Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	validation_status	validation_method	validation_tumor_sample	validation_alt_allele
CCNL2	81669	broad.mit.edu	37	1	1333832	1333832	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1333832delA	uc001afi.2	-						CCNL2_uc001afg.1_5'Flank|CCNL2_uc001afh.2_Intron|CCNL2_uc001afj.2_Intron|CCNL2_uc001afk.2_Intron|LOC148413_uc001afm.2_5'Flank|LOC148413_uc001afn.1_5'Flank|LOC148413_uc009vkc.1_5'Flank|LOC148413_uc009vkd.2_5'Flank	NM_030937	NP_112199			cyclin L2 isoform A						regulation of cyclin-dependent protein kinase activity|regulation of transcription, DNA-dependent|RNA processing|transcription, DNA-dependent	nuclear speck	protein kinase binding			ovary(2)|central_nervous_system(1)	3	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;8.75e-19)|all_lung(118;2.3e-08)|Lung NSC(185;2.38e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Lung SC(97;0.128)		Epithelial(90;2.03e-36)|OV - Ovarian serous cystadenocarcinoma(86;4.17e-22)|Colorectal(212;0.000159)|COAD - Colon adenocarcinoma(227;0.000193)|Kidney(185;0.0023)|BRCA - Breast invasive adenocarcinoma(365;0.00465)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0342)|Lung(427;0.146)														---	---	---	---
GPR153	387509	broad.mit.edu	37	1	6315079	6315079	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6315079delG	uc001amp.1	-							NM_207370	NP_997253			G protein-coupled receptor 153							integral to membrane|plasma membrane	G-protein coupled receptor activity				0	Ovarian(185;0.0634)	all_cancers(23;8.07e-33)|all_epithelial(116;4.45e-18)|all_lung(118;1.09e-06)|all_neural(13;3.68e-06)|Lung NSC(185;1.52e-05)|all_hematologic(16;2.39e-05)|Acute lymphoblastic leukemia(12;0.000372)|Glioma(11;0.00127)|Renal(390;0.00188)|Colorectal(325;0.00342)|Breast(487;0.00475)|Hepatocellular(190;0.0218)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.15)		Epithelial(90;1.91e-37)|GBM - Glioblastoma multiforme(13;4.87e-29)|OV - Ovarian serous cystadenocarcinoma(86;3.03e-19)|Colorectal(212;1.33e-07)|COAD - Colon adenocarcinoma(227;1.36e-05)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000911)|BRCA - Breast invasive adenocarcinoma(365;0.00109)|STAD - Stomach adenocarcinoma(132;0.00313)|READ - Rectum adenocarcinoma(331;0.0642)|Lung(427;0.246)														---	---	---	---
MASP2	10747	broad.mit.edu	37	1	11090383	11090383	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:11090383delA	uc001aru.2	-							NM_006610	NP_006601			mannan-binding lectin serine protease 2 isoform						complement activation, classical pathway|complement activation, lectin pathway|proteolysis	extracellular region	calcium ion binding|calcium-dependent protein binding|serine-type endopeptidase activity			ovary(2)|pancreas(1)|skin(1)	4	Ovarian(185;0.249)	Lung NSC(185;1.04e-05)|all_lung(284;1.31e-05)|Renal(390;0.000147)|Colorectal(325;0.00205)|Breast(348;0.00262)|Hepatocellular(190;0.00913)|Ovarian(437;0.00965)|Myeloproliferative disorder(586;0.0255)	STAD - Stomach adenocarcinoma(5;0.071)	UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;3.12e-07)|COAD - Colon adenocarcinoma(227;7.07e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000293)|Kidney(185;0.000722)|KIRC - Kidney renal clear cell carcinoma(229;0.00258)|READ - Rectum adenocarcinoma(331;0.0487)|STAD - Stomach adenocarcinoma(313;0.192)														---	---	---	---
PLOD1	5351	broad.mit.edu	37	1	12010642	12010642	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12010642delC	uc001atm.2	+						PLOD1_uc010obb.1_Intron	NM_000302	NP_000293			lysyl hydroxylase 1 precursor						epidermis development|hydroxylysine biosynthetic process|protein modification process|response to hypoxia	rough endoplasmic reticulum membrane	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|procollagen-lysine 5-dioxygenase activity|protein homodimerization activity			ovary(2)|breast(1)	3	Ovarian(185;0.249)	Lung NSC(185;8.69e-05)|all_lung(284;9.87e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Ovarian(437;0.00965)|Hepatocellular(190;0.0202)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;6.06e-06)|COAD - Colon adenocarcinoma(227;0.000273)|BRCA - Breast invasive adenocarcinoma(304;0.000311)|Kidney(185;0.000809)|KIRC - Kidney renal clear cell carcinoma(229;0.00267)|STAD - Stomach adenocarcinoma(313;0.00743)|READ - Rectum adenocarcinoma(331;0.0649)	Minoxidil(DB00350)|Succinic acid(DB00139)|Vitamin C(DB00126)													---	---	---	---
Unknown	0	broad.mit.edu	37	1	13881920	13881920	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:13881920delA								PRAMEF17 (162856 upstream) : PDPN (28332 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	1	13882094	13882094	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:13882094delA								PRAMEF17 (163030 upstream) : PDPN (28158 downstream)																																			---	---	---	---
SPATA21	374955	broad.mit.edu	37	1	16729988	16729990	+	Intron	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16729988_16729990delTTT	uc001ayn.2	-						SPATA21_uc001ayl.1_Intron|SPATA21_uc010occ.1_Intron	NM_198546	NP_940948			spermatogenesis associated 21								calcium ion binding			ovary(2)|breast(1)	3		Colorectal(325;0.000147)|Renal(390;0.00145)|Lung NSC(340;0.00215)|Breast(348;0.00224)|all_lung(284;0.00351)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0646)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0182)|COAD - Colon adenocarcinoma(227;1.15e-05)|BRCA - Breast invasive adenocarcinoma(304;4.2e-05)|Kidney(64;0.000183)|KIRC - Kidney renal clear cell carcinoma(64;0.00269)|STAD - Stomach adenocarcinoma(313;0.0122)|READ - Rectum adenocarcinoma(331;0.0651)														---	---	---	---
NECAP2	55707	broad.mit.edu	37	1	16785155	16785156	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16785155_16785156delAA	uc001ayo.2	+						NECAP2_uc001ayp.3_Intron|NECAP2_uc010ocd.1_Intron|NECAP2_uc001ayq.2_Intron	NM_018090	NP_060560			NECAP endocytosis associated 2 isoform 1						endocytosis|protein transport	clathrin vesicle coat|coated pit|plasma membrane					0		Colorectal(325;0.000147)|Renal(390;0.00145)|Lung NSC(340;0.00215)|Breast(348;0.00224)|all_lung(284;0.00351)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0646)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0182)|COAD - Colon adenocarcinoma(227;1.13e-05)|BRCA - Breast invasive adenocarcinoma(304;4.13e-05)|Kidney(64;0.000181)|KIRC - Kidney renal clear cell carcinoma(64;0.00268)|STAD - Stomach adenocarcinoma(196;0.012)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
RCC2	55920	broad.mit.edu	37	1	17735381	17735381	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17735381delA	uc001bal.2	-	12					RCC2_uc001bam.2_3'UTR	NM_001136204	NP_001129676			regulator of chromosome condensation 2						cell division|mitotic prometaphase	chromosome, centromeric region|cytosol|microtubule|nucleolus|spindle					0		Colorectal(325;0.000147)|Breast(348;0.00122)|Renal(390;0.00145)|all_lung(284;0.0054)|Lung NSC(340;0.00566)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0439)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00492)|BRCA - Breast invasive adenocarcinoma(304;7.69e-06)|COAD - Colon adenocarcinoma(227;1.19e-05)|Kidney(64;0.000189)|KIRC - Kidney renal clear cell carcinoma(64;0.00273)|STAD - Stomach adenocarcinoma(196;0.0135)|READ - Rectum adenocarcinoma(331;0.0656)|Lung(427;0.19)														---	---	---	---
EIF4G3	8672	broad.mit.edu	37	1	21299378	21299381	+	Intron	DEL	AAAA	-	-	rs76449388		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:21299378_21299381delAAAA	uc001bec.2	-						EIF4G3_uc010odi.1_Intron|EIF4G3_uc010odj.1_Intron|EIF4G3_uc009vpz.2_Intron|EIF4G3_uc001bed.2_Intron|EIF4G3_uc001bef.2_Intron|EIF4G3_uc001bee.2_Intron|EIF4G3_uc001beg.2_Intron|EIF4G3_uc010odk.1_Intron|EIF4G3_uc001beh.2_Intron	NM_003760	NP_003751			eukaryotic translation initiation factor 4						interspecies interaction between organisms|regulation of translational initiation|RNA metabolic process	eukaryotic translation initiation factor 4F complex	protein binding|RNA cap binding|translation initiation factor activity			skin(1)	1		all_lung(284;2.61e-06)|Lung NSC(340;2.81e-06)|Colorectal(325;3.46e-05)|Renal(390;9.67e-05)|Breast(348;0.00149)|Ovarian(437;0.00338)|Myeloproliferative disorder(586;0.0256)		UCEC - Uterine corpus endometrioid carcinoma (279;0.023)|COAD - Colon adenocarcinoma(152;5.42e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000327)|GBM - Glioblastoma multiforme(114;0.000696)|Kidney(64;0.0018)|STAD - Stomach adenocarcinoma(196;0.00644)|KIRC - Kidney renal clear cell carcinoma(64;0.0185)|READ - Rectum adenocarcinoma(331;0.124)|Lung(427;0.191)														---	---	---	---
STMN1	3925	broad.mit.edu	37	1	26230429	26230429	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:26230429delT	uc001bkz.2	-						STMN1_uc010oev.1_Intron|STMN1_uc001bla.2_Intron|STMN1_uc001blb.2_Intron|STMN1_uc001blc.2_Intron	NM_203401	NP_981946			stathmin 1 isoform a						cell differentiation|intracellular signal transduction|microtubule depolymerization|mitotic spindle organization|nervous system development|response to virus	cytoplasm|microtubule	signal transducer activity|tubulin binding				0		Colorectal(325;3.46e-05)|Lung NSC(340;0.000163)|all_lung(284;0.000234)|Renal(390;0.0007)|Ovarian(437;0.00473)|Breast(348;0.0155)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0505)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|OV - Ovarian serous cystadenocarcinoma(117;1.85e-25)|Colorectal(126;2.96e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.000716)|BRCA - Breast invasive adenocarcinoma(304;0.000946)|STAD - Stomach adenocarcinoma(196;0.00151)|GBM - Glioblastoma multiforme(114;0.013)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
ARID1A	8289	broad.mit.edu	37	1	27087188	27087189	+	Intron	DEL	AT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:27087188_27087189delAT	uc001bmv.1	+						ARID1A_uc001bmt.1_Intron|ARID1A_uc001bmu.1_Intron|ARID1A_uc001bmw.1_Intron	NM_006015	NP_006006			AT rich interactive domain 1A isoform a						androgen receptor signaling pathway|chromatin-mediated maintenance of transcription|estrogen receptor signaling pathway|glucocorticoid receptor signaling pathway|nervous system development|nucleosome mobilization|transcription, DNA-dependent	nBAF complex|npBAF complex|SWI/SNF complex	DNA binding|protein binding			ovary(124)|pancreas(5)|central_nervous_system(3)|endometrium(3)|kidney(3)|skin(2)|upper_aerodigestive_tract(1)|lung(1)	142		all_cancers(24;6.36e-27)|all_epithelial(13;5.93e-24)|Colorectal(325;3.46e-05)|all_lung(284;4.76e-05)|Lung NSC(340;5.83e-05)|Breast(348;9.7e-05)|Renal(390;0.0007)|Ovarian(437;0.00473)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0381)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|all cancers(4;2.61e-56)|Epithelial(14;7.53e-55)|OV - Ovarian serous cystadenocarcinoma(117;4.5e-30)|Colorectal(126;2.07e-09)|COAD - Colon adenocarcinoma(152;4.29e-07)|BRCA - Breast invasive adenocarcinoma(304;4.13e-05)|STAD - Stomach adenocarcinoma(196;0.000279)|KIRC - Kidney renal clear cell carcinoma(1967;0.000794)|GBM - Glioblastoma multiforme(114;0.0132)|READ - Rectum adenocarcinoma(331;0.0469)|Lung(427;0.167)|LUSC - Lung squamous cell carcinoma(448;0.242)				Mis|N|F|S|D		clear cell ovarian carcinoma|RCC								---	---	---	---
FGR	2268	broad.mit.edu	37	1	27948286	27948286	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:27948286delC	uc001boj.2	-						FGR_uc001bok.2_Intron|FGR_uc001bol.2_Intron|FGR_uc001bom.2_Intron	NM_005248	NP_005239			proto-oncogene tyrosine-protein kinase FGR						platelet activation|response to virus	cytosol	ATP binding|non-membrane spanning protein tyrosine kinase activity			skin(2)	2		all_lung(284;2.05e-05)|Colorectal(325;3.46e-05)|Lung NSC(340;3.67e-05)|Renal(390;0.00121)|Breast(348;0.0021)|Ovarian(437;0.00503)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0381)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0416)|OV - Ovarian serous cystadenocarcinoma(117;1.25e-24)|Colorectal(126;1.24e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|BRCA - Breast invasive adenocarcinoma(304;0.00244)|KIRC - Kidney renal clear cell carcinoma(1967;0.0027)|STAD - Stomach adenocarcinoma(196;0.00303)|READ - Rectum adenocarcinoma(331;0.0419)														---	---	---	---
DNAJC8	22826	broad.mit.edu	37	1	28536713	28536713	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:28536713delA	uc001bpn.2	-						DNAJC8_uc001bpo.2_Intron	NM_014280	NP_055095			DnaJ (Hsp40) homolog, subfamily C, member 8						nuclear mRNA splicing, via spliceosome|protein folding	nucleoplasm	heat shock protein binding|unfolded protein binding				0		Colorectal(325;3.46e-05)|Lung NSC(340;4.08e-05)|all_lung(284;4.29e-05)|Renal(390;0.00121)|Breast(348;0.00345)|Ovarian(437;0.0105)|all_neural(195;0.0208)|Myeloproliferative disorder(586;0.0255)		OV - Ovarian serous cystadenocarcinoma(117;2.81e-22)|Colorectal(126;2.99e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.00275)|BRCA - Breast invasive adenocarcinoma(304;0.0059)|STAD - Stomach adenocarcinoma(196;0.00671)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
PHACTR4	65979	broad.mit.edu	37	1	28786929	28786929	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:28786929delA	uc001bpw.2	+						PHACTR4_uc001bpu.2_Intron|PHACTR4_uc001bpv.1_Intron|PHACTR4_uc001bpx.2_Intron|PHACTR4_uc001bpy.2_Intron	NM_001048183	NP_001041648			phosphatase and actin regulator 4 isoform 1								actin binding|protein phosphatase inhibitor activity				0		Colorectal(325;3.46e-05)|Lung NSC(340;4.37e-05)|all_lung(284;7.01e-05)|Renal(390;0.00121)|Breast(348;0.00345)|all_neural(195;0.0208)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0261)		OV - Ovarian serous cystadenocarcinoma(117;1.35e-21)|Colorectal(126;2.96e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.00273)|STAD - Stomach adenocarcinoma(196;0.00299)|BRCA - Breast invasive adenocarcinoma(304;0.0144)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
PHACTR4	65979	broad.mit.edu	37	1	28823268	28823268	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:28823268delT	uc001bpw.2	+	14					PHACTR4_uc001bpv.1_RNA|PHACTR4_uc001bpx.2_3'UTR|PHACTR4_uc001bpy.2_3'UTR|PHACTR4_uc001bpz.2_RNA	NM_001048183	NP_001041648			phosphatase and actin regulator 4 isoform 1								actin binding|protein phosphatase inhibitor activity				0		Colorectal(325;3.46e-05)|Lung NSC(340;4.37e-05)|all_lung(284;7.01e-05)|Renal(390;0.00121)|Breast(348;0.00345)|all_neural(195;0.0208)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0261)		OV - Ovarian serous cystadenocarcinoma(117;1.35e-21)|Colorectal(126;2.96e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.00273)|STAD - Stomach adenocarcinoma(196;0.00299)|BRCA - Breast invasive adenocarcinoma(304;0.0144)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
EPB41	2035	broad.mit.edu	37	1	29435711	29435711	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:29435711delA	uc001brm.1	+						EPB41_uc001brg.1_Intron|EPB41_uc001brh.1_Intron|EPB41_uc001bri.1_Intron|EPB41_uc001brj.1_Intron|EPB41_uc001brl.1_Intron|EPB41_uc009vtl.1_Intron|EPB41_uc009vtm.1_Intron|EPB41_uc009vtn.1_Intron	NM_203342	NP_976217			erythrocyte membrane protein band 4.1						blood circulation|cortical actin cytoskeleton organization|positive regulation of protein binding	extrinsic to membrane|Golgi apparatus|nucleus|plasma membrane|protein complex|spectrin|spectrin-associated cytoskeleton	1-phosphatidylinositol binding|actin binding|spectrin binding|structural constituent of cytoskeleton			ovary(1)	1		Colorectal(325;3.46e-05)|Prostate(1639;0.000244)|Lung NSC(340;0.00328)|all_lung(284;0.00412)|Breast(348;0.00765)|all_neural(195;0.0199)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)|Medulloblastoma(700;0.123)		Colorectal(126;3.12e-07)|COAD - Colon adenocarcinoma(152;1.21e-05)|STAD - Stomach adenocarcinoma(196;0.00395)|KIRC - Kidney renal clear cell carcinoma(1967;0.0249)|BRCA - Breast invasive adenocarcinoma(304;0.0289)|READ - Rectum adenocarcinoma(331;0.0757)														---	---	---	---
BSDC1	55108	broad.mit.edu	37	1	32834302	32834302	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:32834302delT	uc001bvh.3	-						BSDC1_uc010ohg.1_Intron|BSDC1_uc010ohh.1_Intron|BSDC1_uc010ohi.1_Intron|BSDC1_uc001bvg.3_Intron|BSDC1_uc001bvj.2_Intron|BSDC1_uc001bvi.2_Intron	NM_018045	NP_060515			BSD domain containing 1 isoform b								protein binding			upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	3		Myeloproliferative disorder(586;0.0393)|all_neural(195;0.186)																---	---	---	---
SFPQ	6421	broad.mit.edu	37	1	35656888	35656888	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35656888delA	uc001bys.2	-						SFPQ_uc001byr.2_5'Flank	NM_005066	NP_005057			splicing factor proline/glutamine rich						alternative nuclear mRNA splicing, via spliceosome|DNA recombination|DNA repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear matrix|paraspeckles	DNA binding|nucleotide binding|protein binding|protein binding|RNA binding		SFPQ/TFE3(6)	kidney(4)|soft_tissue(2)|ovary(1)|skin(1)	8		Myeloproliferative disorder(586;0.0393)|all_neural(195;0.196)						T	TFE3	papillary renal cell								---	---	---	---
EIF2C4	192670	broad.mit.edu	37	1	36316704	36316704	+	Intron	DEL	A	-	-	rs148523368	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36316704delA	uc001bzj.1	+							NM_017629	NP_060099			eukaryotic translation initiation factor 2C, 4						mRNA catabolic process|negative regulation of translation involved in gene silencing by miRNA	cytoplasmic mRNA processing body|cytosol	protein binding|RNA binding			ovary(1)	1		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---
EIF2C1	26523	broad.mit.edu	37	1	36358976	36358976	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36358976delA	uc001bzl.2	+						EIF2C1_uc001bzk.2_Intron|EIF2C1_uc009vuy.2_5'Flank	NM_012199	NP_036331			eukaryotic translation initiation factor 2C, 1						negative regulation of translation involved in gene silencing by miRNA|nuclear-transcribed mRNA catabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol|micro-ribonucleoprotein complex|polysome	protein binding|RNA binding			ovary(2)|skin(1)	3		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)																---	---	---	---
MTF1	4520	broad.mit.edu	37	1	38301123	38301123	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:38301123delT	uc001cce.1	-						MTF1_uc009vvj.1_Intron	NM_005955	NP_005946			metal-regulatory transcription factor 1							nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|zinc ion binding			ovary(1)|pancreas(1)	2	Acute lymphoblastic leukemia(166;0.074)|all_hematologic(146;0.197)	Myeloproliferative disorder(586;0.0255)																---	---	---	---
MACF1	23499	broad.mit.edu	37	1	39759450	39759451	+	Intron	DEL	GA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39759450_39759451delGA	uc010ois.1	+						MACF1_uc001cda.1_Intron	NM_012090	NP_036222			microfilament and actin filament cross-linker						cell cycle arrest|Golgi to plasma membrane protein transport|positive regulation of Wnt receptor signaling pathway|regulation of epithelial cell migration|regulation of focal adhesion assembly|regulation of microtubule-based process|Wnt receptor signaling pathway|wound healing	Golgi apparatus|microtubule|ruffle membrane	actin filament binding|ATPase activity|calcium ion binding|microtubule binding			ovary(8)|breast(3)|central_nervous_system(3)|skin(2)	16	Lung NSC(20;5.57e-06)|Ovarian(52;0.00769)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;7.78e-19)|Epithelial(16;1.73e-17)|all cancers(16;2.49e-16)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)															---	---	---	---
MACF1	23499	broad.mit.edu	37	1	39792848	39792848	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39792848delT	uc010ois.1	+						MACF1_uc001cda.1_Intron|MACF1_uc001cdc.1_Intron|MACF1_uc001cdb.1_Intron	NM_012090	NP_036222			microfilament and actin filament cross-linker						cell cycle arrest|Golgi to plasma membrane protein transport|positive regulation of Wnt receptor signaling pathway|regulation of epithelial cell migration|regulation of focal adhesion assembly|regulation of microtubule-based process|Wnt receptor signaling pathway|wound healing	Golgi apparatus|microtubule|ruffle membrane	actin filament binding|ATPase activity|calcium ion binding|microtubule binding			ovary(8)|breast(3)|central_nervous_system(3)|skin(2)	16	Lung NSC(20;5.57e-06)|Ovarian(52;0.00769)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;7.78e-19)|Epithelial(16;1.73e-17)|all cancers(16;2.49e-16)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)															---	---	---	---
MFSD2A	84879	broad.mit.edu	37	1	40429116	40429116	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40429116delA	uc001cev.2	+						MFSD2A_uc010ojb.1_Intron|MFSD2A_uc001ceu.2_Intron|MFSD2A_uc010ojc.1_Intron|MFSD2A_uc009vvy.2_Intron	NM_001136493	NP_001129965			major facilitator superfamily domain containing						transmembrane transport	endoplasmic reticulum membrane|integral to membrane				ovary(1)|pancreas(1)	2																		---	---	---	---
KIAA0467	23334	broad.mit.edu	37	1	43897200	43897200	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43897200delC	uc001cjk.1	+							NM_015284	NP_056099			hypothetical protein LOC23334							peroxisome					0	all_hematologic(146;0.0958)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0505)																---	---	---	---
KIF2C	11004	broad.mit.edu	37	1	45219383	45219383	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45219383delT	uc001cmg.3	+						KIF2C_uc010olb.1_Intron|KIF2C_uc010olc.1_Intron|KIF2C_uc001cmh.3_Intron	NM_006845	NP_006836			kinesin family member 2C						blood coagulation|cell division|cell proliferation|chromosome segregation|establishment or maintenance of microtubule cytoskeleton polarity|microtubule depolymerization|microtubule-based movement|mitotic prometaphase|regulation of chromosome segregation	condensed chromosome kinetochore|cytosol|kinesin complex|microtubule|nucleus	ATP binding|centromeric DNA binding|microtubule motor activity|microtubule plus-end binding			ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---
TOE1	114034	broad.mit.edu	37	1	45807064	45807064	+	Intron	DEL	G	-	-	rs3811432	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45807064delG	uc009vxq.2	+						MUTYH_uc001cnf.2_5'Flank|MUTYH_uc009vxo.2_5'Flank|MUTYH_uc001cng.2_5'Flank|MUTYH_uc001cnj.2_5'Flank|MUTYH_uc001cni.2_5'Flank|MUTYH_uc001cnh.2_5'Flank|MUTYH_uc001cno.2_5'Flank|MUTYH_uc001cnk.2_5'Flank|MUTYH_uc010oll.1_5'Flank|MUTYH_uc001cnm.2_5'Flank|MUTYH_uc001cnl.2_5'Flank|MUTYH_uc009vxp.2_5'Flank|MUTYH_uc001cnn.2_5'Flank|TOE1_uc001cnq.3_Intron|TOE1_uc010olm.1_Intron|TOE1_uc010oln.1_Intron|TOE1_uc001cnr.3_Intron	NM_025077	NP_079353			target of EGR1, member 1 (nuclear)							nuclear speck|nucleolus	nucleic acid binding|zinc ion binding			central_nervous_system(1)	1	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---
PIK3R3	8503	broad.mit.edu	37	1	46531603	46531604	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:46531603_46531604insA	uc001cpb.3	-						PIK3R3_uc009vyb.2_Intron|PIK3R3_uc009vyc.2_Intron|PIK3R3_uc001cpc.3_Intron|PIK3R3_uc010olw.1_Intron	NM_003629	NP_003620			phosphoinositide-3-kinase, regulatory subunit 3						insulin receptor signaling pathway|platelet activation|T cell costimulation		1-phosphatidylinositol-3-kinase activity|protein binding				0	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---
Unknown	0	broad.mit.edu	37	1	46782478	46782478	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:46782478delT								UQCRH (33 upstream) : NSUN4 (23912 downstream)																																			---	---	---	---
NRD1	4898	broad.mit.edu	37	1	52301764	52301764	+	Intron	DEL	A	-	-	rs115629064	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52301764delA	uc001ctc.3	-						NRD1_uc009vzb.2_Intron|NRD1_uc001ctd.3_Intron|NRD1_uc001cte.2_Intron|NRD1_uc001ctf.2_Intron|NRD1_uc010ong.1_Intron|NRD1_uc009vzc.1_Intron	NM_002525	NP_002516			nardilysin isoform a						cell migration|cell proliferation|neuromuscular junction development|positive regulation of membrane protein ectodomain proteolysis|proteolysis|regulation of endopeptidase activity	cell surface|cytosol	epidermal growth factor binding|metalloendopeptidase activity|zinc ion binding				0																		---	---	---	---
ZCCHC11	23318	broad.mit.edu	37	1	52923972	52923972	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52923972delA	uc001ctx.2	-						ZCCHC11_uc001cty.2_Intron|ZCCHC11_uc001ctz.2_Intron|ZCCHC11_uc009vze.1_Intron|ZCCHC11_uc009vzf.1_Intron|ZCCHC11_uc001cua.1_Intron	NM_015269	NP_056084			zinc finger, CCHC domain containing 11 isoform						miRNA catabolic process|pre-miRNA processing|RNA 3'-end processing|stem cell maintenance	cytoplasm|nucleolus	nucleic acid binding|protein binding|protein binding|RNA uridylyltransferase activity|zinc ion binding			ovary(2)|skin(1)	3																		---	---	---	---
ZCCHC11	23318	broad.mit.edu	37	1	52937901	52937901	+	Intron	DEL	A	-	-	rs78098408		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52937901delA	uc001ctx.2	-						ZCCHC11_uc001cty.2_Intron|ZCCHC11_uc001ctz.2_Intron|ZCCHC11_uc009vze.1_Intron|ZCCHC11_uc009vzf.1_Intron|ZCCHC11_uc001cub.2_Intron	NM_015269	NP_056084			zinc finger, CCHC domain containing 11 isoform						miRNA catabolic process|pre-miRNA processing|RNA 3'-end processing|stem cell maintenance	cytoplasm|nucleolus	nucleic acid binding|protein binding|protein binding|RNA uridylyltransferase activity|zinc ion binding			ovary(2)|skin(1)	3																		---	---	---	---
GLIS1	148979	broad.mit.edu	37	1	53975643	53975644	+	Frame_Shift_Ins	INS	-	G	G	rs149623150	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:53975643_53975644insG	uc001cvr.1	-	8	1982_1983	c.1415_1416insC	c.(1414-1416)CCGfs	p.P472fs		NM_147193	NP_671726	Q8NBF1	GLIS1_HUMAN	GLIS family zinc finger 1	472	Pro-rich.				negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	nucleus	DNA binding|zinc ion binding			skin(1)	1																		---	---	---	---
TMEM59	9528	broad.mit.edu	37	1	54498074	54498074	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:54498074delA	uc001cwp.2	-						TMEM59_uc001cwn.2_Intron|TMEM59_uc001cwo.2_Intron|TMEM59_uc001cwq.2_Intron|TMEM59_uc001cwr.2_Intron	NM_004872	NP_004863			thymic dendritic cell-derived factor 1							Golgi membrane|integral to membrane					0																		---	---	---	---
TTC4	7268	broad.mit.edu	37	1	55183394	55183395	+	Intron	INS	-	GA	GA			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55183394_55183395insGA	uc001cxx.3	+						C1orf175_uc001cxq.2_Intron|TTC4_uc001cxw.3_Intron|TTC4_uc001cxv.2_Intron	NM_004623	NP_004614			tetratricopeptide repeat domain 4								binding				0																		---	---	---	---
PRKAA2	5563	broad.mit.edu	37	1	57159326	57159326	+	Intron	DEL	A	-	-	rs72195100		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57159326delA	uc001cyk.3	+							NM_006252	NP_006243			AMP-activated protein kinase alpha 2 catalytic						carnitine shuttle|cell cycle arrest|cholesterol biosynthetic process|energy reserve metabolic process|fatty acid biosynthetic process|insulin receptor signaling pathway|regulation of fatty acid biosynthetic process|regulation of fatty acid oxidation	cytosol|nucleoplasm	ATP binding|metal ion binding			breast(4)|ovary(1)|stomach(1)	6																		---	---	---	---
FGGY	55277	broad.mit.edu	37	1	59977913	59977913	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:59977913delA	uc001czi.3	+						FGGY_uc001czg.2_Intron|FGGY_uc001czh.2_Intron|FGGY_uc009wac.2_Intron|FGGY_uc001czj.3_Intron|FGGY_uc001czk.3_Intron|FGGY_uc001czl.3_Intron	NM_018291	NP_060761			FGGY carbohydrate kinase domain containing						carbohydrate metabolic process|cell death|neuron homeostasis		kinase activity|phosphotransferase activity, alcohol group as acceptor			ovary(1)	1	all_cancers(7;7.36e-05)																	---	---	---	---
TM2D1	83941	broad.mit.edu	37	1	62175140	62175140	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:62175140delT	uc001czz.1	-							NM_032027	NP_114416			beta-amyloid binding protein precursor						apoptosis					ovary(1)	1																		---	---	---	---
DOCK7	85440	broad.mit.edu	37	1	62979269	62979269	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:62979269delT	uc001daq.2	-	33	4162	c.4128delA	c.(4126-4128)AAAfs	p.K1376fs	DOCK7_uc001dan.2_Frame_Shift_Del_p.K1237fs|DOCK7_uc001dao.2_Frame_Shift_Del_p.K1237fs|DOCK7_uc001dap.2_Frame_Shift_Del_p.K1345fs|DOCK7_uc001dam.2_Frame_Shift_Del_p.K556fs|DOCK7_uc010oov.1_Frame_Shift_Del_p.K115fs	NM_033407	NP_212132	Q96N67	DOCK7_HUMAN	dedicator of cytokinesis 7	1376					activation of Rac GTPase activity|axonogenesis|establishment of neuroblast polarity|microtubule cytoskeleton organization|positive regulation of peptidyl-serine phosphorylation	axon|basal part of cell|growth cone	GTP binding|guanyl-nucleotide exchange factor activity|Rac GTPase binding			ovary(2)	2																		---	---	---	---
CACHD1	57685	broad.mit.edu	37	1	65156819	65156819	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:65156819delA	uc001dbo.1	+						CACHD1_uc001dbp.1_Intron|CACHD1_uc001dbq.1_Intron|CACHD1_uc010opa.1_Intron	NM_020925	NP_065976			cache domain containing 1						calcium ion transport	integral to membrane				ovary(2)	2																		---	---	---	---
LEPR	3953	broad.mit.edu	37	1	66037974	66037986	+	Intron	DEL	TTTTTTTTTTTTT	-	-	rs71830879	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:66037974_66037986delTTTTTTTTTTTTT	uc001dci.2	+						LEPR_uc001dcg.2_Intron|LEPR_uc001dch.2_Intron|LEPR_uc009waq.2_Intron|LEPR_uc001dcj.2_Intron|LEPR_uc001dck.2_Intron	NM_002303	NP_002294			leptin receptor isoform 1						energy reserve metabolic process|multicellular organismal development	extracellular region|integral to membrane|plasma membrane	cytokine receptor activity			skin(1)	1				OV - Ovarian serous cystadenocarcinoma(397;0.00722)|KIRC - Kidney renal clear cell carcinoma(1967;0.094)														---	---	---	---
SGIP1	84251	broad.mit.edu	37	1	67099769	67099769	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67099769delA	uc001dcr.2	+							NM_032291	NP_115667			SH3-domain GRB2-like (endophilin) interacting						positive regulation of energy homeostasis|positive regulation of feeding behavior|positive regulation of receptor-mediated endocytosis|response to dietary excess	AP-2 adaptor complex	microtubule binding|phospholipid binding|SH3 domain binding			ovary(3)	3																		---	---	---	---
SGIP1	84251	broad.mit.edu	37	1	67101740	67101740	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67101740delA	uc001dcr.2	+							NM_032291	NP_115667			SH3-domain GRB2-like (endophilin) interacting						positive regulation of energy homeostasis|positive regulation of feeding behavior|positive regulation of receptor-mediated endocytosis|response to dietary excess	AP-2 adaptor complex	microtubule binding|phospholipid binding|SH3 domain binding			ovary(3)	3																		---	---	---	---
WDR78	79819	broad.mit.edu	37	1	67313153	67313153	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67313153delT	uc001dcx.2	-						WDR78_uc001dcy.2_Intron|WDR78_uc009waw.2_Intron|WDR78_uc009wax.2_Intron	NM_024763	NP_079039			WD repeat domain 78 isoform 1											ovary(2)	2																		---	---	---	---
RPE65	6121	broad.mit.edu	37	1	68895274	68895274	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:68895274delT	uc001dei.1	-	14						NM_000329	NP_000320			retinal pigment epithelium-specific protein						visual perception	cytoplasm|plasma membrane	all-trans-retinyl-palmitate hydrolase activity|metal ion binding|retinol isomerase activity			ovary(1)	1																		---	---	---	---
DEPDC1	55635	broad.mit.edu	37	1	68955440	68955440	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:68955440delC	uc001dem.3	-						DEPDC1_uc001dek.3_Intron|DEPDC1_uc001del.3_Intron	NM_001114120	NP_001107592			DEP domain containing 1 isoform a						intracellular signal transduction|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	transcriptional repressor complex	GTPase activator activity|protein binding				0				OV - Ovarian serous cystadenocarcinoma(397;7.21e-36)														---	---	---	---
