-type 4.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(1)	1				GBM - Glioblastoma multiforme(193;0.062)|Lung(386;0.0681)|LUSC - Lung squamous cell carcinoma(496;0.18)														---	---	---	---
USP29	57663	broad.mit.edu	37	19	57642249	57642249	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57642249C>A	uc002qny.2	+	4	2562	c.2206C>A	c.(2206-2208)CAG>AAG	p.Q736K		NM_020903	NP_065954	Q9HBJ7	UBP29_HUMAN	ubiquitin specific peptidase 29	736					protein modification process|ubiquitin-dependent protein catabolic process		cysteine-type peptidase activity|protein binding|ubiquitin thiolesterase activity			lung(6)|ovary(2)|breast(2)|pancreas(1)	11		Colorectal(82;5.46e-05)|all_neural(62;0.0218)|Ovarian(87;0.0822)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---
ZNF543	125919	broad.mit.edu	37	19	57839291	57839291	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57839291G>A	uc002qoi.1	+	4	806	c.461G>A	c.(460-462)CGT>CAT	p.R154H		NM_213598	NP_998763	Q08ER8	ZN543_HUMAN	zinc finger protein 543	154					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)|pancreas(1)	2		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.221)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0257)														---	---	---	---
ZNF211	10520	broad.mit.edu	37	19	58153212	58153212	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58153212A>G	uc002qpq.2	+	3	1538	c.1358A>G	c.(1357-1359)TAT>TGT	p.Y453C	ZNF211_uc010yhb.1_Missense_Mutation_p.Y457C|ZNF211_uc002qpp.2_Missense_Mutation_p.Y466C|ZNF211_uc002qpr.2_Missense_Mutation_p.Y517C|ZNF211_uc002qps.2_Missense_Mutation_p.Y518C|ZNF211_uc002qpt.2_Missense_Mutation_p.Y465C|ZNF211_uc010yhc.1_Missense_Mutation_p.Y465C|ZNF211_uc010yhd.1_Missense_Mutation_p.Y392C|ZNF211_uc010yhe.1_Missense_Mutation_p.Y444C	NM_198855	NP_942152	Q13398	ZN211_HUMAN	zinc finger protein 211 isoform 2	453	C2H2-type 9.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2		Colorectal(82;5.46e-05)|all_neural(62;0.0218)|Breast(46;0.0389)|Ovarian(87;0.0443)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---
ZSCAN4	201516	broad.mit.edu	37	19	58189782	58189782	+	Nonsense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58189782G>T	uc002qpu.2	+	5	1508	c.811G>T	c.(811-813)GGA>TGA	p.G271*		NM_152677	NP_689890	Q8NAM6	ZSCA4_HUMAN	zinc finger and SCAN domain containing 4	271					telomere maintenance via telomere lengthening|viral reproduction	nuclear chromosome, telomeric region	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---
C19orf18	147685	broad.mit.edu	37	19	58483842	58483842	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58483842A>G	uc002qqv.2	-	3	361	c.257T>C	c.(256-258)CTG>CCG	p.L86P		NM_152474	NP_689687	Q8NEA5	CS018_HUMAN	hypothetical protein LOC147685 precursor	86	Extracellular (Potential).					integral to membrane				ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.017)														---	---	---	---
SLC27A5	10998	broad.mit.edu	37	19	59011987	59011987	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:59011987G>A	uc002qtc.2	-	5	1379	c.1269C>T	c.(1267-1269)TTC>TTT	p.F423F	SLC27A5_uc002qtb.2_5'Flank	NM_012254	NP_036386	Q9Y2P5	S27A5_HUMAN	solute carrier family 27 (fatty acid	423	Cytoplasmic (Probable).				bile acid and bile salt transport|bile acid biosynthetic process|very long-chain fatty acid metabolic process	endoplasmic reticulum membrane|integral to membrane	ATP binding|cholate-CoA ligase activity|long-chain fatty acid-CoA ligase activity				0		all_cancers(17;4.4e-22)|all_epithelial(17;2.15e-16)|Lung NSC(17;1.24e-06)|all_lung(17;5.41e-06)|Colorectal(82;3.46e-05)|Renal(17;0.00179)|all_neural(62;0.00607)|Ovarian(87;0.0443)|Breast(46;0.0928)|Medulloblastoma(540;0.184)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0168)|Lung(386;0.181)														---	---	---	---
SLC27A5	10998	broad.mit.edu	37	19	59022708	59022708	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:59022708G>T	uc002qtc.2	-	1	725	c.615C>A	c.(613-615)AAC>AAA	p.N205K		NM_012254	NP_036386	Q9Y2P5	S27A5_HUMAN	solute carrier family 27 (fatty acid	205	Cytoplasmic (Probable).				bile acid and bile salt transport|bile acid biosynthetic process|very long-chain fatty acid metabolic process	endoplasmic reticulum membrane|integral to membrane	ATP binding|cholate-CoA ligase activity|long-chain fatty acid-CoA ligase activity				0		all_cancers(17;4.4e-22)|all_epithelial(17;2.15e-16)|Lung NSC(17;1.24e-06)|all_lung(17;5.41e-06)|Colorectal(82;3.46e-05)|Renal(17;0.00179)|all_neural(62;0.00607)|Ovarian(87;0.0443)|Breast(46;0.0928)|Medulloblastoma(540;0.184)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0168)|Lung(386;0.181)														---	---	---	---
RSPO4	343637	broad.mit.edu	37	20	947858	947858	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:947858G>A	uc002wej.2	-	3	465	c.368C>T	c.(367-369)CCG>CTG	p.P123L	RSPO4_uc002wek.2_Missense_Mutation_p.P123L	NM_001029871	NP_001025042	Q2I0M5	RSPO4_HUMAN	R-spondin family, member 4 isoform 1 precursor	123	FU.				Wnt receptor signaling pathway	extracellular region	heparin binding				0																		---	---	---	---
SDCBP2	27111	broad.mit.edu	37	20	1294021	1294021	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:1294021C>T	uc002wev.3	-	5	476	c.347G>A	c.(346-348)CGC>CAC	p.R116H	SDCBP2_uc002weu.3_Missense_Mutation_p.R31H|SDCBP2_uc010zpq.1_Missense_Mutation_p.R116H	NM_080489	NP_536737	Q9H190	SDCB2_HUMAN	syndecan binding protein 2 isoform a	116	PDZ 1.				intracellular signal transduction|intracellular transport|nervous system development	cytoplasm	protein C-terminus binding|protein heterodimerization activity|protein homodimerization activity			large_intestine(1)|skin(1)	2																		---	---	---	---
TMX4	56255	broad.mit.edu	37	20	7980484	7980484	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:7980484C>T	uc002wmx.1	-	4	495	c.362G>A	c.(361-363)CGT>CAT	p.R121H		NM_021156	NP_066979	Q9H1E5	TMX4_HUMAN	thioredoxin-related transmembrane protein 4	121	Thioredoxin.				cell redox homeostasis|electron transport chain|transport	integral to membrane					0																		---	---	---	---
PLCB1	23236	broad.mit.edu	37	20	8608995	8608995	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:8608995C>T	uc002wnb.2	+	4	304	c.301C>T	c.(301-303)CGC>TGC	p.R101C	PLCB1_uc010zrb.1_5'UTR|PLCB1_uc010gbv.1_Missense_Mutation_p.R101C|PLCB1_uc002wmz.1_Missense_Mutation_p.R101C|PLCB1_uc002wna.2_Missense_Mutation_p.R101C|PLCB1_uc002wnc.1_5'UTR	NM_015192	NP_056007	Q9NQ66	PLCB1_HUMAN	phosphoinositide-specific phospholipase C beta 1	101					activation of meiosis involved in egg activation|CD24 biosynthetic process|cerebral cortex development|G1 phase|G2/M transition of mitotic cell cycle|glutamate signaling pathway|insulin-like growth factor receptor signaling pathway|interleukin-1-mediated signaling pathway|interleukin-12-mediated signaling pathway|interleukin-15-mediated signaling pathway|intracellular signal transduction|lipid catabolic process|memory|muscarinic acetylcholine receptor signaling pathway|negative regulation of monocyte extravasation|negative regulation of transcription, DNA-dependent|phosphatidylinositol metabolic process|positive regulation of acrosome reaction|positive regulation of developmental growth|positive regulation of embryonic development|positive regulation of interleukin-12 production|positive regulation of JNK cascade|positive regulation of myoblast differentiation|positive regulation of transcription, DNA-dependent|regulation of fertilization|regulation of G-protein coupled receptor protein signaling pathway|synaptic transmission	cytosol|nuclear chromatin|nuclear speck	calcium ion binding|calmodulin binding|enzyme binding|GTPase activator activity|phosphatidylinositol phospholipase C activity|phosphatidylinositol-4,5-bisphosphate binding|protein homodimerization activity|signal transducer activity			ovary(4)|breast(3)|upper_aerodigestive_tract(2)|skin(2)|lung(1)	12																		---	---	---	---
RRBP1	6238	broad.mit.edu	37	20	17610604	17610604	+	Missense_Mutation	SNP	C	T	T	rs138539631	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:17610604C>T	uc010gcm.1	-	4	429	c.71G>A	c.(70-72)CGT>CAT	p.R24H	RRBP1_uc002wpu.2_Silent_p.A212A|RRBP1_uc002wpv.1_Silent_p.A438A|RRBP1_uc002wpw.1_Silent_p.A438A|RRBP1_uc010gcl.1_Silent_p.A212A			Q9P2E9	RRBP1_HUMAN	Homo sapiens mRNA for KIAA1398 protein, partial cds.	Error:Variant_position_missing_in_Q9P2E9_after_alignment					protein transport|translation|transmembrane transport	integral to endoplasmic reticulum membrane|ribosome	receptor activity			ovary(1)	1																		---	---	---	---