ANKRD13C	81573	broad.mit.edu	37	1	70780919	70780919	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70780919delT	uc001dex.3	-						ANKRD13C_uc009wbk.2_Intron	NM_030816	NP_110443			ankyrin repeat domain 13C						protein retention in ER lumen|regulation of anoikis|regulation of receptor biosynthetic process	endoplasmic reticulum membrane|perinuclear region of cytoplasm	receptor binding				0																		---	---	---	---
CTH	1491	broad.mit.edu	37	1	70896232	70896232	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70896232delT	uc001dfd.2	+						CTH_uc009wbl.1_Intron|CTH_uc001dfe.2_Intron|CTH_uc010oqq.1_Intron	NM_001902	NP_001893			cystathionase isoform 1						cysteine biosynthetic process|hydrogen sulfide biosynthetic process|protein homotetramerization|protein-pyridoxal-5-phosphate linkage via peptidyl-N6-pyridoxal phosphate-L-lysine	cytoplasm|nucleus	cystathionine gamma-lyase activity|L-cysteine desulfhydrase activity|pyridoxal phosphate binding			lung(1)	1					L-Cysteine(DB00151)|Pyridoxal Phosphate(DB00114)													---	---	---	---
C1orf173	127254	broad.mit.edu	37	1	75139070	75139071	+	Intron	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:75139070_75139071insC	uc001dgg.2	-							NM_001002912	NP_001002912			hypothetical protein LOC127254											ovary(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	5																		---	---	---	---
USP33	23032	broad.mit.edu	37	1	78163392	78163392	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:78163392delA	uc001dht.2	-						USP33_uc009wca.1_RNA|USP33_uc001dhs.2_Intron|USP33_uc001dhu.2_Intron	NM_015017	NP_055832			ubiquitin specific protease 33 isoform 1						axon guidance|cell migration|endocytosis|protein K48-linked deubiquitination|protein K63-linked deubiquitination|regulation of G-protein coupled receptor protein signaling pathway|ubiquitin-dependent protein catabolic process	perinuclear region of cytoplasm|VCB complex	cysteine-type endopeptidase activity|G-protein-coupled receptor binding|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity|zinc ion binding			lung(2)|ovary(1)	3																		---	---	---	---
DDAH1	23576	broad.mit.edu	37	1	85815856	85815856	+	Intron	DEL	T	-	-	rs72424090		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85815856delT	uc001dlb.2	-						DDAH1_uc001dlc.2_Intron|uc001dla.1_Intron|DDAH1_uc010osb.1_Intron|DDAH1_uc009wco.2_Intron	NM_012137	NP_036269			dimethylarginine dimethylaminohydrolase 1						arginine catabolic process|citrulline metabolic process|nitric oxide mediated signal transduction		dimethylargininase activity|metal ion binding				0				all cancers(265;0.0318)|Epithelial(280;0.0657)	L-Citrulline(DB00155)													---	---	---	---
HS2ST1	9653	broad.mit.edu	37	1	87563396	87563396	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:87563396delA	uc010osk.1	+						HS2ST1_uc001dmc.3_Intron|LOC339524_uc001dme.1_Intron	NM_012262	NP_036394			heparan sulfate 2-O-sulfotransferase 1 isoform							Golgi membrane|integral to membrane				central_nervous_system(1)	1		Lung NSC(277;0.153)		all cancers(265;0.00699)|Epithelial(280;0.0261)														---	---	---	---
GBP4	115361	broad.mit.edu	37	1	89655543	89655543	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:89655543delA	uc001dnb.2	-							NM_052941	NP_443173			guanylate binding protein 4							cytoplasm	GTP binding|GTPase activity				0				all cancers(265;0.00723)|Epithelial(280;0.0291)														---	---	---	---
GBP5	115362	broad.mit.edu	37	1	89734854	89734854	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:89734854delA	uc001dnc.2	-						GBP5_uc001dnd.2_Intron|GBP5_uc001dne.1_Intron	NM_052942	NP_443174			guanylate-binding protein 5							plasma membrane	GTP binding|GTPase activity			ovary(1)	1				all cancers(265;0.00784)|Epithelial(280;0.0286)														---	---	---	---
GBP5	115362	broad.mit.edu	37	1	89735377	89735377	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:89735377delA	uc001dnc.2	-						GBP5_uc001dnd.2_Intron|GBP5_uc001dne.1_5'UTR	NM_052942	NP_443174			guanylate-binding protein 5							plasma membrane	GTP binding|GTPase activity			ovary(1)	1				all cancers(265;0.00784)|Epithelial(280;0.0286)														---	---	---	---
LRRC8D	55144	broad.mit.edu	37	1	90401406	90401406	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:90401406delT	uc001dnm.2	+	3					LRRC8D_uc001dnn.2_3'UTR	NM_001134479	NP_001127951			leucine rich repeat containing 8 family, member							integral to membrane	protein binding			ovary(2)	2		all_lung(203;0.0894)|Lung NSC(277;0.227)		all cancers(265;0.0109)|Epithelial(280;0.0427)														---	---	---	---
BTBD8	284697	broad.mit.edu	37	1	92568324	92568324	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:92568324delT	uc001doo.2	+						BTBD8_uc010otc.1_Intron	NM_183242	NP_899065			BTB (POZ) domain containing 8							nucleus				ovary(1)	1		all_lung(203;0.0484)|Lung NSC(277;0.126)|Glioma(108;0.222)		all cancers(265;0.0153)|Epithelial(280;0.0982)														---	---	---	---
CCDC18	343099	broad.mit.edu	37	1	93722149	93722149	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:93722149delT	uc001dpq.2	+						CCDC18_uc001dpr.1_Intron	NM_206886	NP_996769			sarcoma antigen NY-SAR-41											ovary(2)|breast(2)|pancreas(1)	5		all_lung(203;0.00196)|Lung NSC(277;0.00903)|Melanoma(281;0.099)|all_neural(321;0.185)|Glioma(108;0.203)		all cancers(265;0.00166)|GBM - Glioblastoma multiforme(16;0.00551)|Epithelial(280;0.0967)														---	---	---	---
Unknown	0	broad.mit.edu	37	1	96884031	96884031	+	IGR	DEL	A	-	-	rs77096023		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:96884031delA								None (None upstream) : PTBP2 (303144 downstream)																																			---	---	---	---
DPH5	51611	broad.mit.edu	37	1	101458413	101458413	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:101458413delT	uc001dts.2	-						DPH5_uc001dtr.2_Intron|DPH5_uc001dtq.2_Intron|DPH5_uc001dtt.2_Intron|DPH5_uc001dtu.2_Intron|DPH5_uc001dtv.2_Intron|DPH5_uc001dtw.2_Intron|DPH5_uc001dtx.2_Intron|DPH5_uc001dty.2_Intron|DPH5_uc001dtz.2_Intron	NM_015958	NP_057042			diphthine synthase isoform a						peptidyl-diphthamide biosynthetic process from peptidyl-histidine		diphthine synthase activity				0		all_epithelial(167;3.1e-06)|all_lung(203;0.000414)|Lung NSC(277;0.000946)		Epithelial(280;0.0385)|all cancers(265;0.043)|COAD - Colon adenocarcinoma(174;0.151)|Colorectal(144;0.173)|Lung(183;0.198)														---	---	---	---
COL11A1	1301	broad.mit.edu	37	1	103364485	103364485	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103364485delT	uc001dul.2	-						COL11A1_uc001duk.2_Intron|COL11A1_uc001dum.2_Intron|COL11A1_uc001dun.2_Intron|COL11A1_uc009weh.2_Intron	NM_001854	NP_001845			alpha 1 type XI collagen isoform A						collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)														---	---	---	---
VAV3	10451	broad.mit.edu	37	1	108247695	108247695	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:108247695delA	uc001dvk.1	-						VAV3_uc010ouw.1_Intron|VAV3_uc001dvl.1_Intron|VAV3_uc010oux.1_Intron	NM_006113	NP_006104			vav 3 guanine nucleotide exchange factor isoform						angiogenesis|apoptosis|B cell receptor signaling pathway|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|platelet activation|positive regulation of B cell proliferation|regulation of Rho protein signal transduction|response to DNA damage stimulus|response to drug|small GTPase mediated signal transduction	cytosol	GTPase activator activity|metal ion binding|SH3/SH2 adaptor activity			ovary(5)|lung(2)|breast(2)	9		all_epithelial(167;5.38e-05)|all_lung(203;0.000314)|Lung NSC(277;0.000594)		Colorectal(144;0.0331)|Lung(183;0.128)|Epithelial(280;0.204)														---	---	---	---
DRAM2	128338	broad.mit.edu	37	1	111667640	111667640	+	Intron	DEL	A	-	-	rs146295738		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:111667640delA	uc001ead.3	-						DRAM2_uc001eae.3_Intron|DRAM2_uc009wfy.2_Intron|DRAM2_uc001eaf.3_Intron	NM_178454	NP_848549			transmembrane protein 77						apoptosis|induction of apoptosis	Golgi apparatus|integral to membrane|lysosomal membrane					0																		---	---	---	---
DDX20	11218	broad.mit.edu	37	1	112299148	112299148	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:112299148delA	uc001ebs.2	+						C1orf183_uc001ebp.1_5'Flank|uc001ebr.2_5'Flank|DDX20_uc010owf.1_Intron	NM_007204	NP_009135			DEAD (Asp-Glu-Ala-Asp) box polypeptide 20						assembly of spliceosomal tri-snRNP|ncRNA metabolic process	Cajal body|cytoskeleton|cytosol|spliceosomal complex	ATP binding|ATP-dependent RNA helicase activity|DNA binding|protein binding			lung(1)|kidney(1)	2		all_cancers(81;1.06e-05)|all_epithelial(167;7.36e-06)|all_lung(203;2.44e-05)|Lung NSC(69;4.15e-05)		Lung(183;0.0234)|Colorectal(144;0.0282)|all cancers(265;0.0614)|Epithelial(280;0.0999)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
ST7L	54879	broad.mit.edu	37	1	113126864	113126864	+	Intron	DEL	A	-	-	rs76579294		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:113126864delA	uc001ecd.2	-						ST7L_uc009wgh.2_Intron|ST7L_uc001ecc.2_Intron|ST7L_uc010owg.1_Intron|ST7L_uc010owh.1_Intron|ST7L_uc001ece.2_Intron|ST7L_uc001ecf.2_Intron|ST7L_uc001ecg.2_Intron|ST7L_uc010owi.1_Intron|ST7L_uc001ech.2_Intron|ST7L_uc001eci.2_Intron|ST7L_uc009wgi.1_Intron|ST7L_uc010owj.1_Intron	NM_017744	NP_060214			suppression of tumorigenicity 7-like isoform 1						negative regulation of cell growth	integral to membrane	binding				0	Lung SC(450;0.246)	all_cancers(81;1.44e-07)|all_epithelial(167;7.64e-07)|all_lung(203;2.16e-05)|Lung NSC(69;3.86e-05)		Lung(183;0.0234)|all cancers(265;0.0246)|Epithelial(280;0.0342)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
CAPZA1	829	broad.mit.edu	37	1	113202197	113202198	+	Intron	DEL	TC	-	-	rs113906793		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:113202197_113202198delTC	uc001ecj.1	+							NM_006135	NP_006126			F-actin capping protein alpha-1 subunit						actin cytoskeleton organization|actin filament capping|blood coagulation|cellular component movement|innate immune response|protein complex assembly	cytosol|extracellular region|F-actin capping protein complex|WASH complex	actin binding				0	Lung SC(450;0.246)	all_cancers(81;1.44e-07)|all_epithelial(167;7.64e-07)|all_lung(203;2.16e-05)|Lung NSC(69;3.86e-05)		Lung(183;0.0234)|all cancers(265;0.0246)|Epithelial(280;0.0342)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
PTPN22	26191	broad.mit.edu	37	1	114377352	114377352	+	Intron	DEL	A	-	-	rs79608028		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:114377352delA	uc001eds.2	-						PTPN22_uc009wgq.2_Intron|PTPN22_uc010owo.1_Intron|PTPN22_uc001edt.2_Intron|PTPN22_uc009wgr.2_Intron|PTPN22_uc009wgs.2_Intron|PTPN22_uc001edu.2_Intron	NM_015967	NP_057051			protein tyrosine phosphatase, non-receptor type						negative regulation of T cell activation|negative regulation of T cell receptor signaling pathway|phosphoanandamide dephosphorylation|regulation of B cell receptor signaling pathway|regulation of natural killer cell proliferation|T cell differentiation	internal side of plasma membrane|nucleus|perinuclear region of cytoplasm	kinase binding|protein tyrosine phosphatase activity|SH3 domain binding			kidney(2)|lung(1)|skin(1)	4	Lung SC(450;0.184)	all_cancers(81;1.93e-08)|all_epithelial(167;4.37e-08)|all_lung(203;5.22e-06)|Lung NSC(69;8.94e-06)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
WARS2	10352	broad.mit.edu	37	1	119619409	119619409	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:119619409delA	uc001ehn.2	-						WARS2_uc010oxf.1_Intron|WARS2_uc001ehm.2_Intron|WARS2_uc010oxg.1_Intron|WARS2_uc010oxh.1_Intron|WARS2_uc010oxi.1_Intron	NM_015836	NP_056651			mitochondrial tryptophanyl tRNA synthetase 2						tryptophanyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|tryptophan-tRNA ligase activity				0	all_neural(166;0.187)	all_lung(203;2.48e-06)|Lung NSC(69;1.74e-05)|all_epithelial(167;0.000564)		Lung(183;0.0629)	L-Tryptophan(DB00150)													---	---	---	---
TXNIP	10628	broad.mit.edu	37	1	145438606	145438606	+	5'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145438606delT	uc001enn.3	+	1					NBPF10_uc001emp.3_Intron|TXNIP_uc001enm.1_RNA|TXNIP_uc010oys.1_5'Flank	NM_006472	NP_006463			thioredoxin interacting protein						cell cycle|keratinocyte differentiation|transcription, DNA-dependent		ubiquitin protein ligase binding			ovary(2)	2	all_hematologic(18;0.0187)|Acute lymphoblastic leukemia(18;0.0786)																	---	---	---	---
HIST2H2AC	8338	broad.mit.edu	37	1	149858742	149858744	+	In_Frame_Del	DEL	ACA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:149858742_149858744delACA	uc001etd.2	+	1	218_220	c.218_220delACA	c.(217-222)GACAAC>GAC	p.N74del	HIST2H2BE_uc001etc.2_5'Flank	NM_003517	NP_003508	Q16777	H2A2C_HUMAN	histone cluster 2, H2ac	74					nucleosome assembly	nucleosome|nucleus	DNA binding			ovary(1)|skin(1)	2	Breast(34;0.0124)|all_hematologic(923;0.127)		STAD - Stomach adenocarcinoma(528;0.133)|LUSC - Lung squamous cell carcinoma(543;0.221)															---	---	---	---
ANP32E	81611	broad.mit.edu	37	1	150195337	150195337	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150195337delA	uc001etw.2	-						ANP32E_uc010pbt.1_Intron|ANP32E_uc010pbu.1_Intron|ANP32E_uc010pbv.1_Intron|ANP32E_uc001etv.3_Intron	NM_030920	NP_112182			acidic (leucine-rich) nuclear phosphoprotein 32							cytoplasmic membrane-bounded vesicle|nucleus	phosphatase inhibitor activity				0	Lung NSC(24;7.29e-29)|Breast(34;0.00211)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.161)|Colorectal(459;0.171)		LUSC - Lung squamous cell carcinoma(543;0.171)															---	---	---	---
ARNT	405	broad.mit.edu	37	1	150818880	150818880	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150818880delA	uc001evr.1	-						ARNT_uc001evs.1_Intron|ARNT_uc009wmb.1_Intron|ARNT_uc009wmc.1_Intron|ARNT_uc009wmd.1_Intron|ARNT_uc009wme.1_Intron|ARNT_uc010pcl.1_Intron	NM_001668	NP_001659			aryl hydrocarbon receptor nuclear translocator						positive regulation of hormone biosynthetic process|positive regulation vascular endothelial growth factor production|regulation of transcription from RNA polymerase II promoter in response to oxidative stress|response to hypoxia		aryl hydrocarbon receptor binding|protein heterodimerization activity|sequence-specific DNA binding transcription factor activity|signal transducer activity|transcription coactivator activity			skin(4)|lung(3)|central_nervous_system(1)|kidney(1)	9	all_lung(15;9e-35)|Lung NSC(24;3.45e-31)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.108)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.02)|BRCA - Breast invasive adenocarcinoma(12;0.00606)|LUSC - Lung squamous cell carcinoma(543;0.211)					T	ETV6	AML								---	---	---	---
SETDB1	9869	broad.mit.edu	37	1	150933382	150933382	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150933382delC	uc001evu.2	+	16	3034	c.2844delC	c.(2842-2844)CACfs	p.H948fs	SETDB1_uc001evv.2_Frame_Shift_Del_p.H948fs|SETDB1_uc009wmg.1_Frame_Shift_Del_p.H948fs	NM_001145415	NP_001138887	Q15047	SETB1_HUMAN	SET domain, bifurcated 1 isoform 1	948	SET.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|Golgi apparatus|nucleus|plasma membrane	DNA binding|histone-lysine N-methyltransferase activity|protein binding|zinc ion binding			ovary(2)|upper_aerodigestive_tract(1)	3	all_lung(15;9e-35)|Lung NSC(24;3.45e-31)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.108)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0486)|BRCA - Breast invasive adenocarcinoma(12;0.0152)|LUSC - Lung squamous cell carcinoma(543;0.211)															---	---	---	---
GABPB2	126626	broad.mit.edu	37	1	151079397	151079397	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151079397delT	uc001ewr.2	+						GABPB2_uc001ews.2_Intron|GABPB2_uc001ewt.2_Intron	NM_144618	NP_653219			GA repeat binding protein, beta 2						positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nucleus	protein heterodimerization activity|transcription regulatory region DNA binding				0				all cancers(107;7.17e-05)|GBM - Glioblastoma multiforme(94;0.000662)														---	---	---	---
SELENBP1	8991	broad.mit.edu	37	1	151341848	151341848	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151341848delG	uc001exx.2	-						SELENBP1_uc010pcy.1_Intron|SELENBP1_uc001exy.2_Intron|SELENBP1_uc001exz.2_Intron|SELENBP1_uc010pcz.1_Intron|SELENBP1_uc009wms.2_Intron|SELENBP1_uc009wmt.2_5'UTR|SELENBP1_uc001eya.2_5'UTR|SELENBP1_uc009wmu.2_Intron	NM_003944	NP_003935			selenium binding protein 1						protein transport	cytosol|membrane|nucleolus	protein binding|selenium binding				0	Lung SC(34;0.00471)|Ovarian(49;0.00871)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.112)|LUSC - Lung squamous cell carcinoma(543;0.181)															---	---	---	---
NUP210L	91181	broad.mit.edu	37	1	154090061	154090061	+	Intron	DEL	A	-	-	rs79748906		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154090061delA	uc001fdw.2	-						NUP210L_uc009woq.2_Intron|NUP210L_uc010peh.1_Intron	NM_207308	NP_997191			nucleoporin 210kDa-like isoform 1							integral to membrane				skin(5)|ovary(4)|large_intestine(1)|central_nervous_system(1)	11	all_lung(78;9.35e-31)|Lung NSC(65;1.33e-28)|Hepatocellular(266;0.0877)|Melanoma(130;0.128)		LUSC - Lung squamous cell carcinoma(543;0.151)|Colorectal(543;0.198)															---	---	---	---
UBAP2L	9898	broad.mit.edu	37	1	154207835	154207835	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154207835delT	uc001fep.3	+						UBAP2L_uc009wot.2_Intron|UBAP2L_uc010pek.1_Intron|UBAP2L_uc010pel.1_Intron|UBAP2L_uc001fen.1_Intron|UBAP2L_uc010pen.1_Intron	NM_014847	NP_055662			ubiquitin associated protein 2-like isoform a						binding of sperm to zona pellucida		protein binding			ovary(1)|central_nervous_system(1)	2	all_lung(78;1.09e-30)|Lung NSC(65;1.66e-28)|Hepatocellular(266;0.0877)		LUSC - Lung squamous cell carcinoma(543;0.185)															---	---	---	---
UBAP2L	9898	broad.mit.edu	37	1	154231676	154231676	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154231676delT	uc001fep.3	+						UBAP2L_uc009wot.2_Intron|UBAP2L_uc010pek.1_Intron|UBAP2L_uc010pel.1_Intron|UBAP2L_uc010pen.1_Intron|UBAP2L_uc001feq.2_Intron|UBAP2L_uc001fer.2_Intron	NM_014847	NP_055662			ubiquitin associated protein 2-like isoform a						binding of sperm to zona pellucida		protein binding			ovary(1)|central_nervous_system(1)	2	all_lung(78;1.09e-30)|Lung NSC(65;1.66e-28)|Hepatocellular(266;0.0877)		LUSC - Lung squamous cell carcinoma(543;0.185)															---	---	---	---
CHRNB2	1141	broad.mit.edu	37	1	154543476	154543476	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154543476delC	uc001ffg.2	+							NM_000748	NP_000739			neuronal nicotinic acetylcholine receptor beta 2						B cell activation|behavioral response to nicotine|calcium ion transport|central nervous system projection neuron axonogenesis|lateral geniculate nucleus development|locomotory behavior|membrane depolarization|memory|negative regulation of action potential|optic nerve morphogenesis|positive regulation of B cell proliferation|positive regulation of dopamine secretion|regulation of circadian sleep/wake cycle, REM sleep|regulation of dendrite morphogenesis|regulation of dopamine metabolic process|regulation of synaptogenesis|response to cocaine|response to ethanol|response to hypoxia|sensory perception of pain|sensory perception of sound|smooth muscle contraction|social behavior|synaptic transmission involved in micturition|synaptic transmission, cholinergic|vestibulocochlear nerve development|visual learning|visual perception	cell junction|external side of plasma membrane|nicotinic acetylcholine-gated receptor-channel complex|postsynaptic membrane	acetylcholine receptor activity|nicotinic acetylcholine-activated cation-selective channel activity				0	all_lung(78;2.22e-29)|Lung NSC(65;3.66e-27)|Hepatocellular(266;0.0877)|all_hematologic(923;0.088)		LUSC - Lung squamous cell carcinoma(543;0.185)		Nicotine(DB00184)													---	---	---	---
ASH1L	55870	broad.mit.edu	37	1	155347853	155347853	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155347853delA	uc009wqq.2	-						RAG1AP1_uc010pey.1_Intron|ASH1L_uc001fkt.2_Intron	NM_018489	NP_060959			absent, small, or homeotic 1-like						cell-cell signaling|DNA packaging|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	chromosome|Golgi apparatus|nucleus|tight junction	DNA binding|histone-lysine N-methyltransferase activity|zinc ion binding			skin(5)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	11	Hepatocellular(266;0.0997)|all_neural(408;0.129)|all_hematologic(923;0.145)		Epithelial(20;1.74e-08)|all cancers(21;3.29e-08)|BRCA - Breast invasive adenocarcinoma(34;0.021)															---	---	---	---
CRABP2	1382	broad.mit.edu	37	1	156669748	156669749	+	3'UTR	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156669748_156669749insG	uc001fpr.2	-	4						NM_001878	NP_001869			cellular retinoic acid binding protein 2						epidermis development|regulation of transcription, DNA-dependent|signal transduction	cytoplasm|nucleus	retinal binding|retinol binding|transporter activity			upper_aerodigestive_tract(1)	1	all_hematologic(923;0.088)|Hepatocellular(266;0.158)				Alitretinoin(DB00523)													---	---	---	---
FCRL5	83416	broad.mit.edu	37	1	157519226	157519226	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:157519226delA	uc001fqu.2	-						FCRL5_uc009wsm.2_Intron|FCRL5_uc010phv.1_Intron|FCRL5_uc010phw.1_Intron|FCRL5_uc001fqv.1_Intron|FCRL5_uc010phx.1_Intron	NM_031281	NP_112571			Fc receptor-like 5							integral to membrane|plasma membrane	receptor activity			ovary(3)|breast(2)|central_nervous_system(1)	6	all_hematologic(112;0.0378)|Hepatocellular(266;0.178)	Prostate(1639;0.231)																---	---	---	---
MNDA	4332	broad.mit.edu	37	1	158817340	158817340	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158817340delA	uc001fsz.1	+							NM_002432	NP_002423			myeloid cell nuclear differentiation antigen						B cell receptor signaling pathway|cellular defense response|negative regulation of B cell proliferation|positive regulation of apoptosis|regulation of transcription, DNA-dependent|response to DNA damage stimulus|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding			ovary(2)|skin(2)	4	all_hematologic(112;0.0378)																	---	---	---	---
SH2D1B	117157	broad.mit.edu	37	1	162372704	162372704	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:162372704delT	uc001gbz.1	-						SH2D1B_uc001gca.1_Intron	NM_053282	NP_444512			SH2 domain containing 1B											pancreas(1)	1	all_hematologic(112;0.115)		BRCA - Breast invasive adenocarcinoma(70;0.126)															---	---	---	---
UAP1	6675	broad.mit.edu	37	1	162558826	162558827	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:162558826_162558827delTT	uc001gce.3	+							NM_003115	NP_003106			UDP-N-acetylglucosamine pyrophosphorylase 1						dolichol-linked oligosaccharide biosynthetic process|post-translational protein modification|protein N-linked glycosylation via asparagine|UDP-N-acetylglucosamine biosynthetic process	cytosol|nucleus|plasma membrane	UDP-N-acetylglucosamine diphosphorylase activity			ovary(2)|skin(2)|kidney(1)	5	all_hematologic(112;0.115)		BRCA - Breast invasive adenocarcinoma(70;0.126)															---	---	---	---
ADCY10	55811	broad.mit.edu	37	1	167780157	167780157	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:167780157delA	uc001ger.2	-						ADCY10_uc009wvj.2_Intron|ADCY10_uc009wvk.2_Intron|ADCY10_uc010plj.1_Intron	NM_018417	NP_060887			adenylate cyclase 10						intracellular signal transduction|spermatogenesis	cytoskeleton|cytosol|perinuclear region of cytoplasm|plasma membrane|soluble fraction	adenylate cyclase activity|ATP binding|magnesium ion binding			central_nervous_system(2)|ovary(1)	3																		---	---	---	---
C1orf112	55732	broad.mit.edu	37	1	169811728	169811728	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169811728delA	uc001ggp.2	+						C1orf112_uc001ggj.2_Intron|C1orf112_uc001ggq.2_Intron|C1orf112_uc009wvt.2_Intron|C1orf112_uc009wvu.1_Intron|C1orf112_uc001ggr.2_Intron|C1orf112_uc010plv.1_Intron	NM_018186	NP_060656			hypothetical protein LOC55732												0	all_hematologic(923;0.0922)|Acute lymphoblastic leukemia(37;0.181)																	---	---	---	---
SERPINC1	462	broad.mit.edu	37	1	173879823	173879823	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173879823delA	uc001gjt.2	-							NM_000488	NP_000479			serpin peptidase inhibitor, clade C, member 1						blood coagulation|regulation of proteolysis	extracellular space|plasma membrane	heparin binding|protease binding|serine-type endopeptidase inhibitor activity			ovary(1)	1					Enoxaparin(DB01225)|Fondaparinux sodium(DB00569)|Heparin(DB01109)													---	---	---	---
CEP350	9857	broad.mit.edu	37	1	179961116	179961116	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:179961116delT	uc001gnt.2	+						CEP350_uc001gnr.1_Intron|CEP350_uc009wxl.2_Intron	NM_014810	NP_055625			centrosome-associated protein 350							centrosome|nucleus|spindle				ovary(4)	4																		---	---	---	---
CEP350	9857	broad.mit.edu	37	1	180031282	180031282	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:180031282delT	uc001gnt.2	+						CEP350_uc009wxl.2_Intron	NM_014810	NP_055625			centrosome-associated protein 350							centrosome|nucleus|spindle				ovary(4)	4																		---	---	---	---
HMCN1	83872	broad.mit.edu	37	1	186121844	186121844	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186121844delT	uc001grq.1	+						HMCN1_uc001grs.1_Intron	NM_031935	NP_114141			hemicentin 1 precursor						response to stimulus|visual perception	basement membrane	calcium ion binding			ovary(22)|skin(1)	23																		---	---	---	---
UCHL5	51377	broad.mit.edu	37	1	192997359	192997360	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:192997359_192997360insT	uc001gsm.2	-						UCHL5_uc001gsn.2_Intron|UCHL5_uc001gso.2_Intron|UCHL5_uc010pov.1_Intron|UCHL5_uc001gsp.2_Intron|UCHL5_uc001gsq.2_Intron|UCHL5_uc010pow.1_Intron|UCHL5_uc010pox.1_Intron	NM_015984	NP_057068			ubiquitin carboxyl-terminal hydrolase L5						DNA recombination|DNA repair|protein deubiquitination|regulation of proteasomal protein catabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent|ubiquitin-dependent protein catabolic process	cytosol|Ino80 complex|proteasome complex	endopeptidase inhibitor activity|omega peptidase activity|proteasome binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			lung(2)|ovary(1)	3																		---	---	---	---
CDC73	79577	broad.mit.edu	37	1	193091320	193091320	+	5'UTR	DEL	G	-	-	rs80356643		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:193091320delG	uc001gtb.2	+	1						NM_024529	NP_078805			parafibromin						cell cycle|histone H2B ubiquitination|histone monoubiquitination|transcription, DNA-dependent	Cdc73/Paf1 complex	protein binding			parathyroid(46)|ovary(1)|breast(1)|pancreas(1)	49														Hyperparathyroidism_Familial_Isolated|Hyperparathyroidism-Jaw_Tumor_Syndrome		OREG0014058	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
CDC73	79577	broad.mit.edu	37	1	193181176	193181176	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:193181176delT	uc001gtb.2	+							NM_024529	NP_078805			parafibromin						cell cycle|histone H2B ubiquitination|histone monoubiquitination|transcription, DNA-dependent	Cdc73/Paf1 complex	protein binding			parathyroid(46)|ovary(1)|breast(1)|pancreas(1)	49														Hyperparathyroidism_Familial_Isolated|Hyperparathyroidism-Jaw_Tumor_Syndrome				---	---	---	---
KCNT2	343450	broad.mit.edu	37	1	196274286	196274286	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:196274286delT	uc001gtd.1	-						KCNT2_uc009wyt.1_Intron|KCNT2_uc001gte.1_Intron|KCNT2_uc001gtf.1_Intron|KCNT2_uc001gtg.1_Intron|KCNT2_uc009wyu.2_Intron|KCNT2_uc001gth.1_Intron	NM_198503	NP_940905			potassium channel, subfamily T, member 2							voltage-gated potassium channel complex	ATP binding|calcium-activated potassium channel activity|voltage-gated potassium channel activity			ovary(5)|breast(1)|skin(1)	7																		---	---	---	---
CFH	3075	broad.mit.edu	37	1	196642420	196642421	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:196642420_196642421delTT	uc001gtj.3	+						CFH_uc001gti.3_Intron|CFH_uc009wyw.2_Intron|CFH_uc009wyx.2_Intron	NM_000186	NP_000177			complement factor H isoform a precursor						complement activation, alternative pathway	extracellular space				skin(4)|ovary(1)|breast(1)	6																		---	---	---	---
CACNA1S	779	broad.mit.edu	37	1	201019881	201019881	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201019881delA	uc001gvv.2	-							NM_000069	NP_000060			calcium channel, voltage-dependent, L type,						axon guidance	I band|T-tubule|voltage-gated calcium channel complex	high voltage-gated calcium channel activity			ovary(3)|central_nervous_system(1)|skin(1)	5					Magnesium Sulfate(DB00653)|Verapamil(DB00661)													---	---	---	---
PTPN7	5778	broad.mit.edu	37	1	202128510	202128510	+	Frame_Shift_Del	DEL	C	-	-	rs144275491		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202128510delC	uc001gxm.1	-	2	152	c.21delG	c.(19-21)GGGfs	p.G7fs	PTPN7_uc001gxl.1_Frame_Shift_Del_p.G46fs|PTPN7_uc001gxn.1_Frame_Shift_Del_p.G7fs|PTPN7_uc010ppv.1_5'UTR|PTPN7_uc010ppw.1_5'UTR|PTPN7_uc010ppx.1_Frame_Shift_Del_p.G81fs|PTPN7_uc010ppy.1_RNA|PTPN7_uc001gxo.1_5'Flank	NM_002832	NP_002823	P35236	PTN7_HUMAN	protein tyrosine phosphatase, non-receptor type	7						cytosol|internal side of plasma membrane	protein binding|protein tyrosine phosphatase activity			skin(1)	1																		---	---	---	---
SOX13	9580	broad.mit.edu	37	1	204083753	204083753	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:204083753delG	uc001ham.2	+						SOX13_uc001hal.2_Intron|SOX13_uc010pqp.1_Intron|SOX13_uc010pqq.1_5'Flank	NM_005686	NP_005677			SRY-box 13						anatomical structure morphogenesis	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			breast(1)|central_nervous_system(1)	2	all_cancers(21;0.0754)|Breast(84;0.116)|all_epithelial(62;0.189)		KIRC - Kidney renal clear cell carcinoma(13;0.0584)|Kidney(21;0.0934)|BRCA - Breast invasive adenocarcinoma(75;0.109)															---	---	---	---
CTSE	1510	broad.mit.edu	37	1	206325078	206325078	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206325078delT	uc001hdu.2	+						CTSE_uc001hdv.2_Intron|CTSE_uc010prs.1_Intron	NM_001910	NP_001901			cathepsin E isoform a preproprotein						antigen processing and presentation of exogenous peptide antigen via MHC class II|digestion|proteolysis	endosome	aspartic-type endopeptidase activity			ovary(1)	1			BRCA - Breast invasive adenocarcinoma(75;0.0754)															---	---	---	---
DYRK3	8444	broad.mit.edu	37	1	206810442	206810442	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206810442delA	uc001hej.2	+						DYRK3_uc001hek.2_Intron|DYRK3_uc001hei.2_Intron	NM_003582	NP_003573			dual-specificity tyrosine-(Y)-phosphorylation						erythrocyte differentiation	nucleus	ATP binding|magnesium ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			stomach(2)|central_nervous_system(1)	3	Breast(84;0.183)		BRCA - Breast invasive adenocarcinoma(75;0.166)															---	---	---	---
RCOR3	55758	broad.mit.edu	37	1	211451448	211451448	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:211451448delT	uc001hig.2	+						RCOR3_uc010psv.1_Intron|RCOR3_uc001hie.2_Intron|RCOR3_uc010psw.1_Intron|RCOR3_uc001hif.2_Intron	NM_018254	NP_060724			REST corepressor 3 isoform d						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding			ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(81;0.00961)|all cancers(67;0.0999)|Epithelial(68;0.171)														---	---	---	---
USH2A	7399	broad.mit.edu	37	1	216073975	216073975	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216073975delT	uc001hku.1	-							NM_206933	NP_996816			usherin isoform B						maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---
EPRS	2058	broad.mit.edu	37	1	220207053	220207056	+	Intron	DEL	AAAG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:220207053_220207056delAAAG	uc001hly.1	-						EPRS_uc010puf.1_Intron|EPRS_uc001hlz.1_Intron|EPRS_uc009xdt.1_Intron	NM_004446	NP_004437			glutamyl-prolyl tRNA synthetase						glutamyl-tRNA aminoacylation|prolyl-tRNA aminoacylation|protein complex assembly	cytosol|soluble fraction	ATP binding|glutamate-tRNA ligase activity|proline-tRNA ligase activity|protein binding|RNA binding			ovary(1)|skin(1)	2				GBM - Glioblastoma multiforme(131;0.0735)	L-Glutamic Acid(DB00142)|L-Proline(DB00172)													---	---	---	---
Unknown	0	broad.mit.edu	37	1	222435596	222435596	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222435596delT								DUSP10 (520135 upstream) : HHIPL2 (260006 downstream)																																			---	---	---	---
MIA3	375056	broad.mit.edu	37	1	222833062	222833062	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222833062delT	uc001hnl.2	+						MIA3_uc001hnm.2_Intron	NM_198551	NP_940953			melanoma inhibitory activity family, member 3						exocytosis|negative regulation of cell adhesion|negative regulation of cell migration|positive regulation of leukocyte migration|protein transport|wound healing	endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(4)|central_nervous_system(1)	5				GBM - Glioblastoma multiforme(131;0.0199)														---	---	---	---
TP53BP2	7159	broad.mit.edu	37	1	223980974	223980974	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223980974delA	uc010pvb.1	-						TP53BP2_uc001hod.2_Intron|TP53BP2_uc010puz.1_Intron|TP53BP2_uc010pva.1_Intron	NM_001031685	NP_001026855			tumor protein p53 binding protein, 2 isoform 1						apoptosis|cell cycle|induction of apoptosis|negative regulation of cell cycle|signal transduction	nucleus|perinuclear region of cytoplasm	NF-kappaB binding|protein binding|SH3 domain binding|SH3/SH2 adaptor activity			ovary(2)|lung(1)	3				GBM - Glioblastoma multiforme(131;0.0958)														---	---	---	---
ABCB10	23456	broad.mit.edu	37	1	229653865	229653865	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229653865delT	uc001htp.3	-	13						NM_012089	NP_036221			ATP-binding cassette, sub-family B, member 10							integral to mitochondrial membrane|mitochondrial inner membrane	ATP binding|oligopeptide-transporting ATPase activity			breast(2)	2	Breast(184;0.143)|Ovarian(103;0.249)	Prostate(94;0.167)																---	---	---	---
C1orf124	83932	broad.mit.edu	37	1	231475794	231475796	+	Intron	DEL	AAA	-	-	rs67211745		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:231475794_231475796delAAA	uc001hur.2	+						EXOC8_uc001huq.2_5'Flank|C1orf124_uc001hus.2_Intron|C1orf124_uc001hut.2_Intron	NM_032018	NP_114407			hypothetical protein LOC83932 isoform a						DNA repair	nuclear speck	DNA binding|metal ion binding				0	Breast(184;0.0871)	all_cancers(173;0.151)|Prostate(94;0.183)																---	---	---	---
TARBP1	6894	broad.mit.edu	37	1	234568985	234568985	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:234568985delA	uc001hwd.2	-							NM_005646	NP_005637			TAR RNA binding protein 1						regulation of transcription from RNA polymerase II promoter|RNA processing	nucleus	RNA binding|RNA methyltransferase activity			ovary(2)|skin(1)	3	Ovarian(103;0.0339)	all_cancers(173;0.00995)|Prostate(94;0.0115)|all_epithelial(177;0.172)	OV - Ovarian serous cystadenocarcinoma(106;0.000263)															---	---	---	---
HEATR1	55127	broad.mit.edu	37	1	236736257	236736258	+	Intron	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236736257_236736258insC	uc001hyd.1	-						HEATR1_uc009xgh.1_Intron	NM_018072	NP_060542			protein BAP28						rRNA processing	nucleolus|ribonucleoprotein complex	protein binding			ovary(2)|skin(1)	3	Ovarian(103;0.0634)|Breast(184;0.133)	all_cancers(173;0.0255)|Prostate(94;0.175)	OV - Ovarian serous cystadenocarcinoma(106;0.00117)															---	---	---	---
RYR2	6262	broad.mit.edu	37	1	237969687	237969688	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237969687_237969688insT	uc001hyl.1	+						RYR2_uc010pyb.1_Intron	NM_001035	NP_001026			cardiac muscle ryanodine receptor						cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---
AKT3	10000	broad.mit.edu	37	1	243788427	243788437	+	Intron	DEL	TTTTTTTTTTT	-	-	rs149544579		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:243788427_243788437delTTTTTTTTTTT	uc001iab.1	-						AKT3_uc001hzz.1_Intron	NM_005465	NP_005456			AKT3 kinase isoform 1						signal transduction	Golgi apparatus|nucleus|plasma membrane	ATP binding|protein binding|protein serine/threonine kinase activity			stomach(1)|lung(1)|breast(1)|central_nervous_system(1)	4	all_cancers(71;0.000307)|all_epithelial(71;0.000374)|all_lung(81;0.0323)|Ovarian(71;0.0619)|all_neural(11;0.101)|Lung NSC(105;0.168)	all_cancers(173;0.0274)	all cancers(7;4.3e-08)|GBM - Glioblastoma multiforme(7;5.12e-06)|OV - Ovarian serous cystadenocarcinoma(106;0.00196)															---	---	---	---
ADSS	159	broad.mit.edu	37	1	244587210	244587210	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:244587210delA	uc001iaj.2	-						ADSS_uc009xgr.1_Intron	NM_001126	NP_001117			adenylosuccinate synthase						AMP biosynthetic process|immune system process|purine base metabolic process	cytosol|plasma membrane	adenylosuccinate synthase activity|GTP binding|magnesium ion binding|phosphate binding			ovary(2)|kidney(1)	3	all_cancers(71;2.17e-05)|all_epithelial(71;0.00015)|all_neural(11;0.0269)|Breast(184;0.0654)|Glioma(6;0.0724)|Ovarian(71;0.0761)|all_lung(81;0.0874)|Lung NSC(105;0.121)	all_cancers(173;0.0896)|all_epithelial(177;0.172)	all cancers(7;9.71e-08)|GBM - Glioblastoma multiforme(7;1.28e-05)|OV - Ovarian serous cystadenocarcinoma(106;0.0014)		L-Aspartic Acid(DB00128)													---	---	---	---
AHCTF1	25909	broad.mit.edu	37	1	247059065	247059065	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247059065delA	uc001ibu.1	-						AHCTF1_uc001ibv.1_Intron|AHCTF1_uc009xgs.1_Intron	NM_015446	NP_056261			transcription factor ELYS						cytokinesis|mitotic prometaphase|mRNA transport|nuclear pore complex assembly|protein transport|transmembrane transport	condensed chromosome kinetochore|cytosol|nuclear matrix|nuclear membrane|nuclear pore|nucleoplasm	DNA binding			ovary(5)|skin(2)	7	all_cancers(71;3.05e-05)|all_epithelial(71;6.72e-06)|Ovarian(71;0.0173)|Breast(184;0.0318)|all_lung(81;0.0458)|Lung NSC(105;0.0518)	all_cancers(173;0.0266)	OV - Ovarian serous cystadenocarcinoma(106;0.00271)															---	---	---	---
Unknown	0	broad.mit.edu	37	1	247348604	247348606	+	IGR	DEL	AGG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247348604_247348606delAGG								ZNF124 (13286 upstream) : VN1R5 (70768 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	1	248844550	248844550	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248844550delT								OR2T27 (30365 upstream) : OR14I1 (120 downstream)																																			---	---	---	---
PXDN	7837	broad.mit.edu	37	2	1652960	1652960	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1652960delG	uc002qxa.2	-	17	2656	c.2592delC	c.(2590-2592)CCCfs	p.P864fs		NM_012293	NP_036425	Q92626	PXDN_HUMAN	peroxidasin precursor	864					extracellular matrix organization|hydrogen peroxide catabolic process|immune response	endoplasmic reticulum|extracellular space|proteinaceous extracellular matrix	extracellular matrix structural constituent|heme binding|interleukin-1 receptor antagonist activity|peroxidase activity			pancreas(6)|ovary(2)	8	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.0845)|Lung NSC(108;0.00641)|all_epithelial(98;0.00716)		all cancers(51;0.0492)|OV - Ovarian serous cystadenocarcinoma(76;0.0973)|Epithelial(75;0.17)|GBM - Glioblastoma multiforme(21;0.228)														---	---	---	---
MYT1L	23040	broad.mit.edu	37	2	1890247	1890247	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1890247delT	uc002qxe.2	-						MYT1L_uc002qxd.2_Intron|MYT1L_uc010ewl.1_Intron	NM_015025	NP_055840			myelin transcription factor 1-like						cell differentiation|nervous system development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(5)|central_nervous_system(1)	6	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.037)|all_epithelial(98;0.241)		OV - Ovarian serous cystadenocarcinoma(76;0.169)|all cancers(51;0.244)														---	---	---	---
KIDINS220	57498	broad.mit.edu	37	2	8875008	8875009	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:8875008_8875009insA	uc002qzc.2	-						KIDINS220_uc010yiv.1_Intron|KIDINS220_uc002qzd.2_Intron|KIDINS220_uc010yiw.1_Intron|KIDINS220_uc002qzb.2_Intron	NM_020738	NP_065789			kinase D-interacting substrate of 220 kDa						activation of MAPKK activity|nerve growth factor receptor signaling pathway	cytosol|integral to membrane				ovary(3)|central_nervous_system(1)	4	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
NBAS	51594	broad.mit.edu	37	2	15537482	15537483	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:15537482_15537483insT	uc002rcc.1	-						NBAS_uc010exl.1_Intron|NBAS_uc002rcd.1_Intron	NM_015909	NP_056993			neuroblastoma-amplified protein											ovary(2)|liver(1)|skin(1)	4																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	17566418	17566418	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:17566418delA								FAM49A (719322 upstream) : RAD51AP2 (125568 downstream)																																			---	---	---	---
SMC6	79677	broad.mit.edu	37	2	17883218	17883218	+	Intron	DEL	T	-	-	rs11681696	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:17883218delT	uc002rco.2	-						SMC6_uc010exo.2_Intron|SMC6_uc002rcn.2_Intron|SMC6_uc002rcp.1_Intron	NM_001142286	NP_001135758			SMC6 protein						DNA recombination|DNA repair	chromosome|nucleus	ATP binding			breast(4)|upper_aerodigestive_tract(1)|kidney(1)	6	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.158)																	---	---	---	---
WDR35	57539	broad.mit.edu	37	2	20169510	20169512	+	Intron	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:20169510_20169512delTTT	uc002rdi.2	-						WDR35_uc002rdj.2_Intron|WDR35_uc010ext.2_Intron|WDR35_uc002rdh.2_Intron	NM_001006657	NP_001006658			WD repeat domain 35 isoform 1											ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---
Unknown	0	broad.mit.edu	37	2	26363043	26363044	+	IGR	DEL	AA	-	-	rs112696641		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:26363043_26363044delAA								RAB10 (2721 upstream) : HADHA (50461 downstream)																																			---	---	---	---
HADHA	3030	broad.mit.edu	37	2	26423952	26423952	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:26423952delA	uc002rgy.2	-						HADHA_uc010yks.1_Intron	NM_000182	NP_000173			mitochondrial trifunctional protein, alpha						fatty acid beta-oxidation	fatty acid beta-oxidation multienzyme complex|mitochondrial nucleoid|nucleolus	3-hydroxyacyl-CoA dehydrogenase activity|acetyl-CoA C-acetyltransferase activity|coenzyme binding|enoyl-CoA hydratase activity|long-chain-3-hydroxyacyl-CoA dehydrogenase activity|protein binding			ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				NADH(DB00157)													---	---	---	---
IFT172	26160	broad.mit.edu	37	2	27678781	27678781	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27678781delA	uc002rku.2	-						IFT172_uc010ezb.2_5'Flank	NM_015662	NP_056477			selective LIM binding factor homolog						cilium assembly	cilium	binding			large_intestine(1)|ovary(1)	2	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
RBKS	64080	broad.mit.edu	37	2	28055369	28055369	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:28055369delT	uc002rlo.1	-						RBKS_uc010ezi.1_Intron|RBKS_uc010ymg.1_Intron	NM_022128	NP_071411			ribokinase						D-ribose metabolic process		ATP binding|ribokinase activity			ovary(1)|skin(1)	2	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
YIPF4	84272	broad.mit.edu	37	2	32517177	32517177	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32517177delT	uc002rok.2	+							NM_032312	NP_115688			Yip1 domain family, member 4							endoplasmic reticulum|integral to membrane	protein binding				0	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
TTC27	55622	broad.mit.edu	37	2	32892001	32892001	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32892001delT	uc002rom.2	+						TTC27_uc010ymx.1_Intron	NM_017735	NP_060205			tetratricopeptide repeat domain 27								protein binding			central_nervous_system(1)	1																		---	---	---	---
FEZ2	9637	broad.mit.edu	37	2	36785668	36785668	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:36785668delA	uc002rph.2	-						FEZ2_uc002rpe.2_Intron|FEZ2_uc002rpf.2_Intron|FEZ2_uc002rpg.2_Intron|FEZ2_uc002rpi.2_Intron|FEZ2_uc002rpj.2_Intron	NM_005102	NP_005093			zygin 2 isoform 1						axon guidance|signal transduction		protein binding			ovary(1)	1		all_hematologic(82;0.21)																---	---	---	---
DHX57	90957	broad.mit.edu	37	2	39038624	39038624	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:39038624delT	uc002rrf.2	-						DHX57_uc002rrd.3_Intron|DHX57_uc002rre.2_Intron	NM_198963	NP_945314			DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57								ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding|zinc ion binding			ovary(1)|lung(1)|skin(1)	3		all_hematologic(82;0.248)																---	---	---	---
DHX57	90957	broad.mit.edu	37	2	39075647	39075647	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:39075647delA	uc002rrf.2	-						DHX57_uc002rrd.3_Intron|DHX57_uc002rre.2_Intron	NM_198963	NP_945314			DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57								ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding|zinc ion binding			ovary(1)|lung(1)|skin(1)	3		all_hematologic(82;0.248)																---	---	---	---
THADA	63892	broad.mit.edu	37	2	43768645	43768647	+	Intron	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:43768645_43768647delTTT	uc002rsw.3	-						THADA_uc010far.2_Intron|THADA_uc002rsx.3_Intron|THADA_uc002rsy.3_Intron|THADA_uc010fas.1_Intron|THADA_uc002rsz.2_Intron|THADA_uc010fat.1_Intron|THADA_uc002rta.2_Intron	NM_001083953	NP_001077422			thyroid adenoma associated								binding			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(82;0.00361)|all_hematologic(82;0.00837)																---	---	---	---
LOC728819	728819	broad.mit.edu	37	2	43903432	43903432	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:43903432delA	uc010fav.1	-	1	30	c.30delT	c.(28-30)TTTfs	p.F10fs	PLEKHH2_uc002rte.3_Intron|PLEKHH2_uc002rtf.3_Intron|PLEKHH2_uc010yny.1_Intron	NM_001101330	NP_001094800			C1GALT1-specific chaperone 1-like												0		all_hematologic(82;0.166)|Acute lymphoblastic leukemia(82;0.17)																---	---	---	---
SRBD1	55133	broad.mit.edu	37	2	45832677	45832678	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:45832677_45832678insA	uc002rus.2	-							NM_018079	NP_060549			S1 RNA binding domain 1						nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		hydrolase activity, acting on ester bonds|RNA binding			central_nervous_system(1)	1		all_hematologic(82;0.166)|Acute lymphoblastic leukemia(82;0.17)	LUSC - Lung squamous cell carcinoma(58;0.0917)|Lung(47;0.154)															---	---	---	---
EPCAM	4072	broad.mit.edu	37	2	47600582	47600582	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:47600582delT	uc002rvx.2	+						EPCAM_uc002rvw.2_Intron	NM_002354	NP_002345			epithelial cell adhesion molecule precursor						positive regulation of cell proliferation	apical plasma membrane|basolateral plasma membrane|integral to membrane|lateral plasma membrane|tight junction	protein binding			skin(1)	1														Lynch_syndrome				---	---	---	---
MSH2	4436	broad.mit.edu	37	2	47709797	47709797	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:47709797delA	uc002rvy.1	+						MSH2_uc010yoh.1_Intron|MSH2_uc002rvz.2_Intron|MSH2_uc010fbg.2_Intron	NM_000251	NP_000242			mutS homolog 2						B cell differentiation|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|double-strand break repair|intra-S DNA damage checkpoint|isotype switching|maintenance of DNA repeat elements|male gonad development|meiotic gene conversion|meiotic mismatch repair|negative regulation of neuron apoptosis|negative regulation of reciprocal meiotic recombination|positive regulation of helicase activity|postreplication repair|response to UV-B|response to X-ray|somatic hypermutation of immunoglobulin genes	MutSalpha complex|MutSbeta complex|nuclear chromosome	ATP binding|DNA-dependent ATPase activity|double-strand/single-strand DNA junction binding|guanine/thymine mispair binding|loop DNA binding|protein C-terminus binding|protein homodimerization activity|protein kinase binding|Y-form DNA binding	p.?(2)		large_intestine(33)|haematopoietic_and_lymphoid_tissue(6)|endometrium(4)|ovary(3)|cervix(2)|central_nervous_system(2)|stomach(1)|small_intestine(1)|breast(1)|skin(1)|prostate(1)	55		all_hematologic(82;0.0359)|Acute lymphoblastic leukemia(82;0.175)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)					D|Mis|N|F|S		colorectal|endometrial|ovarian	colorectal|endometrial|ovarian		MMR	Lynch_syndrome|Muir-Torre_syndrome|Turcot_syndrome|Constitutional_Mismatch_Repair_Deficiency_Syndrome				---	---	---	---
Unknown	0	broad.mit.edu	37	2	53713377	53713377	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:53713377delT								None (None upstream) : ASB3 (183741 downstream)																																			---	---	---	---
SMEK2	57223	broad.mit.edu	37	2	55814011	55814011	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:55814011delA	uc002rzc.2	-						SMEK2_uc002rzb.2_Intron|SMEK2_uc002rzd.2_Intron|SMEK2_uc002rza.2_Intron	NM_001122964	NP_001116436			SMEK homolog 2, suppressor of mek1 isoform 1							microtubule organizing center|nucleus	protein binding			skin(1)	1			LUSC - Lung squamous cell carcinoma(58;0.127)|Lung(47;0.132)															---	---	---	---
PUS10	150962	broad.mit.edu	37	2	61171973	61171973	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61171973delA	uc010fci.2	-						PUS10_uc002sao.2_Intron|PUS10_uc010ypk.1_Intron	NM_144709	NP_653310			pseudouridylate synthase 10						pseudouridine synthesis|tRNA processing		pseudouridine synthase activity|RNA binding			ovary(2)|large_intestine(1)|kidney(1)	4			LUSC - Lung squamous cell carcinoma(5;1.56e-06)|Lung(5;2.48e-05)|Epithelial(17;0.113)															---	---	---	---
VPS54	51542	broad.mit.edu	37	2	64124487	64124487	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:64124487delA	uc002scq.2	-						VPS54_uc002scp.2_Intron|VPS54_uc002scn.2_Intron|VPS54_uc002sco.2_Intron|VPS54_uc010fct.2_Intron	NM_016516	NP_057600			vacuolar protein sorting 54 isoform 1						protein transport|retrograde transport, endosome to Golgi						0																		---	---	---	---
GKN2	200504	broad.mit.edu	37	2	69177086	69177086	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:69177086delT	uc002sfa.2	-						GKN2_uc002sfb.3_Intron	NM_182536	NP_872342			trefoil factor interactions(z) 1 precursor							extracellular region					0																		---	---	---	---
C2orf42	54980	broad.mit.edu	37	2	70409239	70409240	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:70409239_70409240delTT	uc002sgh.2	-							NM_017880	NP_060350			hypothetical protein LOC54980												0																		---	---	---	---
ATP6V1B1	525	broad.mit.edu	37	2	71191573	71191573	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71191573delC	uc002shj.2	+	12	1236	c.1149delC	c.(1147-1149)TACfs	p.Y383fs	ATP6V1B1_uc010fdv.2_Frame_Shift_Del_p.Y366fs|ATP6V1B1_uc010fdw.2_RNA|ATP6V1B1_uc010fdx.2_Frame_Shift_Del_p.Y341fs	NM_001692	NP_001683	P15313	VATB1_HUMAN	ATPase, H+ transporting, lysosomal 56/58kDa, V1	383					ATP hydrolysis coupled proton transport|calcium ion homeostasis|cellular iron ion homeostasis|excretion|inner ear morphogenesis|insulin receptor signaling pathway|ossification|pH reduction|sensory perception of sound|transferrin transport	apical plasma membrane|basolateral plasma membrane|cytosol|endomembrane system|lateral plasma membrane|microvillus|proton-transporting V-type ATPase, V1 domain|vacuolar proton-transporting V-type ATPase complex	ATP binding|hydrogen ion transporting ATP synthase activity, rotational mechanism|proton-transporting ATPase activity, rotational mechanism			skin(1)	1																OREG0014686	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
ALMS1	7840	broad.mit.edu	37	2	73830582	73830583	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73830582_73830583delAA	uc002sje.1	+						ALMS1_uc002sjf.1_Intron|ALMS1_uc002sjh.1_3'UTR	NM_015120	NP_055935			Alstrom syndrome 1						G2/M transition of mitotic cell cycle	centrosome|cilium|cytosol|microtubule basal body|spindle pole				skin(3)|ovary(2)|breast(2)|pancreas(1)|lung(1)	9																		---	---	---	---
POLE4	56655	broad.mit.edu	37	2	75187745	75187745	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:75187745delA	uc002snf.2	+							NM_019896	NP_063949			DNA-directed DNA polymerase epsilon 4						histone H3 acetylation	Ada2/Gcn5/Ada3 transcription activator complex	DNA-directed DNA polymerase activity|protein binding|sequence-specific DNA binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	78019880	78019881	+	IGR	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:78019880_78019881delTT								LRRTM4 (270378 upstream) : SNAR-H (162152 downstream)																																			---	---	---	---
DNAH6	1768	broad.mit.edu	37	2	84777275	84777275	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:84777275delA	uc010fgb.2	+						DNAH6_uc002soo.2_Intron|DNAH6_uc002sop.2_Intron	NM_001370	NP_001361			dynein, axonemal, heavy polypeptide 6						microtubule-based movement	cilium axoneme|cytoplasm|dynein complex|microtubule	ATP binding|ATPase activity|microtubule motor activity			central_nervous_system(1)	1																		---	---	---	---
ST3GAL5	8869	broad.mit.edu	37	2	86067102	86067102	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:86067102delA	uc002sqq.1	-	7					ST3GAL5_uc010fgq.1_3'UTR|ST3GAL5_uc002sqp.1_3'UTR	NM_003896	NP_003887			ST3 beta-galactoside alpha-2,3-sialyltransferase						ganglioside biosynthetic process|protein glycosylation	integral to Golgi membrane|integral to plasma membrane	lactosylceramide alpha-2,3-sialyltransferase activity|neolactotetraosylceramide alpha-2,3-sialyltransferase activity				0																		---	---	---	---
RMND5A	64795	broad.mit.edu	37	2	87096002	87096002	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:87096002delA	uc002srs.3	+						uc010fgu.1_Intron					SubName: Full=cDNA FLJ10361 fis, clone NT2RM2001256, highly similar to Anaphase-promoting complex subunit 1;											ovary(1)|skin(1)	2																		---	---	---	---
RGPD1	400966	broad.mit.edu	37	2	87157456	87157456	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:87157456delG	uc010fgv.2	+						RMND5A_uc002srs.3_Intron|RGPD1_uc002ssb.2_Intron	NM_001024457	NP_001019628			RANBP2-like and GRIP domain containing 1						intracellular transport		binding				0																		---	---	---	---
ANKRD20B	729171	broad.mit.edu	37	2	95483038	95483039	+	Frame_Shift_Ins	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:95483038_95483039insT	uc010fhq.1	-	1	508_509	c.116_117insA	c.(115-117)AATfs	p.N39fs	ANKRD20B_uc010fhp.2_RNA	NM_001012421	NP_001012421			ankyrin repeat domain 20 family, member A2												0																		---	---	---	---
ANKRD20B	729171	broad.mit.edu	37	2	95488700	95488700	+	Intron	DEL	A	-	-	rs13389021	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:95488700delA	uc010fhp.2	-							NR_003366				Homo sapiens ankyrin repeat domain 20B (ANKRD20B), non-coding RNA.												0																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	96533452	96533452	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:96533452delT	uc002sva.1	-						uc002suz.1_Intron|uc002svb.1_Intron					Homo sapiens cDNA FLJ41632 fis, clone FCBBF1000297, highly  similar to Human protein immuno-reactive with anti-PTH polyclonal antibodies mRNA.																														---	---	---	---
MGAT4A	11320	broad.mit.edu	37	2	99261956	99261956	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:99261956delT	uc002sze.2	-	9	1138	c.824delA	c.(823-825)AATfs	p.N275fs	C2orf64_uc002sza.2_RNA|MGAT4A_uc010yvm.1_Frame_Shift_Del_p.N147fs|MGAT4A_uc010fil.2_Frame_Shift_Del_p.N29fs	NM_012214	NP_036346	Q9UM21	MGT4A_HUMAN	alpha-1,3-mannosyl-glycoprotein	275	Lumenal (Potential).				N-glycan processing|post-translational protein modification|protein N-linked glycosylation via asparagine	extracellular region|Golgi membrane|integral to membrane	alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity|metal ion binding			skin(1)	1																		---	---	---	---
AFF3	3899	broad.mit.edu	37	2	100185503	100185504	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:100185503_100185504insT	uc002tag.2	-						AFF3_uc002taf.2_Intron	NM_002285	NP_002276			AF4/FMR2 family, member 3 isoform 1						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(2)|pancreas(1)|lung(1)|kidney(1)|skin(1)	6																		---	---	---	---
MFSD9	84804	broad.mit.edu	37	2	103343084	103343085	+	Intron	DEL	CA	-	-	rs112803412		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:103343084_103343085delCA	uc002tcb.2	-						MFSD9_uc010fja.2_Intron	NM_032718	NP_116107			major facilitator superfamily domain containing						transmembrane transport	integral to membrane|plasma membrane	transporter activity			ovary(2)|breast(2)	4																		---	---	---	---
TMEM182	130827	broad.mit.edu	37	2	103378582	103378585	+	5'UTR	DEL	TTTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:103378582_103378585delTTTT	uc010fjb.2	+	1					TMEM182_uc002tcc.3_Intron|TMEM182_uc002tcd.3_Intron	NM_144632	NP_653233			transmembrane protein 182 precursor							integral to membrane					0																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	105387604	105387605	+	IGR	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:105387604_105387605insA								LOC150568 (258390 upstream) : POU3F3 (84364 downstream)																																			---	---	---	---
RGPD3	653489	broad.mit.edu	37	2	107032131	107032140	+	Intron	DEL	AAAAAAAAAA	-	-	rs72300272		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:107032131_107032140delAAAAAAAAAA	uc010ywi.1	-							NM_001144013	NP_001137485			RANBP2-like and GRIP domain containing 3						intracellular transport		binding			ovary(1)	1																		---	---	---	---
RGPD3	653489	broad.mit.edu	37	2	107034135	107034135	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:107034135delT	uc010ywi.1	-							NM_001144013	NP_001137485			RANBP2-like and GRIP domain containing 3						intracellular transport		binding			ovary(1)	1																		---	---	---	---
ST6GAL2	84620	broad.mit.edu	37	2	107450798	107450799	+	Intron	INS	-	AT	AT			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:107450798_107450799insAT	uc002tdq.2	-						ST6GAL2_uc002tdr.2_Intron|ST6GAL2_uc002tds.3_Intron	NM_001142351	NP_001135823			ST6 beta-galactosamide						growth|multicellular organismal development|oligosaccharide metabolic process|protein glycosylation	Golgi cisterna membrane|integral to Golgi membrane	beta-galactoside alpha-2,6-sialyltransferase activity			pancreas(6)|ovary(4)|skin(1)	11																		---	---	---	---
RGPD4	285190	broad.mit.edu	37	2	108453048	108453048	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:108453048delT	uc010ywk.1	+						RGPD4_uc002tdu.2_5'Flank	NM_182588	NP_872394			RANBP2-like and GRIP domain containing 4						intracellular transport		binding			skin(2)	2																		---	---	---	---
RANBP2	5903	broad.mit.edu	37	2	109368319	109368319	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:109368319delT	uc002tem.3	+							NM_006267	NP_006258			RAN binding protein 2						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA transport|protein folding|protein import into nucleus|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|nuclear pore	peptidyl-prolyl cis-trans isomerase activity|Ran GTPase binding|zinc ion binding		RANBP2/ALK(16)	soft_tissue(16)|lung(1)|pancreas(1)	18																		---	---	---	---
ANAPC1	64682	broad.mit.edu	37	2	112563643	112563643	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:112563643delA	uc002thi.2	-							NM_022662	NP_073153			anaphase promoting complex subunit 1						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell division|mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|cytosol|nucleoplasm				skin(2)	2																		---	---	---	---
IWS1	55677	broad.mit.edu	37	2	128238536	128238536	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128238536delA	uc002ton.2	-	14						NM_017969	NP_060439			IWS1 homolog						transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.0735)														---	---	---	---
WDR33	55339	broad.mit.edu	37	2	128478163	128478163	+	Intron	DEL	T	-	-	rs72166193		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128478163delT	uc002tpg.1	-							NM_018383	NP_060853			WD repeat domain 33 isoform 1						postreplication repair|spermatogenesis	collagen|nucleus	protein binding				0	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.0695)														---	---	---	---
Unknown	0	broad.mit.edu	37	2	128825103	128825104	+	IGR	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128825103_128825104delAA								SAP130 (39470 upstream) : UGGT1 (23650 downstream)																																			---	---	---	---
LOC150776	150776	broad.mit.edu	37	2	132269134	132269134	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:132269134delT	uc010fna.2	+						LOC150776_uc010zax.1_Intron|LOC150776_uc010zay.1_Intron|LOC150776_uc010zaz.1_Intron|LOC150776_uc002tsy.3_Intron					Homo sapiens cDNA FLJ61219 complete cds, highly similar to Homo sapiens sphingomyelin phosphodiesterase 4, neutral membrane, transcript variant 2, mRNA.												0																		---	---	---	---
SPOPL	339745	broad.mit.edu	37	2	139322477	139322477	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:139322477delT	uc002tvh.2	+							NM_001001664	NP_001001664			speckle-type POZ protein-like							nucleus				skin(2)|breast(1)	3				BRCA - Breast invasive adenocarcinoma(221;0.0296)														---	---	---	---
LRP1B	53353	broad.mit.edu	37	2	142011893	142011893	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:142011893delA	uc002tvj.1	-						LRP1B_uc010fnl.1_Intron	NM_018557	NP_061027			low density lipoprotein-related protein 1B						protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)											TSP Lung(27;0.18)			---	---	---	---
TNFAIP6	7130	broad.mit.edu	37	2	152214427	152214427	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152214427delT	uc002txk.2	+							NM_007115	NP_009046			tumor necrosis factor, alpha-induced protein 6						cell adhesion|cell-cell signaling|inflammatory response|signal transduction		hyaluronic acid binding				0				BRCA - Breast invasive adenocarcinoma(221;0.131)														---	---	---	---
RIF1	55183	broad.mit.edu	37	2	152293643	152293643	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152293643delT	uc002txm.2	+						RIF1_uc002txl.2_Intron|RIF1_uc010fnv.1_Intron|RIF1_uc002txn.2_Intron|RIF1_uc002txo.2_Intron|RIF1_uc010zby.1_Intron	NM_018151	NP_060621			RAP1 interacting factor 1						cell cycle|response to DNA damage stimulus	chromosome, telomeric region|cytoplasm|nucleus|spindle	binding			ovary(5)|breast(4)|skin(3)|lung(2)|kidney(1)	15				BRCA - Breast invasive adenocarcinoma(221;0.0429)														---	---	---	---
TANC1	85461	broad.mit.edu	37	2	160006760	160006760	+	Intron	DEL	T	-	-	rs111498713		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160006760delT	uc002uag.2	+						TANC1_uc010fol.1_Intron|TANC1_uc010zcm.1_Intron|TANC1_uc010fom.1_Intron|TANC1_uc002uah.1_3'UTR	NM_033394	NP_203752			tetratricopeptide repeat, ankyrin repeat and							cell junction|postsynaptic density|postsynaptic membrane	binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
LY75	4065	broad.mit.edu	37	2	160634565	160634566	+	Intron	DEL	CC	-	-	rs35013477		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160634565_160634566delCC	uc002ubb.3	-						LY75_uc010fos.2_Intron|CD302_uc002uba.2_Intron|CD302_uc010zco.1_Intron	NM_002349	NP_002340			lymphocyte antigen 75 precursor						endocytosis|immune response|inflammatory response	integral to plasma membrane	receptor activity|sugar binding				0				COAD - Colon adenocarcinoma(177;0.132)														---	---	---	---
ITGB6	3694	broad.mit.edu	37	2	160968845	160968845	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160968845delT	uc002ubh.2	-						ITGB6_uc010fou.2_Intron|ITGB6_uc010zcq.1_Intron|ITGB6_uc010fov.1_Intron	NM_000888	NP_000879			integrin, beta 6 precursor						cell-matrix adhesion|integrin-mediated signaling pathway|interspecies interaction between organisms|multicellular organismal development	integrin complex	receptor activity			ovary(1)|lung(1)|skin(1)	3																		---	---	---	---