SEC23B	10483	broad.mit.edu	37	20	18511337	18511337	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:18511337A>T	uc002wqz.1	+	10	1566	c.1123A>T	c.(1123-1125)ATG>TTG	p.M375L	SEC23B_uc002wra.1_Missense_Mutation_p.M375L|SEC23B_uc002wrb.1_Missense_Mutation_p.M375L|SEC23B_uc010zsb.1_Missense_Mutation_p.M357L|SEC23B_uc002wrc.1_Missense_Mutation_p.M375L	NM_006363	NP_006354	Q15437	SC23B_HUMAN	Sec23 homolog B	375					ER to Golgi vesicle-mediated transport|intracellular protein transport	COPII vesicle coat|endoplasmic reticulum membrane|ER-Golgi intermediate compartment membrane|Golgi membrane	zinc ion binding			ovary(1)	1																		---	---	---	---
PAX1	5075	broad.mit.edu	37	20	21687581	21687581	+	Silent	SNP	C	T	T	rs140128849		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:21687581C>T	uc002wsj.2	+	2	846	c.792C>T	c.(790-792)GGC>GGT	p.G264G	PAX1_uc010zsl.1_Silent_p.G264G|PAX1_uc010zsm.1_Silent_p.G240G	NM_006192	NP_006183	P15863	PAX1_HUMAN	paired box 1	264					regulation of transcription, DNA-dependent|skeletal system development|transcription from RNA polymerase II promoter	nucleus	DNA binding			upper_aerodigestive_tract(1)|kidney(1)	2																		---	---	---	---
HM13	81502	broad.mit.edu	37	20	30155873	30155873	+	Intron	SNP	T	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:30155873T>A	uc002wwe.2	+						HM13_uc002wwc.2_Intron|HM13_uc002wwd.2_Intron|HM13_uc002wwf.2_Intron|HM13_uc010gdu.2_Intron	NM_030789	NP_110416			minor histocompatibility antigen 13 isoform 1						membrane protein proteolysis	cell surface|endoplasmic reticulum membrane|integral to membrane|plasma membrane	aspartic-type endopeptidase activity|protein binding			breast(1)	1	all_cancers(5;3.44e-05)|Lung NSC(7;4.38e-06)|all_lung(7;7.65e-06)|all_hematologic(12;0.158)|Ovarian(7;0.198)		all cancers(5;0.000479)|Colorectal(19;0.00202)|COAD - Colon adenocarcinoma(19;0.0264)															---	---	---	---
TPX2	22974	broad.mit.edu	37	20	30381814	30381814	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:30381814T>C	uc002wwp.1	+	14	2371	c.1673T>C	c.(1672-1674)CTG>CCG	p.L558P	TPX2_uc010gdv.1_Missense_Mutation_p.L594P	NM_012112	NP_036244	Q9ULW0	TPX2_HUMAN	TPX2, microtubule-associated protein homolog	558					activation of protein kinase activity|apoptosis|cell division|cell proliferation|mitosis|regulation of mitotic spindle organization	cytoplasm|microtubule|nucleus|spindle pole	ATP binding|GTP binding|protein kinase binding			large_intestine(1)|ovary(1)	2			Epithelial(4;0.000771)|Colorectal(19;0.00306)|all cancers(5;0.004)|COAD - Colon adenocarcinoma(19;0.0347)|OV - Ovarian serous cystadenocarcinoma(3;0.0656)															---	---	---	---
MAP1LC3A	84557	broad.mit.edu	37	20	33147545	33147545	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33147545G>A	uc002xaq.1	+	4	363	c.209G>A	c.(208-210)CGC>CAC	p.R70H	MAP1LC3A_uc002xap.1_Missense_Mutation_p.R74H	NM_032514	NP_115903	Q9H492	MLP3A_HUMAN	microtubule-associated protein 1 light chain 3	70					autophagic vacuole assembly	autophagic vacuole membrane|cytoplasmic vesicle|cytosol|endomembrane system|microtubule	phosphatidylethanolamine binding|protein binding				0																		---	---	---	---
NCOA6	23054	broad.mit.edu	37	20	33345744	33345744	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33345744C>T	uc002xav.2	-	8	3378	c.807G>A	c.(805-807)CAG>CAA	p.Q269Q	NCOA6_uc002xaw.2_Silent_p.Q269Q|NCOA6_uc010gew.1_Silent_p.Q226Q	NM_014071	NP_054790	Q14686	NCOA6_HUMAN	nuclear receptor coactivator 6	269	TBP/GTF2A-binding region.|NCOA1-binding region.|Gln-rich.|CREBBP-binding region.				brain development|cellular lipid metabolic process|DNA recombination|DNA repair|DNA replication|estrogen receptor signaling pathway|glucocorticoid receptor signaling pathway|heart development|myeloid cell differentiation|positive regulation of transcription from RNA polymerase II promoter|response to hormone stimulus|transcription initiation from RNA polymerase II promoter	transcription factor complex	chromatin binding|enzyme binding|estrogen receptor binding|ligand-dependent nuclear receptor transcription coactivator activity|retinoid X receptor binding|thyroid hormone receptor binding			ovary(3)|breast(3)|central_nervous_system(1)	7																		---	---	---	---
MMP24	10893	broad.mit.edu	37	20	33862135	33862135	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33862135T>C	uc002xbu.2	+	9	1664	c.1661T>C	c.(1660-1662)GTG>GCG	p.V554A	EDEM2_uc010zuv.1_Intron	NM_006690	NP_006681	Q9Y5R2	MMP24_HUMAN	matrix metalloproteinase 24 preproprotein	554	Extracellular (Potential).|Hemopexin-like 4.				proteolysis	integral to plasma membrane|proteinaceous extracellular matrix	calcium ion binding|enzyme activator activity|metalloendopeptidase activity|zinc ion binding				0			BRCA - Breast invasive adenocarcinoma(18;0.00252)															---	---	---	---
GDF5	8200	broad.mit.edu	37	20	34022366	34022366	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34022366C>T	uc002xck.1	-	2	1166	c.847G>A	c.(847-849)GTG>ATG	p.V283M	GDF5_uc010gfc.1_Missense_Mutation_p.V283M|uc002xcj.2_Silent_p.H259H|GDF5_uc010zvc.1_Missense_Mutation_p.V283M	NM_000557	NP_000548	P43026	GDF5_HUMAN	growth differentiation factor 5 preproprotein	283					cartilage development|cell-cell signaling|growth|transforming growth factor beta receptor signaling pathway	extracellular space	cytokine activity|growth factor activity				0	Lung NSC(9;0.00642)|all_lung(11;0.0094)		BRCA - Breast invasive adenocarcinoma(18;0.00663)															---	---	---	---
C20orf152	140894	broad.mit.edu	37	20	34618312	34618312	+	3'UTR	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34618312G>T	uc002xes.1	+	11					C20orf152_uc002xer.1_Missense_Mutation_p.Q487H|C20orf152_uc010gfp.1_RNA					SubName: Full=C20orf152 protein;												0	Breast(12;0.00631)																	---	---	---	---
C20orf118	140711	broad.mit.edu	37	20	35507503	35507503	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35507503G>A	uc002xgg.1	+	3	257	c.249G>A	c.(247-249)ACG>ACA	p.T83T		NM_080628	NP_542195	A0PJX2	CT118_HUMAN	hypothetical protein LOC140711	83	TLD.										0		Myeloproliferative disorder(115;0.00874)																---	---	---	---
EMILIN3	90187	broad.mit.edu	37	20	39990546	39990546	+	Missense_Mutation	SNP	C	T	T	rs139544093		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:39990546C>T	uc002xjy.1	-	4	1887	c.1663G>A	c.(1663-1665)GCA>ACA	p.A555T		NM_052846	NP_443078	Q9NT22	EMIL3_HUMAN	elastin microfibril interfacer 3	555						proteinaceous extracellular matrix				ovary(1)	1		Myeloproliferative disorder(115;0.00425)																---	---	---	---
PTPRT	11122	broad.mit.edu	37	20	41101154	41101154	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:41101154C>T	uc002xkg.2	-	8	1386	c.1202G>A	c.(1201-1203)CGG>CAG	p.R401Q	PTPRT_uc010ggj.2_Missense_Mutation_p.R401Q	NM_007050	NP_008981	O14522	PTPRT_HUMAN	protein tyrosine phosphatase, receptor type, T	401	Extracellular (Potential).|Fibronectin type-III 2.				homophilic cell adhesion|transmembrane receptor protein tyrosine kinase signaling pathway	cell surface|integral to membrane|plasma membrane	alpha-catenin binding|beta-catenin binding|cadherin binding|delta-catenin binding|gamma-catenin binding|protein tyrosine phosphatase activity|receptor activity			skin(8)|ovary(7)|lung(5)	20		Myeloproliferative disorder(115;0.00452)|Lung NSC(126;0.0573)|all_lung(126;0.0783)																---	---	---	---
SFRS6	6431	broad.mit.edu	37	20	42088725	42088725	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:42088725G>A	uc010zwg.1	+	4	604	c.434G>A	c.(433-435)CGA>CAA	p.R145Q	SFRS6_uc002xki.2_Missense_Mutation_p.R16Q|SFRS6_uc002xkk.2_Missense_Mutation_p.R145Q	NM_006275	NP_006266	Q13247	SRSF6_HUMAN	arginine/serine-rich splicing factor 6	145	RRM 2.		R -> Q (in a colorectal cancer sample; somatic mutation).		mRNA 3'-end processing|mRNA export from nucleus|mRNA splice site selection|termination of RNA polymerase II transcription	nucleoplasm	nucleotide binding|protein binding|RNA binding	p.R145Q(1)			0		Myeloproliferative disorder(115;0.00452)	COAD - Colon adenocarcinoma(18;0.0031)															---	---	---	---
HNF4A	3172	broad.mit.edu	37	20	43058237	43058237	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43058237G>A	uc002xma.2	+	10	1446	c.1357G>A	c.(1357-1359)GTC>ATC	p.V453I	HNF4A_uc002xlu.2_Missense_Mutation_p.V421I|HNF4A_uc002xlv.2_Missense_Mutation_p.V431I|HNF4A_uc002xlz.2_Missense_Mutation_p.V443I|HNF4A_uc010ggq.2_Missense_Mutation_p.V446I	NM_000457	NP_000448	P41235	HNF4A_HUMAN	hepatocyte nuclear factor 4 alpha isoform b	453			V -> I.		blood coagulation|endocrine pancreas development|glucose homeostasis|negative regulation of cell growth|negative regulation of cell proliferation|ornithine metabolic process|phospholipid homeostasis|positive regulation of cholesterol homeostasis|regulation of growth hormone receptor signaling pathway|regulation of insulin secretion|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|response to glucose stimulus|triglyceride homeostasis|xenobiotic metabolic process	cytoplasm	activating transcription factor binding|protein homodimerization activity|receptor binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|steroid hormone receptor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(1)|lung(1)|skin(1)	3		Myeloproliferative disorder(115;0.0122)	COAD - Colon adenocarcinoma(18;0.00189)															---	---	---	---