PSMD14	10213	broad.mit.edu	37	2	162251500	162251502	+	Intron	DEL	TTT	-	-	rs112832377		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:162251500_162251502delTTT	uc002ubu.2	+							NM_005805	NP_005796			proteasome 26S subunit, non-ATPase 14						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K63-linked deubiquitination|regulation of apoptosis|regulation of cellular amino acid metabolic process|regulation of proteasomal protein catabolic process|S phase of mitotic cell cycle|viral reproduction	proteasome complex	endopeptidase activator activity|metal ion binding|metallopeptidase activity|proteasome binding|ubiquitin thiolesterase activity			breast(1)	1																		---	---	---	---
SCN9A	6335	broad.mit.edu	37	2	167160479	167160479	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:167160479delT	uc010fpl.2	-						SCN9A_uc002udr.1_Intron|SCN9A_uc002uds.1_Intron|SCN9A_uc002udt.1_Intron	NM_002977	NP_002968			sodium channel, voltage-gated, type IX, alpha							voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(6)|central_nervous_system(5)|skin(2)	13					Lamotrigine(DB00555)|Lidocaine(DB00281)													---	---	---	---
PRKRA	8575	broad.mit.edu	37	2	179311995	179311998	+	Intron	DEL	AAAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179311995_179311998delAAAA	uc002umf.2	-						PRKRA_uc002umd.2_Intron|PRKRA_uc002ume.2_Intron|PRKRA_uc002umg.2_Intron	NM_003690	NP_003681			protein kinase, interferon-inducible double						immune response|negative regulation of cell proliferation|production of siRNA involved in RNA interference|response to virus	perinuclear region of cytoplasm	double-stranded RNA binding|enzyme activator activity|protein homodimerization activity			central_nervous_system(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.00406)|Epithelial(96;0.00634)|all cancers(119;0.0265)															---	---	---	---
FKBP7	51661	broad.mit.edu	37	2	179342865	179342866	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179342865_179342866insT	uc002umk.2	-						FKBP7_uc002umm.2_Intron|FKBP7_uc002uml.2_Intron|FKBP7_uc010zff.1_Intron|PLEKHA3_uc002umn.2_5'Flank	NM_181342	NP_851939			FK506 binding protein 7 isoform a precursor						protein folding	endoplasmic reticulum lumen|membrane	calcium ion binding|FK506 binding|peptidyl-prolyl cis-trans isomerase activity				0			OV - Ovarian serous cystadenocarcinoma(117;0.00406)|Epithelial(96;0.0159)|all cancers(119;0.0564)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179505993	179505993	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179505993delT	uc010zfg.1	-	169	33128	c.32904delA	c.(32902-32904)AAAfs	p.K10968fs	TTN_uc010zfh.1_Frame_Shift_Del_p.K4663fs|TTN_uc010zfi.1_Frame_Shift_Del_p.K4596fs|TTN_uc010zfj.1_Frame_Shift_Del_p.K4471fs|TTN_uc010fre.1_Frame_Shift_Del_p.K846fs|TTN_uc002umw.1_Intron|TTN_uc002umx.1_Intron	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	11895							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
SESTD1	91404	broad.mit.edu	37	2	179989383	179989383	+	Intron	DEL	T	-	-	rs77134645		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179989383delT	uc002uni.3	-						SESTD1_uc002unh.3_5'Flank	NM_178123	NP_835224			SEC14 and spectrin domains 1						regulation of calcium ion transport via voltage-gated calcium channel activity		phosphatidic acid binding|phosphatidylinositol-3,4-bisphosphate binding|phosphatidylinositol-3,5-bisphosphate binding|phosphatidylinositol-3-phosphate binding|phosphatidylinositol-4,5-bisphosphate binding|phosphatidylinositol-4-phosphate binding|phosphatidylinositol-5-phosphate binding|protein binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.0344)|Epithelial(96;0.0531)|all cancers(119;0.147)															---	---	---	---
SESTD1	91404	broad.mit.edu	37	2	180056424	180056424	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:180056424delA	uc002uni.3	-							NM_178123	NP_835224			SEC14 and spectrin domains 1						regulation of calcium ion transport via voltage-gated calcium channel activity		phosphatidic acid binding|phosphatidylinositol-3,4-bisphosphate binding|phosphatidylinositol-3,5-bisphosphate binding|phosphatidylinositol-3-phosphate binding|phosphatidylinositol-4,5-bisphosphate binding|phosphatidylinositol-4-phosphate binding|phosphatidylinositol-5-phosphate binding|protein binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.0344)|Epithelial(96;0.0531)|all cancers(119;0.147)															---	---	---	---
CWC22	57703	broad.mit.edu	37	2	180819771	180819771	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:180819771delA	uc010frh.1	-						CWC22_uc002uno.2_Intron|CWC22_uc002unp.2_Intron	NM_020943	NP_065994			CWC22 spliceosome-associated protein homolog							catalytic step 2 spliceosome	protein binding|RNA binding				0																		---	---	---	---
SSFA2	6744	broad.mit.edu	37	2	182765412	182765412	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:182765412delT	uc002uoi.2	+						SSFA2_uc002uoh.2_Intron|SSFA2_uc002uoj.2_Intron|SSFA2_uc002uok.2_Intron|SSFA2_uc010zfo.1_Intron|SSFA2_uc002uol.2_Intron	NM_001130445	NP_001123917			sperm specific antigen 2 isoform 1							cytoplasm|plasma membrane	actin binding			breast(1)|central_nervous_system(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.0856)															---	---	---	---
CALCRL	10203	broad.mit.edu	37	2	188224010	188224010	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:188224010delA	uc002upv.3	-						CALCRL_uc010frt.2_Intron	NM_005795	NP_005786			calcitonin receptor-like precursor							integral to plasma membrane				lung(3)|ovary(1)	4			OV - Ovarian serous cystadenocarcinoma(117;0.0554)|Epithelial(96;0.227)															---	---	---	---
COL3A1	1281	broad.mit.edu	37	2	189861726	189861727	+	Intron	DEL	TG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:189861726_189861727delTG	uc002uqj.1	+							NM_000090	NP_000081			collagen type III alpha 1 preproprotein						axon guidance|cell-matrix adhesion|collagen biosynthetic process|collagen fibril organization|fibril organization|heart development|integrin-mediated signaling pathway|negative regulation of immune response|peptide cross-linking|platelet activation|response to cytokine stimulus|response to radiation|skin development|transforming growth factor beta receptor signaling pathway	collagen type III|extracellular space	extracellular matrix structural constituent|integrin binding|platelet-derived growth factor binding			central_nervous_system(7)|ovary(4)|large_intestine(2)	13			OV - Ovarian serous cystadenocarcinoma(117;0.0106)|Epithelial(96;0.141)		Collagenase(DB00048)|Palifermin(DB00039)													---	---	---	---
WDR75	84128	broad.mit.edu	37	2	190313093	190313093	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:190313093delT	uc002uql.1	+						WDR75_uc002uqm.1_Intron|WDR75_uc002uqn.1_Intron	NM_032168	NP_115544			WD repeat domain 75							nucleolus				ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.00105)|Epithelial(96;0.0129)|all cancers(119;0.0456)															---	---	---	---
GLS	2744	broad.mit.edu	37	2	191797646	191797646	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:191797646delT	uc002usf.2	+						GLS_uc002use.2_3'UTR|GLS_uc002usg.1_3'UTR|GLS_uc002ush.2_Intron|GLS_uc010zgi.1_Intron|GLS_uc010zgj.1_Intron	NM_014905	NP_055720			glutaminase precursor						cellular amino acid biosynthetic process|glutamate secretion|glutamine catabolic process|neurotransmitter secretion	mitochondrial matrix	glutaminase activity			ovary(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.00625)|Epithelial(96;0.0744)|all cancers(119;0.181)		L-Glutamic Acid(DB00142)|L-Glutamine(DB00130)													---	---	---	---
PGAP1	80055	broad.mit.edu	37	2	197755382	197755382	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197755382delA	uc002utw.2	-						PGAP1_uc002utx.2_Intron|PGAP1_uc002uty.1_Intron|PGAP1_uc010zgv.1_Intron	NM_024989	NP_079265			GPI deacylase						attachment of GPI anchor to protein|C-terminal protein lipidation|intracellular protein transport|myo-inositol transport	integral to membrane|intrinsic to endoplasmic reticulum membrane	nuclease activity|phosphoric ester hydrolase activity			ovary(3)|central_nervous_system(1)	4																		---	---	---	---
SF3B1	23451	broad.mit.edu	37	2	198257295	198257295	+	Intron	DEL	G	-	-	rs72167899		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:198257295delG	uc002uue.2	-							NM_012433	NP_036565			splicing factor 3b, subunit 1 isoform 1						nuclear mRNA splicing, via spliceosome	catalytic step 2 spliceosome|nuclear speck|U12-type spliceosomal complex	protein binding			pancreas(3)|ovary(1)|breast(1)|skin(1)	6			OV - Ovarian serous cystadenocarcinoma(117;0.246)															---	---	---	---
MOBKL3	25843	broad.mit.edu	37	2	198404920	198404920	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:198404920delT	uc002uun.3	+						MOBKL3_uc002uum.3_Intron|MOBKL3_uc010fsn.2_Intron|MOBKL3_uc010fso.2_Intron|MOBKL3_uc010zgz.1_Intron	NM_015387	NP_056202			Mps One Binder kinase activator-like 3 isoform						transport	Golgi cisterna membrane|perinuclear region of cytoplasm	metal ion binding|protein binding				0			Epithelial(96;0.225)															---	---	---	---
SATB2	23314	broad.mit.edu	37	2	200233218	200233219	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:200233218_200233219insA	uc002uuy.1	-						SATB2_uc010fsq.1_Intron|SATB2_uc002uuz.1_Intron|SATB2_uc002uva.1_Intron	NM_015265	NP_056080			SATB homeobox 2							cytoplasm|nuclear matrix	sequence-specific DNA binding transcription factor activity			ovary(1)	1																		---	---	---	---
AOX1	316	broad.mit.edu	37	2	201460262	201460262	+	Intron	DEL	A	-	-	rs150008050	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:201460262delA	uc002uvx.2	+							NM_001159	NP_001150			aldehyde oxidase 1						inflammatory response|reactive oxygen species metabolic process	cytoplasm	2 iron, 2 sulfur cluster binding|aldehyde oxidase activity|flavin adenine dinucleotide binding|iron ion binding|NAD binding|xanthine dehydrogenase activity			ovary(4)|pancreas(1)|skin(1)	6					Brimonidine(DB00484)|Chlorpromazine(DB00477)|Famciclovir(DB00426)|Menadione(DB00170)|Methotrexate(DB00563)|NADH(DB00157)|Palonosetron(DB00377)|Penciclovir(DB00299)|Raloxifene(DB00481)|Zaleplon(DB00962)|Zonisamide(DB00909)													---	---	---	---
BZW1	9689	broad.mit.edu	37	2	201686851	201686851	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:201686851delT	uc010zhg.1	+						BZW1_uc002uwc.2_Intron	NM_014670	NP_055485			basic leucine zipper and W2 domains 1						regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm	protein binding				0																		---	---	---	---
TRAK2	66008	broad.mit.edu	37	2	202260297	202260297	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202260297delA	uc002uyb.3	-						TRAK2_uc002uyc.2_Intron	NM_015049	NP_055864			trafficking protein, kinesin binding 2							early endosome|plasma membrane	GABA receptor binding				0																		---	---	---	---
ALS2CR11	151254	broad.mit.edu	37	2	202483476	202483476	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202483476delA	uc002uye.2	-						ALS2CR11_uc002uyf.2_Intron|ALS2CR11_uc010fti.2_Intron	NM_152525	NP_689738			amyotrophic lateral sclerosis 2 (juvenile)											large_intestine(1)|ovary(1)|skin(1)	3																		---	---	---	---
ALS2	57679	broad.mit.edu	37	2	202603193	202603193	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202603193delT	uc002uyo.2	-						ALS2_uc002uyp.3_Intron|ALS2_uc010ftl.2_Intron	NM_020919	NP_065970			alsin isoform 1						cell death|endosome organization|positive regulation of Rac GTPase activity|regulation of endosome size	centrosome|cytosol|early endosome|growth cone|lamellipodium|protein complex|ruffle	protein homodimerization activity|protein serine/threonine kinase activator activity|Rab GTPase binding|Rab guanyl-nucleotide exchange factor activity|Rac guanyl-nucleotide exchange factor activity|Ran guanyl-nucleotide exchange factor activity			skin(5)|lung(1)|breast(1)	7																		---	---	---	---
ABI2	10152	broad.mit.edu	37	2	204291747	204291747	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:204291747delA	uc002vaa.2	+						ABI2_uc002uzz.2_Intron|ABI2_uc010zih.1_Intron|ABI2_uc010zii.1_Intron|ABI2_uc010zij.1_Intron|ABI2_uc002vab.2_Intron|ABI2_uc010zik.1_Intron|ABI2_uc010zil.1_Intron|ABI2_uc010zim.1_Intron|ABI2_uc002vac.2_Intron|ABI2_uc010zin.1_Intron	NM_005759	NP_005750			abl interactor 2						actin polymerization or depolymerization|cell migration|peptidyl-tyrosine phosphorylation	cytoskeleton|cytosol|filopodium|lamellipodium	cytoskeletal adaptor activity|DNA binding|kinase binding|proline-rich region binding|SH3 domain binding|ubiquitin protein ligase binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	204628940	204628940	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:204628940delT								CD28 (26384 upstream) : CTLA4 (103569 downstream)																																			---	---	---	---
MDH1B	130752	broad.mit.edu	37	2	207604137	207604137	+	Intron	DEL	A	-	-	rs141240854		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:207604137delA	uc002vbs.2	-						MDH1B_uc010ziw.1_Intron|MDH1B_uc010fui.2_Intron|MDH1B_uc010fuj.2_Intron|MDH1B_uc002vbt.2_Intron	NM_001039845	NP_001034934			malate dehydrogenase 1B, NAD (soluble)						carbohydrate metabolic process|malate metabolic process|tricarboxylic acid cycle		binding|malate dehydrogenase activity			ovary(3)|kidney(1)	4				LUSC - Lung squamous cell carcinoma(261;0.0763)|Epithelial(149;0.131)|Lung(261;0.145)														---	---	---	---
MDH1B	130752	broad.mit.edu	37	2	207610905	207610905	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:207610905delA	uc002vbs.2	-						MDH1B_uc010ziw.1_Intron|MDH1B_uc010fui.2_Intron|MDH1B_uc010fuj.2_Intron|MDH1B_uc002vbt.2_Intron	NM_001039845	NP_001034934			malate dehydrogenase 1B, NAD (soluble)						carbohydrate metabolic process|malate metabolic process|tricarboxylic acid cycle		binding|malate dehydrogenase activity			ovary(3)|kidney(1)	4				LUSC - Lung squamous cell carcinoma(261;0.0763)|Epithelial(149;0.131)|Lung(261;0.145)														---	---	---	---
DES	1674	broad.mit.edu	37	2	220286392	220286393	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220286392_220286393delTT	uc002vll.2	+							NM_001927	NP_001918			desmin						cytoskeleton organization|muscle filament sliding|regulation of heart contraction	cytosol|Z disc	protein binding|structural constituent of cytoskeleton			central_nervous_system(2)	2		Renal(207;0.0183)		Epithelial(149;5.25e-07)|all cancers(144;0.000103)|Lung(261;0.00533)|LUSC - Lung squamous cell carcinoma(224;0.008)														---	---	---	---
EPHA4	2043	broad.mit.edu	37	2	222310820	222310820	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:222310820delT	uc002vmq.2	-						EPHA4_uc002vmr.2_Intron|EPHA4_uc010zlm.1_Intron|EPHA4_uc010zln.1_Intron	NM_004438	NP_004429			ephrin receptor EphA4 precursor							integral to plasma membrane	ATP binding|ephrin receptor activity			lung(6)|large_intestine(2)|central_nervous_system(2)|urinary_tract(1)|skin(1)	12		Renal(207;0.0183)		Epithelial(121;5.38e-09)|all cancers(144;2.47e-06)|LUSC - Lung squamous cell carcinoma(224;0.0115)|Lung(261;0.0154)														---	---	---	---
WDFY1	57590	broad.mit.edu	37	2	224763643	224763643	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:224763643delA	uc002vnq.2	-							NM_020830	NP_065881			WD repeat and FYVE domain containing 1							cytosol|early endosome|nucleus	1-phosphatidylinositol binding|zinc ion binding			lung(1)	1		all_lung(227;0.00682)|Lung NSC(271;0.00859)|Renal(207;0.0112)|all_hematologic(139;0.189)		Epithelial(121;5.34e-10)|all cancers(144;1.67e-07)|Lung(261;0.00807)|LUSC - Lung squamous cell carcinoma(224;0.00843)														---	---	---	---
RHBDD1	84236	broad.mit.edu	37	2	227771326	227771326	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:227771326delT	uc002voi.2	+						RHBDD1_uc010fxc.2_Intron|RHBDD1_uc002voj.2_5'Flank	NM_032276	NP_115652			rhomboid domain containing 1							integral to membrane	serine-type endopeptidase activity			ovary(1)	1		Renal(207;0.023)|all_lung(227;0.13)|Esophageal squamous(248;0.23)|all_hematologic(139;0.248)		Epithelial(121;1.47e-11)|all cancers(144;1.52e-08)|Lung(261;0.0128)|LUSC - Lung squamous cell carcinoma(224;0.0175)														---	---	---	---
COL4A4	1286	broad.mit.edu	37	2	227916908	227916908	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:227916908delA	uc010zlt.1	-							NM_000092	NP_000083			alpha 4 type IV collagen precursor						axon guidance|glomerular basement membrane development	basal lamina|collagen type IV	extracellular matrix structural constituent|protein binding			ovary(5)|central_nervous_system(3)|pancreas(1)|breast(1)|skin(1)	11		Renal(207;0.00844)|all_lung(227;0.0187)|Lung NSC(271;0.0879)|all_hematologic(139;0.21)|Esophageal squamous(248;0.242)		Epithelial(121;6.7e-11)|all cancers(144;5.39e-08)|Lung(261;0.0132)|LUSC - Lung squamous cell carcinoma(224;0.0181)														---	---	---	---
DIS3L2	129563	broad.mit.edu	37	2	232952456	232952456	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:232952456delT	uc010fxz.2	+						DIS3L2_uc002vsm.3_Intron|DIS3L2_uc002vsn.1_Intron|DIS3L2_uc002vso.2_Intron	NM_152383	NP_689596			DIS3 mitotic control homolog (S.								exonuclease activity|ribonuclease activity|RNA binding			ovary(1)|breast(1)|central_nervous_system(1)	3		all_hematologic(139;0.00809)|Renal(207;0.0113)|Acute lymphoblastic leukemia(138;0.0195)|all_lung(227;0.0465)|Lung NSC(271;0.136)		Epithelial(121;1.6e-13)|BRCA - Breast invasive adenocarcinoma(100;0.00104)|LUSC - Lung squamous cell carcinoma(224;0.0109)|Lung(119;0.0149)														---	---	---	---
DIS3L2	129563	broad.mit.edu	37	2	232995570	232995570	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:232995570delA	uc010fxz.2	+						DIS3L2_uc002vsm.3_Intron|DIS3L2_uc002vsn.1_3'UTR|DIS3L2_uc002vso.2_Intron	NM_152383	NP_689596			DIS3 mitotic control homolog (S.								exonuclease activity|ribonuclease activity|RNA binding			ovary(1)|breast(1)|central_nervous_system(1)	3		all_hematologic(139;0.00809)|Renal(207;0.0113)|Acute lymphoblastic leukemia(138;0.0195)|all_lung(227;0.0465)|Lung NSC(271;0.136)		Epithelial(121;1.6e-13)|BRCA - Breast invasive adenocarcinoma(100;0.00104)|LUSC - Lung squamous cell carcinoma(224;0.0109)|Lung(119;0.0149)														---	---	---	---
INPP5D	3635	broad.mit.edu	37	2	234078560	234078560	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:234078560delC	uc010zmo.1	+						INPP5D_uc010zmp.1_Intron	NM_001017915	NP_001017915			SH2 containing inositol phosphatase isoform a						apoptosis|blood coagulation|leukocyte migration|T cell receptor signaling pathway	cytosol	inositol-polyphosphate 5-phosphatase activity|phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity|SH3 domain binding			ovary(1)|central_nervous_system(1)	2		Breast(86;0.0013)|Renal(207;0.00339)|all_hematologic(139;0.0116)|all_lung(227;0.0273)|Acute lymphoblastic leukemia(138;0.0328)|Lung NSC(271;0.0843)		Epithelial(121;1.16e-17)|BRCA - Breast invasive adenocarcinoma(100;0.000479)|LUSC - Lung squamous cell carcinoma(224;0.00655)|Lung(119;0.00802)|GBM - Glioblastoma multiforme(43;0.0185)														---	---	---	---
TRPM8	79054	broad.mit.edu	37	2	234878164	234878165	+	Intron	INS	-	T	T	rs146973167	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:234878164_234878165insT	uc002vvh.2	+						TRPM8_uc010fyj.2_Intron	NM_024080	NP_076985			transient receptor potential cation channel,							integral to membrane				skin(4)	4		Breast(86;0.00205)|Renal(207;0.00694)|all_lung(227;0.0129)|Lung NSC(271;0.0408)|all_hematologic(139;0.0753)|Acute lymphoblastic leukemia(138;0.224)		Epithelial(121;1.19e-17)|BRCA - Breast invasive adenocarcinoma(100;0.000139)|Lung(119;0.00758)|LUSC - Lung squamous cell carcinoma(224;0.0108)	Menthol(DB00825)													---	---	---	---
CAPN10	11132	broad.mit.edu	37	2	241529076	241529076	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:241529076delG	uc002vzk.1	+						CAPN10_uc010zoh.1_Intron|CAPN10_uc002vzl.1_Intron|CAPN10_uc002vzm.1_Intron|CAPN10_uc002vzn.1_Intron|CAPN10_uc002vzo.1_Intron|CAPN10_uc010fzg.1_Intron|CAPN10_uc002vzp.1_Intron|CAPN10_uc002vzq.1_Intron	NM_023083	NP_075571			calpain 10 isoform a						actin cytoskeleton reorganization|cellular response to insulin stimulus|positive regulation of apoptosis|positive regulation of glucose import|positive regulation of insulin secretion|positive regulation of intracellular transport|proteolysis	cytosol|plasma membrane	calcium-dependent cysteine-type endopeptidase activity|cytoskeletal protein binding|SNARE binding			ovary(3)|large_intestine(2)|lung(1)	6		all_epithelial(40;1.72e-15)|Breast(86;2.14e-05)|Renal(207;0.00183)|Ovarian(221;0.0228)|all_lung(227;0.0294)|all_neural(83;0.0459)|Lung NSC(271;0.094)|all_hematologic(139;0.158)|Melanoma(123;0.16)|Hepatocellular(293;0.244)		Epithelial(32;1.13e-31)|all cancers(36;3.24e-29)|OV - Ovarian serous cystadenocarcinoma(60;2.82e-15)|Kidney(56;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;5.1e-06)|Lung(119;0.00168)|Colorectal(34;0.00495)|LUSC - Lung squamous cell carcinoma(224;0.00813)|COAD - Colon adenocarcinoma(134;0.032)														---	---	---	---
NEU4	129807	broad.mit.edu	37	2	242758455	242758456	+	3'UTR	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242758455_242758456insG	uc010fzr.2	+	4					NEU4_uc002wcl.2_RNA|NEU4_uc002wcm.2_3'UTR|NEU4_uc002wcn.1_3'UTR|NEU4_uc002wco.1_3'UTR|NEU4_uc002wcp.1_3'UTR	NM_080741	NP_542779			sialidase 4							lysosomal lumen|organelle inner membrane	exo-alpha-sialidase activity|protein binding				0		all_cancers(19;1.09e-40)|all_epithelial(40;2.03e-18)|Breast(86;1.53e-05)|all_lung(227;0.00338)|Renal(207;0.00502)|Ovarian(221;0.00716)|Lung NSC(271;0.012)|Esophageal squamous(248;0.129)|Melanoma(123;0.144)|all_hematologic(139;0.158)|all_neural(83;0.243)|Hepatocellular(293;0.244)		Epithelial(32;3.84e-33)|all cancers(36;8.08e-31)|OV - Ovarian serous cystadenocarcinoma(60;7.41e-15)|Kidney(56;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;1.63e-06)|Lung(119;0.000152)|LUSC - Lung squamous cell carcinoma(224;0.00154)|Colorectal(34;0.0129)|COAD - Colon adenocarcinoma(134;0.0825)														---	---	---	---
GRM7	2917	broad.mit.edu	37	3	7456574	7456575	+	Intron	DEL	TT	-	-	rs79755836		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:7456574_7456575delTT	uc003bqm.2	+						GRM7_uc011ata.1_Intron|GRM7_uc011atb.1_Intron|GRM7_uc010hcf.2_Intron|GRM7_uc011atc.1_Intron|GRM7_uc010hcg.2_Intron|GRM7_uc003bql.2_Intron|GRM7_uc003bqn.1_Intron	NM_000844	NP_000835			glutamate receptor, metabotropic 7 isoform a						negative regulation of adenylate cyclase activity|negative regulation of cAMP biosynthetic process|negative regulation of glutamate secretion|sensory perception of smell|sensory perception of sound|synaptic transmission	asymmetric synapse|axon|cell cortex|dendritic shaft|integral to plasma membrane|postsynaptic membrane|presynaptic active zone	adenylate cyclase inhibitor activity|calcium ion binding|glutamate binding|group III metabotropic glutamate receptor activity|PDZ domain binding|serine binding			ovary(4)|lung(3)	7					L-Glutamic Acid(DB00142)													---	---	---	---
OGG1	4968	broad.mit.edu	37	3	9797996	9797996	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:9797996delA	uc003bsi.2	+						OGG1_uc003bsh.2_Intron|OGG1_uc003bsj.2_Intron|OGG1_uc003bsk.2_Intron|OGG1_uc003bsl.2_Intron|OGG1_uc003bsm.2_Intron|OGG1_uc003bsn.2_Intron|OGG1_uc003bso.2_Intron|OGG1_uc003bsp.1_Intron|OGG1_uc010hcm.1_Intron|OGG1_uc003bsq.1_Intron|OGG1_uc003bsr.1_Intron	NM_002542	NP_002533			8-oxoguanine DNA-glycosylase 1 isoform 1a						depurination|nucleotide-excision repair|regulation of protein import into nucleus, translocation|regulation of transcription, DNA-dependent|response to oxidative stress|response to radiation	mitochondrion|nuclear matrix|nuclear speck	damaged DNA binding|endonuclease activity|oxidized purine base lesion DNA N-glycosylase activity|protein binding				0	Medulloblastoma(99;0.227)												BER_DNA_glycosylases					---	---	---	---
IL17RE	132014	broad.mit.edu	37	3	9953492	9953492	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:9953492delT	uc003btu.2	+						CIDEC_uc003bto.2_Intron|IL17RE_uc003btw.2_Intron|IL17RE_uc003btx.2_Intron|IL17RE_uc010hcq.2_Intron|IL17RE_uc003bty.2_Intron	NM_153483	NP_705616			interleukin 17 receptor E isoform 1							cytoplasm|extracellular region|integral to membrane	receptor activity			central_nervous_system(1)	1				OV - Ovarian serous cystadenocarcinoma(96;5.34e-64)														---	---	---	---
PRRT3	285368	broad.mit.edu	37	3	9991859	9991859	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:9991859delA	uc003bul.2	-						CIDEC_uc003bto.2_Intron|PRRT3_uc003buk.2_Intron|PRRT3_uc003bum.2_Intron	NM_207351	NP_997234			proline-rich transmembrane protein 3 precursor							integral to membrane					0																		---	---	---	---
FANCD2	2177	broad.mit.edu	37	3	10119557	10119557	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10119557delA	uc003buw.2	+						FANCD2_uc003bux.1_Intron|FANCD2_uc003buy.1_Intron|FANCD2_uc010hcw.1_Intron	NM_033084	NP_149075			Fanconi anemia complementation group D2 isoform						DNA repair|response to gamma radiation	nucleoplasm	protein binding|protein binding			central_nervous_system(2)|ovary(1)|skin(1)	4				OV - Ovarian serous cystadenocarcinoma(96;0.148)				D|Mis|N|F			AML|leukemia		Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia				---	---	---	---
ATP2B2	491	broad.mit.edu	37	3	10427117	10427117	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10427117delA	uc003bvt.2	-						ATP2B2_uc003bvv.2_Intron|ATP2B2_uc003bvw.2_Intron|ATP2B2_uc010hdo.2_Intron	NM_001001331	NP_001001331			plasma membrane calcium ATPase 2 isoform 1						ATP biosynthetic process|cytosolic calcium ion homeostasis|platelet activation	cytosol|integral to membrane|plasma membrane	ATP binding|ATP binding|calcium ion binding|calcium-transporting ATPase activity|calcium-transporting ATPase activity|calmodulin binding|calmodulin binding|metal ion binding|PDZ domain binding|protein C-terminus binding			ovary(3)|skin(2)|central_nervous_system(1)	6																		---	---	---	---
TMEM40	55287	broad.mit.edu	37	3	12791467	12791468	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:12791467_12791468delAA	uc003bxg.1	-						TMEM40_uc003bxh.1_Intron|TMEM40_uc003bxi.1_Intron|TMEM40_uc011auv.1_Intron	NM_018306	NP_060776			transmembrane protein 40							integral to membrane					0																		---	---	---	---
IQSEC1	9922	broad.mit.edu	37	3	13094263	13094264	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:13094263_13094264delTT	uc011auw.1	-							NM_001134382	NP_001127854			IQ motif and Sec7 domain 1 isoform a						regulation of ARF protein signal transduction	cytoplasm|nucleus	ARF guanyl-nucleotide exchange factor activity			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	3	14123259	14123259	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:14123259delA								TPRXL (15780 upstream) : CHCHD4 (30319 downstream)																																			---	---	---	---
XPC	7508	broad.mit.edu	37	3	14190590	14190592	+	Intron	DEL	TTT	-	-	rs111520695		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:14190590_14190592delTTT	uc011ave.1	-						XPC_uc011avf.1_Intron|XPC_uc011avg.1_Intron	NM_004628	NP_004619			xeroderma pigmentosum, complementation group C						nucleotide-excision repair, DNA damage recognition|nucleotide-excision repair, DNA damage removal	cytoplasm|nucleoplasm|XPC complex	bubble DNA binding|damaged DNA binding|loop DNA binding|protein binding|single-stranded DNA binding			ovary(2)|breast(1)	3								Mis|N|F|S			skin basal cell|skin squamous cell|melanoma		NER	Xeroderma_Pigmentosum				---	---	---	---
CAPN7	23473	broad.mit.edu	37	3	15259193	15259193	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:15259193delA	uc003bzn.2	+							NM_014296	NP_055111			calpain 7						proteolysis	nucleus	calcium-dependent cysteine-type endopeptidase activity			ovary(1)	1																		---	---	---	---
NR1D2	9975	broad.mit.edu	37	3	23997335	23997335	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:23997335delA	uc003ccs.2	+						NR1D2_uc010hfd.2_Intron|NR1D2_uc011awk.1_Intron	NM_005126	NP_005117			nuclear receptor subfamily 1, group D, member 2						regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	sequence-specific DNA binding|steroid hormone receptor activity|zinc ion binding			urinary_tract(1)|kidney(1)|skin(1)	3																		---	---	---	---
NEK10	152110	broad.mit.edu	37	3	27353769	27353769	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:27353769delA	uc003cdt.1	-							NM_199347	NP_955379			NIMA-related kinase 10 isoform 3								ATP binding|metal ion binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(5)|stomach(2)|central_nervous_system(2)|lung(2)|skin(1)|pancreas(1)	13																		---	---	---	---
SLC4A7	9497	broad.mit.edu	37	3	27479196	27479197	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:27479196_27479197delAA	uc003cdv.2	-						SLC4A7_uc011awu.1_Intron|SLC4A7_uc011awv.1_Intron|SLC4A7_uc003cdu.3_Intron|SLC4A7_uc011aww.1_Intron|SLC4A7_uc011awx.1_Intron|SLC4A7_uc011awy.1_Intron|SLC4A7_uc011awz.1_Intron|SLC4A7_uc011axa.1_Intron|SLC4A7_uc011axb.1_Intron|SLC4A7_uc010hfm.2_Intron|SLC4A7_uc003cdw.2_Intron	NM_003615	NP_003606			solute carrier family 4, sodium bicarbonate							apical plasma membrane|basolateral plasma membrane|integral to membrane|stereocilium	inorganic anion exchanger activity|protein binding|sodium:bicarbonate symporter activity			ovary(3)|central_nervous_system(1)|skin(1)	5																		---	---	---	---
Unknown	0	broad.mit.edu	37	3	32549855	32549855	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:32549855delA								CMTM6 (5452 upstream) : DYNC1LI1 (17614 downstream)																																			---	---	---	---
CRTAP	10491	broad.mit.edu	37	3	33173749	33173749	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:33173749delT	uc003cfl.3	+						CRTAP_uc010hfz.2_Intron|CRTAP_uc003cfm.2_Intron|CRTAP_uc003cfn.2_Intron	NM_006371	NP_006362			cartilage associated protein precursor							proteinaceous extracellular matrix	binding				0																OREG0015461	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PDCD6IP	10015	broad.mit.edu	37	3	33877438	33877438	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:33877438delT	uc003cfx.2	+						PDCD6IP_uc003cfy.2_Intron|PDCD6IP_uc011axw.1_Intron	NM_013374	NP_037506			programmed cell death 6 interacting protein						apoptosis|cell cycle|cell division|interspecies interaction between organisms|protein transport	cytosol|melanosome|microtubule organizing center	calcium-dependent protein binding			ovary(1)|skin(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	3	36810381	36810382	+	IGR	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:36810381_36810382delTT								DCLK3 (29029 upstream) : TRANK1 (57929 downstream)																																			---	---	---	---
WDR48	57599	broad.mit.edu	37	3	39119881	39119881	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:39119881delT	uc003cit.2	+						WDR48_uc011ayt.1_Intron|WDR48_uc011ayu.1_Intron|WDR48_uc011ayv.1_Intron|WDR48_uc003ciu.2_Intron	NM_020839	NP_065890			WD repeat domain 48						interspecies interaction between organisms|protein deubiquitination	lysosome|nucleus	protein binding			ovary(1)|breast(1)	2				KIRC - Kidney renal clear cell carcinoma(284;0.0588)|Kidney(284;0.0738)														---	---	---	---
LARS2	23395	broad.mit.edu	37	3	45561625	45561625	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:45561625delT	uc003cop.1	+						LARS2_uc010hit.1_Intron	NM_015340	NP_056155			leucyl-tRNA synthetase 2, mitochondrial						leucyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|leucine-tRNA ligase activity			upper_aerodigestive_tract(1)|ovary(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.0122)|KIRC - Kidney renal clear cell carcinoma(197;0.0313)|Kidney(197;0.0372)	L-Leucine(DB00149)													---	---	---	---
DHX30	22907	broad.mit.edu	37	3	47852443	47852444	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:47852443_47852444delTT	uc003cru.2	+						DHX30_uc003crr.3_Intron|DHX30_uc003crs.2_Intron|DHX30_uc003crt.2_Intron	NM_138615	NP_619520			DEAH (Asp-Glu-Ala-His) box polypeptide 30							mitochondrial nucleoid	ATP binding|ATP-dependent helicase activity|protein binding|RNA binding			ovary(2)|skin(2)	4				BRCA - Breast invasive adenocarcinoma(193;0.000696)|KIRC - Kidney renal clear cell carcinoma(197;0.00609)|Kidney(197;0.007)														---	---	---	---
PRKAR2A	5576	broad.mit.edu	37	3	48810664	48810664	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48810664delA	uc010hki.1	-						PRKAR2A_uc003cux.1_Intron|PRKAR2A_uc003cuy.1_Intron	NM_004157	NP_004148			cAMP-dependent protein kinase, regulatory						activation of phospholipase C activity|activation of protein kinase A activity|blood coagulation|cellular response to glucagon stimulus|energy reserve metabolic process|intracellular signal transduction|nerve growth factor receptor signaling pathway|regulation of insulin secretion|transmembrane transport|water transport	centrosome|cytosol|membrane fraction	cAMP binding|cAMP-dependent protein kinase regulator activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.000176)|Kidney(197;0.00246)|KIRC - Kidney renal clear cell carcinoma(197;0.00261)														---	---	---	---
ARIH2	10425	broad.mit.edu	37	3	48999022	48999022	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48999022delT	uc003cvb.2	+						ARIH2_uc003cvc.2_Intron|ARIH2_uc003cvf.2_Intron|ARIH2_uc010hkl.2_Intron|ARIH2_uc003cvd.1_Intron|ARIH2_uc003cve.1_Intron	NM_006321	NP_006312			ariadne homolog 2						developmental cell growth|hemopoietic stem cell proliferation|protein K48-linked ubiquitination|protein K63-linked ubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	nucleic acid binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;9.42e-05)|Kidney(197;0.00258)|KIRC - Kidney renal clear cell carcinoma(197;0.00269)														---	---	---	---
CCDC36	339834	broad.mit.edu	37	3	49249057	49249058	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49249057_49249058delAA	uc003cwk.2	+						CCDC36_uc003cwl.3_Intron|CCDC36_uc011bck.1_Intron|CCDC36_uc010hkt.2_Intron	NM_178173	NP_835467			coiled-coil domain containing 36											ovary(1)|kidney(1)	2				BRCA - Breast invasive adenocarcinoma(193;9.11e-05)|Kidney(197;0.00248)|KIRC - Kidney renal clear cell carcinoma(197;0.00262)														---	---	---	---
MST1	4485	broad.mit.edu	37	3	49723727	49723729	+	Intron	DEL	CCC	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49723727_49723729delCCC	uc003cxg.2	-						MST1_uc011bcs.1_In_Frame_Del_p.343_344GG>G|MST1_uc010hkx.2_3'UTR|MST1_uc011bct.1_3'UTR	NM_020998	NP_066278			macrophage stimulating 1 (hepatocyte growth						proteolysis	extracellular region	serine-type endopeptidase activity			lung(1)	1				BRCA - Breast invasive adenocarcinoma(193;4.47e-05)|Kidney(197;0.00216)|KIRC - Kidney renal clear cell carcinoma(197;0.00244)														---	---	---	---
RBM6	10180	broad.mit.edu	37	3	50103612	50103612	+	Intron	DEL	A	-	-	rs77592512	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:50103612delA	uc003cyc.2	+						RBM6_uc010hlc.1_Intron|RBM6_uc003cyd.2_Intron|RBM6_uc003cye.2_Intron|RBM6_uc011bdi.1_Intron|RBM6_uc010hld.1_Intron|RBM6_uc010hle.1_Intron|RBM6_uc010hlf.1_Intron	NM_005777	NP_005768			RNA binding motif protein 6						RNA processing	nucleus	DNA binding|nucleotide binding|RNA binding|zinc ion binding			ovary(2)	2				BRCA - Breast invasive adenocarcinoma(193;6.81e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.0084)|Kidney(197;0.00977)														---	---	---	---
GRM2	2912	broad.mit.edu	37	3	51751910	51751911	+	Intron	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51751910_51751911insG	uc010hlv.2	+						GRM2_uc003dbo.3_Intron|GRM2_uc010hlu.2_Intron	NM_000839	NP_000830			glutamate receptor, metabotropic 2 isoform a						synaptic transmission	integral to plasma membrane				lung(1)	1				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.000539)|KIRC - Kidney renal clear cell carcinoma(197;0.000716)	Acamprosate(DB00659)|Nicotine(DB00184)													---	---	---	---
PBRM1	55193	broad.mit.edu	37	3	52662815	52662815	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52662815delG	uc003des.2	-						PBRM1_uc003dex.2_Intron|PBRM1_uc003deq.2_Intron|PBRM1_uc003der.2_Intron|PBRM1_uc003det.2_Intron|PBRM1_uc003deu.2_Intron|PBRM1_uc003dev.2_Intron|PBRM1_uc003dew.2_Intron|PBRM1_uc010hmk.1_Intron|PBRM1_uc003dey.2_Intron|PBRM1_uc003dez.1_Intron|PBRM1_uc003dfb.1_Intron	NM_181042	NP_060635			polybromo 1 isoform 4						chromatin remodeling|mitosis|negative regulation of cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear chromosome	chromatin binding|DNA binding|protein binding			kidney(136)|breast(4)	140				BRCA - Breast invasive adenocarcinoma(193;1.8e-05)|Kidney(197;0.00105)|KIRC - Kidney renal clear cell carcinoma(197;0.00122)|OV - Ovarian serous cystadenocarcinoma(275;0.0613)				Mis|N|F|S|D|O		clear cell renal carcinoma|breast								---	---	---	---
NEK4	6787	broad.mit.edu	37	3	52768925	52768926	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52768925_52768926delAA	uc003dfq.3	-						NEK4_uc011bej.1_Intron	NM_003157	NP_003148			NIMA-related kinase 4						cell division|mitosis	nucleus	ATP binding|metal ion binding|protein serine/threonine kinase activity			large_intestine(1)	1				BRCA - Breast invasive adenocarcinoma(193;7.44e-05)|Kidney(197;0.000711)|KIRC - Kidney renal clear cell carcinoma(197;0.00086)|OV - Ovarian serous cystadenocarcinoma(275;0.0513)														---	---	---	---
SFMBT1	51460	broad.mit.edu	37	3	52950388	52950396	+	Intron	DEL	TTTTTTTTA	-	-	rs71087030		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52950388_52950396delTTTTTTTTA	uc003dgf.2	-						SFMBT1_uc010hmr.2_Intron|SFMBT1_uc003dgg.2_Intron|SFMBT1_uc003dgh.2_Intron	NM_001005159	NP_001005159			Scm-like with four mbt domains 1						regulation of transcription, DNA-dependent	nucleus				ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;9.91e-05)|Kidney(197;0.000644)|KIRC - Kidney renal clear cell carcinoma(197;0.000792)|OV - Ovarian serous cystadenocarcinoma(275;0.113)														---	---	---	---
IL17RB	55540	broad.mit.edu	37	3	53898563	53898563	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:53898563delA	uc003dha.2	+							NM_018725	NP_061195			interleukin 17B receptor precursor						defense response|regulation of cell growth	extracellular region|integral to plasma membrane	cytokine receptor activity			ovary(2)|pancreas(1)	3				BRCA - Breast invasive adenocarcinoma(193;0.000158)|KIRC - Kidney renal clear cell carcinoma(284;0.00588)|Kidney(284;0.00673)|OV - Ovarian serous cystadenocarcinoma(275;0.118)														---	---	---	---
GABRR3	200959	broad.mit.edu	37	3	97744540	97744540	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97744540delA	uc011bgr.1	-							NM_001105580	NP_001099050			gamma-aminobutyric acid (GABA) receptor, rho 3						gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity				0																		---	---	---	---
TBC1D23	55773	broad.mit.edu	37	3	100042414	100042414	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100042414delT	uc003dtt.2	+						TBC1D23_uc003dts.2_Intron|TBC1D23_uc003dtu.2_Intron	NM_018309	NP_060779			TBC1 domain family, member 23							intracellular	Rab GTPase activator activity			ovary(1)|liver(1)	2																		---	---	---	---
TOMM70A	9868	broad.mit.edu	37	3	100105553	100105553	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100105553delA	uc003dtw.2	-							NM_014820	NP_055635			translocase of outer mitochondrial membrane 70						protein targeting to mitochondrion	integral to membrane|mitochondrial outer membrane translocase complex	protein binding|protein transmembrane transporter activity			ovary(1)	1																		---	---	---	---
SENP7	57337	broad.mit.edu	37	3	101091103	101091103	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:101091103delA	uc003dut.2	-						SENP7_uc003duu.2_Intron|SENP7_uc003duv.2_Intron|SENP7_uc003duw.2_Intron|SENP7_uc003dux.2_Intron	NM_020654	NP_065705			sentrin/SUMO-specific protease 7 isoform 1						proteolysis	nucleus	cysteine-type peptidase activity			ovary(3)|lung(2)	5																		---	---	---	---
Unknown	0	broad.mit.edu	37	3	101318024	101318024	+	IGR	DEL	T	-	-	rs148687228	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:101318024delT								PCNP (4745 upstream) : ZBTB11 (50261 downstream)																																			---	---	---	---
CEP97	79598	broad.mit.edu	37	3	101445760	101445761	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:101445760_101445761insA	uc003dvk.1	+						CEP97_uc010hpm.1_Intron|CEP97_uc011bhf.1_Intron|CEP97_uc003dvl.1_5'Flank	NM_024548	NP_078824			centrosomal protein 97kDa							centrosome|nucleus	protein binding			ovary(2)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	3	107046624	107046624	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:107046624delT								LOC344595 (814 upstream) : CCDC54 (49564 downstream)																																			---	---	---	---
CD47	961	broad.mit.edu	37	3	107769318	107769318	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:107769318delA	uc003dwt.1	-						CD47_uc003dwu.1_Intron|CD47_uc003dwv.1_Intron|CD47_uc003dww.1_Intron	NM_001777	NP_001768			CD47 antigen isoform 1 precursor						blood coagulation|cell adhesion|cell junction assembly|integrin-mediated signaling pathway|leukocyte migration|positive regulation of cell proliferation|positive regulation of cell-cell adhesion|positive regulation of T cell activation	integral to plasma membrane	protein binding|thrombospondin receptor activity			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(3;0.0191)|Epithelial(53;0.118)															---	---	---	---
MYH15	22989	broad.mit.edu	37	3	108173172	108173172	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108173172delA	uc003dxa.1	-							NM_014981	NP_055796			myosin, heavy polypeptide 15							myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity			ovary(5)|central_nervous_system(2)	7																		---	---	---	---
MYH15	22989	broad.mit.edu	37	3	108211835	108211836	+	Intron	INS	-	GA	GA			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108211835_108211836insGA	uc003dxa.1	-							NM_014981	NP_055796			myosin, heavy polypeptide 15							myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity			ovary(5)|central_nervous_system(2)	7																		---	---	---	---
KIAA1524	57650	broad.mit.edu	37	3	108300479	108300479	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108300479delA	uc003dxb.3	-						KIAA1524_uc003dxc.1_Intron|KIAA1524_uc010hpw.1_Intron	NM_020890	NP_065941			p90 autoantigen							cytoplasm|integral to membrane	protein binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
DZIP3	9666	broad.mit.edu	37	3	108356147	108356147	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108356147delT	uc003dxd.2	+						DZIP3_uc003dxf.1_Intron|DZIP3_uc011bhm.1_Intron|DZIP3_uc003dxe.1_Intron|DZIP3_uc003dxg.1_Intron	NM_014648	NP_055463			DAZ interacting protein 3, zinc finger						protein polyubiquitination	cytoplasm	polyubiquitin binding|RNA binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
MORC1	27136	broad.mit.edu	37	3	108782278	108782278	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108782278delT	uc003dxl.2	-						MORC1_uc011bhn.1_Intron	NM_014429	NP_055244			MORC family CW-type zinc finger 1						cell differentiation|multicellular organismal development|spermatogenesis	nucleus	ATP binding|zinc ion binding			ovary(3)|skin(3)|breast(2)	8																		---	---	---	---
MORC1	27136	broad.mit.edu	37	3	108818455	108818455	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:108818455delT	uc003dxl.2	-						MORC1_uc011bhn.1_Intron	NM_014429	NP_055244			MORC family CW-type zinc finger 1						cell differentiation|multicellular organismal development|spermatogenesis	nucleus	ATP binding|zinc ion binding			ovary(3)|skin(3)|breast(2)	8																		---	---	---	---
PHLDB2	90102	broad.mit.edu	37	3	111671328	111671328	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111671328delT	uc010hqa.2	+						PHLDB2_uc003dyc.2_Intron|PHLDB2_uc003dyd.2_Intron|PHLDB2_uc003dyg.2_Intron|PHLDB2_uc003dyh.2_Intron|PHLDB2_uc003dyi.2_Intron	NM_001134438	NP_001127910			pleckstrin homology-like domain, family B,							cytoplasm|intermediate filament cytoskeleton|plasma membrane				ovary(4)|skin(2)	6																		---	---	---	---
ABHD10	55347	broad.mit.edu	37	3	111705091	111705091	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111705091delT	uc003dyk.3	+						ABHD10_uc011bhq.1_Intron	NM_018394	NP_060864			abhydrolase domain containing 10 precursor							mitochondrion	serine-type peptidase activity				0																		---	---	---	---
SLC9A10	285335	broad.mit.edu	37	3	111904187	111904187	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111904187delA	uc003dyu.2	-						SLC9A10_uc011bhu.1_Intron|SLC9A10_uc010hqc.2_Intron	NM_183061	NP_898884			sperm-specific sodium proton exchanger						cell differentiation|multicellular organismal development|sodium ion transport|spermatogenesis	cilium|flagellar membrane|integral to membrane	solute:hydrogen antiporter activity			ovary(3)|breast(2)	5																		---	---	---	---
NAA50	80218	broad.mit.edu	37	3	113459588	113459588	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113459588delT	uc003ean.1	-						NAA50_uc010hqm.1_5'Flank|NAA50_uc011bij.1_Intron	NM_025146	NP_079422			N-acetyltransferase 13						N-terminal protein amino acid acetylation	cytoplasm	N-acetyltransferase activity|protein binding				0																		---	---	---	---
GRAMD1C	54762	broad.mit.edu	37	3	113588456	113588456	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113588456delA	uc003eaq.3	+						GRAMD1C_uc011bil.1_Intron|GRAMD1C_uc011bim.1_Intron	NM_017577	NP_060047			GRAM domain containing 1C							integral to membrane				ovary(2)|skin(1)	3																		---	---	---	---
ZBTB20	26137	broad.mit.edu	37	3	114058003	114058003	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:114058003delG	uc003ebi.2	-	5	2255	c.2075delC	c.(2074-2076)CCTfs	p.P692fs	ZBTB20_uc003ebj.2_Frame_Shift_Del_p.P619fs|ZBTB20_uc010hqp.2_Frame_Shift_Del_p.P619fs|ZBTB20_uc003ebk.2_Frame_Shift_Del_p.P619fs|ZBTB20_uc003ebl.2_Frame_Shift_Del_p.P619fs|ZBTB20_uc003ebm.2_Frame_Shift_Del_p.P619fs|ZBTB20_uc003ebn.2_Frame_Shift_Del_p.P619fs	NM_015642	NP_056457	Q9HC78	ZBT20_HUMAN	zinc finger and BTB domain containing 20 isoform	692					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(4)|skin(1)	5				LUSC - Lung squamous cell carcinoma(41;0.0581)|Lung(219;0.191)														---	---	---	---
GAP43	2596	broad.mit.edu	37	3	115342811	115342811	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:115342811delT	uc003ebq.2	+						GAP43_uc003ebr.2_Intron	NM_002045	NP_002036			growth associated protein 43 isoform 2						activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|cell differentiation|nervous system development|regulation of filopodium assembly|regulation of growth|response to wounding	cell junction|filopodium membrane|growth cone membrane|synapse	calmodulin binding			ovary(1)	1				GBM - Glioblastoma multiforme(114;0.164)														---	---	---	---
GSK3B	2932	broad.mit.edu	37	3	119595241	119595241	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:119595241delA	uc003edo.2	-						GSK3B_uc003edn.2_Intron	NM_001146156	NP_001139628			glycogen synthase kinase 3 beta isoform 2						axon guidance|epithelial to mesenchymal transition|ER overload response|glycogen metabolic process|hippocampus development|negative regulation of apoptosis|negative regulation of protein binding|negative regulation of protein complex assembly|nerve growth factor receptor signaling pathway|peptidyl-serine phosphorylation|phosphatidylinositol-mediated signaling|positive regulation of cell-matrix adhesion|positive regulation of protein complex assembly|positive regulation of protein export from nucleus|positive regulation of Rac GTPase activity|regulation of microtubule-based process|superior temporal gyrus development	Axin-APC-beta-catenin-GSK3B complex|beta-catenin destruction complex|centrosome|cytosol|nucleus|plasma membrane	ATP binding|beta-catenin binding|NF-kappaB binding|p53 binding|protein kinase A catalytic subunit binding|protein serine/threonine kinase activity|RNA polymerase II transcription factor binding|tau-protein kinase activity|ubiquitin protein ligase binding			lung(2)	2				GBM - Glioblastoma multiforme(114;0.24)	Lithium(DB01356)													---	---	---	---
PARP14	54625	broad.mit.edu	37	3	122433232	122433232	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:122433232delA	uc003efq.3	+	12	4015	c.3956delA	c.(3955-3957)GAAfs	p.E1319fs	PARP14_uc010hrk.2_RNA|PARP14_uc003efr.2_Frame_Shift_Del_p.E1036fs|PARP14_uc003efs.1_Frame_Shift_Del_p.E1036fs	NM_017554	NP_060024	Q460N5	PAR14_HUMAN	poly (ADP-ribose) polymerase family, member 14	1319	Macro 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus|plasma membrane	NAD+ ADP-ribosyltransferase activity			ovary(2)|breast(2)|lung(1)|pancreas(1)	6				GBM - Glioblastoma multiforme(114;0.0531)														---	---	---	---
SEMA5B	54437	broad.mit.edu	37	3	122631702	122631702	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:122631702delG	uc003efz.1	-	18	3017	c.2713delC	c.(2713-2715)CAGfs	p.Q905fs	SEMA5B_uc011bju.1_Frame_Shift_Del_p.Q847fs|SEMA5B_uc003ega.1_RNA|SEMA5B_uc003egb.1_Frame_Shift_Del_p.Q905fs|SEMA5B_uc003efy.1_5'Flank	NM_001031702	NP_001026872	Q9P283	SEM5B_HUMAN	semaphorin 5B isoform 1	905	Extracellular (Potential).|TSP type-1 3.				cell differentiation|nervous system development	integral to membrane	receptor activity			ovary(2)|breast(2)|pancreas(2)|central_nervous_system(1)	7				GBM - Glioblastoma multiforme(114;0.0367)														---	---	---	---
SEMA5B	54437	broad.mit.edu	37	3	122680312	122680314	+	Intron	DEL	TTT	-	-	rs111407084		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:122680312_122680314delTTT	uc003efz.1	-						SEMA5B_uc011bju.1_Intron|SEMA5B_uc003ega.1_Intron|SEMA5B_uc003egb.1_Intron|SEMA5B_uc010hro.1_Intron|SEMA5B_uc010hrp.1_Intron	NM_001031702	NP_001026872			semaphorin 5B isoform 1						cell differentiation|nervous system development	integral to membrane	receptor activity			ovary(2)|breast(2)|pancreas(2)|central_nervous_system(1)	7				GBM - Glioblastoma multiforme(114;0.0367)														---	---	---	---
ZNF148	7707	broad.mit.edu	37	3	125030060	125030060	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:125030060delA	uc003ehx.3	-						ZNF148_uc003ehz.3_Intron|ZNF148_uc010hsa.2_Intron|ZNF148_uc003eia.3_Intron|ZNF148_uc003ehy.2_Intron	NM_021964	NP_068799			zinc finger protein 148						cellular defense response|negative regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	Golgi apparatus|nucleus	protein binding|sequence-specific DNA binding|zinc ion binding			skin(2)|ovary(1)|pancreas(1)	4																		---	---	---	---
ROPN1B	152015	broad.mit.edu	37	3	125694392	125694392	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:125694392delT	uc003eih.2	+						ROPN1B_uc010hsb.2_Intron|ROPN1B_uc010hsc.2_5'Flank|ROPN1B_uc011bkg.1_Intron	NM_001012337	NP_001012337			ropporin, rhophilin associated protein 1B						acrosome reaction|cell-cell adhesion|cytokinesis|fusion of sperm to egg plasma membrane|Rho protein signal transduction|sperm motility|spermatogenesis	cytoplasm|flagellum	cAMP-dependent protein kinase regulator activity|protein heterodimerization activity|protein homodimerization activity|receptor signaling complex scaffold activity				0				GBM - Glioblastoma multiforme(114;0.151)														---	---	---	---
KLF15	28999	broad.mit.edu	37	3	126062510	126062510	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:126062510delA	uc011bkk.1	-	3						NM_014079	NP_054798			Kruppel-like factor 15							nucleus	DNA binding|zinc ion binding			lung(1)	1				GBM - Glioblastoma multiforme(114;0.147)														---	---	---	---
KBTBD12	166348	broad.mit.edu	37	3	127646442	127646442	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:127646442delA	uc010hsr.2	+						KBTBD12_uc003ejy.3_Intron|KBTBD12_uc010hsq.2_Intron|KBTBD12_uc003eka.3_Intron|KBTBD12_uc003ejz.2_Intron	NM_207335	NP_997218			kelch domain containing 6											ovary(1)	1																		---	---	---	---
RPN1	6184	broad.mit.edu	37	3	128363639	128363639	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128363639delA	uc003ekr.1	-						RPN1_uc011bkq.1_Intron	NM_002950	NP_002941			ribophorin I precursor						post-translational protein modification|protein N-linked glycosylation via asparagine	integral to membrane|melanosome|oligosaccharyltransferase complex|rough microsome	dolichyl-diphosphooligosaccharide-protein glycotransferase activity|protein binding			ovary(2)|central_nervous_system(1)	3				GBM - Glioblastoma multiforme(114;0.189)				T	EVI1	AML								---	---	---	---
CNBP	7555	broad.mit.edu	37	3	128890733	128890733	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128890733delA	uc003elq.3	-						CNBP_uc003elr.3_Intron|CNBP_uc011bku.1_Intron	NM_003418	NP_003409			zinc finger protein 9 isoform 3						cholesterol biosynthetic process	endoplasmic reticulum	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	3	130547277	130547277	+	IGR	DEL	A	-	-	rs3211035		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130547277delA								PIK3R4 (81581 upstream) : ATP2C1 (22168 downstream)																																			---	---	---	---
NEK11	79858	broad.mit.edu	37	3	130871047	130871047	+	Intron	DEL	T	-	-	rs150507740	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130871047delT	uc003eny.2	+						NEK11_uc003enx.2_Intron|NEK11_uc003eoa.2_Intron|NEK11_uc003enz.2_Intron|NEK11_uc010htn.2_Intron|NEK11_uc011blk.1_Intron|NEK11_uc011bll.1_Intron|NEK11_uc011blm.1_Intron|NEK11_uc010hto.1_Intron	NM_024800	NP_079076			NIMA-related kinase 11 isoform 1						cell cycle|intra-S DNA damage checkpoint|intracellular protein kinase cascade	nucleolus	ATP binding|identical protein binding|metal ion binding|protein serine/threonine kinase activity			large_intestine(4)|stomach(1)|central_nervous_system(1)	6																		---	---	---	---
Unknown	0	broad.mit.edu	37	3	132106524	132106524	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132106524delA								ACPP (19380 upstream) : DNAJC13 (30029 downstream)																																			---	---	---	---
DNAJC13	23317	broad.mit.edu	37	3	132220414	132220415	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132220414_132220415delAA	uc003eor.2	+							NM_015268	NP_056083			DnaJ (Hsp40) homolog, subfamily C, member 13								heat shock protein binding			ovary(1)|breast(1)	2																		---	---	---	---
NPHP3	27031	broad.mit.edu	37	3	132406074	132406074	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132406074delA	uc003epe.1	-						NPHP3_uc003eoz.1_5'Flank|NPHP3_uc003epd.1_Intron	NM_153240	NP_694972			nephrocystin 3						maintenance of organ identity|negative regulation of canonical Wnt receptor signaling pathway|photoreceptor cell maintenance|regulation of Wnt receptor signaling pathway, planar cell polarity pathway|Wnt receptor signaling pathway	cilium	protein binding			ovary(1)	1																		---	---	---	---
TOPBP1	11073	broad.mit.edu	37	3	133342879	133342879	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133342879delA	uc003eps.2	-						TOPBP1_uc003ept.1_Intron	NM_007027	NP_008958			topoisomerase (DNA) II binding protein 1						DNA repair|response to ionizing radiation	microtubule organizing center|PML body|spindle pole	DNA binding|protein C-terminus binding			ovary(2)|kidney(2)|skin(1)|lung(1)|pancreas(1)	7													Other_conserved_DNA_damage_response_genes					---	---	---	---
ARMC8	25852	broad.mit.edu	37	3	137981526	137981526	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:137981526delA	uc003esa.1	+						TXNDC6_uc003esd.1_Intron|TXNDC6_uc010huf.1_Intron|TXNDC6_uc003ese.1_Intron|ARMC8_uc011bmf.1_Intron|ARMC8_uc011bmg.1_Intron|ARMC8_uc011bmh.1_Intron|ARMC8_uc003esb.1_Intron|ARMC8_uc003esc.1_Intron|ARMC8_uc003esf.1_5'Flank	NM_015396	NP_056211			armadillo repeat containing 8 isoform 2								binding				0																		---	---	---	---
PIK3CB	5291	broad.mit.edu	37	3	138402351	138402351	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:138402351delA	uc011bmq.1	-						PIK3CB_uc011bmn.1_Intron|PIK3CB_uc011bmo.1_Intron|PIK3CB_uc011bmp.1_Intron	NM_006219	NP_006210			catalytic phosphatidylinositol 3-kinase beta						activation of MAPK activity|chemotaxis|fibroblast growth factor receptor signaling pathway|G-protein coupled receptor protein signaling pathway|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|platelet activation|T cell receptor signaling pathway	phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity			breast(2)|ovary(1)|lung(1)|skin(1)	5																		---	---	---	---
ATP1B3	483	broad.mit.edu	37	3	141632861	141632861	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:141632861delA	uc003eug.1	+						ATP1B3_uc011bne.1_Intron|ATP1B3_uc003euh.1_Intron	NM_001679	NP_001670			Na+/K+ -ATPase beta 3 subunit						ATP biosynthetic process|blood coagulation|leukocyte migration	melanosome|sodium:potassium-exchanging ATPase complex	protein binding|sodium:potassium-exchanging ATPase activity				0																		---	---	---	---
ATR	545	broad.mit.edu	37	3	142188042	142188042	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142188042delA	uc003eux.3	-						ATR_uc003euy.1_Intron	NM_001184	NP_001175			ataxia telangiectasia and Rad3 related protein						cell cycle|cellular response to gamma radiation|cellular response to UV|DNA damage checkpoint|DNA repair|DNA replication|multicellular organismal development|negative regulation of DNA replication|peptidyl-serine phosphorylation|positive regulation of DNA damage response, signal transduction by p53 class mediator|protein autophosphorylation|replicative senescence	PML body	ATP binding|DNA binding|MutLalpha complex binding|MutSalpha complex binding|protein serine/threonine kinase activity			lung(5)|skin(5)|breast(4)|ovary(3)|stomach(1)|central_nervous_system(1)|liver(1)	20													Other_conserved_DNA_damage_response_genes					---	---	---	---
ATR	545	broad.mit.edu	37	3	142223907	142223907	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142223907delA	uc003eux.3	-							NM_001184	NP_001175			ataxia telangiectasia and Rad3 related protein						cell cycle|cellular response to gamma radiation|cellular response to UV|DNA damage checkpoint|DNA repair|DNA replication|multicellular organismal development|negative regulation of DNA replication|peptidyl-serine phosphorylation|positive regulation of DNA damage response, signal transduction by p53 class mediator|protein autophosphorylation|replicative senescence	PML body	ATP binding|DNA binding|MutLalpha complex binding|MutSalpha complex binding|protein serine/threonine kinase activity			lung(5)|skin(5)|breast(4)|ovary(3)|stomach(1)|central_nervous_system(1)|liver(1)	20													Other_conserved_DNA_damage_response_genes					---	---	---	---
PLS1	5357	broad.mit.edu	37	3	142408406	142408406	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142408406delA	uc010huv.2	+						PLS1_uc003euz.2_Intron|PLS1_uc003eva.2_Intron	NM_001145319	NP_001138791			plastin 1							cytoplasm	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(1)	1																		---	---	---	---
PCOLCE2	26577	broad.mit.edu	37	3	142557423	142557424	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142557423_142557424insT	uc003evd.2	-							NM_013363	NP_037495			procollagen C-endopeptidase enhancer 2							extracellular region	collagen binding|heparin binding|peptidase activator activity			ovary(2)|skin(1)	3																		---	---	---	---
CP	1356	broad.mit.edu	37	3	148916129	148916129	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:148916129delT	uc003ewy.3	-						CP_uc011bnr.1_Intron|CP_uc003ewx.3_Intron|CP_uc003ewz.2_Intron|CP_uc010hvf.1_Intron	NM_000096	NP_000087			ceruloplasmin precursor						cellular iron ion homeostasis|copper ion transport|transmembrane transport	extracellular space	chaperone binding|ferroxidase activity			ovary(1)	1		Prostate(884;0.00217)|Hepatocellular(537;0.00826)|Myeloproliferative disorder(1037;0.0122)|all_neural(597;0.0189)|Melanoma(1037;0.152)	LUSC - Lung squamous cell carcinoma(72;0.0473)|Lung(72;0.0607)		Drotrecogin alfa(DB00055)													---	---	---	---
MED12L	116931	broad.mit.edu	37	3	150908389	150908389	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:150908389delT	uc003eyp.2	+						MED12L_uc011bnz.1_Intron|MED12L_uc003eyn.2_Intron|MED12L_uc003eyo.2_Intron	NM_053002	NP_443728			mediator of RNA polymerase II transcription,						regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	mediator complex				ovary(4)|large_intestine(1)|central_nervous_system(1)|skin(1)	7			LUSC - Lung squamous cell carcinoma(72;0.0394)|Lung(72;0.0517)															---	---	---	---
GFM1	85476	broad.mit.edu	37	3	158402144	158402144	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:158402144delA	uc003fce.2	+						GFM1_uc003fcf.2_Intron|GFM1_uc003fcg.2_Intron	NM_024996	NP_079272			G elongation factor, mitochondrial 1 precursor						mitochondrial translational elongation	mitochondrion	GTP binding|GTPase activity|translation elongation factor activity			ovary(3)|central_nervous_system(1)	4			Lung(72;0.00309)|LUSC - Lung squamous cell carcinoma(72;0.0043)															---	---	---	---
KPNA4	3840	broad.mit.edu	37	3	160253734	160253734	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160253734delA	uc003fdn.2	-							NM_002268	NP_002259			karyopherin alpha 4						NLS-bearing substrate import into nucleus	cytoplasm|nuclear pore	protein binding				0			Lung(72;0.00149)|LUSC - Lung squamous cell carcinoma(72;0.00216)															---	---	---	---
MECOM	2122	broad.mit.edu	37	3	168861605	168861605	+	5'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:168861605delA	uc003ffi.3	-	2					MECOM_uc003ffj.3_Frame_Shift_Del_p.Y7fs|MECOM_uc011bpi.1_5'UTR|MECOM_uc003ffn.3_5'UTR|MECOM_uc003ffk.2_5'UTR|MECOM_uc003ffl.2_Frame_Shift_Del_p.Y103fs|MECOM_uc011bpj.1_Frame_Shift_Del_p.Y131fs|MECOM_uc011bpk.1_5'UTR|MECOM_uc010hwn.2_Frame_Shift_Del_p.Y131fs|MECOM_uc003ffm.1_Frame_Shift_Del_p.Y7fs	NM_005241	NP_005232			MDS1 and EVI1 complex locus isoform b						apoptosis|cell differentiation|hemopoietic stem cell proliferation|negative regulation of JNK cascade|negative regulation of programmed cell death|negative regulation of transcription, DNA-dependent|regulation of cell cycle	nuclear speck	DNA binding|protein binding|protein homodimerization activity|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(5)|skin(5)|upper_aerodigestive_tract(1)|central_nervous_system(1)|ovary(1)|pancreas(1)	14																		---	---	---	---
SAMD7	344658	broad.mit.edu	37	3	169642738	169642738	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169642738delT	uc003fgd.2	+						SAMD7_uc003fge.2_Intron|SAMD7_uc011bpo.1_Intron	NM_182610	NP_872416			sterile alpha motif domain containing 7											skin(1)	1	all_cancers(22;1.55e-22)|all_epithelial(15;2.41e-27)|all_lung(20;3.52e-17)|Lung NSC(18;1.44e-16)|Ovarian(172;0.000337)|Breast(254;0.169)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.0106)															---	---	---	---
PRKCI	5584	broad.mit.edu	37	3	169985594	169985594	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169985594delT	uc003fgs.2	+							NM_002740	NP_002731			protein kinase C, iota						anti-apoptosis|cellular membrane organization|cellular response to insulin stimulus|establishment or maintenance of epithelial cell apical/basal polarity|intracellular signal transduction|nerve growth factor receptor signaling pathway|positive regulation of establishment of protein localization in plasma membrane|positive regulation of glucose import|protein targeting to membrane|secretion|tight junction assembly|vesicle-mediated transport	cytosol|endosome|nucleus|polarisome	ATP binding|phospholipid binding|protein binding|protein kinase C activity|zinc ion binding			lung(2)|ovary(1)|breast(1)|skin(1)	5	all_cancers(22;6.45e-23)|all_epithelial(15;8.52e-28)|all_lung(20;6.31e-17)|Lung NSC(18;2.61e-16)|Ovarian(172;0.000337)|Breast(254;0.169)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.197)															---	---	---	---
FNDC3B	64778	broad.mit.edu	37	3	172080219	172080219	+	Intron	DEL	T	-	-	rs11333442		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:172080219delT	uc003fhy.2	+						FNDC3B_uc003fhz.3_Intron	NM_022763	NP_073600			fibronectin type III domain containing 3B							endoplasmic reticulum|integral to membrane				ovary(2)|breast(1)	3	all_cancers(22;1.01e-18)|Ovarian(172;0.00167)|Breast(254;0.165)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)	GBM - Glioblastoma multiforme(1;0.0494)														---	---	---	---