PIGT	51604	broad.mit.edu	37	20	44049163	44049163	+	Intron	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44049163C>A	uc002xoh.1	+						PIGT_uc010ghb.1_Intron|PIGT_uc010zwt.1_Intron|PIGT_uc010ghd.1_Intron|PIGT_uc010ghc.1_Intron|PIGT_uc010ghe.1_Intron|PIGT_uc010ghf.1_Intron|PIGT_uc002xoj.1_Intron|PIGT_uc002xok.1_Intron|PIGT_uc010zwu.1_Intron|PIGT_uc002xoi.1_RNA|PIGT_uc010zwv.1_Intron|PIGT_uc010zww.1_Intron|PIGT_uc010zwx.1_Intron|PIGT_uc010zwy.1_Intron|PIGT_uc010zwz.1_Intron|PIGT_uc010zxa.1_Intron|PIGT_uc002xol.1_Intron|PIGT_uc010zxb.1_5'UTR|PIGT_uc002xom.1_5'Flank	NM_015937	NP_057021			phosphatidylinositol glycan anchor biosynthesis,						attachment of GPI anchor to protein|C-terminal protein lipidation	GPI-anchor transamidase complex	protein binding			pancreas(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---
ZMYND8	23613	broad.mit.edu	37	20	45867695	45867695	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:45867695C>T	uc002xta.1	-	15	2666	c.2412G>A	c.(2410-2412)CCG>CCA	p.P804P	ZMYND8_uc010ghq.1_Silent_p.P481P|ZMYND8_uc010ghr.1_Silent_p.P779P|ZMYND8_uc002xst.1_Silent_p.P732P|ZMYND8_uc002xsu.1_Intron|ZMYND8_uc002xsv.1_Silent_p.P732P|ZMYND8_uc002xsw.1_Silent_p.P556P|ZMYND8_uc002xsx.1_Silent_p.P556P|ZMYND8_uc002xsy.1_Silent_p.P779P|ZMYND8_uc002xsz.1_Silent_p.P741P|ZMYND8_uc010zxy.1_Silent_p.P831P|ZMYND8_uc002xtb.1_Silent_p.P824P|ZMYND8_uc002xss.2_Silent_p.P804P|ZMYND8_uc010zxz.1_Intron|ZMYND8_uc002xtc.1_Silent_p.P824P|ZMYND8_uc002xtd.1_Silent_p.P799P|ZMYND8_uc002xte.1_Silent_p.P804P|ZMYND8_uc010zya.1_Silent_p.P804P|ZMYND8_uc002xtf.1_Silent_p.P824P|ZMYND8_uc002xtg.2_Silent_p.P798P|ZMYND8_uc010ghs.1_Silent_p.P798P|ZMYND8_uc002xsr.1_5'UTR	NM_012408	NP_036540	Q9ULU4	PKCB1_HUMAN	zinc finger, MYND-type containing 8 isoform b	804							protein binding|zinc ion binding			central_nervous_system(2)|urinary_tract(1)|ovary(1)|skin(1)	5			Epithelial(1;0.0289)|all cancers(1;0.0962)|OV - Ovarian serous cystadenocarcinoma(1;0.154)															---	---	---	---
PREX1	57580	broad.mit.edu	37	20	47270000	47270000	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47270000G>A	uc002xtw.1	-	20	2268	c.2245C>T	c.(2245-2247)CAG>TAG	p.Q749*	PREX1_uc002xtv.1_Nonsense_Mutation_p.Q46*	NM_020820	NP_065871	Q8TCU6	PREX1_HUMAN	phosphatidylinositol-3,4,	749					actin filament polymerization|apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|neutrophil activation|small GTPase mediated signal transduction|superoxide metabolic process	cytosol|plasma membrane	enzyme binding|phospholipid binding|Rho GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			lung(3)|ovary(2)|pancreas(1)	6			BRCA - Breast invasive adenocarcinoma(12;0.0135)|Colorectal(8;0.198)															---	---	---	---
STAU1	6780	broad.mit.edu	37	20	47739654	47739654	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47739654G>A	uc002xud.2	-	8	1352	c.941C>T	c.(940-942)CCG>CTG	p.P314L	STAU1_uc002xua.2_Missense_Mutation_p.P233L|STAU1_uc002xub.2_Missense_Mutation_p.P239L|STAU1_uc002xuc.2_Missense_Mutation_p.P233L|STAU1_uc002xue.2_Missense_Mutation_p.P233L|STAU1_uc002xuf.2_Missense_Mutation_p.P239L|STAU1_uc002xug.2_Missense_Mutation_p.P314L	NM_017453	NP_059347	O95793	STAU1_HUMAN	staufen isoform b	314	DRBM 3.					microtubule associated complex|rough endoplasmic reticulum|stress granule	double-stranded RNA binding			ovary(4)|kidney(1)	5			BRCA - Breast invasive adenocarcinoma(12;0.000644)|Colorectal(8;0.198)															---	---	---	---
KCNB1	3745	broad.mit.edu	37	20	47990503	47990503	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47990503T>C	uc002xur.1	-	2	1758	c.1594A>G	c.(1594-1596)ATG>GTG	p.M532V	KCNB1_uc002xus.1_Missense_Mutation_p.M532V	NM_004975	NP_004966	Q14721	KCNB1_HUMAN	potassium voltage-gated channel, Shab-related	532	Cytoplasmic (Potential).				energy reserve metabolic process|regulation of insulin secretion	voltage-gated potassium channel complex	protein binding|voltage-gated potassium channel activity			pancreas(1)|skin(1)	2			BRCA - Breast invasive adenocarcinoma(12;0.000405)|COAD - Colon adenocarcinoma(4;0.14)|Colorectal(8;0.166)															---	---	---	---
ATP9A	10079	broad.mit.edu	37	20	50244187	50244187	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:50244187G>A	uc002xwg.1	-	17	1797	c.1797C>T	c.(1795-1797)CTC>CTT	p.L599L	ATP9A_uc010gih.1_Silent_p.L463L|ATP9A_uc002xwf.1_Intron	NM_006045	NP_006036	O75110	ATP9A_HUMAN	ATPase, class II, type 9A	599	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(4)	4																		---	---	---	---
DOK5	55816	broad.mit.edu	37	20	53226972	53226972	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:53226972C>T	uc002xwy.2	+	6	865	c.645C>T	c.(643-645)GAC>GAT	p.D215D	DOK5_uc010gin.2_Silent_p.D107D|DOK5_uc002xwz.2_Silent_p.D77D	NM_018431	NP_060901	Q9P104	DOK5_HUMAN	docking protein 5	215	IRS-type PTB.						insulin receptor binding			ovary(1)	1			Colorectal(105;0.202)															---	---	---	---
CASS4	57091	broad.mit.edu	37	20	55012542	55012542	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:55012542C>T	uc002xxp.2	+	3	584	c.359C>T	c.(358-360)GCG>GTG	p.A120V	CASS4_uc002xxq.3_Missense_Mutation_p.A120V|CASS4_uc002xxr.2_Missense_Mutation_p.A120V|CASS4_uc010zze.1_Intron|CASS4_uc010gio.2_Missense_Mutation_p.A120V	NM_001164116	NP_001157588	Q9NQ75	CASS4_HUMAN	HEF-like protein isoform a	120					cell adhesion	cytoplasm|cytoskeleton|focal adhesion	two-component sensor activity			ovary(2)|skin(1)	3																		---	---	---	---
CTCFL	140690	broad.mit.edu	37	20	56094287	56094287	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:56094287G>A	uc010gix.1	-	3	1563	c.901C>T	c.(901-903)CGG>TGG	p.R301W	CTCFL_uc010giw.1_Missense_Mutation_p.R301W|CTCFL_uc002xym.2_Missense_Mutation_p.R301W|CTCFL_uc010giz.1_5'UTR|CTCFL_uc010giy.1_5'UTR|CTCFL_uc010gja.1_Missense_Mutation_p.R301W|CTCFL_uc010gjb.1_Missense_Mutation_p.R301W|CTCFL_uc010gjc.1_Missense_Mutation_p.R301W|CTCFL_uc010gjd.1_Missense_Mutation_p.R301W|CTCFL_uc010gje.2_Missense_Mutation_p.R301W|CTCFL_uc010gjf.2_Missense_Mutation_p.R96W|CTCFL_uc010gjg.2_Missense_Mutation_p.R33W|CTCFL_uc010gjh.1_Missense_Mutation_p.R301W|CTCFL_uc010gji.1_Missense_Mutation_p.R96W|CTCFL_uc010gjj.1_Missense_Mutation_p.R301W|CTCFL_uc010gjk.1_Missense_Mutation_p.R301W|CTCFL_uc010gjl.1_Missense_Mutation_p.R301W	NM_080618	NP_542185	Q8NI51	CTCFL_HUMAN	CCCTC-binding factor-like protein	301	C2H2-type 2.				cell cycle|DNA methylation involved in gamete generation|histone methylation|positive regulation of transcription, DNA-dependent|regulation of gene expression by genetic imprinting|regulation of histone H3-K4 methylation|transcription, DNA-dependent	cytoplasm|nucleus	histone binding|sequence-specific DNA binding|transcription regulatory region DNA binding|zinc ion binding			ovary(2)|large_intestine(1)|skin(1)	4	Lung NSC(12;0.00132)|all_lung(29;0.00433)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(13;3.95e-12)|Epithelial(14;3.41e-08)|all cancers(14;2.09e-07)															---	---	---	---
LSM14B	149986	broad.mit.edu	37	20	60701385	60701385	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:60701385C>T	uc010gjy.1	+	3	523	c.317C>T	c.(316-318)TCG>TTG	p.S106L	LSM14B_uc002ybt.2_Missense_Mutation_p.S106L|LSM14B_uc010gjx.1_Missense_Mutation_p.S132L|LSM14B_uc002ybv.2_Missense_Mutation_p.S106L|LSM14B_uc010gjz.1_5'UTR|LSM14B_uc010zzz.1_5'UTR	NM_144703	NP_653304	Q9BX40	LS14B_HUMAN	LSM14 homolog B	106					multicellular organismal development|regulation of translation	ribonucleoprotein complex					0	Breast(26;3.97e-09)		BRCA - Breast invasive adenocarcinoma(19;1.28e-07)															---	---	---	---
LAMA5	3911	broad.mit.edu	37	20	60908501	60908501	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:60908501C>T	uc002ycq.2	-	25	3125	c.3058G>A	c.(3058-3060)GCG>ACG	p.A1020T		NM_005560	NP_005551	O15230	LAMA5_HUMAN	laminin alpha 5 precursor	1020	Domain IV 1 (domain IV B).				angiogenesis|cell proliferation|cell recognition|cytoskeleton organization|endothelial cell differentiation|focal adhesion assembly|integrin-mediated signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development|substrate adhesion-dependent cell spreading	extracellular space|laminin-1 complex|laminin-10 complex|laminin-11 complex	integrin binding			ovary(1)|pancreas(1)|skin(1)	3	Breast(26;1.57e-08)		BRCA - Breast invasive adenocarcinoma(19;4.36e-06)		Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---
RTEL1	51750	broad.mit.edu	37	20	62321132	62321132	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62321132G>A	uc002yfu.1	+	24	2398	c.2055G>A	c.(2053-2055)CAG>CAA	p.Q685Q	RTEL1_uc011abc.1_RNA|RTEL1_uc002yft.1_Silent_p.Q685Q|RTEL1_uc011abd.1_Silent_p.Q709Q|RTEL1_uc011abe.1_Silent_p.Q462Q|RTEL1_uc002yfw.2_RNA|RTEL1_uc002yfx.1_5'UTR	NM_016434	NP_057518	Q9NZ71	RTEL1_HUMAN	regulator of telomere elongation helicase 1	685					DNA repair|regulation of double-strand break repair via homologous recombination|telomere maintenance	nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|iron-sulfur cluster binding|metal ion binding				0	all_cancers(38;6.47e-12)|all_epithelial(29;3.75e-13)		Epithelial(9;1.25e-09)|all cancers(9;5.13e-09)|BRCA - Breast invasive adenocarcinoma(10;7.26e-05)|OV - Ovarian serous cystadenocarcinoma(5;0.00223)|Colorectal(105;0.107)															---	---	---	---
TPD52L2	7165	broad.mit.edu	37	20	62520579	62520579	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62520579T>C	uc002yhc.2	+	6	642	c.513T>C	c.(511-513)GTT>GTC	p.V171V	TPD52L2_uc002ygy.2_Silent_p.V194V|TPD52L2_uc002ygz.2_Silent_p.V185V|TPD52L2_uc002yha.2_Silent_p.V174V|TPD52L2_uc002yhb.2_Silent_p.V165V|TPD52L2_uc002yhd.2_Silent_p.V151V|TPD52L2_uc011abk.1_Silent_p.V122V|TPD52L2_uc011abl.1_Silent_p.V128V|TPD52L2_uc002yhe.2_Silent_p.V70V	NM_003288	NP_003279	O43399	TPD54_HUMAN	tumor protein D52-like 2 isoform e	171					regulation of cell proliferation	perinuclear region of cytoplasm	protein binding|protein homodimerization activity			ovary(1)|skin(1)	2	all_cancers(38;1.3e-12)|all_epithelial(29;2.23e-14)|Lung NSC(23;5.92e-10)|all_lung(23;2.08e-09)																	---	---	---	---
NPBWR2	2832	broad.mit.edu	37	20	62737475	62737475	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62737475C>T	uc011abt.1	-	1	710	c.710G>A	c.(709-711)CGC>CAC	p.R237H		NM_005286	NP_005277	P48146	NPBW2_HUMAN	neuropeptides B/W receptor 2	237	Cytoplasmic (Potential).					plasma membrane	opioid receptor activity|protein binding			large_intestine(1)	1	all_cancers(38;2.58e-11)|all_epithelial(29;6.4e-13)|Lung NSC(23;1.25e-09)|all_lung(23;4.21e-09)																	---	---	---	---
MYT1	4661	broad.mit.edu	37	20	62836917	62836917	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62836917G>A	uc002yii.2	+	6	525	c.161G>A	c.(160-162)TGC>TAC	p.C54Y	MYT1_uc002yih.2_Missense_Mutation_p.C54Y|MYT1_uc002yij.2_5'Flank	NM_004535	NP_004526	Q01538	MYT1_HUMAN	myelin transcription factor 1	54	C2HC-type 1.				cell differentiation|nervous system development	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2	all_cancers(38;1.82e-11)|all_epithelial(29;3.3e-13)|Lung NSC(23;5.21e-10)|all_lung(23;1.92e-09)																	---	---	---	---
BACH1	571	broad.mit.edu	37	21	30698948	30698948	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:30698948C>T	uc002ynj.2	+	3	918	c.803C>T	c.(802-804)CCG>CTG	p.P268L	BACH1_uc002ynk.2_Missense_Mutation_p.P268L|BACH1_uc002ynl.2_RNA	NM_001186	NP_001177	O14867	BACH1_HUMAN	BTB and CNC homology 1 transcription factor	268						nucleus	protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|liver(1)	2																		---	---	---	---
HUNK	30811	broad.mit.edu	37	21	33246192	33246192	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:33246192G>T	uc002yph.2	+	1	565	c.205G>T	c.(205-207)GGC>TGC	p.G69C		NM_014586	NP_055401	P57058	HUNK_HUMAN	hormonally upregulated Neu-associated kinase	69	ATP (By similarity).|Protein kinase.				multicellular organismal development|signal transduction		ATP binding|protein serine/threonine kinase activity			stomach(1)|skin(1)	2																		---	---	---	---
PCP4	5121	broad.mit.edu	37	21	41270416	41270416	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:41270416G>A	uc002yyp.2	+	2	106	c.25G>A	c.(25-27)GCA>ACA	p.A9T		NM_006198	NP_006189	P48539	PCP4_HUMAN	Purkinje cell protein 4	9				A -> P (in Ref. 1; CAA63724).	central nervous system development	cytosol|nucleus				large_intestine(1)	1		Prostate(19;2.65e-06)|all_epithelial(19;0.138)																---	---	---	---
DSCAM	1826	broad.mit.edu	37	21	41516548	41516548	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:41516548G>A	uc002yyq.1	-	17	3581	c.3129C>T	c.(3127-3129)AGC>AGT	p.S1043S	DSCAM_uc002yyr.1_RNA	NM_001389	NP_001380	O60469	DSCAM_HUMAN	Down syndrome cell adhesion molecule isoform	1043	Fibronectin type-III 2.|Extracellular (Potential).				cell adhesion|dendrite self-avoidance|negative regulation of cell adhesion|positive regulation of axon extension involved in axon guidance|positive regulation of phosphorylation	axon|extracellular region|growth cone|integral to plasma membrane|membrane fraction	protein binding			ovary(6)|skin(4)|upper_aerodigestive_tract(1)	11		all_cancers(19;0.186)|Prostate(19;1.15e-05)|all_epithelial(19;0.0103)																---	---	---	---
FAM3B	54097	broad.mit.edu	37	21	42718974	42718974	+	Silent	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:42718974T>C	uc002yzb.1	+	6	578	c.432T>C	c.(430-432)AGT>AGC	p.S144S	FAM3B_uc002yza.2_RNA|FAM3B_uc002yzc.1_Silent_p.S96S|FAM3B_uc002yzd.1_Silent_p.S167S	NM_058186	NP_478066	P58499	FAM3B_HUMAN	family with sequence similarity 3, member B	144					apoptosis|insulin secretion	extracellular space	cytokine activity				0		Prostate(19;1.57e-07)|all_epithelial(19;0.0404)																---	---	---	---
PDE9A	5152	broad.mit.edu	37	21	44182210	44182210	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44182210G>A	uc002zbm.2	+	14	1166	c.1103G>A	c.(1102-1104)CGC>CAC	p.R368H	PDE9A_uc002zbn.2_Missense_Mutation_p.R241H|PDE9A_uc002zbo.2_Missense_Mutation_p.R315H|PDE9A_uc002zbp.2_Missense_Mutation_p.R161H|PDE9A_uc002zbq.2_Missense_Mutation_p.R266H|PDE9A_uc002zbs.2_Missense_Mutation_p.R161H|PDE9A_uc002zbr.2_Missense_Mutation_p.R161H|PDE9A_uc002zbt.2_Missense_Mutation_p.R240H|PDE9A_uc002zbu.2_Missense_Mutation_p.R234H|PDE9A_uc002zbv.2_Missense_Mutation_p.R208H|PDE9A_uc002zbw.2_Missense_Mutation_p.R151H|PDE9A_uc002zbx.2_Missense_Mutation_p.R308H|PDE9A_uc002zby.2_Missense_Mutation_p.R151H|PDE9A_uc002zbz.2_Missense_Mutation_p.R260H|PDE9A_uc002zca.2_Missense_Mutation_p.R327H|PDE9A_uc002zcb.2_Missense_Mutation_p.R342H|PDE9A_uc002zcc.2_Missense_Mutation_p.R267H|PDE9A_uc002zcd.2_Missense_Mutation_p.R282H|PDE9A_uc002zce.2_Missense_Mutation_p.R301H|PDE9A_uc002zcf.2_Missense_Mutation_p.R161H|PDE9A_uc002zcg.2_Missense_Mutation_p.R161H|PDE9A_uc002zch.2_Missense_Mutation_p.R151H|PDE9A_uc010gpf.1_Missense_Mutation_p.R161H	NM_002606	NP_002597	O76083	PDE9A_HUMAN	phosphodiesterase 9A isoform a	368	Catalytic (By similarity).				platelet activation|signal transduction	cytosol|endoplasmic reticulum|Golgi apparatus|perinuclear region of cytoplasm|ruffle membrane	3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding|protein binding			ovary(1)|skin(1)	2																		---	---	---	---
PKNOX1	5316	broad.mit.edu	37	21	44438317	44438317	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44438317A>T	uc002zcq.1	+	7	885	c.697A>T	c.(697-699)ACA>TCA	p.T233S	PKNOX1_uc002zcp.1_Missense_Mutation_p.T233S|PKNOX1_uc011aex.1_Missense_Mutation_p.T116S	NM_004571	NP_004562	P55347	PKNX1_HUMAN	PBX/knotted 1 homeobox 1	233							sequence-specific DNA binding			large_intestine(2)	2																		---	---	---	---
MICAL3	57553	broad.mit.edu	37	22	18301213	18301213	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:18301213C>T	uc002zng.3	-	26	4567	c.4214G>A	c.(4213-4215)CGG>CAG	p.R1405Q	MICAL3_uc011agl.1_Missense_Mutation_p.R1321Q|MICAL3_uc010gre.1_5'Flank	NM_015241	NP_056056	Q7RTP6	MICA3_HUMAN	microtubule associated monoxygenase, calponin	1405	Pro-rich.					cytoplasm|cytoskeleton	monooxygenase activity|zinc ion binding				0		all_epithelial(15;0.198)		Lung(27;0.0427)														---	---	---	---
TSSK2	23617	broad.mit.edu	37	22	19119120	19119120	+	Missense_Mutation	SNP	G	A	A	rs141724999		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19119120G>A	uc002zow.2	+	1	800	c.208G>A	c.(208-210)GGC>AGC	p.G70S	DGCR14_uc002zot.2_3'UTR|DGCR14_uc002zou.2_3'UTR|DGCR14_uc002zov.2_RNA	NM_053006	NP_443732	Q96PF2	TSSK2_HUMAN	testis-specific serine kinase 2	70	Protein kinase.				cell differentiation|multicellular organismal development|spermatogenesis	cytoplasm	ATP binding|magnesium ion binding|protein binding|protein serine/threonine kinase activity			stomach(1)	1	Colorectal(54;0.0993)																	---	---	---	---
HIRA	7290	broad.mit.edu	37	22	19396104	19396104	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19396104C>A	uc002zpf.1	-	3	333	c.113G>T	c.(112-114)GGG>GTG	p.G38V	HIRA_uc011agx.1_5'UTR|HIRA_uc010grn.1_Missense_Mutation_p.G38V|HIRA_uc010gro.1_5'UTR|HIRA_uc010grp.2_RNA	NM_003325	NP_003316	P54198	HIRA_HUMAN	HIR histone cell cycle regulation defective	38	WD 1.				chromatin modification|regulation of transcription from RNA polymerase II promoter	PML body	chromatin binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(1)	1	Colorectal(54;0.0993)																	---	---	---	---