CCDC39	339829	broad.mit.edu	37	3	180337133	180337133	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180337133delT	uc010hxe.2	-	16	2294	c.2179delA	c.(2179-2181)ATTfs	p.I727fs	CCDC39_uc003fkn.2_RNA	NM_181426	NP_852091	Q9UFE4	CCD39_HUMAN	coiled-coil domain containing 39	727	Potential.				axonemal dynein complex assembly|ciliary cell motility|cilium movement involved in determination of left/right asymmetry|flagellar cell motility	cilium axoneme|cytoplasm|cytoskeleton				ovary(4)	4	all_cancers(143;9.31e-15)|Ovarian(172;0.0212)		OV - Ovarian serous cystadenocarcinoma(80;5.62e-23)|GBM - Glioblastoma multiforme(14;0.000558)															---	---	---	---
FXR1	8087	broad.mit.edu	37	3	180671370	180671370	+	Intron	DEL	T	-	-	rs75916673		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180671370delT	uc003fkq.2	+						FXR1_uc003fkp.2_Intron|FXR1_uc003fkr.2_Intron|FXR1_uc011bqj.1_Intron|FXR1_uc003fks.2_Intron|FXR1_uc011bqk.1_Intron|FXR1_uc011bql.1_Intron	NM_005087	NP_005078			fragile X mental retardation-related protein 1						apoptosis|cell differentiation|muscle organ development	nucleolus|polysome				breast(1)	1	all_cancers(143;6.07e-14)|Ovarian(172;0.0212)		Epithelial(37;3.05e-35)|OV - Ovarian serous cystadenocarcinoma(80;2.4e-22)															---	---	---	---
Unknown	0	broad.mit.edu	37	3	180863907	180863909	+	IGR	DEL	AAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180863907_180863909delAAA								DNAJC19 (156377 upstream) : SOX2OT (417600 downstream)																																			---	---	---	---
KLHL6	89857	broad.mit.edu	37	3	183245512	183245513	+	Intron	DEL	GT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183245512_183245513delGT	uc003flr.2	-						KLHL6_uc003fls.1_Intron|KLHL6_uc003flt.1_Intron	NM_130446	NP_569713			kelch-like 6											haematopoietic_and_lymphoid_tissue(2)|ovary(1)	3	all_cancers(143;9.2e-12)|Ovarian(172;0.0172)		all cancers(12;1.29e-44)|Epithelial(37;1.24e-38)|LUSC - Lung squamous cell carcinoma(7;2.58e-24)|Lung(8;1.79e-22)|OV - Ovarian serous cystadenocarcinoma(80;2.32e-22)															---	---	---	---
PARL	55486	broad.mit.edu	37	3	183562247	183562247	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183562247delA	uc003fmd.2	-						PARL_uc003fme.2_Intron	NM_018622	NP_061092			presenilin associated, rhomboid-like isoform 1						proteolysis	integral to membrane|mitochondrial inner membrane|nucleus	serine-type endopeptidase activity				0	all_cancers(143;6.55e-10)|Ovarian(172;0.0303)		all cancers(12;2.21e-41)|Epithelial(37;1.34e-36)|OV - Ovarian serous cystadenocarcinoma(80;6.48e-22)															---	---	---	---
ABCC5	10057	broad.mit.edu	37	3	183696103	183696103	+	Intron	DEL	T	-	-	rs67116575		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183696103delT	uc003fmg.2	-						ABCC5_uc011bqt.1_Intron|ABCC5_uc010hxl.2_Intron	NM_005688	NP_005679			ATP-binding cassette, sub-family C, member 5							integral to plasma membrane|membrane fraction	ATP binding|ATPase activity, coupled to transmembrane movement of substances|organic anion transmembrane transporter activity			ovary(2)|large_intestine(1)|central_nervous_system(1)	4	all_cancers(143;1.85e-10)|Ovarian(172;0.0303)		Epithelial(37;1.74e-35)|OV - Ovarian serous cystadenocarcinoma(80;6.48e-22)															---	---	---	---
EIF4G1	1981	broad.mit.edu	37	3	184046178	184046178	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184046178delA	uc003fnp.2	+						EIF4G1_uc003fnt.2_Intron|EIF4G1_uc003fnq.2_Intron|EIF4G1_uc003fnr.2_Intron|EIF4G1_uc010hxx.2_Intron|EIF4G1_uc003fns.2_Intron|EIF4G1_uc010hxy.2_Intron|EIF4G1_uc003fnv.3_Intron|EIF4G1_uc003fnu.3_Intron|EIF4G1_uc003fnw.2_Intron|EIF4G1_uc003fnx.2_Intron|EIF4G1_uc003fny.3_Intron|EIF4G1_uc003foa.2_5'Flank	NM_198241	NP_937884			eukaryotic translation initiation factor 4						insulin receptor signaling pathway|interspecies interaction between organisms|nuclear-transcribed mRNA poly(A) tail shortening|regulation of translational initiation	cytosol|eukaryotic translation initiation factor 4F complex	protein binding|translation initiation factor activity			lung(2)|ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	all_cancers(143;1.06e-10)|Ovarian(172;0.0339)		Epithelial(37;1.53e-33)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)															---	---	---	---
TBCCD1	55171	broad.mit.edu	37	3	186268857	186268857	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186268857delT	uc003fqg.2	-						TBCCD1_uc011bry.1_Intron|TBCCD1_uc003fqh.2_Intron	NM_018138	NP_060608			TBCC domain containing 1						cell morphogenesis|maintenance of centrosome location|maintenance of Golgi location|regulation of cell migration|regulation of cell shape	spindle pole centrosome	binding			large_intestine(1)|ovary(1)	2	all_cancers(143;3.75e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;4.3e-21)	GBM - Glioblastoma multiforme(93;0.0474)														---	---	---	---
Unknown	0	broad.mit.edu	37	3	187141216	187141216	+	IGR	DEL	A	-	-	rs80024997		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:187141216delA								RTP4 (51849 upstream) : SST (245480 downstream)																																			---	---	---	---
LEPREL1	55214	broad.mit.edu	37	3	189700671	189700671	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:189700671delT	uc011bsk.1	-						LEPREL1_uc003fsg.2_Intron	NM_018192	NP_060662			leprecan-like 1 isoform a						collagen metabolic process|negative regulation of cell proliferation|peptidyl-proline hydroxylation	basement membrane|endoplasmic reticulum|Golgi apparatus	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|procollagen-proline 3-dioxygenase activity			breast(3)|ovary(1)	4	all_cancers(143;4.01e-10)|Ovarian(172;0.0925)		Lung(62;4.35e-05)	GBM - Glioblastoma multiforme(93;0.02)	L-Proline(DB00172)|Succinic acid(DB00139)|Vitamin C(DB00126)													---	---	---	---
ATP13A4	84239	broad.mit.edu	37	3	193130399	193130400	+	Intron	INS	-	GA	GA			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:193130399_193130400insGA	uc003ftd.2	-						ATP13A4_uc010hzi.2_Intron	NM_032279	NP_115655			ATPase type 13A4						ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			ovary(2)	2	all_cancers(143;1.76e-08)|Ovarian(172;0.0386)		OV - Ovarian serous cystadenocarcinoma(49;2.72e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;0.000109)														---	---	---	---
ATP13A4	84239	broad.mit.edu	37	3	193180774	193180774	+	Intron	DEL	A	-	-	rs113344721		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:193180774delA	uc003ftd.2	-						ATP13A4_uc003fte.1_Intron|ATP13A4_uc011bsr.1_Intron|ATP13A4_uc010hzi.2_Intron|ATP13A4_uc003ftf.3_Intron	NM_032279	NP_115655			ATPase type 13A4						ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			ovary(2)	2	all_cancers(143;1.76e-08)|Ovarian(172;0.0386)		OV - Ovarian serous cystadenocarcinoma(49;2.72e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;0.000109)														---	---	---	---
ACAP2	23527	broad.mit.edu	37	3	195000334	195000335	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195000334_195000335delAA	uc003fun.3	-							NM_012287	NP_036419			centaurin, beta 2						regulation of ARF GTPase activity		ARF GTPase activator activity|zinc ion binding			large_intestine(1)|ovary(1)	2																		---	---	---	---
ACAP2	23527	broad.mit.edu	37	3	195029738	195029739	+	Intron	INS	-	AAAGT	AAAGT	rs10636354		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195029738_195029739insAAAGT	uc003fun.3	-							NM_012287	NP_036419			centaurin, beta 2						regulation of ARF GTPase activity		ARF GTPase activator activity|zinc ion binding			large_intestine(1)|ovary(1)	2																		---	---	---	---
MUC4	4585	broad.mit.edu	37	3	195498355	195498355	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195498355delA	uc011bto.1	-						MUC4_uc003fuz.2_Intron|MUC4_uc003fva.2_Intron|MUC4_uc003fvb.2_Intron|MUC4_uc003fvc.2_Intron|MUC4_uc003fvd.2_Intron|MUC4_uc003fve.2_Intron|MUC4_uc010hzr.2_Intron|MUC4_uc011btf.1_Intron|MUC4_uc011btg.1_Intron|MUC4_uc011bth.1_Intron|MUC4_uc011bti.1_Intron|MUC4_uc011btj.1_Intron|MUC4_uc011btk.1_Intron|MUC4_uc011btl.1_Intron|MUC4_uc011btm.1_Intron|MUC4_uc011btn.1_Intron|MUC4_uc003fvo.2_Intron|MUC4_uc003fvp.2_Intron|MUC4_uc010hzu.1_Intron	NM_018406	NP_060876			mucin 4 isoform a						cell-matrix adhesion	integral to plasma membrane|proteinaceous extracellular matrix	ErbB-2 class receptor binding|extracellular matrix constituent, lubricant activity				0	all_cancers(143;1.11e-08)|Ovarian(172;0.0634)|Breast(254;0.206)	Lung NSC(153;0.191)	Epithelial(36;3.72e-24)|all cancers(36;6.22e-22)|OV - Ovarian serous cystadenocarcinoma(49;1.1e-18)|Lung(62;4.65e-05)|LUSC - Lung squamous cell carcinoma(58;5.31e-05)	GBM - Glioblastoma multiforme(46;2.37e-05)														---	---	---	---
SDHAP1	255812	broad.mit.edu	37	3	195690462	195690463	+	Intron	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195690462_195690463insG	uc003fvy.2	-						SDHAP1_uc003fvx.3_Intron					Homo sapiens full length insert cDNA clone ZC24D06.												0																		---	---	---	---
NCBP2	22916	broad.mit.edu	37	3	196664216	196664217	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196664216_196664217delAA	uc003fxd.1	-						NCBP2_uc003fxb.1_Intron|NCBP2_uc011btz.1_Intron|NCBP2_uc003fxc.1_Intron|NCBP2_uc003fxe.1_Intron|NCBP2_uc003fxf.2_3'UTR	NM_007362	NP_031388			nuclear cap binding protein subunit 2, 20kDa						gene silencing by RNA|histone mRNA metabolic process|mRNA 3'-end processing|mRNA capping|mRNA export from nucleus|ncRNA metabolic process|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|positive regulation of RNA export from nucleus|positive regulation of viral transcription|regulation of translational initiation|snRNA export from nucleus|spliceosomal snRNP assembly|termination of RNA polymerase II transcription|transcription elongation from RNA polymerase II promoter|viral reproduction	cytosol|mRNA cap binding complex|nucleoplasm	nucleotide binding|protein binding|RNA 7-methylguanosine cap binding				0	all_cancers(143;1.8e-08)|Ovarian(172;0.0634)|Breast(254;0.135)		Epithelial(36;3.42e-24)|all cancers(36;2.27e-22)|OV - Ovarian serous cystadenocarcinoma(49;4.13e-19)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.00551)														---	---	---	---
EVC2	132884	broad.mit.edu	37	4	5633295	5633295	+	Intron	DEL	G	-	-	rs113488613		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:5633295delG	uc003gij.2	-						EVC2_uc011bwb.1_Intron|EVC2_uc003gik.2_Intron	NM_147127	NP_667338			limbin							integral to membrane				large_intestine(3)|ovary(2)	5																		---	---	---	---
TAPT1	202018	broad.mit.edu	37	4	16189981	16189982	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:16189981_16189982delAA	uc010ied.1	-						TAPT1_uc011bxd.1_Intron|TAPT1_uc011bxe.1_Intron	NM_153365	NP_699196			transmembrane anterior posterior transformation							integral to membrane	growth hormone-releasing hormone receptor activity				0																		---	---	---	---
LAP3	51056	broad.mit.edu	37	4	17581308	17581308	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:17581308delT	uc003gph.1	+						LAP3_uc010ieg.2_Intron	NM_015907	NP_056991			leucine aminopeptidase 3						proteolysis	nucleus	aminopeptidase activity|magnesium ion binding|manganese ion binding|metalloexopeptidase activity|zinc ion binding				0																		---	---	---	---
LAP3	51056	broad.mit.edu	37	4	17609358	17609358	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:17609358delT	uc003gph.1	+	13						NM_015907	NP_056991			leucine aminopeptidase 3						proteolysis	nucleus	aminopeptidase activity|magnesium ion binding|manganese ion binding|metalloexopeptidase activity|zinc ion binding				0																		---	---	---	---
GBA3	57733	broad.mit.edu	37	4	22750449	22750449	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:22750449delT	uc003gqp.3	+						GBA3_uc010iep.2_Intron|GBA3_uc011bxo.1_Intron	NM_020973	NP_066024			cytosolic beta-glucosidase isoform a						glycoside catabolic process|glycosylceramide catabolic process	cytosol	beta-galactosidase activity|beta-glucosidase activity|cation binding|glycosylceramidase activity				0																		---	---	---	---
ANAPC4	29945	broad.mit.edu	37	4	25411236	25411236	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:25411236delT	uc003gro.2	+						ANAPC4_uc003grp.2_Intron	NM_013367	NP_037499			anaphase-promoting complex subunit 4						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell division|G2/M transition of mitotic cell cycle|mitotic anaphase|mitotic cell cycle spindle assembly checkpoint|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|cytosol|nucleoplasm	protein phosphatase binding|ubiquitin-protein ligase activity			ovary(2)|large_intestine(1)|pancreas(1)|skin(1)	5		Breast(46;0.0503)																---	---	---	---
ARAP2	116984	broad.mit.edu	37	4	36230143	36230144	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:36230143_36230144insA	uc003gsq.1	-						ARAP2_uc003gsr.1_Intron	NM_015230	NP_056045			ArfGAP with RhoGAP domain, ankyrin repeat and PH						regulation of ARF GTPase activity|small GTPase mediated signal transduction	cytosol	ARF GTPase activator activity|phosphatidylinositol-3,4,5-trisphosphate binding|zinc ion binding			ovary(1)|pancreas(1)|skin(1)	3																		---	---	---	---
WDR19	57728	broad.mit.edu	37	4	39217323	39217323	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:39217323delA	uc003gtv.2	+						WDR19_uc010ifl.1_Intron|WDR19_uc003gtu.1_Intron|WDR19_uc011byi.1_Intron|WDR19_uc003gtw.1_5'Flank	NM_025132	NP_079408			WD repeat domain 19						cell projection organization	microtubule basal body|motile cilium|photoreceptor connecting cilium	binding			large_intestine(1)	1																		---	---	---	---
PDS5A	23244	broad.mit.edu	37	4	39864420	39864420	+	Intron	DEL	A	-	-	rs11300861		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:39864420delA	uc003guv.3	-						PDS5A_uc010ifo.2_Intron	NM_001100399	NP_001093869			PDS5, regulator of cohesion maintenance, homolog						cell division|mitosis|negative regulation of DNA replication	chromatin|nucleus	identical protein binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	4	43412012	43412012	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:43412012delT								GRXCR1 (379339 upstream) : KCTD8 (763910 downstream)																																			---	---	---	---
CORIN	10699	broad.mit.edu	37	4	47644240	47644240	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47644240delA	uc003gxm.2	-						CORIN_uc011bzf.1_Intron|CORIN_uc011bzg.1_Intron	NM_006587	NP_006578			corin						peptide hormone processing|regulation of systemic arterial blood pressure by atrial natriuretic peptide	integral to membrane|plasma membrane	scavenger receptor activity|serine-type endopeptidase activity|serine-type exopeptidase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
FRYL	285527	broad.mit.edu	37	4	48625212	48625213	+	Intron	DEL	AC	-	-	rs776579	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:48625212_48625213delAC	uc003gyh.1	-						FRYL_uc003gyk.2_Intron|FRYL_uc003gyl.1_Intron|FRYL_uc003gym.1_Intron	NM_015030	NP_055845			furry-like						regulation of transcription, DNA-dependent|transcription, DNA-dependent		protein binding			skin(1)	1																		---	---	---	---
SRP72	6731	broad.mit.edu	37	4	57352462	57352462	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57352462delT	uc003hbv.2	+						SRP72_uc010ihe.2_Intron|SRP72_uc003hbw.1_Intron	NM_006947	NP_008878			signal recognition particle 72kDa						response to drug|SRP-dependent cotranslational protein targeting to membrane	cytosol|nucleolus|plasma membrane|signal recognition particle, endoplasmic reticulum targeting	7S RNA binding|signal recognition particle binding			ovary(1)	1	Glioma(25;0.08)|all_neural(26;0.101)																	---	---	---	---
POLR2B	5431	broad.mit.edu	37	4	57890430	57890430	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57890430delT	uc003hcl.1	+						POLR2B_uc011cae.1_Intron|POLR2B_uc011caf.1_Intron|POLR2B_uc003hcm.1_Intron	NM_000938	NP_000929			DNA directed RNA polymerase II polypeptide B						mRNA capping|nuclear mRNA splicing, via spliceosome|positive regulation of viral transcription|protein phosphorylation|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair|viral reproduction	DNA-directed RNA polymerase II, core complex	DNA binding|DNA-directed RNA polymerase activity|metal ion binding|protein binding|ribonucleoside binding			ovary(2)	2	Glioma(25;0.08)|all_neural(26;0.181)																	---	---	---	---
IGFBP7	3490	broad.mit.edu	37	4	57907077	57907077	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57907077delG	uc003hcn.2	-	2	520	c.498delC	c.(496-498)CCCfs	p.P166fs	IGFBP7_uc011cag.1_Frame_Shift_Del_p.P166fs	NM_001553	NP_001544	Q16270	IBP7_HUMAN	insulin-like growth factor binding protein 7	166	Ig-like C2-type.				cell adhesion|negative regulation of cell proliferation|regulation of cell growth	extracellular space	insulin-like growth factor binding			lung(2)|central_nervous_system(1)	3	Glioma(25;0.08)|all_neural(26;0.181)				Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)													---	---	---	---
UBA6	55236	broad.mit.edu	37	4	68531151	68531152	+	Intron	INS	-	TG	TG	rs60372702		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:68531151_68531152insTG	uc003hdg.3	-						UBA6_uc003hdi.2_Intron|UBA6_uc003hdj.2_Intron	NM_018227	NP_060697			ubiquitin-activating enzyme E1-like 2						protein ubiquitination|ubiquitin-dependent protein catabolic process	cytoplasm	ATP binding|FAT10 activating enzyme activity|ligase activity|protein binding				0																		---	---	---	---
YTHDC1	91746	broad.mit.edu	37	4	69197627	69197627	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:69197627delA	uc003hdx.2	-						YTHDC1_uc003hdy.2_Intron	NM_001031732	NP_001026902			splicing factor YT521-B isoform 1											upper_aerodigestive_tract(1)|ovary(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	4	70212662	70212662	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70212662delT								UGT2B28 (51895 upstream) : UGT2B4 (133222 downstream)																																			---	---	---	---
UGT2A1	10941	broad.mit.edu	37	4	70462252	70462252	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70462252delT	uc003hem.3	-						UGT2A1_uc011caq.1_Intron|UGT2A1_uc010ihu.2_Intron|UGT2A1_uc010iht.2_Intron|UGT2A1_uc010ihs.2_Intron	NM_006798	NP_006789			UDP glucuronosyltransferase 2 family,						detection of chemical stimulus|sensory perception of smell	integral to membrane	glucuronosyltransferase activity|glucuronosyltransferase activity			ovary(1)	1																		---	---	---	---
CSN2	1447	broad.mit.edu	37	4	70821913	70821913	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70821913delA	uc003hes.3	-						CSN2_uc003het.3_Intron	NM_001891	NP_001882			casein beta precursor						calcium ion transport	extracellular region	calcium ion binding|enzyme inhibitor activity|transporter activity				0																		---	---	---	---
GRSF1	2926	broad.mit.edu	37	4	71698227	71698227	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:71698227delA	uc010iia.1	-						GRSF1_uc011caz.1_Intron|GRSF1_uc003hfs.2_Intron	NM_002092	NP_002083			G-rich RNA sequence binding factor 1 isoform 1						mRNA polyadenylation		mRNA binding|nucleotide binding				0		all_hematologic(202;0.21)	Lung(101;0.235)															---	---	---	---
SLC4A4	8671	broad.mit.edu	37	4	72352882	72352882	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:72352882delA	uc003hfy.2	+						SLC4A4_uc010iic.2_Intron|SLC4A4_uc010iib.2_Intron|SLC4A4_uc003hfz.2_Intron|SLC4A4_uc003hgc.3_Intron|SLC4A4_uc010iid.2_Intron	NM_001098484	NP_001091954			solute carrier family 4, sodium bicarbonate							basolateral plasma membrane|integral to plasma membrane	inorganic anion exchanger activity|protein binding|sodium:bicarbonate symporter activity			ovary(3)|kidney(1)|skin(1)	5			Lung(101;0.0739)|LUSC - Lung squamous cell carcinoma(112;0.225)															---	---	---	---
PARM1	25849	broad.mit.edu	37	4	75959192	75959192	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:75959192delA	uc003hih.1	+							NM_015393	NP_056208			prostatic androgen-repressed message-1						positive regulation of telomerase activity	early endosome|endosome membrane|Golgi membrane|integral to membrane|late endosome|plasma membrane				ovary(1)	1																		---	---	---	---
RCHY1	25898	broad.mit.edu	37	4	76415602	76415602	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:76415602delT	uc003hik.2	-						RCHY1_uc010iio.2_Intron|RCHY1_uc003hij.2_Intron|RCHY1_uc003hil.2_Intron|RCHY1_uc010iip.2_Intron|RCHY1_uc010iiq.2_Intron|RCHY1_uc010iir.2_Intron	NM_015436	NP_056251			ring finger and CHY zinc finger domain						positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein ubiquitination|protein autoubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nuclear speck|ubiquitin ligase complex	electron carrier activity|p53 binding|protein homodimerization activity|ubiquitin-protein ligase activity|zinc ion binding			pancreas(1)	1			Lung(101;0.0973)|LUSC - Lung squamous cell carcinoma(112;0.122)															---	---	---	---
SCARB2	950	broad.mit.edu	37	4	77095082	77095082	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:77095082delT	uc003hju.1	-						SCARB2_uc011cbu.1_Intron	NM_005506	NP_005497			scavenger receptor class B, member 2						cell adhesion|protein targeting to lysosome	integral to plasma membrane|lysosomal lumen|lysosomal membrane|membrane fraction	enzyme binding|receptor activity				0			Lung(101;0.196)															---	---	---	---
MRPL1	65008	broad.mit.edu	37	4	78830559	78830560	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:78830559_78830560insT	uc003hku.2	+						MRPL1_uc010iji.1_Intron	NM_020236	NP_064621			mitochondrial ribosomal protein L1 precursor								RNA binding				0																		---	---	---	---
ANTXR2	118429	broad.mit.edu	37	4	80929638	80929638	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:80929638delT	uc003hlz.3	-						ANTXR2_uc003hly.3_Intron|ANTXR2_uc003hlx.1_Intron|ANTXR2_uc010ijn.2_Intron	NM_001145794	NP_001139266			anthrax toxin receptor 2 isoform 2							endoplasmic reticulum membrane|extracellular region|integral to membrane|plasma membrane	metal ion binding|protein binding|receptor activity			ovary(1)	1														Juvenile_Hyaline_Fibromatosis				---	---	---	---
COPS4	51138	broad.mit.edu	37	4	83984161	83984161	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:83984161delT	uc003hoa.2	+						COPS4_uc003hob.2_Intron|COPS4_uc010ijw.2_Intron|COPS4_uc010ijx.2_Intron	NM_016129	NP_057213			COP9 signalosome subunit 4						cullin deneddylation	cytoplasm|signalosome	protein binding			kidney(1)	1		Hepatocellular(203;0.114)																---	---	---	---
FAM175A	84142	broad.mit.edu	37	4	84393346	84393346	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:84393346delA	uc003hou.2	-						FAM175A_uc003hot.2_5'Flank|FAM175A_uc003hov.2_Intron	NM_139076	NP_620775			coiled-coil domain containing 98						chromatin modification|double-strand break repair|G2/M transition DNA damage checkpoint|positive regulation of DNA repair|response to ionizing radiation	BRCA1-A complex	polyubiquitin binding			kidney(1)	1																		---	---	---	---
FAM175A	84142	broad.mit.edu	37	4	84398556	84398556	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:84398556delA	uc003hou.2	-						FAM175A_uc003hov.2_Intron	NM_139076	NP_620775			coiled-coil domain containing 98						chromatin modification|double-strand break repair|G2/M transition DNA damage checkpoint|positive regulation of DNA repair|response to ionizing radiation	BRCA1-A complex	polyubiquitin binding			kidney(1)	1																		---	---	---	---
ARHGAP24	83478	broad.mit.edu	37	4	86491585	86491585	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:86491585delT	uc003hpk.2	+						ARHGAP24_uc003hpi.1_Intron|ARHGAP24_uc003hpj.2_Intron	NM_001025616	NP_001020787			Rho GTPase activating protein 24 isoform 1						angiogenesis|cell differentiation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cell projection|cytoskeleton|cytosol|focal adhesion	GTPase activator activity|protein binding				0		Hepatocellular(203;0.114)|all_hematologic(202;0.21)|Acute lymphoblastic leukemia(40;0.242)		OV - Ovarian serous cystadenocarcinoma(123;0.000571)														---	---	---	---
PTPN13	5783	broad.mit.edu	37	4	87656212	87656212	+	Intron	DEL	T	-	-	rs77672732		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:87656212delT	uc003hpz.2	+						PTPN13_uc003hpy.2_Intron|PTPN13_uc003hqa.2_Intron|PTPN13_uc003hqb.2_Intron	NM_080683	NP_542414			protein tyrosine phosphatase, non-receptor type							cytoplasm|cytoskeleton|plasma membrane	protein binding|protein binding|protein tyrosine phosphatase activity			ovary(4)|breast(1)|kidney(1)	6		Hepatocellular(203;0.114)|all_hematologic(202;0.21)|Acute lymphoblastic leukemia(40;0.242)		OV - Ovarian serous cystadenocarcinoma(123;0.00082)														---	---	---	---
HERC5	51191	broad.mit.edu	37	4	89400784	89400784	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:89400784delT	uc003hrt.2	+						HERC5_uc011cdm.1_Intron	NM_016323	NP_057407			hect domain and RLD 5						innate immune response|ISG15-protein conjugation|negative regulation of type I interferon production|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|regulation of cyclin-dependent protein kinase activity|regulation of defense response to virus|response to virus	cytosol|perinuclear region of cytoplasm	ISG15 ligase activity|protein binding|ubiquitin-protein ligase activity			ovary(4)|lung(3)|skin(2)	9		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;0.000209)														---	---	---	---
DAPP1	27071	broad.mit.edu	37	4	100789086	100789086	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:100789086delA	uc003hvf.3	+						DAPP1_uc010ilh.2_Intron	NM_014395	NP_055210			dual adaptor of phosphotyrosine and						signal transduction	cytoplasm|plasma membrane	phosphatidylinositol-3,4,5-trisphosphate binding|phosphatidylinositol-3,4-bisphosphate binding|protein tyrosine phosphatase activity				0				OV - Ovarian serous cystadenocarcinoma(123;7.04e-09)														---	---	---	---
MAPKSP1	8649	broad.mit.edu	37	4	100805115	100805116	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:100805115_100805116insT	uc003hvg.2	-						MAPKSP1_uc003hvi.2_Intron|MAPKSP1_uc003hvh.2_Intron	NM_021970	NP_068805			MAPK scaffold protein 1						cellular protein localization|cellular response to amino acid stimulus|positive regulation of TOR signaling cascade	Ragulator complex	protein binding				0																		---	---	---	---
MAPKSP1	8649	broad.mit.edu	37	4	100806896	100806896	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:100806896delT	uc003hvg.2	-						MAPKSP1_uc003hvi.2_Intron|MAPKSP1_uc003hvh.2_Intron	NM_021970	NP_068805			MAPK scaffold protein 1						cellular protein localization|cellular response to amino acid stimulus|positive regulation of TOR signaling cascade	Ragulator complex	protein binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	4	103383230	103383230	+	IGR	DEL	A	-	-	rs77311063	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:103383230delA								SLC39A8 (116575 upstream) : NFKB1 (39256 downstream)																																			---	---	---	---
UBE2D3	7323	broad.mit.edu	37	4	103720344	103720344	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:103720344delA	uc003hwk.2	-						UBE2D3_uc003hwi.2_Intron|UBE2D3_uc003hwj.2_Intron|UBE2D3_uc003hwl.2_Intron|UBE2D3_uc011cet.1_Intron|UBE2D3_uc011ceu.1_Intron|UBE2D3_uc003hwo.2_Intron|UBE2D3_uc003hwp.2_Intron|UBE2D3_uc003hwq.2_Intron|UBE2D3_uc003hwr.2_Intron	NM_181887	NP_871616			ubiquitin-conjugating enzyme E2D 3 isoform 1						apoptosis|BMP signaling pathway|DNA repair|negative regulation of type I interferon production|proteasomal ubiquitin-dependent protein catabolic process|protein K11-linked ubiquitination|protein K48-linked ubiquitination|protein monoubiquitination|transforming growth factor beta receptor signaling pathway	endosome membrane|plasma membrane	ATP binding|protein binding|ubiquitin-protein ligase activity				0		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;2.13e-08)														---	---	---	---
LEF1	51176	broad.mit.edu	37	4	109000954	109000954	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:109000954delA	uc003hyt.1	-						LEF1_uc011cfj.1_Intron|LEF1_uc011cfk.1_Intron|LEF1_uc003hyu.1_Intron|LEF1_uc003hyv.1_Intron|LEF1_uc010imb.1_Intron|LEF1_uc010ima.1_5'Flank|LEF1_uc003hyw.1_5'Flank	NM_016269	NP_057353			lymphoid enhancer-binding factor 1 isoform 1						canonical Wnt receptor signaling pathway|cell chemotaxis|cellular response to interleukin-4|epithelial to mesenchymal transition|histone H3 acetylation|histone H4 acetylation|negative regulation of apoptosis in bone marrow|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cell-cell adhesion|negative regulation of DNA binding|negative regulation of estrogen receptor binding|negative regulation of interleukin-13 production|negative regulation of interleukin-4 production|negative regulation of interleukin-5 production|negative regulation of transcription, DNA-dependent|neutrophil differentiation|osteoblast differentiation|palate development|positive regulation by host of viral transcription|positive regulation of cell cycle process|positive regulation of cell growth|positive regulation of cell migration|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of cell proliferation in bone marrow|positive regulation of cell-cell adhesion|positive regulation of epithelial to mesenchymal transition|positive regulation of granulocyte differentiation|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|T-helper 1 cell differentiation	cytoplasm|protein-DNA complex|transcription factor complex	armadillo repeat domain binding|beta-catenin binding|C2H2 zinc finger domain binding|caspase inhibitor activity|DNA bending activity|enhancer binding|estrogen receptor activity|estrogen receptor binding|gamma-catenin binding|histone binding|sequence-specific DNA binding|transcription regulatory region DNA binding			large_intestine(1)	1				OV - Ovarian serous cystadenocarcinoma(123;0.000224)														---	---	---	---
GAR1	54433	broad.mit.edu	37	4	110739444	110739444	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:110739444delT	uc003hzt.2	+						GAR1_uc003hzu.2_Intron|GAR1_uc010imh.1_Intron|GAR1_uc010imi.2_Intron	NM_018983	NP_061856			nucleolar protein family A, member 1						rRNA processing|snRNA pseudouridine synthesis	box H/ACA snoRNP complex|Cajal body	cation channel activity|pseudouridine synthase activity|snoRNA binding				0																		---	---	---	---
ENPEP	2028	broad.mit.edu	37	4	111409613	111409613	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:111409613delT	uc003iab.3	+							NM_001977	NP_001968			glutamyl aminopeptidase						cell migration|cell proliferation|cell-cell signaling|proteolysis	integral to plasma membrane	aminopeptidase activity|metalloexopeptidase activity|zinc ion binding			skin(3)|ovary(1)|breast(1)	5		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.0031)	L-Glutamic Acid(DB00142)													---	---	---	---
ARSJ	79642	broad.mit.edu	37	4	114823494	114823494	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:114823494delT	uc003ibq.1	-	2	2624	c.1736delA	c.(1735-1737)AAGfs	p.K579fs	ARSJ_uc010imu.1_Frame_Shift_Del_p.K579fs|ARSJ_uc010imv.1_Frame_Shift_Del_p.K407fs	NM_024590	NP_078866	Q5FYB0	ARSJ_HUMAN	arylsulfatase J precursor	579						extracellular region	arylsulfatase activity|metal ion binding			ovary(1)	1		Ovarian(17;0.0035)|Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.00194)														---	---	---	---
PRSS12	8492	broad.mit.edu	37	4	119203559	119203559	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:119203559delT	uc003ica.1	-							NM_003619	NP_003610			neurotrypsin precursor							membrane	scavenger receptor activity			skin(1)	1																		---	---	---	---
SEC24D	9871	broad.mit.edu	37	4	119659261	119659262	+	Intron	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:119659261_119659262insC	uc003ici.3	-						SEC24D_uc003ich.3_Intron|SEC24D_uc003icj.3_Intron|SEC24D_uc003icl.2_Intron	NM_014822	NP_055637			Sec24-related protein D						COPII vesicle coating|intracellular protein transport|post-translational protein modification|protein N-linked glycosylation via asparagine	COPII vesicle coat|cytosol|endoplasmic reticulum membrane|Golgi membrane|perinuclear region of cytoplasm	zinc ion binding				0																		---	---	---	---
TNIP3	79931	broad.mit.edu	37	4	122059992	122059992	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:122059992delC	uc010ing.2	-						TNIP3_uc010inh.2_Intron|TNIP3_uc011cgj.1_Intron	NM_024873	NP_079149			TNFAIP3 interacting protein 3											ovary(1)	1																		---	---	---	---
TRPC3	7222	broad.mit.edu	37	4	122801049	122801050	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:122801049_122801050insA	uc003ieg.2	-						TRPC3_uc010inr.2_Intron|TRPC3_uc003ief.2_Intron|TRPC3_uc011cgl.1_Intron	NM_001130698	NP_001124170			transient receptor potential cation channel,						axon guidance|phototransduction|platelet activation	integral to plasma membrane	protein binding|store-operated calcium channel activity			ovary(2)	2																		---	---	---	---
GYPE	2996	broad.mit.edu	37	4	144809651	144809651	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:144809651delT	uc003ijj.2	-						GYPE_uc010ion.2_Intron|GYPE_uc003ijk.3_Intron	NM_198682	NP_941391			glycophorin E precursor							integral to plasma membrane					0	all_hematologic(180;0.158)																	---	---	---	---
TMEM184C	55751	broad.mit.edu	37	4	148554739	148554739	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:148554739delT	uc003ila.3	+							NM_018241	NP_060711			transmembrane protein 184C							integral to membrane					0																		---	---	---	---
ARHGAP10	79658	broad.mit.edu	37	4	148967884	148967884	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:148967884delA	uc003ilf.2	+						ARHGAP10_uc003ilg.2_Intron|ARHGAP10_uc003ilh.2_Intron|ARHGAP10_uc003ili.2_Intron	NM_024605	NP_078881			Rho GTPase activating protein 10						apoptosis|filopodium assembly|regulation of apoptosis|small GTPase mediated signal transduction	cytosol|perinuclear region of cytoplasm|plasma membrane	cytoskeletal adaptor activity|SH3 domain binding			skin(2)|pancreas(1)|lung(1)	4	all_hematologic(180;0.151)	Renal(17;0.0166)		GBM - Glioblastoma multiforme(119;0.0423)														---	---	---	---
RPS3A	6189	broad.mit.edu	37	4	152023353	152023353	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:152023353delT	uc003ilz.2	+						RPS3A_uc011cie.1_Intron|SNORD73A_uc003ima.1_5'Flank	NM_001006	NP_000997			ribosomal protein S3a						cell differentiation|endocrine pancreas development|induction of apoptosis|translational elongation|translational initiation|translational termination|viral transcription	cytosolic small ribosomal subunit|nucleolus	protein binding|RNA binding|structural constituent of ribosome			ovary(1)	1	all_hematologic(180;0.093)																	---	---	---	---
RPS3A	6189	broad.mit.edu	37	4	152024907	152024908	+	Intron	DEL	TA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:152024907_152024908delTA	uc003ilz.2	+						RPS3A_uc011cie.1_3'UTR|SNORD73A_uc003ima.1_5'Flank	NM_001006	NP_000997			ribosomal protein S3a						cell differentiation|endocrine pancreas development|induction of apoptosis|translational elongation|translational initiation|translational termination|viral transcription	cytosolic small ribosomal subunit|nucleolus	protein binding|RNA binding|structural constituent of ribosome			ovary(1)	1	all_hematologic(180;0.093)																	---	---	---	---
Unknown	0	broad.mit.edu	37	4	165865192	165865192	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:165865192delA								MARCH1 (559990 upstream) : TRIM61 (10408 downstream)																																			---	---	---	---
NEK1	4750	broad.mit.edu	37	4	170429376	170429376	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:170429376delA	uc003isb.1	-						NEK1_uc003isc.1_Intron|NEK1_uc003isd.1_Intron|NEK1_uc003ise.1_Intron|NEK1_uc003isf.1_Intron	NM_012224	NP_036356			NIMA-related kinase 1						cell division|cilium assembly|mitosis	nucleus|pericentriolar material	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			lung(3)|ovary(2)|large_intestine(1)	6		Prostate(90;0.00601)|Renal(120;0.0183)		GBM - Glioblastoma multiforme(119;0.0287)|KIRC - Kidney renal clear cell carcinoma(143;0.0325)|Kidney(143;0.0385)|LUSC - Lung squamous cell carcinoma(193;0.14)														---	---	---	---
WDR17	116966	broad.mit.edu	37	4	177019259	177019259	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:177019259delA	uc003iuj.2	+						WDR17_uc003iuk.2_Intron|WDR17_uc003ium.3_Intron|WDR17_uc003iul.1_Intron	NM_170710	NP_733828			WD repeat domain 17 isoform 1											ovary(2)|skin(2)|pancreas(1)|central_nervous_system(1)	6		Breast(14;0.00015)|Melanoma(52;0.00886)|Prostate(90;0.00996)|Renal(120;0.0183)|all_hematologic(60;0.107)|all_neural(102;0.164)		all cancers(43;2.21e-20)|Epithelial(43;9.71e-18)|OV - Ovarian serous cystadenocarcinoma(60;2.38e-09)|GBM - Glioblastoma multiforme(59;0.000295)|STAD - Stomach adenocarcinoma(60;0.000703)|LUSC - Lung squamous cell carcinoma(193;0.0232)														---	---	---	---
FAM92A3	403315	broad.mit.edu	37	4	183959379	183959379	+	RNA	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:183959379delA	uc003ivi.3	+	1		c.562delA				NR_003612				Homo sapiens family with sequence similarity 92, member A3, mRNA (cDNA clone IMAGE:4822144).												0																		---	---	---	---
SNX25	83891	broad.mit.edu	37	4	186242224	186242224	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:186242224delA	uc003ixh.2	+						SNX25_uc010ish.2_Intron|SNX25_uc003ixi.2_Intron	NM_031953	NP_114159			sorting nexin 25						cell communication|protein transport	endosome membrane	phosphatidylinositol binding|signal transducer activity			ovary(2)|breast(2)|pancreas(1)	5		all_lung(41;1.03e-13)|Lung NSC(41;2.5e-13)|Hepatocellular(41;0.00826)|Colorectal(36;0.00886)|Renal(120;0.00988)|Prostate(90;0.0235)|all_hematologic(60;0.0592)|all_neural(102;0.243)		all cancers(43;2.13e-24)|Epithelial(43;6.15e-22)|OV - Ovarian serous cystadenocarcinoma(60;5.6e-11)|BRCA - Breast invasive adenocarcinoma(30;0.00013)|Colorectal(24;0.000165)|GBM - Glioblastoma multiforme(59;0.000357)|COAD - Colon adenocarcinoma(29;0.000887)|STAD - Stomach adenocarcinoma(60;0.00118)|LUSC - Lung squamous cell carcinoma(40;0.0129)|READ - Rectum adenocarcinoma(43;0.228)														---	---	---	---
SNX25	83891	broad.mit.edu	37	4	186244502	186244503	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:186244502_186244503delTT	uc003ixh.2	+						SNX25_uc010ish.2_Intron|SNX25_uc003ixi.2_Intron	NM_031953	NP_114159			sorting nexin 25						cell communication|protein transport	endosome membrane	phosphatidylinositol binding|signal transducer activity			ovary(2)|breast(2)|pancreas(1)	5		all_lung(41;1.03e-13)|Lung NSC(41;2.5e-13)|Hepatocellular(41;0.00826)|Colorectal(36;0.00886)|Renal(120;0.00988)|Prostate(90;0.0235)|all_hematologic(60;0.0592)|all_neural(102;0.243)		all cancers(43;2.13e-24)|Epithelial(43;6.15e-22)|OV - Ovarian serous cystadenocarcinoma(60;5.6e-11)|BRCA - Breast invasive adenocarcinoma(30;0.00013)|Colorectal(24;0.000165)|GBM - Glioblastoma multiforme(59;0.000357)|COAD - Colon adenocarcinoma(29;0.000887)|STAD - Stomach adenocarcinoma(60;0.00118)|LUSC - Lung squamous cell carcinoma(40;0.0129)|READ - Rectum adenocarcinoma(43;0.228)														---	---	---	---
KLKB1	3818	broad.mit.edu	37	4	187149201	187149201	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187149201delA	uc003iyy.2	+						KLKB1_uc011clc.1_Intron|KLKB1_uc011cld.1_Intron	NM_000892	NP_000883			plasma kallikrein B1 precursor						blood coagulation, intrinsic pathway|Factor XII activation|fibrinolysis|plasminogen activation|positive regulation of fibrinolysis	cytoplasm|extracellular space|plasma membrane	serine-type endopeptidase activity			ovary(1)	1		all_cancers(14;1.55e-52)|all_epithelial(14;7.69e-39)|all_lung(41;1.34e-13)|Lung NSC(41;3.58e-13)|Melanoma(20;1.91e-06)|Colorectal(36;0.00664)|Hepatocellular(41;0.00886)|Renal(120;0.00988)|Prostate(90;0.00996)|all_hematologic(60;0.014)|all_neural(102;0.243)		OV - Ovarian serous cystadenocarcinoma(60;1.29e-10)|BRCA - Breast invasive adenocarcinoma(30;3.8e-05)|GBM - Glioblastoma multiforme(59;0.000131)|STAD - Stomach adenocarcinoma(60;0.000292)|LUSC - Lung squamous cell carcinoma(40;0.00241)|READ - Rectum adenocarcinoma(43;0.168)														---	---	---	---
KIAA0947	23379	broad.mit.edu	37	5	5457380	5457381	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:5457380_5457381delTT	uc003jdm.3	+							NM_015325	NP_056140			hypothetical protein LOC23379											ovary(1)|central_nervous_system(1)	2																		---	---	---	---
KIAA0947	23379	broad.mit.edu	37	5	5476075	5476075	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:5476075delT	uc003jdm.3	+							NM_015325	NP_056140			hypothetical protein LOC23379											ovary(1)|central_nervous_system(1)	2																		---	---	---	---
MARCH6	10299	broad.mit.edu	37	5	10394704	10394704	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:10394704delT	uc003jet.1	+						MARCH6_uc011cmu.1_Intron|MARCH6_uc003jeu.1_Intron|MARCH6_uc011cmv.1_Intron	NM_005885	NP_005876			membrane-associated ring finger (C3HC4) 6						protein K48-linked ubiquitination	integral to endoplasmic reticulum membrane	ubiquitin conjugating enzyme binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|breast(1)	2																		---	---	---	---
DNAH5	1767	broad.mit.edu	37	5	13824140	13824140	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:13824140delA	uc003jfd.2	-							NM_001369	NP_001360			dynein, axonemal, heavy chain 5						microtubule-based movement	cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(14)|skin(13)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|pancreas(1)	31	Lung NSC(4;0.00476)													Kartagener_syndrome				---	---	---	---
MYO10	4651	broad.mit.edu	37	5	16668191	16668191	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:16668191delA	uc003jft.3	-						MYO10_uc011cnb.1_Intron|MYO10_uc011cnc.1_Intron|MYO10_uc011cnd.1_Intron|MYO10_uc011cne.1_Intron|MYO10_uc010itx.2_Intron	NM_012334	NP_036466			myosin X						axon guidance|signal transduction	myosin complex	actin binding|ATP binding|motor activity			ovary(2)|pancreas(1)	3																		---	---	---	---
CDH18	1016	broad.mit.edu	37	5	19747499	19747499	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:19747499delT	uc003jgc.2	-						CDH18_uc003jgd.2_Intron|CDH18_uc011cnm.1_Intron	NM_004934	NP_004925			cadherin 18, type 2 preproprotein						adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(5)|large_intestine(1)|skin(1)	7	Lung NSC(1;0.00734)|all_lung(1;0.0197)																	---	---	---	---
CDH10	1008	broad.mit.edu	37	5	24492846	24492847	+	Intron	DEL	AT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:24492846_24492847delAT	uc003jgr.1	-						CDH10_uc011cnu.1_Intron	NM_006727	NP_006718			cadherin 10, type 2 preproprotein						adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|pancreas(4)|breast(2)	12				STAD - Stomach adenocarcinoma(35;0.0556)											HNSCC(23;0.051)			---	---	---	---
RNASEN	29102	broad.mit.edu	37	5	31451753	31451753	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31451753delA	uc003jhg.2	-						RNASEN_uc003jhh.2_Intron|RNASEN_uc003jhi.2_Intron	NM_013235	NP_037367			ribonuclease III, nuclear isoform 1						gene silencing by RNA|ribosome biogenesis|RNA processing	nucleolus|nucleoplasm	double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity				0																		---	---	---	---
PDZD2	23037	broad.mit.edu	37	5	31840576	31840576	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31840576delT	uc003jhl.2	+						PDZD2_uc003jhm.2_Intron	NM_178140	NP_835260			PDZ domain containing 2						cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9																		---	---	---	---
NPR3	4883	broad.mit.edu	37	5	32786466	32786466	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:32786466delT	uc003jhv.2	+	8					NPR3_uc011cnz.1_3'UTR|NPR3_uc003jhu.2_3'UTR|C5orf23_uc003jhw.1_5'Flank	NM_000908	NP_000899			natriuretic peptide receptor C/guanylate cyclase						osteoclast proliferation|positive regulation of urine volume|regulation of blood pressure|regulation of osteoblast proliferation|skeletal system development	integral to membrane	hormone binding|natriuretic peptide receptor activity			ovary(1)|central_nervous_system(1)	2					Nesiritide(DB04899)													---	---	---	---
RXFP3	51289	broad.mit.edu	37	5	33938339	33938339	+	3'UTR	DEL	G	-	-	rs3832336		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:33938339delG	uc003jic.1	+	1						NM_016568	NP_057652			relaxin/insulin-like family peptide receptor 3							integral to plasma membrane	N-formyl peptide receptor activity			upper_aerodigestive_tract(1)	1																		---	---	---	---
SKP2	6502	broad.mit.edu	37	5	36183774	36183774	+	Intron	DEL	T	-	-	rs141292010		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:36183774delT	uc003jkd.2	+							NM_032637	NP_116026			S-phase kinase-associated protein 2 isoform 2						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell proliferation|G1/S transition of mitotic cell cycle|S phase of mitotic cell cycle	nucleoplasm|SCF ubiquitin ligase complex	protein binding			central_nervous_system(2)|ovary(1)|breast(1)	4	all_lung(31;5.63e-05)		Epithelial(62;0.0396)|Lung(74;0.111)|all cancers(62;0.115)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---
HEATR7B2	133558	broad.mit.edu	37	5	41047896	41047896	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41047896delA	uc003jmj.3	-						HEATR7B2_uc003jmi.3_Intron	NM_173489	NP_775760			HEAT repeat family member 7B2								binding			ovary(6)|central_nervous_system(2)	8																		---	---	---	---
PAIP1	10605	broad.mit.edu	37	5	43535227	43535227	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:43535227delA	uc003job.2	-						PAIP1_uc003joa.2_Intron|PAIP1_uc010ivp.2_Intron|PAIP1_uc010ivo.2_Intron|PAIP1_uc003joc.2_Intron	NM_006451	NP_006442			poly(A) binding protein interacting protein 1						mRNA stabilization|nuclear-transcribed mRNA poly(A) tail shortening|translational initiation	cytosol	protein binding|RNA binding|translation activator activity			ovary(1)	1	Lung NSC(6;2.07e-05)																	---	---	---	---
Unknown	0	broad.mit.edu	37	5	50571607	50571610	+	IGR	DEL	AAAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:50571607_50571610delAAAA								PARP8 (433438 upstream) : ISL1 (107348 downstream)																																			---	---	---	---
C5orf35	133383	broad.mit.edu	37	5	56210885	56210885	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:56210885delT	uc003jqx.2	+						C5orf35_uc003jqy.2_Intron	NM_153706	NP_714917			hypothetical protein LOC133383											ovary(1)	1		Lung NSC(810;0.000861)|Prostate(74;0.0305)|Breast(144;0.173)		OV - Ovarian serous cystadenocarcinoma(10;2.58e-39)														---	---	---	---
PDE4D	5144	broad.mit.edu	37	5	59284181	59284182	+	3'UTR	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:59284181_59284182delTT	uc003jse.1	-	5					PDE4D_uc003jsb.2_Intron|PDE4D_uc010iwj.1_3'UTR					Homo sapiens cAMP-specific phosphodiesterase PDE4D7 (PDE4D) mRNA, complete cds; alternatively spliced.						signal transduction	cytosol|insoluble fraction|membrane|microtubule organizing center|soluble fraction	3',5'-cyclic-AMP phosphodiesterase activity|metal ion binding			breast(1)|central_nervous_system(1)	2		all_cancers(5;6.5e-58)|all_epithelial(5;1.75e-57)|all_lung(5;6.84e-18)|Lung NSC(5;1.29e-17)|Melanoma(5;0.00168)|Prostate(74;0.00234)|Colorectal(97;0.00629)|Ovarian(174;0.00832)|Breast(144;0.00996)|all_hematologic(6;0.0344)|Hepatocellular(6;0.0742)|Esophageal squamous(6;0.0954)		Epithelial(2;2.6e-55)|all cancers(2;2.66e-49)|OV - Ovarian serous cystadenocarcinoma(10;1.48e-39)|Colorectal(2;8.29e-08)|Lung(2;4.47e-07)|STAD - Stomach adenocarcinoma(2;1.11e-05)|COAD - Colon adenocarcinoma(2;0.00012)|LUSC - Lung squamous cell carcinoma(2;0.000775)|LUAD - Lung adenocarcinoma(3;0.0173)|READ - Rectum adenocarcinoma(2;0.0276)	Adenosine monophosphate(DB00131)|Dyphylline(DB00651)													---	---	---	---
CENPK	64105	broad.mit.edu	37	5	64848599	64848600	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:64848599_64848600delAA	uc003jts.2	-						CENPK_uc003jtt.2_Intron|CENPK_uc003jtu.2_Intron	NM_022145	NP_071428			SoxLZ/Sox6 leucine zipper binding protein						CenH3-containing nucleosome assembly at centromere|mitotic prometaphase	condensed chromosome kinetochore|cytosol|nucleoplasm					0		Lung NSC(167;7.21e-05)|Prostate(74;0.0174)|Ovarian(174;0.186)		Lung(70;0.00466)														---	---	---	---
MARVELD2	153562	broad.mit.edu	37	5	68737186	68737186	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:68737186delA	uc003jwq.2	+						MARVELD2_uc010ixf.2_Intron|MARVELD2_uc003jwr.1_Intron|MARVELD2_uc003jws.1_Intron	NM_001038603	NP_001033692			MARVEL domain containing 2 isoform 1						sensory perception of sound	integral to membrane|tight junction					0		Lung NSC(167;0.000937)|Prostate(74;0.0187)|Ovarian(174;0.16)		OV - Ovarian serous cystadenocarcinoma(47;7.31e-57)|Epithelial(20;1.05e-52)|all cancers(19;2.63e-48)|Lung(70;0.0183)														---	---	---	---
GTF2H2C	728340	broad.mit.edu	37	5	68862364	68862365	+	Intron	DEL	GG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:68862364_68862365delGG	uc003jwx.3	+						GTF2H2C_uc003jww.1_Intron|GTF2H2C_uc003jwz.3_Intron|GTF2H2C_uc011cre.1_Intron|GTF2H2C_uc003jwy.3_Intron	NM_001098728	NP_001092198			general transcription factor IIH, polypeptide						DNA repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding				0																		---	---	---	---
TNPO1	3842	broad.mit.edu	37	5	72146953	72146953	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:72146953delA	uc003kck.3	+						TNPO1_uc011csi.1_Intron|TNPO1_uc011csj.1_Intron|TNPO1_uc003kch.2_Intron|TNPO1_uc003kci.3_Intron|TNPO1_uc003kcg.3_Intron	NM_002270	NP_002261			transportin 1 isoform 1						interspecies interaction between organisms|mRNA metabolic process|protein import into nucleus, translocation	cytosol|nucleus	nuclear localization sequence binding|protein binding|protein transporter activity			skin(3)|urinary_tract(1)|ovary(1)|kidney(1)|central_nervous_system(1)	7		Lung NSC(167;0.0053)|Ovarian(174;0.0175)		OV - Ovarian serous cystadenocarcinoma(47;6.14e-54)														---	---	---	---
RGNEF	64283	broad.mit.edu	37	5	73165731	73165731	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:73165731delA	uc011csq.1	+						RGNEF_uc003kcx.2_Intron|RGNEF_uc010izf.2_Intron|RGNEF_uc011csr.1_Intron	NM_001080479	NP_001073948			Rho-guanine nucleotide exchange factor						cell differentiation|intracellular signal transduction|regulation of Rho protein signal transduction	cytoplasm|plasma membrane	metal ion binding|Rho guanyl-nucleotide exchange factor activity|RNA binding				0		Lung NSC(167;0.0378)|all_lung(232;0.04)|Ovarian(174;0.0798)		OV - Ovarian serous cystadenocarcinoma(47;1.25e-51)														---	---	---	---
GFM2	84340	broad.mit.edu	37	5	74037263	74037263	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:74037263delA	uc003kdh.1	-						GFM2_uc003kdi.1_Intron|GFM2_uc010izj.1_Intron|GFM2_uc010izk.1_Intron|GFM2_uc003kdj.1_Intron|GFM2_uc010izl.1_Intron	NM_032380	NP_115756			mitochondrial elongation factor G2 isoform 1						mitochondrial translation|ribosome disassembly	mitochondrion	GTP binding|GTPase activity				0		all_lung(232;0.00101)|Lung NSC(167;0.00278)|Ovarian(174;0.0129)|Breast(144;0.231)		OV - Ovarian serous cystadenocarcinoma(47;1.86e-56)														---	---	---	---
FAM151B	167555	broad.mit.edu	37	5	79809324	79809324	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79809324delT	uc003kgv.1	+						FAM151B_uc010jal.1_Intron	NM_205548	NP_991111			hypothetical protein LOC167555												0		Lung NSC(167;0.0427)|all_lung(232;0.0464)|Ovarian(174;0.113)		OV - Ovarian serous cystadenocarcinoma(54;8.21e-47)|Epithelial(54;8.3e-42)|all cancers(79;1.97e-36)														---	---	---	---
FAM151B	167555	broad.mit.edu	37	5	79817732	79817732	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79817732delT	uc003kgv.1	+						FAM151B_uc010jal.1_Intron	NM_205548	NP_991111			hypothetical protein LOC167555												0		Lung NSC(167;0.0427)|all_lung(232;0.0464)|Ovarian(174;0.113)		OV - Ovarian serous cystadenocarcinoma(54;8.21e-47)|Epithelial(54;8.3e-42)|all cancers(79;1.97e-36)														---	---	---	---
DHFR	1719	broad.mit.edu	37	5	79933949	79933949	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79933949delA	uc003kgy.1	-						DHFR_uc011ctl.1_Intron|DHFR_uc011ctm.1_Intron|DHFR_uc010jap.1_Intron|DHFR_uc003kgx.1_Intron	NM_000791	NP_000782			dihydrofolate reductase						folic acid metabolic process|glycine biosynthetic process|nucleotide biosynthetic process|one-carbon metabolic process|regulation of transcription involved in G1/S phase of mitotic cell cycle|response to methotrexate|tetrahydrofolate metabolic process	cytosol	dihydrofolate reductase activity|drug binding|folate reductase activity|NADP binding				0		Lung NSC(167;0.00475)|all_lung(232;0.00502)|Ovarian(174;0.0261)		OV - Ovarian serous cystadenocarcinoma(54;2.69e-46)|Epithelial(54;7.49e-41)|all cancers(79;1.54e-35)	Dapsone(DB00250)|Dimethyl sulfoxide(DB01093)|Lamotrigine(DB00555)|Methotrexate(DB00563)|NADH(DB00157)|Pemetrexed(DB00642)|Proguanil(DB01131)|Pyrimethamine(DB00205)|Trimethoprim(DB00440)|Trimetrexate(DB01157)													---	---	---	---
ACOT12	134526	broad.mit.edu	37	5	80638647	80638647	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:80638647delA	uc003khl.3	-						RNU5E_uc011cto.1_Intron	NM_130767	NP_570123			acyl-CoA thioesterase 12						acyl-CoA metabolic process|fatty acid metabolic process	cytosol	acetyl-CoA hydrolase activity|carboxylesterase activity			ovary(1)|kidney(1)	2		Lung NSC(167;0.0176)|all_lung(232;0.0205)|Ovarian(174;0.135)		OV - Ovarian serous cystadenocarcinoma(54;1.37e-45)|Epithelial(54;1.25e-39)|all cancers(79;5.01e-34)														---	---	---	---
Unknown	0	broad.mit.edu	37	5	81614226	81614226	+	IGR	DEL	A	-	-	rs71756795		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:81614226delA								ATP6AP1L (80 upstream) : TMEM167A (734441 downstream)																																			---	---	---	---
TMEM161B	153396	broad.mit.edu	37	5	87536473	87536474	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:87536473_87536474delAA	uc003kjc.2	-						TMEM161B_uc011cty.1_Intron|TMEM161B_uc010jax.2_Intron|TMEM161B_uc011ctz.1_Intron	NM_153354	NP_699185			transmembrane protein 161B							integral to membrane				skin(2)	2		all_cancers(142;0.000275)|Lung NSC(167;0.00901)|all_lung(232;0.0111)|Colorectal(57;0.0959)|Ovarian(174;0.1)		OV - Ovarian serous cystadenocarcinoma(54;6.24e-36)|Epithelial(54;6.8e-31)|all cancers(79;1.07e-26)														---	---	---	---
LOC645323	645323	broad.mit.edu	37	5	87898998	87898998	+	Intron	DEL	A	-	-	rs11959094		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:87898998delA	uc011cua.1	-							NR_015436				Homo sapiens cDNA FLJ34037 fis, clone FCBBF2005439.												0																		---	---	---	---
Unknown	0	broad.mit.edu	37	5	88215295	88215295	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:88215295delA	uc003kjn.1	+											Homo sapiens mRNA; cDNA DKFZp586I041 (from clone DKFZp586I041).																														---	---	---	---
GPR98	84059	broad.mit.edu	37	5	90398018	90398018	+	Intron	DEL	T	-	-	rs140911567		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90398018delT	uc003kju.2	+						GPR98_uc003kjt.2_Intron|GPR98_uc003kjw.2_Intron|GPR98_uc003kjx.2_Intron	NM_032119	NP_115495			G protein-coupled receptor 98 precursor						cell communication|cell-cell adhesion|maintenance of organ identity|neuropeptide signaling pathway|photoreceptor cell maintenance	cell surface|cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(11)|central_nervous_system(3)|pancreas(2)	16		all_cancers(142;1.05e-09)|all_epithelial(76;1.81e-12)|all_lung(232;5.41e-06)|Lung NSC(167;1.72e-05)|Ovarian(174;0.00948)|Colorectal(57;0.133)|Breast(839;0.192)		OV - Ovarian serous cystadenocarcinoma(54;7.01e-30)|Epithelial(54;6.79e-25)|all cancers(79;1.88e-20)												OREG0016703	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
ARRDC3	57561	broad.mit.edu	37	5	90671548	90671548	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90671548delT	uc003kjz.2	-							NM_020801	NP_065852			arrestin domain containing 3						signal transduction	cytoplasm	protein binding			ovary(1)|breast(1)	2		all_cancers(142;2.22e-05)|all_epithelial(76;1.58e-07)|all_lung(232;0.000521)|Lung NSC(167;0.000548)|Ovarian(174;0.0798)|Colorectal(57;0.207)		OV - Ovarian serous cystadenocarcinoma(54;4.56e-30)|Epithelial(54;7.55e-26)|all cancers(79;3.63e-22)														---	---	---	---
FAM172A	83989	broad.mit.edu	37	5	93019526	93019526	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:93019526delT	uc010jbd.2	-						FAM172A_uc011cuf.1_Intron|FAM172A_uc011cug.1_Intron|FAM172A_uc011cuh.1_Intron|FAM172A_uc011cui.1_Intron|FAM172A_uc011cuj.1_Intron	NM_032042	NP_114431			hypothetical protein LOC83989 isoform 1							endoplasmic reticulum|extracellular region					0																		---	---	---	---
MAN2A1	4124	broad.mit.edu	37	5	109202902	109202902	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:109202902delT	uc003kou.1	+	22						NM_002372	NP_002363			mannosidase, alpha, class 2A, member 1						mannose metabolic process|post-translational protein modification|protein N-linked glycosylation via asparagine	Golgi membrane|integral to membrane	alpha-mannosidase activity|carbohydrate binding|mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity|zinc ion binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3		all_cancers(142;8.66e-07)|all_epithelial(76;7.73e-09)|Prostate(80;0.000303)|Lung NSC(167;0.0186)|all_lung(232;0.0241)|Ovarian(225;0.0444)|Colorectal(57;0.0959)|Breast(839;0.244)		OV - Ovarian serous cystadenocarcinoma(64;2.17e-10)|Epithelial(69;1.37e-09)|COAD - Colon adenocarcinoma(37;0.141)														---	---	---	---
YTHDC2	64848	broad.mit.edu	37	5	112915100	112915100	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112915100delT	uc003kqn.2	+							NM_022828	NP_073739			YTH domain containing 2								ATP binding|ATP-dependent helicase activity|nucleic acid binding			skin(2)|central_nervous_system(1)	3		all_cancers(142;7.69e-05)|all_epithelial(76;6.42e-07)|Colorectal(10;0.00278)|Prostate(80;0.00955)|Ovarian(225;0.0444)|Lung NSC(810;0.143)|all_lung(232;0.163)|Breast(839;0.244)		OV - Ovarian serous cystadenocarcinoma(64;7.2e-08)|Epithelial(69;8.83e-08)|all cancers(49;6.9e-06)|COAD - Colon adenocarcinoma(37;0.0458)|Colorectal(14;0.0594)														---	---	---	---
Unknown	0	broad.mit.edu	37	5	121188522	121188522	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:121188522delA								FTMT (1 upstream) : SRFBP1 (109134 downstream)																																			---	---	---	---
CSNK1G3	1456	broad.mit.edu	37	5	122924299	122924299	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:122924299delA	uc003ktm.2	+						CSNK1G3_uc003ktl.2_Intron|CSNK1G3_uc003ktn.2_Intron|CSNK1G3_uc003kto.2_Intron|CSNK1G3_uc011cwr.1_Intron|CSNK1G3_uc011cws.1_Intron|CSNK1G3_uc010jda.2_Intron	NM_004384	NP_004375			casein kinase 1, gamma 3 isoform 1						Wnt receptor signaling pathway	cytoplasm	ATP binding|protein serine/threonine kinase activity				0		all_cancers(142;0.0156)|Prostate(80;0.0322)|Lung NSC(810;0.245)	KIRC - Kidney renal clear cell carcinoma(527;0.165)|Kidney(363;0.229)	OV - Ovarian serous cystadenocarcinoma(64;0.000121)|Epithelial(69;0.000227)|all cancers(49;0.00176)														---	---	---	---
FSTL4	23105	broad.mit.edu	37	5	132534817	132534817	+	Frame_Shift_Del	DEL	C	-	-	rs140495211		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:132534817delC	uc003kyn.1	-	16	2717	c.2499delG	c.(2497-2499)GGGfs	p.G833fs	FSTL4_uc003kym.1_Frame_Shift_Del_p.G482fs	NM_015082	NP_055897	Q6MZW2	FSTL4_HUMAN	follistatin-like 4 precursor	833						extracellular region	calcium ion binding			central_nervous_system(1)|skin(1)	2		all_cancers(142;0.244)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---
NME5	8382	broad.mit.edu	37	5	137451362	137451362	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137451362delT	uc003lce.2	-	6					BRD8_uc003lcc.1_Intron	NM_003551	NP_003542			non-metastatic cells 5, protein expressed in						anti-apoptosis|CTP biosynthetic process|GTP biosynthetic process|multicellular organismal development|spermatid development|UTP biosynthetic process		ATP binding|nucleoside diphosphate kinase activity|protein binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0109)															---	---	---	---
FCHSD1	89848	broad.mit.edu	37	5	141026156	141026156	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:141026156delC	uc003llk.2	-						FCHSD1_uc010jgg.2_5'UTR|FCHSD1_uc003llj.2_Intron	NM_033449	NP_258260			FCH and double SH3 domains 1										FCHSD1/BRAF(2)	skin(2)|ovary(1)|central_nervous_system(1)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
SH3TC2	79628	broad.mit.edu	37	5	148384558	148384559	+	Intron	DEL	TG	-	-	rs1432799	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:148384558_148384559delTG	uc003lpu.2	-						SH3TC2_uc003lpp.1_Intron|SH3TC2_uc010jgw.2_Intron|SH3TC2_uc003lps.2_Intron|SH3TC2_uc003lpt.2_Intron|SH3TC2_uc010jgx.2_Intron	NM_024577	NP_078853			SH3 domain and tetratricopeptide repeats 2								binding			ovary(2)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
CSF1R	1436	broad.mit.edu	37	5	149473844	149473844	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:149473844delT	uc003lrm.2	-							NM_005211	NP_005202			colony stimulating factor 1 receptor precursor						cell proliferation|multicellular organismal development|transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane|receptor complex	ATP binding|cytokine binding|macrophage colony-stimulating factor receptor activity|protein homodimerization activity			haematopoietic_and_lymphoid_tissue(38)|lung(6)|central_nervous_system(3)|liver(3)|breast(2)|endometrium(1)|ovary(1)	54			KIRC - Kidney renal clear cell carcinoma(527;0.000962)|Kidney(363;0.00147)		Imatinib(DB00619)|Sunitinib(DB01268)													---	---	---	---
G3BP1	10146	broad.mit.edu	37	5	151174853	151174853	+	Intron	DEL	A	-	-	rs35887288		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:151174853delA	uc003lun.2	+						G3BP1_uc003lum.2_Intron|G3BP1_uc011dcu.1_Intron|G3BP1_uc010jhz.2_Intron|G3BP1_uc003luq.2_5'Flank	NM_005754	NP_005745			Ras-GTPase-activating protein SH3-domain-binding						Ras protein signal transduction|transport	cytosol|nucleus|plasma membrane	ATP binding|ATP-dependent DNA helicase activity|ATP-dependent RNA helicase activity|DNA binding|endonuclease activity|protein binding|RNA binding			skin(3)|ovary(1)	4		all_hematologic(541;0.0338)|Medulloblastoma(196;0.091)	Kidney(363;0.000171)|KIRC - Kidney renal clear cell carcinoma(527;0.000785)															---	---	---	---
LARP1	23367	broad.mit.edu	37	5	154170383	154170383	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:154170383delT	uc003lvp.2	+						LARP1_uc003lvo.2_Intron|LARP1_uc010jie.1_Intron	NM_033551	NP_291029			la related protein isoform 2								protein binding|RNA binding			ovary(2)|pancreas(1)|skin(1)	4	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.147)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)															---	---	---	---
C5orf4	10826	broad.mit.edu	37	5	154217841	154217842	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:154217841_154217842delAA	uc003lvs.3	-						C5orf4_uc011dde.1_Intron	NM_032385	NP_115761			hypothetical protein LOC10826						fatty acid biosynthetic process	integral to membrane	iron ion binding|oxidoreductase activity			ovary(1)	1	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.0999)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)															---	---	---	---
GEMIN5	25929	broad.mit.edu	37	5	154305780	154305780	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:154305780delA	uc003lvx.3	-						GEMIN5_uc011ddk.1_Intron	NM_015465	NP_056280			gemin 5						ncRNA metabolic process|protein complex assembly|spliceosomal snRNP assembly	Cajal body|cytosol|spliceosomal complex	protein binding|snRNA binding			skin(2)|ovary(1)	3	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.147)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)															---	---	---	---
TIMD4	91937	broad.mit.edu	37	5	156375404	156375404	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156375404delA	uc003lwh.2	-						TIMD4_uc010jii.2_Intron	NM_138379	NP_612388			T-cell immunoglobulin and mucin domain							integral to membrane				ovary(2)	2	Renal(175;0.00488)	Medulloblastoma(196;0.0523)|all_neural(177;0.21)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)															---	---	---	---