UFD1L	7353	broad.mit.edu	37	22	19463058	19463058	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19463058C>T	uc002zpm.2	-	2	201	c.71G>A	c.(70-72)CGC>CAC	p.R24H	UFD1L_uc002zpo.2_Missense_Mutation_p.R24H|UFD1L_uc011agy.1_Missense_Mutation_p.R24H|UFD1L_uc002zpp.2_5'UTR|UFD1L_uc010grq.2_5'UTR	NM_005659	NP_005650	Q92890	UFD1_HUMAN	ubiquitin fusion degradation 1-like isoform A	24					skeletal system development|ubiquitin-dependent protein catabolic process	cytosol|nucleus	protein binding|ubiquitin-specific protease activity				0	Colorectal(54;0.0993)																	---	---	---	---
ARVCF	421	broad.mit.edu	37	22	19960570	19960570	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19960570G>A	uc002zqz.2	-						ARVCF_uc002zqy.2_Intron	NM_001670	NP_001661			armadillo repeat protein						cell adhesion|multicellular organismal development		protein binding			liver(1)	1	Colorectal(54;0.0993)																	---	---	---	---
TRMT2A	27037	broad.mit.edu	37	22	20103586	20103586	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:20103586C>T	uc002zrk.1	-	3	789	c.574G>A	c.(574-576)GAG>AAG	p.E192K	TRMT2A_uc002zrl.1_Missense_Mutation_p.E192K|TRMT2A_uc002zrm.1_Silent_p.A12A|TRMT2A_uc002zrn.1_Missense_Mutation_p.E192K|TRMT2A_uc011ahk.1_Missense_Mutation_p.E192K|RANBP1_uc011ahl.1_5'Flank|RANBP1_uc002zro.1_5'Flank|RANBP1_uc002zrp.2_5'Flank	NM_182984	NP_892029	Q8IZ69	TRM2A_HUMAN	HpaII tiny fragments locus 9C	192	Potential.				RNA processing		nucleotide binding|RNA binding|RNA methyltransferase activity			breast(1)	1																		---	---	---	---
AIFM3	150209	broad.mit.edu	37	22	21330537	21330537	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21330537G>A	uc002ztj.2	+	10	1059	c.841G>A	c.(841-843)GTG>ATG	p.V281M	AIFM3_uc002ztk.2_Missense_Mutation_p.V281M|AIFM3_uc002ztl.2_Missense_Mutation_p.V287M|AIFM3_uc011ahx.1_Missense_Mutation_p.V269M|AIFM3_uc002ztm.1_Missense_Mutation_p.V93M	NM_144704	NP_653305	Q96NN9	AIFM3_HUMAN	apoptosis-inducing factor,	281					activation of caspase activity by cytochrome c|cell redox homeostasis|electron transport chain|induction of apoptosis|mitochondrial depolarization|transport	endoplasmic reticulum|mitochondrial inner membrane	2 iron, 2 sulfur cluster binding|caspase activator activity|flavin adenine dinucleotide binding|metal ion binding|oxidoreductase activity|protein binding			ovary(2)|lung(2)	4	all_cancers(11;3.71e-26)|all_epithelial(7;1.59e-23)|Lung NSC(8;3.06e-15)|all_lung(8;5.05e-14)|Melanoma(16;0.000465)|Ovarian(15;0.0028)|Colorectal(54;0.0332)|all_neural(72;0.142)	Lung SC(17;0.0367)	LUSC - Lung squamous cell carcinoma(15;0.000204)|Lung(15;0.00494)|Epithelial(17;0.195)															---	---	---	---
P2RX6	9127	broad.mit.edu	37	22	21377631	21377631	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21377631C>A	uc010gsu.1	+	7	706	c.706C>A	c.(706-708)CCC>ACC	p.P236T	P2RX6_uc002ztz.2_Missense_Mutation_p.P210T|P2RX6_uc002zua.2_RNA|P2RX6_uc002zuc.1_RNA	NM_005446	NP_005437	O15547	P2RX6_HUMAN	purinergic receptor P2X6 isoform 1	236	Extracellular (Potential).				muscle contraction|protein homooligomerization	cell junction|cytoplasm|integral to plasma membrane	ATP binding|extracellular ATP-gated cation channel activity|identical protein binding|purinergic nucleotide receptor activity				0																		---	---	---	---
MAPK1	5594	broad.mit.edu	37	22	22153338	22153338	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:22153338C>T	uc002zvn.2	-	4	812	c.572G>A	c.(571-573)CGT>CAT	p.R191H	MAPK1_uc002zvo.2_Missense_Mutation_p.R191H|MAPK1_uc010gtk.1_Missense_Mutation_p.R191H	NM_002745	NP_002736	P28482	MK01_HUMAN	mitogen-activated protein kinase 1	191	Protein kinase.				activation of MAPK activity|activation of MAPKK activity|axon guidance|cell cycle|epidermal growth factor receptor signaling pathway|ERK1 and ERK2 cascade|induction of apoptosis|innate immune response|insulin receptor signaling pathway|interspecies interaction between organisms|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|platelet activation|Ras protein signal transduction|regulation of sequence-specific DNA binding transcription factor activity|stress-activated MAPK cascade|synaptic transmission|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway|transcription, DNA-dependent	cytosol|nucleoplasm	ATP binding|DNA binding|MAP kinase activity|phosphatase binding|RNA polymerase II carboxy-terminal domain kinase activity			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3	Colorectal(54;0.105)	all_lung(157;3.89e-05)		READ - Rectum adenocarcinoma(21;0.0689)	Arsenic trioxide(DB01169)													---	---	---	---
C22orf13	83606	broad.mit.edu	37	22	24944875	24944875	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:24944875C>T	uc003aah.2	-						C22orf13_uc003aal.2_Intron|C22orf13_uc003aai.3_Intron|C22orf13_uc003aaj.3_Intron|C22orf13_uc003aak.3_Intron	NM_031444	NP_113632			chromosome 22 open reading frame 13												0																		---	---	---	---
IGLL3	91353	broad.mit.edu	37	22	25716014	25716014	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:25716014C>T	uc003abr.2	+	2	736	c.636C>T	c.(634-636)AGC>AGT	p.S212S		NM_001013618	NP_001013640			immunoglobulin lambda-like polypeptide 3												0																		---	---	---	---
MYO18B	84700	broad.mit.edu	37	22	26423348	26423348	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26423348C>T	uc003abz.1	+	43	7658	c.7408C>T	c.(7408-7410)CGT>TGT	p.R2470C	MYO18B_uc003aca.1_Missense_Mutation_p.R2351C|MYO18B_uc010guy.1_Missense_Mutation_p.R2352C|MYO18B_uc010guz.1_Missense_Mutation_p.R2350C|MYO18B_uc011aka.1_Missense_Mutation_p.R1624C|MYO18B_uc011akb.1_Missense_Mutation_p.R1983C|MYO18B_uc010gva.1_Missense_Mutation_p.R453C|MYO18B_uc010gvb.1_RNA	NM_032608	NP_115997	Q8IUG5	MY18B_HUMAN	myosin XVIIIB	2470						nucleus|sarcomere|unconventional myosin complex	actin binding|ATP binding|motor activity			ovary(5)|central_nervous_system(3)|large_intestine(2)|breast(2)	12																		---	---	---	---
SEC14L3	266629	broad.mit.edu	37	22	30856091	30856091	+	Missense_Mutation	SNP	C	T	T	rs142573310	byFrequency;by1000genomes	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:30856091C>T	uc003ahy.2	-	12	1209	c.1120G>A	c.(1120-1122)GCC>ACC	p.A374T	SEC14L3_uc003ahz.2_Missense_Mutation_p.A297T|SEC14L3_uc003aia.2_Missense_Mutation_p.A315T|SEC14L3_uc003aib.2_Missense_Mutation_p.A315T	NM_174975	NP_777635	Q9UDX4	S14L3_HUMAN	SEC14-like 3	374	GOLD.					integral to membrane|intracellular	lipid binding|transporter activity			ovary(3)|pancreas(1)|skin(1)	5					Vitamin E(DB00163)													---	---	---	---
SEC14L4	284904	broad.mit.edu	37	22	30887696	30887696	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:30887696G>A	uc003aid.2	-	11	1045	c.945C>T	c.(943-945)GGC>GGT	p.G315G	SEC14L4_uc011akz.1_Silent_p.G315G|SEC14L4_uc003aie.2_Silent_p.G300G|SEC14L4_uc003aif.2_Silent_p.G261G	NM_174977	NP_777637	Q9UDX3	S14L4_HUMAN	SEC14p-like protein TAP3 isoform a	315	GOLD.					integral to membrane|intracellular	lipid binding|transporter activity			skin(1)	1					Vitamin E(DB00163)													---	---	---	---
OSBP2	23762	broad.mit.edu	37	22	31301891	31301891	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:31301891G>A	uc003aiy.1	+	13	2547	c.2443G>A	c.(2443-2445)GTA>ATA	p.V815I	OSBP2_uc011ala.1_Missense_Mutation_p.V649I|OSBP2_uc010gwc.1_Missense_Mutation_p.V642I|OSBP2_uc011alb.1_Missense_Mutation_p.V766I|OSBP2_uc003aiz.1_Missense_Mutation_p.V814I|OSBP2_uc003aja.1_Missense_Mutation_p.V448I|OSBP2_uc011alc.1_Missense_Mutation_p.V557I|OSBP2_uc003ajb.2_Missense_Mutation_p.V360I|OSBP2_uc011ald.1_Missense_Mutation_p.V359I|OSBP2_uc010gwd.1_Missense_Mutation_p.R298H	NM_030758	NP_110385	Q969R2	OSBP2_HUMAN	oxysterol binding protein 2 isoform a	815					lipid transport	membrane	lipid binding			breast(1)|skin(1)	2																		---	---	---	---
SMTN	6525	broad.mit.edu	37	22	31493263	31493263	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:31493263G>T	uc003ajl.1	+	16	2316	c.2098G>T	c.(2098-2100)GGC>TGC	p.G700C	SMTN_uc003ajk.1_Missense_Mutation_p.G700C|SMTN_uc003ajm.1_Missense_Mutation_p.G700C|SMTN_uc011ale.1_Missense_Mutation_p.G785C|SMTN_uc011alf.1_Missense_Mutation_p.G756C|SMTN_uc003ajn.1_Missense_Mutation_p.G723C|SMTN_uc011alg.1_Missense_Mutation_p.G156C|SMTN_uc003ajo.1_Missense_Mutation_p.G223C|SMTN_uc010gwe.1_Missense_Mutation_p.G80C	NM_006932	NP_008863	P53814	SMTN_HUMAN	smoothelin isoform c	700					muscle organ development|smooth muscle contraction	actin cytoskeleton|cytoplasm	actin binding|structural constituent of muscle			large_intestine(2)|pancreas(1)	3																		---	---	---	---
SMTN	6525	broad.mit.edu	37	22	31496923	31496923	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:31496923C>T	uc003ajl.1	+						SMTN_uc003ajk.1_Nonsense_Mutation_p.R886*|SMTN_uc003ajm.1_Nonsense_Mutation_p.R886*|SMTN_uc011ale.1_Intron|SMTN_uc011alf.1_Nonsense_Mutation_p.R942*|SMTN_uc003ajn.1_Nonsense_Mutation_p.R909*|SMTN_uc011alg.1_Nonsense_Mutation_p.R342*|SMTN_uc003ajo.1_Nonsense_Mutation_p.R409*|SMTN_uc010gwe.1_Nonsense_Mutation_p.R266*|SMTN_uc003ajp.1_5'Flank	NM_006932	NP_008863			smoothelin isoform c						muscle organ development|smooth muscle contraction	actin cytoskeleton|cytoplasm	actin binding|structural constituent of muscle			large_intestine(2)|pancreas(1)	3																		---	---	---	---
PISD	23761	broad.mit.edu	37	22	32021782	32021782	+	Intron	SNP	G	A	A	rs149634136		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:32021782G>A	uc003alm.3	-						PISD_uc003alk.2_Missense_Mutation_p.A7V|PISD_uc003all.2_Missense_Mutation_p.A6V|PISD_uc011alr.1_Missense_Mutation_p.A6V|PISD_uc003aln.3_Intron	NM_014338	NP_055153			phosphatidylserine decarboxylase						phospholipid biosynthetic process	mitochondrion	phosphatidylserine decarboxylase activity			central_nervous_system(2)|ovary(1)	3					Phosphatidylserine(DB00144)													---	---	---	---
TIMP3	7078	broad.mit.edu	37	22	33255244	33255244	+	Silent	SNP	C	T	T	rs149161075	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:33255244C>T	uc003anb.2	+	5	1702	c.516C>T	c.(514-516)TTC>TTT	p.F172F	SYN3_uc003amx.2_Intron|SYN3_uc003amy.2_Intron|SYN3_uc003amz.2_Intron	NM_000362	NP_000353	P35625	TIMP3_HUMAN	tissue inhibitor of metalloproteinase 3	172	Mediates interaction with EFEMP1.				negative regulation of membrane protein ectodomain proteolysis|visual perception		metal ion binding|metalloendopeptidase inhibitor activity|protein binding			lung(1)	1																		---	---	---	---
MCM5	4174	broad.mit.edu	37	22	35817310	35817310	+	Splice_Site	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:35817310G>T	uc003anu.3	+	15	1927	c.1833_splice	c.e15-1	p.R611_splice	MCM5_uc010gwr.2_Splice_Site_p.R420_splice|MCM5_uc003anv.3_Splice_Site_p.R568_splice|MCM5_uc003anw.1_Splice_Site_p.R395_splice	NM_006739	NP_006730			minichromosome maintenance complex component 5						cell cycle checkpoint|DNA strand elongation involved in DNA replication|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|S phase of mitotic cell cycle	MCM complex	ATP binding|DNA binding|helicase activity|protein binding			ovary(1)	1																		---	---	---	---
ELFN2	114794	broad.mit.edu	37	22	37769658	37769658	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:37769658G>A	uc003asq.3	-	3	2703	c.1917C>T	c.(1915-1917)AGC>AGT	p.S639S		NM_052906	NP_443138	Q5R3F8	LRFN6_HUMAN	leucine rich repeat containing 62	639	Cytoplasmic (Potential).					cell surface|integral to membrane				upper_aerodigestive_tract(1)|ovary(1)	2	Melanoma(58;0.0574)																	---	---	---	---
GGA1	26088	broad.mit.edu	37	22	38019393	38019393	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38019393C>T	uc003atc.2	+	8	1034	c.669C>T	c.(667-669)AAC>AAT	p.N223N	GGA1_uc003atd.2_Silent_p.N223N|GGA1_uc003ate.2_Silent_p.N223N|GGA1_uc003atf.2_Silent_p.N150N	NM_013365	NP_037497	Q9UJY5	GGA1_HUMAN	golgi associated, gamma adaptin ear containing,	223	Interaction with ARF3.|GAT.				intracellular protein transport|vesicle-mediated transport	clathrin adaptor complex|endosome membrane|Golgi apparatus part	protein binding			breast(2)|ovary(1)	3	Melanoma(58;0.0574)															OREG0026543	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PLA2G6	8398	broad.mit.edu	37	22	38528987	38528987	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38528987C>T	uc003auy.1	-	7	1064	c.928G>A	c.(928-930)GTG>ATG	p.V310M	PLA2G6_uc003auz.1_Missense_Mutation_p.V310M|PLA2G6_uc003ava.1_Missense_Mutation_p.V310M|PLA2G6_uc003avb.2_Missense_Mutation_p.V310M|PLA2G6_uc010gxk.1_RNA|PLA2G6_uc011ano.1_Missense_Mutation_p.V275M	NM_003560	NP_003551	O60733	PA2G6_HUMAN	phospholipase A2, group VI isoform a	310	ANK 5.		V -> E (in NBIA2A).		cardiolipin biosynthetic process|cell death|lipid catabolic process	centrosome|membrane				ovary(1)	1	Melanoma(58;0.045)				Quinacrine(DB01103)													---	---	---	---
ST13	6767	broad.mit.edu	37	22	41226918	41226918	+	Missense_Mutation	SNP	G	A	A	rs36082289		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41226918G>A	uc003aze.2	-	9	867	c.724C>T	c.(724-726)CGT>TGT	p.R242C	ST13_uc011aow.1_Missense_Mutation_p.R232C	NM_003932	NP_003923	P50502	F10A1_HUMAN	heat shock 70kD protein binding protein	242							protein binding, bridging				0																		---	---	---	---
TTLL1	25809	broad.mit.edu	37	22	43455541	43455541	+	Intron	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43455541C>T	uc003bdi.2	-						TTLL1_uc010gzh.2_Intron|TTLL1_uc003bdj.2_Intron|TTLL1_uc003bdh.2_Intron	NM_012263	NP_036395			tubulin tyrosine ligase-like family, member 1						protein polyglutamylation	cytoplasm|microtubule	ATP binding|tubulin-glutamic acid ligase activity|tubulin-tyrosine ligase activity			skin(1)	1		Ovarian(80;0.0694)		BRCA - Breast invasive adenocarcinoma(115;0.00461)														---	---	---	---
SCUBE1	80274	broad.mit.edu	37	22	43735243	43735243	+	Splice_Site	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43735243T>C	uc003bdt.1	-	2	177	c.89_splice	c.e2-1	p.G30_splice	SCUBE1_uc003bdu.1_Splice_Site_p.G30_splice	NM_173050	NP_766638			signal peptide, CUB domain, EGF-like 1						adult heart development|blood coagulation|endothelial cell differentiation|inflammatory response|post-embryonic development|protein homooligomerization	external side of plasma membrane|extracellular space|extrinsic to plasma membrane	calcium ion binding|identical protein binding|protein heterodimerization activity			central_nervous_system(2)|ovary(1)|lung(1)|skin(1)	5		all_neural(38;0.0414)|Ovarian(80;0.07)																---	---	---	---
MPPED1	758	broad.mit.edu	37	22	43898596	43898596	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43898596G>A	uc011apv.1	+	6	1044	c.821G>A	c.(820-822)CGC>CAC	p.R274H	MPPED1_uc011apw.1_Missense_Mutation_p.R168H|MPPED1_uc011apx.1_Missense_Mutation_p.R116H|MPPED1_uc011apy.1_Missense_Mutation_p.R274H|MPPED1_uc011apz.1_Missense_Mutation_p.R307H	NM_001044370	NP_001037835	O15442	MPPD1_HUMAN	metallophosphoesterase domain containing 1	274							hydrolase activity				0		all_neural(38;0.0244)|Ovarian(80;0.0694)																---	---	---	---
EFCAB6	64800	broad.mit.edu	37	22	44031067	44031067	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:44031067G>A	uc003bdy.1	-	18	2228	c.2013C>T	c.(2011-2013)GAC>GAT	p.D671D	EFCAB6_uc003bdz.1_Silent_p.D519D|EFCAB6_uc010gzi.1_Silent_p.D519D|EFCAB6_uc010gzj.1_Intron|EFCAB6_uc010gzk.1_Intron	NM_022785	NP_073622	Q5THR3	EFCB6_HUMAN	CAP-binding protein complex interacting protein	671					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	calcium ion binding			ovary(3)|skin(2)|upper_aerodigestive_tract(1)|pancreas(1)	7		Ovarian(80;0.0247)|all_neural(38;0.025)																---	---	---	---
EFCAB6	64800	broad.mit.edu	37	22	44151724	44151724	+	Intron	SNP	A	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:44151724A>T	uc003bdy.1	-						EFCAB6_uc003bdz.1_Intron|EFCAB6_uc010gzi.1_Intron|EFCAB6_uc011aqa.1_Intron|EFCAB6_uc003bea.1_Intron|EFCAB6_uc003beb.3_Intron	NM_022785	NP_073622			CAP-binding protein complex interacting protein						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	calcium ion binding			ovary(3)|skin(2)|upper_aerodigestive_tract(1)|pancreas(1)	7		Ovarian(80;0.0247)|all_neural(38;0.025)																---	---	---	---
CELSR1	9620	broad.mit.edu	37	22	46792559	46792559	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:46792559G>A	uc003bhw.1	-	13	5786	c.5786C>T	c.(5785-5787)CCG>CTG	p.P1929L	CELSR1_uc011arc.1_Missense_Mutation_p.P250L	NM_014246	NP_055061	Q9NYQ6	CELR1_HUMAN	cadherin EGF LAG seven-pass G-type receptor 1	1929	Extracellular (Potential).|EGF-like 6; calcium-binding.				central nervous system development|homophilic cell adhesion|neural tube closure|neuropeptide signaling pathway	integral to plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein dimerization activity			lung(4)|breast(4)|pancreas(2)|skin(1)	11		Ovarian(80;0.00142)|Breast(42;0.00296)|all_neural(38;0.0416)|Colorectal(5;0.0766)		UCEC - Uterine corpus endometrioid carcinoma (28;0.00643)|BRCA - Breast invasive adenocarcinoma(115;0.171)														---	---	---	---
FAM19A5	25817	broad.mit.edu	37	22	49103656	49103656	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:49103656G>A	uc003bim.3	+	3	507	c.390G>A	c.(388-390)ACG>ACA	p.T130T	FAM19A5_uc003bio.3_Silent_p.T123T	NM_001082967	NP_001076436	Q7Z5A7	F19A5_HUMAN	family with sequence similarity 19 (chemokine	130						extracellular region|integral to membrane				large_intestine(1)	1		all_cancers(38;2.95e-11)|all_epithelial(38;3.07e-10)|all_lung(38;2.89e-05)|Breast(42;0.000396)|Lung NSC(38;0.000471)|Ovarian(80;0.00934)|Lung SC(80;0.195)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0227)|BRCA - Breast invasive adenocarcinoma(115;0.119)														---	---	---	---
BRD1	23774	broad.mit.edu	37	22	50191612	50191612	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50191612C>T	uc003biv.2	-	5	2426	c.1939G>A	c.(1939-1941)GTG>ATG	p.V647M	BRD1_uc011arf.1_Missense_Mutation_p.V242M|BRD1_uc011arg.1_Missense_Mutation_p.V696M|BRD1_uc011arh.1_Missense_Mutation_p.V647M|BRD1_uc003biu.3_Missense_Mutation_p.V647M	NM_014577	NP_055392	O95696	BRD1_HUMAN	bromodomain containing protein 1	647	Bromo.				histone H3 acetylation	MOZ/MORF histone acetyltransferase complex	zinc ion binding			pancreas(1)	1		all_cancers(38;6.11e-10)|all_epithelial(38;8.06e-09)|all_lung(38;6.64e-05)|Lung NSC(38;0.0011)|Breast(42;0.00235)|Ovarian(80;0.0139)|Lung SC(80;0.164)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0369)|BRCA - Breast invasive adenocarcinoma(115;0.21)														---	---	---	---
CRELD2	79174	broad.mit.edu	37	22	50316958	50316958	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50316958G>A	uc003bja.2	+	7	900	c.765G>A	c.(763-765)ACG>ACA	p.T255T	CRELD2_uc003biz.3_Silent_p.T255T|CRELD2_uc010haj.2_Silent_p.T255T|CRELD2_uc010hal.2_Silent_p.T304T|CRELD2_uc010hak.2_Intron|CRELD2_uc010ham.2_Silent_p.T255T	NM_024324	NP_077300	Q6UXH1	CREL2_HUMAN	cysteine-rich with EGF-like domains 2 isoform b	255	FU 2.					endoplasmic reticulum|extracellular region	calcium ion binding				0		all_cancers(38;5.53e-07)|all_epithelial(38;3.84e-06)|all_lung(38;0.00208)|Breast(42;0.0104)|Lung NSC(38;0.0199)|Ovarian(80;0.0907)|Lung SC(80;0.236)		BRCA - Breast invasive adenocarcinoma(115;0.198)|LUAD - Lung adenocarcinoma(64;0.247)														---	---	---	---
TUBGCP6	85378	broad.mit.edu	37	22	50658984	50658984	+	Silent	SNP	G	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50658984G>T	uc003bkb.1	-	16	4316	c.3804C>A	c.(3802-3804)ACC>ACA	p.T1268T	TUBGCP6_uc003bka.1_Silent_p.T355T|TUBGCP6_uc010har.1_Silent_p.T1260T|TUBGCP6_uc010has.1_RNA	NM_020461	NP_065194	Q96RT7	GCP6_HUMAN	tubulin, gamma complex associated protein 6	1268	9 X 27 AA tandem repeats.|9.				G2/M transition of mitotic cell cycle|microtubule nucleation	centrosome|cytosol|gamma-tubulin ring complex|microtubule|spindle pole	microtubule binding			ovary(2)|central_nervous_system(2)	4		all_cancers(38;5.79e-13)|all_epithelial(38;1.71e-11)|all_lung(38;3.89e-05)|Breast(42;0.000523)|Lung NSC(38;0.000992)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		LUAD - Lung adenocarcinoma(64;0.109)|BRCA - Breast invasive adenocarcinoma(115;0.21)														---	---	---	---
SHOX	6473	broad.mit.edu	37	X	591692	591692	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:591692C>T	uc004cph.1	+	2	751	c.60C>T	c.(58-60)AAC>AAT	p.N20N	SHOX_uc004cpi.2_Silent_p.N20N	NM_000451	NP_000442	O15266	SHOX_HUMAN	short stature homeobox isoform SHOXa	20	Poly-Gly.				skeletal system development|transcription from RNA polymerase II promoter	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)																---	---	---	---
SLC25A6	293	broad.mit.edu	37	X	1508630	1508630	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1508630G>A	uc004cpt.2	-						SLC25A6_uc004cpu.2_Intron	NM_001636	NP_001627			adenine nucleotide translocator 3						active induction of host immune response by virus|apoptosis|energy reserve metabolic process|regulation of insulin secretion|viral infectious cycle	integral to membrane|mitochondrial inner membrane presequence translocase complex	ATP:ADP antiporter activity|protein binding				0		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)			Clodronate(DB00720)													---	---	---	---
ZBED1	9189	broad.mit.edu	37	X	2407993	2407993	+	Silent	SNP	G	A	A	rs141687518		TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:2407993G>A	uc004cqg.2	-	2	969	c.768C>T	c.(766-768)ATC>ATT	p.I256I	DHRSX_uc004cqf.3_Intron|ZBED1_uc004cqh.1_Silent_p.I256I	NM_004729	NP_004720	O96006	ZBED1_HUMAN	zinc finger, BED-type containing 1	256						nuclear chromosome	DNA binding|metal ion binding|protein dimerization activity|transposase activity				0		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)																---	---	---	---
KAL1	3730	broad.mit.edu	37	X	8503692	8503692	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:8503692C>T	uc004csf.2	-	12	1932	c.1782G>A	c.(1780-1782)ACG>ACA	p.T594T		NM_000216	NP_000207	P23352	KALM_HUMAN	Kallmann syndrome 1 protein precursor	594	Fibronectin type-III 4.				axon guidance|cell adhesion|cellular component movement	extracellular space|plasma membrane|proteinaceous extracellular matrix	extracellular matrix structural constituent|heparin binding|serine-type endopeptidase inhibitor activity			ovary(3)|pancreas(1)	4																		---	---	---	---
ARX	170302	broad.mit.edu	37	X	25033731	25033731	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:25033731G>A	uc004dbp.3	-	1	335	c.124C>T	c.(124-126)CGG>TGG	p.R42W		NM_139058	NP_620689	Q96QS3	ARX_HUMAN	aristaless related homeobox	42						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
HDAC6	10013	broad.mit.edu	37	X	48661558	48661558	+	Silent	SNP	A	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:48661558A>G	uc011mmi.1	+	4	341	c.246A>G	c.(244-246)GCA>GCG	p.A82A	HDAC6_uc004dkr.1_Silent_p.A82A|HDAC6_uc004dks.1_Silent_p.A82A|HDAC6_uc010nig.1_5'UTR|HDAC6_uc004dkt.1_Silent_p.A82A|HDAC6_uc004dku.3_Silent_p.A82A|HDAC6_uc011mmj.1_Silent_p.A27A|HDAC6_uc011mmk.1_Silent_p.A63A	NM_006044	NP_006035	Q9UBN7	HDAC6_HUMAN	histone deacetylase 6	82					aggresome assembly|cellular response to hydrogen peroxide|Hsp90 deacetylation|lysosome localization|macroautophagy|misfolded or incompletely synthesized protein catabolic process|negative regulation of proteolysis|negative regulation of transcription, DNA-dependent|peptidyl-lysine deacetylation|polyubiquitinated misfolded protein transport|positive regulation of apoptosis|positive regulation of cellular chaperone-mediated protein complex assembly|positive regulation of epithelial cell migration|positive regulation of receptor biosynthetic process|positive regulation of signal transduction|regulation of androgen receptor signaling pathway|regulation of receptor activity|response to growth factor stimulus|response to toxin|transcription, DNA-dependent|tubulin deacetylation	aggresome|caveola|cell leading edge|cytosol|histone deacetylase complex|microtubule associated complex|perinuclear region of cytoplasm	actin binding|alpha-tubulin binding|beta-catenin binding|dynein complex binding|histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|Hsp90 protein binding|microtubule binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|polyubiquitin binding|tau protein binding|tubulin deacetylase activity|zinc ion binding			ovary(3)|upper_aerodigestive_tract(1)	4					Vorinostat(DB02546)													---	---	---	---
PPP1R3F	89801	broad.mit.edu	37	X	49138500	49138500	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:49138500C>T	uc004dnh.1	+	3	1133	c.1117C>T	c.(1117-1119)CGT>TGT	p.R373C	PPP1R3F_uc011mnd.1_Missense_Mutation_p.R44C|PPP1R3F_uc004dni.2_Missense_Mutation_p.R27C|PPP1R3F_uc004dnj.1_Missense_Mutation_p.R27C	NM_033215	NP_149992	Q6ZSY5	PPR3F_HUMAN	protein phosphatase 1, regulatory (inhibitor)	373	Extracellular (Potential).					integral to membrane				ovary(2)|skin(1)	3	Ovarian(276;0.236)																	---	---	---	---
ALAS2	212	broad.mit.edu	37	X	55039970	55039970	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:55039970G>A	uc004dua.3	-	10	1687	c.1549C>T	c.(1549-1551)CGC>TGC	p.R517C	ALAS2_uc004dub.3_Missense_Mutation_p.R504C|ALAS2_uc004dud.3_Missense_Mutation_p.R480C	NM_000032	NP_000023	P22557	HEM0_HUMAN	5-aminolevulinate synthase 2 isoform a	517					cellular iron ion homeostasis|erythrocyte differentiation|heme biosynthetic process|hemoglobin biosynthetic process|oxygen homeostasis|response to hypoxia	mitochondrial inner membrane|mitochondrial matrix	5-aminolevulinate synthase activity|coenzyme binding|glycine binding|protein binding|pyridoxal phosphate binding|transferase activity, transferring nitrogenous groups			ovary(1)	1					Glycine(DB00145)													---	---	---	---
PCDH19	57526	broad.mit.edu	37	X	99662749	99662749	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:99662749C>T	uc010nmz.2	-	1	2523	c.847G>A	c.(847-849)GAC>AAC	p.D283N	PCDH19_uc004efw.3_Missense_Mutation_p.D283N|PCDH19_uc004efx.3_Missense_Mutation_p.D283N	NM_020766	NP_001098713	Q8TAB3	PCD19_HUMAN	protocadherin 19 isoform b	283	Cadherin 3.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)|breast(2)|upper_aerodigestive_tract(1)|urinary_tract(1)|skin(1)	7																		---	---	---	---
GPRASP2	114928	broad.mit.edu	37	X	101971337	101971337	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:101971337T>G	uc004ejk.2	+	4	2874	c.1540T>G	c.(1540-1542)TTT>GTT	p.F514V	GPRASP2_uc004ejl.2_Missense_Mutation_p.F514V|GPRASP2_uc004ejm.2_Missense_Mutation_p.F514V|GPRASP2_uc011mrp.1_5'Flank	NM_138437	NP_612446	Q96D09	GASP2_HUMAN	G protein-coupled receptor associated sorting	514						cytoplasm	protein binding			ovary(1)	1																		---	---	---	---
COL4A6	1288	broad.mit.edu	37	X	107402789	107402789	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107402789G>A	uc004enw.3	-	44	4821	c.4718C>T	c.(4717-4719)GCA>GTA	p.A1573V	COL4A6_uc004env.3_Missense_Mutation_p.A1572V|COL4A6_uc011msn.1_Missense_Mutation_p.A1548V|COL4A6_uc010npk.2_Missense_Mutation_p.A1515V|COL4A6_uc011msm.1_Missense_Mutation_p.A107V|COL4A6_uc010npj.2_Missense_Mutation_p.A52V	NM_001847	NP_001838	Q14031	CO4A6_HUMAN	type IV alpha 6 collagen isoform A precursor	1573	Collagen IV NC1.				cell adhesion|extracellular matrix organization	collagen type IV	extracellular matrix structural constituent|protein binding			ovary(6)|urinary_tract(1)|large_intestine(1)	8														Alport_syndrome_with_Diffuse_Leiomyomatosis				---	---	---	---
COL4A5	1287	broad.mit.edu	37	X	107911743	107911743	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107911743G>A	uc004enz.1	+						COL4A5_uc011mso.1_Intron	NM_033380	NP_203699			type IV collagen alpha 5 isoform 2 precursor						axon guidance	collagen type IV	extracellular matrix structural constituent|protein binding			ovary(3)|central_nervous_system(1)	4														Alport_syndrome_with_Diffuse_Leiomyomatosis				---	---	---	---
IRS4	8471	broad.mit.edu	37	X	107979542	107979542	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107979542C>T	uc004eoc.2	-	1	66	c.33G>A	c.(31-33)GCG>GCA	p.A11A		NM_003604	NP_003595	O14654	IRS4_HUMAN	insulin receptor substrate 4	11						plasma membrane	insulin receptor binding|SH3/SH2 adaptor activity|signal transducer activity			ovary(4)|large_intestine(2)|lung(1)|breast(1)|skin(1)|pancreas(1)	10																		---	---	---	---
CAPN6	827	broad.mit.edu	37	X	110495724	110495724	+	Silent	SNP	C	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:110495724C>A	uc004epc.1	-	5	678	c.510G>T	c.(508-510)CTG>CTT	p.L170L	CAPN6_uc011msu.1_Intron	NM_014289	NP_055104	Q9Y6Q1	CAN6_HUMAN	calpain 6	170	Calpain catalytic.				microtubule bundle formation|proteolysis|regulation of cytoskeleton organization	perinuclear region of cytoplasm|spindle microtubule	calcium-dependent cysteine-type endopeptidase activity|microtubule binding			ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|lung(1)|skin(1)	6																		---	---	---	---
DCAF12L1	139170	broad.mit.edu	37	X	125686397	125686397	+	Silent	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:125686397G>A	uc004eul.2	-	1	446	c.195C>T	c.(193-195)CCC>CCT	p.P65P		NM_178470	NP_848565	Q5VU92	DC121_HUMAN	DDB1 and CUL4 associated factor 12-like 1	65										skin(3)|ovary(1)	4																		---	---	---	---
ACTRT1	139741	broad.mit.edu	37	X	127185702	127185702	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:127185702C>T	uc004eum.2	-	1	681	c.484G>A	c.(484-486)GTC>ATC	p.V162I		NM_138289	NP_612146	Q8TDG2	ACTT1_HUMAN	actin-related protein T1	162						cytoplasm|cytoskeleton				ovary(2)|central_nervous_system(2)|skin(1)	5																		---	---	---	---
OCRL	4952	broad.mit.edu	37	X	128682529	128682529	+	Intron	SNP	T	C	C			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:128682529T>C	uc004euq.2	+						OCRL_uc004eur.2_Intron	NM_000276	NP_000267			phosphatidylinositol polyphosphate 5-phosphatase						regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	clathrin-coated vesicle|cytosol|early endosome|Golgi stack|Golgi-associated vesicle	GTPase activator activity|phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity|protein binding			lung(2)|ovary(1)|kidney(1)	4																		---	---	---	---
GPC3	2719	broad.mit.edu	37	X	132887949	132887949	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:132887949G>A	uc004exe.1	-	3	782	c.592C>T	c.(592-594)CTC>TTC	p.L198F	GPC3_uc004exd.1_Missense_Mutation_p.L70F|GPC3_uc010nrn.1_Missense_Mutation_p.L198F|GPC3_uc011mvh.1_Missense_Mutation_p.L182F|GPC3_uc010nro.1_Missense_Mutation_p.L144F|GPC3_uc010nrp.1_Missense_Mutation_p.L70F	NM_004484	NP_004475	P51654	GPC3_HUMAN	glypican 3 isoform 2 precursor	198						extracellular space|integral to plasma membrane|proteinaceous extracellular matrix	heparan sulfate proteoglycan binding|peptidyl-dipeptidase inhibitor activity			lung(2)|prostate(1)|breast(1)|skin(1)	5	Acute lymphoblastic leukemia(192;0.000127)							T|D|Mis|N|F|S			Wilms tumour			Simpson-Golabi-Behmel_syndrome				---	---	---	---
MAGEA1	4100	broad.mit.edu	37	X	152482987	152482987	+	Silent	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:152482987C>T	uc004fhf.2	-	3	244	c.24G>A	c.(22-24)CTG>CTA	p.L8L		NM_004988	NP_004979	P43355	MAGA1_HUMAN	melanoma antigen family A, 1	8						cytoplasm|plasma membrane				central_nervous_system(7)|ovary(1)|lung(1)|breast(1)	10	all_hematologic(71;4.25e-06)|Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
DUSP9	1852	broad.mit.edu	37	X	152915111	152915111	+	Silent	SNP	G	A	A	rs137969779	byFrequency	TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:152915111G>A	uc004fhx.3	+	3	1002	c.798G>A	c.(796-798)TCG>TCA	p.S266S	DUSP9_uc004fhy.3_Silent_p.S266S	NM_001395	NP_001386	Q99956	DUS9_HUMAN	dual specificity phosphatase 9	266	Tyrosine-protein phosphatase.				inactivation of MAPK activity|JNK cascade	cytosol|endoplasmic reticulum|nucleus	MAP kinase tyrosine/serine/threonine phosphatase activity|protein tyrosine phosphatase activity			ovary(2)	2	all_hematologic(71;4.25e-06)|Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
HCFC1	3054	broad.mit.edu	37	X	153219639	153219639	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153219639C>T	uc004fjp.2	-	17	4739	c.4211G>A	c.(4210-4212)GGC>GAC	p.G1404D		NM_005334	NP_005325	P51610	HCFC1_HUMAN	host cell factor 1	1404					cell cycle|interspecies interaction between organisms|positive regulation of cell cycle|positive regulation of gene expression|protein stabilization|reactivation of latent virus|regulation of protein complex assembly|transcription from RNA polymerase II promoter	mitochondrion|MLL1 complex|MLL5-L complex|Set1C/COMPASS complex	chromatin binding|identical protein binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity			ovary(2)	2	all_cancers(53;6.23e-16)|all_epithelial(53;5.61e-10)|all_lung(58;3.99e-07)|Lung NSC(58;5.02e-07)|all_hematologic(71;4.25e-06)|Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
FLNA	2316	broad.mit.edu	37	X	153596065	153596065	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153596065C>T	uc004fkk.2	-	4	913	c.664G>A	c.(664-666)GTT>ATT	p.V222I	FLNA_uc010nuu.1_Missense_Mutation_p.V222I	NM_001110556	NP_001104026	P21333	FLNA_HUMAN	filamin A, alpha isoform 2	222	CH 2.|Actin-binding.				actin crosslink formation|actin cytoskeleton reorganization|cell junction assembly|cytoplasmic sequestering of protein|establishment of protein localization|inhibition of adenylate cyclase activity by dopamine receptor signaling pathway|negative regulation of protein catabolic process|negative regulation of sequence-specific DNA binding transcription factor activity|platelet activation|platelet degranulation|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of transcription factor import into nucleus|protein localization at cell surface|protein stabilization|receptor clustering	cell cortex|cytosol|extracellular region|nucleus|plasma membrane	actin filament binding|Fc-gamma receptor I complex binding|glycoprotein binding|GTP-Ral binding|protein homodimerization activity|Rac GTPase binding|signal transducer activity|transcription factor binding			breast(6)	6	all_cancers(53;3.7e-16)|all_epithelial(53;2.97e-10)|all_lung(58;1.84e-07)|Lung NSC(58;5.84e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)																	---	---	---	---
FAM50A	9130	broad.mit.edu	37	X	153677561	153677561	+	Intron	SNP	G	A	A			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153677561G>A	uc004fll.3	+							NM_004699	NP_004690			XAP-5 protein						spermatogenesis	nucleus				ovary(1)	1	all_cancers(53;5.05e-16)|all_epithelial(53;1.87e-10)|all_lung(58;1.84e-07)|Lung NSC(58;5.84e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)																	---	---	---	---
PLXNA3	55558	broad.mit.edu	37	X	153693146	153693146	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-4306-01	TCGA-CG-4306-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153693146C>T	uc004flm.2	+	10	2151	c.1978C>T	c.(1978-1980)CGC>TGC	p.R660C		NM_017514	NP_059984	P51805	PLXA3_HUMAN	plexin A3 precursor	660	Extracellular (Potential).				axon guidance	integral to membrane|intracellular|plasma membrane	transmembrane receptor activity			upper_aerodigestive_tract(1)|ovary(1)|central_nervous_system(1)	3	all_cancers(53;5.05e-16)|all_epithelial(53;1.87e-10)|all_lung(58;1.84e-07)|Lung NSC(58;5.84e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)																	---	---	---	---