ATP10B	23120	broad.mit.edu	37	5	160112954	160112954	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:160112954delC	uc003lym.1	-						ATP10B_uc003lyp.2_Intron|ATP10B_uc011deg.1_Intron|ATP10B_uc003lyo.2_5'Flank	NM_025153	NP_079429			ATPase, class V, type 10B						ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(3)|central_nervous_system(1)|pancreas(1)	5	Renal(175;0.00196)	Medulloblastoma(196;0.0377)|all_neural(177;0.121)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)															---	---	---	---
ODZ2	57451	broad.mit.edu	37	5	167182419	167182419	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:167182419delT	uc010jjd.2	+						ODZ2_uc003lzq.2_Intron|ODZ2_uc003lzr.3_Intron	NM_001122679	NP_001116151			odz, odd Oz/ten-m homolog 2											ovary(6)|central_nervous_system(4)	10	Renal(175;0.00124)|Lung NSC(126;0.136)|all_lung(126;0.242)	Medulloblastoma(196;0.0241)|all_neural(177;0.026)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.0444)|OV - Ovarian serous cystadenocarcinoma(192;0.0694)|Epithelial(171;0.124)														---	---	---	---
CCDC99	54908	broad.mit.edu	37	5	169021159	169021161	+	In_Frame_Del	DEL	AAG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:169021159_169021161delAAG	uc003mae.3	+	5	821_823	c.542_544delAAG	c.(541-546)AAAGAA>AAA	p.E183del	CCDC99_uc010jjj.2_In_Frame_Del_p.E112del|CCDC99_uc011deq.1_Intron|CCDC99_uc010jjk.2_Intron	NM_017785	NP_060255	Q96EA4	SPDLY_HUMAN	coiled-coil domain containing 99	183	Potential.				cell division|establishment of mitotic spindle orientation|mitotic metaphase plate congression|mitotic prometaphase|protein localization to kinetochore	condensed chromosome outer kinetochore|cytosol|microtubule organizing center|nucleus|spindle pole	kinetochore binding|protein binding			ovary(1)|liver(1)	2	Renal(175;0.000159)|Lung NSC(126;0.0221)|all_lung(126;0.0337)	Medulloblastoma(196;0.0208)|all_neural(177;0.0416)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)															---	---	---	---
NPM1	4869	broad.mit.edu	37	5	170819655	170819655	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:170819655delT	uc011dex.1	+						NPM1_uc003mbh.2_Intron|NPM1_uc003mbi.2_Intron|NPM1_uc003mbj.2_Intron	NM_002520	NP_002511			nucleophosmin 1 isoform 1						anti-apoptosis|cell aging|CenH3-containing nucleosome assembly at centromere|centrosome cycle|DNA repair|interspecies interaction between organisms|intracellular protein transport|negative regulation of cell proliferation|negative regulation of centrosome duplication|nucleocytoplasmic transport|positive regulation of NF-kappaB transcription factor activity|protein oligomerization|regulation of endodeoxyribonuclease activity|regulation of endoribonuclease activity|ribosome assembly|signal transduction	nucleolus|nucleoplasm|ribonucleoprotein complex|spindle pole centrosome	histone binding|NF-kappaB binding|protein binding|protein heterodimerization activity|protein homodimerization activity|ribosomal large subunit binding|ribosomal small subunit binding|RNA binding|Tat protein binding|transcription coactivator activity|unfolded protein binding		NPM1/ALK(632)	haematopoietic_and_lymphoid_tissue(3109)|skin(1)	3110	Renal(175;0.000159)|Lung NSC(126;0.00576)|all_lung(126;0.00963)	Medulloblastoma(196;0.0208)|all_neural(177;0.0416)	Kidney(164;7.24e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000516)					T|F 	ALK|RARA|MLF1	NHL|APL|AML								---	---	---	---
SFXN1	94081	broad.mit.edu	37	5	174949356	174949357	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:174949356_174949357delTT	uc003mda.2	+						SFXN1_uc003mdb.1_Intron	NM_022754	NP_073591			sideroflexin 1						iron ion homeostasis	integral to membrane	cation transmembrane transporter activity|protein binding			ovary(1)	1	all_cancers(89;0.00922)|Renal(175;0.000269)|Lung NSC(126;0.00515)|all_lung(126;0.00873)	Medulloblastoma(196;0.0399)|all_neural(177;0.0663)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000183)															---	---	---	---
TSPAN17	26262	broad.mit.edu	37	5	176082909	176082912	+	Intron	DEL	AAAC	-	-	rs6897431	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176082909_176082912delAAAC	uc003met.2	+						TSPAN17_uc003mes.3_Intron|TSPAN17_uc003meu.2_Intron|TSPAN17_uc003mev.2_Intron|TSPAN17_uc003mew.2_Intron	NM_012171	NP_036303			transmembrane 4 superfamily member 17 isoform a							integral to membrane|ubiquitin ligase complex	protein binding|ubiquitin-protein ligase activity				0	all_cancers(89;0.00141)|Renal(175;0.000269)|Lung NSC(126;0.00814)|all_lung(126;0.0133)	Medulloblastoma(196;0.00498)|all_neural(177;0.0212)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
NSD1	64324	broad.mit.edu	37	5	176675269	176675269	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176675269delA	uc003mfr.3	+	11	4723	c.4585delA	c.(4585-4587)AAAfs	p.K1529fs	NSD1_uc003mft.3_Frame_Shift_Del_p.K1260fs|NSD1_uc003mfs.1_Frame_Shift_Del_p.K1426fs|NSD1_uc011dfx.1_Frame_Shift_Del_p.K1177fs	NM_022455	NP_071900	Q96L73	NSD1_HUMAN	nuclear receptor binding SET domain protein 1	1529					negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nucleus	androgen receptor binding|chromatin binding|estrogen receptor binding|histone methyltransferase activity (H3-K36 specific)|histone methyltransferase activity (H4-K20 specific)|ligand-dependent nuclear receptor binding|retinoid X receptor binding|thyroid hormone receptor binding|transcription corepressor activity|zinc ion binding			ovary(2)|kidney(1)	3	all_cancers(89;1.57e-05)|Renal(175;0.000269)|Lung NSC(126;0.00111)|all_lung(126;0.002)	all_neural(177;0.00409)|Medulloblastoma(196;0.00498)|all_hematologic(541;0.21)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)|Epithelial(233;0.198)	Kidney(146;0.235)				T	NUP98	AML		Sotos Syndrome		Beckwith-Wiedemann_syndrome|Sotos_syndrome|Weaver_syndrome	HNSCC(47;0.14)			---	---	---	---
DBN1	1627	broad.mit.edu	37	5	176899050	176899051	+	Intron	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176899050_176899051insG	uc003mgy.2	-						DBN1_uc003mgx.2_Intron|DBN1_uc010jkn.1_Intron	NM_004395	NP_004386			drebrin 1 isoform a						actin filament organization|regulation of dendrite development|regulation of neuronal synaptic plasticity	actomyosin|cytoplasm|dendrite	actin binding|profilin binding			breast(3)|ovary(1)|lung(1)|skin(1)	6	all_cancers(89;2.17e-05)|Renal(175;0.000269)|Lung NSC(126;0.0014)|all_lung(126;0.0025)	all_neural(177;0.00409)|Medulloblastoma(196;0.00498)|all_hematologic(541;0.21)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
CANX	821	broad.mit.edu	37	5	179135170	179135170	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:179135170delT	uc003mkk.2	+						CANX_uc011dgp.1_Intron|CANX_uc010jlb.1_Intron|CANX_uc003mkl.2_Intron|CANX_uc011dgq.1_Intron	NM_001746	NP_001737			calnexin precursor						post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine|protein secretion	endoplasmic reticulum lumen|endoplasmic reticulum membrane|integral to membrane|melanosome	calcium ion binding|sugar binding|unfolded protein binding				0	all_cancers(89;0.000129)|all_epithelial(37;5.59e-05)|Renal(175;0.000159)|Lung NSC(126;0.00121)|all_lung(126;0.00218)	all_cancers(40;0.0413)|Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)		Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---
BTNL9	153579	broad.mit.edu	37	5	180482769	180482769	+	Intron	DEL	A	-	-	rs78636845		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:180482769delA	uc003mmt.2	+							NM_152547	NP_689760			butyrophilin-like 9 precursor							integral to membrane				ovary(1)|central_nervous_system(1)	2	all_cancers(89;2.45e-05)|all_epithelial(37;3.77e-06)|Renal(175;0.000159)|Lung NSC(126;0.00211)|all_lung(126;0.00371)|Breast(19;0.114)	all_cancers(40;0.0801)|Medulloblastoma(196;0.0392)|all_neural(177;0.0529)|all_hematologic(541;0.191)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
RIPK1	8737	broad.mit.edu	37	6	3105661	3105661	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:3105661delT	uc010jni.2	+						RIPK1_uc003muv.3_Intron|RIPK1_uc003muw.3_Intron|RIPK1_uc011dhs.1_Intron|RIPK1_uc003mux.2_Intron	NM_003804	NP_003795			receptor (TNFRSF)-interacting serine-threonine						activation of caspase activity|activation of JUN kinase activity|activation of pro-apoptotic gene products|induction of apoptosis by extracellular signals|induction of necroptosis by extracellular signals|innate immune response|MyD88-independent toll-like receptor signaling pathway|positive regulation of anti-apoptosis|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-8 production|positive regulation of NF-kappaB transcription factor activity|positive regulation of reactive oxygen species metabolic process|positive regulation of transcription from RNA polymerase II promoter|positive regulation of tumor necrosis factor production|protein autophosphorylation|regulation of ATP:ADP antiporter activity|Toll signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|death-inducing signaling complex|endosome membrane|mitochondrion|receptor complex	ATP binding|death domain binding|death receptor binding|protein serine/threonine kinase activity			large_intestine(3)|lung(1)|skin(1)	5	Ovarian(93;0.0386)	all_hematologic(90;0.0895)																---	---	---	---
JARID2	3720	broad.mit.edu	37	6	15246576	15246576	+	5'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:15246576delT	uc003nbj.2	+	1					JARID2_uc011diu.1_Intron|JARID2_uc011div.1_5'Flank	NM_004973	NP_004964			jumonji, AT rich interactive domain 2 protein						central nervous system development|chromatin modification|negative regulation of histone methylation|positive regulation of histone H3-K9 methylation|stem cell differentiation|transcription, DNA-dependent		chromatin binding			ovary(2)|lung(1)|pancreas(1)	4	Breast(50;0.0142)|Ovarian(93;0.103)	all_hematologic(90;0.00612)																---	---	---	---
E2F3	1871	broad.mit.edu	37	6	20483287	20483288	+	Intron	DEL	TG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:20483287_20483288delTG	uc003nda.2	+							NM_001949	NP_001940			E2F transcription factor 3						G1 phase of mitotic cell cycle|G2 phase of mitotic cell cycle|transcription initiation from RNA polymerase II promoter	transcription factor complex	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity			lung(1)	1	all_cancers(95;0.154)|all_epithelial(95;0.0585)|Breast(50;0.146)|Ovarian(93;0.148)		OV - Ovarian serous cystadenocarcinoma(7;0.0068)|all cancers(50;0.0148)|Epithelial(50;0.0562)															---	---	---	---
TDP2	51567	broad.mit.edu	37	6	24654601	24654601	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:24654601delT	uc003nej.2	-						TDP2_uc003nei.2_Intron|TDP2_uc010jpu.1_Intron	NM_016614	NP_057698			TRAF and TNF receptor-associated protein						cell surface receptor linked signaling pathway|double-strand break repair	PML body	5'-tyrosyl-DNA phosphodiesterase activity|magnesium ion binding|nuclease activity|protein binding|transcription corepressor activity			ovary(1)|lung(1)	2													Direct_reversal_of_damage|Editing_and_processing_nucleases					---	---	---	---
HIST1H2BJ	8970	broad.mit.edu	37	6	27099962	27099962	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27099962delA	uc003niu.1	-						HIST1H2AG_uc003niw.2_5'Flank					Homo sapiens histone cluster 1, H2bj, mRNA (cDNA clone IMAGE:4048288), with apparent retained intron.						defense response to bacterium|nucleosome assembly	nucleosome|nucleus	DNA binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	6	27293740	27293740	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27293740delA								FKSG83 (1 upstream) : ZNF204P (31862 downstream)																																			---	---	---	---
TUBB	203068	broad.mit.edu	37	6	30688217	30688217	+	5'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30688217delA	uc003nrl.2	+	1					MDC1_uc003nrg.3_5'Flank|TUBB_uc003nrk.1_5'UTR|TUBB_uc011dmq.1_5'Flank	NM_178014	NP_821133			tubulin, beta						cellular component movement|G2/M transition of mitotic cell cycle|microtubule-based movement|natural killer cell mediated cytotoxicity|protein polymerization	cytosol|microtubule	GTP binding|GTPase activity|MHC class I protein binding			ovary(1)	1					Colchicine(DB01394)|Vinblastine(DB00570)|Vincristine(DB00541)|Vinorelbine(DB00361)													---	---	---	---
PPT2	9374	broad.mit.edu	37	6	32123888	32123888	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32123888delT	uc003nzx.2	+						uc003nzv.3_5'Flank|PPT2_uc003nzw.2_Intron|PPT2_uc011dpi.1_Intron|PPT2_uc003nzy.1_Intron|PPT2_uc003nzz.2_Intron|PPT2_uc003oaa.2_Intron|PPT2_uc010jtu.1_Intron	NM_005155	NP_005146			palmitoyl-protein thioesterase 2 isoform a						protein modification process	lysosome	palmitoyl-(protein) hydrolase activity				0																		---	---	---	---
COL11A2	1302	broad.mit.edu	37	6	33140009	33140009	+	Intron	DEL	T	-	-	rs973233	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33140009delT	uc003ocx.1	-						COL11A2_uc010jul.1_Intron|COL11A2_uc003ocy.1_Intron|COL11A2_uc003ocz.1_Intron	NM_080680	NP_542411			collagen, type XI, alpha 2 isoform 1						cartilage development|cell adhesion|collagen fibril organization|sensory perception of sound|soft palate development	collagen type XI	extracellular matrix structural constituent conferring tensile strength|protein binding, bridging			ovary(3)|skin(2)	5																		---	---	---	---
TCP11	6954	broad.mit.edu	37	6	35087761	35087761	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35087761delT	uc003okd.2	-						TCP11_uc003ojz.1_Intron|TCP11_uc003oka.2_Intron|TCP11_uc003okb.2_Intron|TCP11_uc003okc.2_Intron|TCP11_uc011dsu.1_Intron|TCP11_uc011dsv.1_Intron|TCP11_uc011dsw.1_Intron	NM_001093728	NP_001087197			t-complex 11 isoform 1						cell differentiation|multicellular organismal development|spermatogenesis	integral to membrane				ovary(3)|skin(2)	5																		---	---	---	---
FKBP5	2289	broad.mit.edu	37	6	35547629	35547630	+	Intron	DEL	TG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35547629_35547630delTG	uc011dte.1	-						FKBP5_uc003okx.2_Intron|FKBP5_uc011dtf.1_Intron|FKBP5_uc003oky.2_Intron	NM_001145776	NP_001139248			FK506 binding protein 5 isoform 1						protein folding	cytoplasm|membrane|nucleus	FK506 binding|heat shock protein binding|peptidyl-prolyl cis-trans isomerase activity			ovary(1)	1																		---	---	---	---
ETV7	51513	broad.mit.edu	37	6	36334250	36334250	+	3'UTR	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:36334250delC	uc003omb.2	-	8					ETV7_uc003olz.1_Intron|ETV7_uc003oma.1_Intron|ETV7_uc010jwg.2_RNA|ETV7_uc003omc.2_3'UTR|ETV7_uc010jwj.2_3'UTR|ETV7_uc010jwh.2_3'UTR|ETV7_uc010jwi.2_3'UTR|ETV7_uc011dtl.1_3'UTR	NM_016135	NP_057219			ets variant 7						organ morphogenesis|transcription from RNA polymerase II promoter	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|skin(1)	2																		---	---	---	---
DNAH8	1769	broad.mit.edu	37	6	38770842	38770842	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38770842delT	uc003ooe.1	+							NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21																		---	---	---	---
DNAH8	1769	broad.mit.edu	37	6	38783495	38783495	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38783495delT	uc003ooe.1	+							NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21																		---	---	---	---
DNAH8	1769	broad.mit.edu	37	6	38867746	38867746	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38867746delA	uc003ooe.1	+							NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21																		---	---	---	---
TAF8	129685	broad.mit.edu	37	6	42019374	42019374	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42019374delT	uc003ors.2	+						CCND3_uc003orp.2_5'Flank|CCND3_uc011duk.1_5'Flank|CCND3_uc011dum.1_5'Flank|TAF8_uc003orr.2_Intron|TAF8_uc003ort.2_Intron|TAF8_uc003oru.1_Intron|TAF8_uc003orv.1_Intron|TAF8_uc011dun.1_Intron	NM_138572	NP_612639			TBP-associated factor 8						cell differentiation|maintenance of protein location in nucleus|positive regulation of transcription, DNA-dependent|regulation of fat cell differentiation|transcription, DNA-dependent	perinuclear region of cytoplasm|transcription factor TFIID complex	DNA binding|protein binding			ovary(1)	1	Colorectal(47;0.196)		STAD - Stomach adenocarcinoma(11;0.000204)|Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)|Epithelial(12;0.00179)															---	---	---	---
Unknown	0	broad.mit.edu	37	6	42467818	42467818	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42467818delA								TRERF1 (47953 upstream) : UBR2 (64240 downstream)																																			---	---	---	---
UBR2	23304	broad.mit.edu	37	6	42600224	42600224	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42600224delT	uc011dur.1	+						UBR2_uc011dus.1_Intron|UBR2_uc010jxv.1_Intron|UBR2_uc003osh.2_Intron	NM_015255	NP_056070			ubiquitin protein ligase E3 component n-recognin						cellular response to leucine|chromatin silencing|histone H2A ubiquitination|negative regulation of TOR signaling cascade	nucleus|plasma membrane	leucine binding|zinc ion binding			ovary(3)|pancreas(1)	4	Colorectal(47;0.196)		Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)|all cancers(41;0.004)|KIRC - Kidney renal clear cell carcinoma(15;0.02)|Kidney(15;0.0388)|OV - Ovarian serous cystadenocarcinoma(102;0.196)															---	---	---	---
MRPL2	51069	broad.mit.edu	37	6	43023098	43023098	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43023098delA	uc003ots.1	-						CUL7_uc011dvb.1_5'Flank|CUL7_uc003otq.2_5'Flank|CUL7_uc010jyh.2_5'Flank|KLC4_uc003otr.1_Intron	NM_015950	NP_057034			mitochondrial ribosomal protein L2 precursor						translation	mitochondrion|ribosome	structural constituent of ribosome				0		Ovarian(999;0.0014)	Colorectal(64;0.00237)|COAD - Colon adenocarcinoma(64;0.00473)|all cancers(41;0.00708)|OV - Ovarian serous cystadenocarcinoma(102;0.0442)	BRCA - Breast invasive adenocarcinoma(397;0.0026)														---	---	---	---
CD2AP	23607	broad.mit.edu	37	6	47576839	47576839	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47576839delT	uc003oyw.2	+							NM_012120	NP_036252			CD2-associated protein						cell division|mitosis|protein complex assembly|signal transduction|substrate-dependent cell migration, cell extension	cytoplasm|filamentous actin|nucleolus|plasma membrane|ruffle	SH3 domain binding|structural constituent of cytoskeleton			ovary(1)|skin(1)	2			Lung(136;0.105)|LUSC - Lung squamous cell carcinoma(51;0.138)															---	---	---	---
CRISP3	10321	broad.mit.edu	37	6	49701364	49701364	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49701364delT	uc003ozs.2	-							NM_006061	NP_006052			cysteine-rich secretory protein 3 precursor						innate immune response	proteinaceous extracellular matrix|specific granule				skin(2)	2	Lung NSC(77;0.0161)		KIRC - Kidney renal clear cell carcinoma(2;0.106)|Kidney(12;0.156)															---	---	---	---
DEFB113	245927	broad.mit.edu	37	6	49936566	49936566	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49936566delT	uc011dwq.1	-	2	73	c.73delA	c.(73-75)ACAfs	p.T25fs		NM_001037729	NP_001032818	Q30KQ7	DB113_HUMAN	beta-defensin 113 precursor	25					defense response to bacterium	extracellular region					0	Lung NSC(77;0.042)																	---	---	---	---
PKHD1	5314	broad.mit.edu	37	6	51921383	51921383	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51921383delT	uc003pah.1	-						PKHD1_uc003pai.2_Intron	NM_138694	NP_619639			fibrocystin isoform 1						cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity			lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)																	---	---	---	---
Unknown	0	broad.mit.edu	37	6	53219904	53219905	+	IGR	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:53219904_53219905insA								ELOVL5 (5962 upstream) : GCLC (142235 downstream)																																			---	---	---	---
COL21A1	81578	broad.mit.edu	37	6	55938902	55938903	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:55938902_55938903insT	uc003pcs.2	-						COL21A1_uc010jzz.2_Intron|COL21A1_uc011dxg.1_Intron|COL21A1_uc011dxh.1_Intron|COL21A1_uc003pcr.2_Intron	NM_030820	NP_110447			collagen, type XXI, alpha 1 precursor						cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(2)	2	Lung NSC(77;0.0483)		LUSC - Lung squamous cell carcinoma(124;0.181)															---	---	---	---
COL21A1	81578	broad.mit.edu	37	6	56047463	56047463	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56047463delA	uc003pcs.2	-						COL21A1_uc003pct.1_Intron|COL21A1_uc011dxi.1_Intron|COL21A1_uc003pcu.1_Intron	NM_030820	NP_110447			collagen, type XXI, alpha 1 precursor						cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(2)	2	Lung NSC(77;0.0483)		LUSC - Lung squamous cell carcinoma(124;0.181)															---	---	---	---
PHF3	23469	broad.mit.edu	37	6	64356299	64356299	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:64356299delT	uc003pen.2	+						PHF3_uc010kaf.1_Intron|PHF3_uc003pem.2_Intron|PHF3_uc010kag.1_Intron|PHF3_uc010kah.1_Intron|PHF3_uc011dxs.1_Intron|PHF3_uc003peo.2_Intron					RecName: Full=PHD finger protein 3;						multicellular organismal development|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(3)|lung(1)|skin(1)	5	all_cancers(3;0.0241)|all_epithelial(2;0.00306)|Lung NSC(77;0.121)		LUSC - Lung squamous cell carcinoma(74;0.0644)|Lung(124;0.148)															---	---	---	---
COL19A1	1310	broad.mit.edu	37	6	70769513	70769513	+	Intron	DEL	T	-	-	rs3793042	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70769513delT	uc003pfc.1	+						COL19A1_uc010kam.1_Intron	NM_001858	NP_001849			alpha 1 type XIX collagen precursor						cell differentiation|cell-cell adhesion|extracellular matrix organization|skeletal system development	collagen	extracellular matrix structural constituent|protein binding, bridging			ovary(2)|breast(2)	4																		---	---	---	---
FAM135A	57579	broad.mit.edu	37	6	71162046	71162046	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:71162046delT	uc003pfj.2	+						FAM135A_uc003pfi.2_Intron|FAM135A_uc003pfh.2_Intron|FAM135A_uc003pfk.2_Intron|FAM135A_uc003pfl.2_Intron	NM_001162529	NP_001156001			hypothetical protein LOC57579 isoform c											central_nervous_system(1)	1																		---	---	---	---
KCNQ5	56479	broad.mit.edu	37	6	73835182	73835182	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:73835182delT	uc003pgk.2	+						KCNQ5_uc011dyh.1_Intron|KCNQ5_uc011dyi.1_Intron|KCNQ5_uc010kat.2_Intron|KCNQ5_uc011dyj.1_Intron|KCNQ5_uc011dyk.1_Intron	NM_019842	NP_062816			potassium voltage-gated channel, KQT-like						protein complex assembly|synaptic transmission	voltage-gated potassium channel complex	inward rectifier potassium channel activity			ovary(4)|large_intestine(2)|skin(1)	7		all_epithelial(107;0.116)|Lung NSC(302;0.219)		COAD - Colon adenocarcinoma(1;0.0107)|Colorectal(1;0.0583)														---	---	---	---
DDX43	55510	broad.mit.edu	37	6	74122224	74122225	+	Intron	DEL	AG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:74122224_74122225delAG	uc003pgw.2	+							NM_018665	NP_061135			DEAD (Asp-Glu-Ala-Asp) box polypeptide 43							intracellular	ATP binding|ATP-dependent RNA helicase activity|RNA binding			ovary(2)|upper_aerodigestive_tract(1)|skin(1)	4																		---	---	---	---
IMPG1	3617	broad.mit.edu	37	6	76717020	76717020	+	Intron	DEL	T	-	-	rs76741306		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76717020delT	uc003pik.1	-							NM_001563	NP_001554			interphotoreceptor matrix proteoglycan 1						visual perception	proteinaceous extracellular matrix	extracellular matrix structural constituent|receptor activity			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(125;0.0418)|all_hematologic(105;0.222)																---	---	---	---
SNAP91	9892	broad.mit.edu	37	6	84269650	84269650	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:84269650delT	uc011dze.1	-						SNAP91_uc011dzd.1_Intron|SNAP91_uc003pkb.2_Intron|SNAP91_uc003pkc.2_Intron|SNAP91_uc003pkd.2_Intron|SNAP91_uc003pka.2_Intron	NM_014841	NP_055656			synaptosomal-associated protein, 91kDa homolog						clathrin coat assembly	clathrin coat|coated pit|plasma membrane	1-phosphatidylinositol binding|clathrin binding			ovary(1)	1		all_cancers(76;0.000243)|Acute lymphoblastic leukemia(125;2.91e-07)|all_hematologic(105;0.000337)|all_epithelial(107;0.0575)		BRCA - Breast invasive adenocarcinoma(397;0.0967)														---	---	---	---
RNGTT	8732	broad.mit.edu	37	6	89614293	89614295	+	Intron	DEL	ATT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:89614293_89614295delATT	uc003pmr.2	-						RNGTT_uc003pms.2_Intron|RNGTT_uc011dzu.1_Intron|RNGTT_uc003pmt.2_Intron	NM_003800	NP_003791			RNA guanylyltransferase and 5'-phosphatase						interspecies interaction between organisms|mRNA capping|transcription from RNA polymerase II promoter|viral reproduction	nucleoplasm	GTP binding|mRNA guanylyltransferase activity|polynucleotide 5'-phosphatase activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			upper_aerodigestive_tract(1)	1		all_cancers(76;4.07e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.49e-10)|all_hematologic(105;7.79e-07)|all_epithelial(107;6.86e-05)		BRCA - Breast invasive adenocarcinoma(108;0.151)														---	---	---	---
GABRR1	2569	broad.mit.edu	37	6	89888394	89888394	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:89888394delT	uc003pna.2	-	10					GABRR1_uc011dzv.1_3'UTR	NM_002042	NP_002033			gamma-aminobutyric acid (GABA) receptor, rho 1						gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			pancreas(1)	1		all_cancers(76;9.49e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.46e-10)|all_hematologic(105;7.74e-07)|all_epithelial(107;0.000114)		BRCA - Breast invasive adenocarcinoma(108;0.00917)	Picrotoxin(DB00466)													---	---	---	---
MDN1	23195	broad.mit.edu	37	6	90409616	90409616	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90409616delA	uc003pnn.1	-							NM_014611	NP_055426			MDN1, midasin homolog						protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---
KLHL32	114792	broad.mit.edu	37	6	97575496	97575496	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:97575496delT	uc010kcm.1	+						KLHL32_uc011ead.1_Intron|KLHL32_uc003poz.2_Intron|KLHL32_uc011eae.1_Intron|KLHL32_uc003ppa.2_Intron	NM_052904	NP_443136			kelch-like 32											ovary(3)|skin(1)	4		all_cancers(76;1.19e-06)|Acute lymphoblastic leukemia(125;5.83e-10)|all_hematologic(75;3.67e-07)|all_epithelial(107;0.00778)|Colorectal(196;0.122)		BRCA - Breast invasive adenocarcinoma(108;0.0558)														---	---	---	---
C6orf167	253714	broad.mit.edu	37	6	97730435	97730438	+	Intron	DEL	GGGG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:97730435_97730438delGGGG	uc003ppb.2	-						C6orf167_uc011eaf.1_5'Flank|C6orf167_uc010kcn.1_Intron|C6orf167_uc010kco.1_5'Flank|C6orf167_uc003ppc.2_5'Flank	NM_198468	NP_940870			hypothetical protein LOC253714						double-strand break repair via homologous recombination|replication fork processing	nuclear replication fork	protein binding				0		all_cancers(76;0.000243)|Acute lymphoblastic leukemia(125;7.02e-10)|all_hematologic(75;1.23e-06)|all_epithelial(107;0.148)|Colorectal(196;0.198)		BRCA - Breast invasive adenocarcinoma(108;0.0457)														---	---	---	---
ASCC3	10973	broad.mit.edu	37	6	101091859	101091859	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:101091859delT	uc003pqk.2	-							NM_006828	NP_006819			activating signal cointegrator 1 complex subunit						regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|microtubule cytoskeleton	ATP binding|ATP-dependent helicase activity|nucleic acid binding			ovary(5)|skin(1)	6		all_cancers(76;1.45e-07)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(87;0.00149)|Hepatocellular(1;0.0893)|Colorectal(196;0.13)		BRCA - Breast invasive adenocarcinoma(108;0.0539)|all cancers(137;0.103)|GBM - Glioblastoma multiforme(226;0.199)														---	---	---	---
GRIK2	2898	broad.mit.edu	37	6	102133965	102133965	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:102133965delA	uc003pqp.3	+						GRIK2_uc003pqn.2_Intron|GRIK2_uc003pqo.3_Intron|GRIK2_uc010kcw.2_Intron	NM_021956	NP_068775			glutamate receptor, ionotropic, kainate 2						glutamate signaling pathway|induction of programmed cell death in response to chemical stimulus|neuron apoptosis|positive regulation of synaptic transmission|regulation of short-term neuronal synaptic plasticity	cell junction|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|kainate selective glutamate receptor activity			ovary(2)|pancreas(1)|breast(1)|skin(1)	5		all_cancers(76;1.19e-07)|Acute lymphoblastic leukemia(125;6.17e-11)|all_hematologic(75;6.01e-08)|all_epithelial(87;0.0121)|Colorectal(196;0.14)		all cancers(137;0.112)|BRCA - Breast invasive adenocarcinoma(108;0.124)|GBM - Glioblastoma multiforme(226;0.206)	L-Glutamic Acid(DB00142)													---	---	---	---
GRIK2	2898	broad.mit.edu	37	6	102503432	102503432	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:102503432delA	uc003pqp.3	+	15	2788	c.2539delA	c.(2539-2541)AAAfs	p.K847fs	GRIK2_uc003pqo.3_Frame_Shift_Del_p.K847fs|GRIK2_uc010kcw.2_Frame_Shift_Del_p.K847fs	NM_021956	NP_068775	Q13002	GRIK2_HUMAN	glutamate receptor, ionotropic, kainate 2	847	Cytoplasmic (Potential).				glutamate signaling pathway|induction of programmed cell death in response to chemical stimulus|neuron apoptosis|positive regulation of synaptic transmission|regulation of short-term neuronal synaptic plasticity	cell junction|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|kainate selective glutamate receptor activity			ovary(2)|pancreas(1)|breast(1)|skin(1)	5		all_cancers(76;1.19e-07)|Acute lymphoblastic leukemia(125;6.17e-11)|all_hematologic(75;6.01e-08)|all_epithelial(87;0.0121)|Colorectal(196;0.14)		all cancers(137;0.112)|BRCA - Breast invasive adenocarcinoma(108;0.124)|GBM - Glioblastoma multiforme(226;0.206)	L-Glutamic Acid(DB00142)													---	---	---	---
PREP	5550	broad.mit.edu	37	6	105725779	105725779	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:105725779delA	uc003prc.2	-	15						NM_002726	NP_002717			prolyl endopeptidase						proteolysis		serine-type endopeptidase activity			ovary(3)	3		all_cancers(87;0.000128)|Acute lymphoblastic leukemia(125;1.9e-08)|all_hematologic(75;9.25e-07)|all_epithelial(87;0.0344)|Lung NSC(302;0.191)|Colorectal(196;0.202)			Oxytocin(DB00107)													---	---	---	---
PREP	5550	broad.mit.edu	37	6	105776939	105776939	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:105776939delA	uc003prc.2	-							NM_002726	NP_002717			prolyl endopeptidase						proteolysis		serine-type endopeptidase activity			ovary(3)	3		all_cancers(87;0.000128)|Acute lymphoblastic leukemia(125;1.9e-08)|all_hematologic(75;9.25e-07)|all_epithelial(87;0.0344)|Lung NSC(302;0.191)|Colorectal(196;0.202)			Oxytocin(DB00107)													---	---	---	---
NR2E1	7101	broad.mit.edu	37	6	108502387	108502388	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:108502387_108502388insT	uc003psg.2	+							NM_003269	NP_003260			nuclear receptor subfamily 2, group E, member 1						regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	sequence-specific DNA binding|steroid hormone receptor activity|zinc ion binding			central_nervous_system(1)|skin(1)	2		all_cancers(87;8.13e-05)|Acute lymphoblastic leukemia(125;3.07e-08)|all_hematologic(75;3.33e-06)|all_epithelial(87;0.00866)|Colorectal(196;0.0637)		BRCA - Breast invasive adenocarcinoma(108;0.013)|Epithelial(106;0.0521)|all cancers(137;0.068)|OV - Ovarian serous cystadenocarcinoma(136;0.0689)														---	---	---	---
WASF1	8936	broad.mit.edu	37	6	110423574	110423574	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:110423574delA	uc003ptv.1	-						WASF1_uc003ptw.1_Intron|WASF1_uc003ptx.1_Intron|WASF1_uc003pty.1_Intron	NM_003931	NP_003922			Wiskott-Aldrich syndrome protein family member						actin filament polymerization|cellular component movement	actin cytoskeleton	actin binding				0		all_cancers(87;1.18e-05)|Acute lymphoblastic leukemia(125;2.66e-08)|all_hematologic(75;1.13e-06)|all_epithelial(87;0.00159)|Colorectal(196;0.0488)		OV - Ovarian serous cystadenocarcinoma(136;0.0364)|Epithelial(106;0.051)|all cancers(137;0.0687)														---	---	---	---
CDC40	51362	broad.mit.edu	37	6	110551459	110551459	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:110551459delA	uc003pua.2	+	15						NM_015891	NP_056975			cell division cycle 40 homolog						mRNA 3'-end processing|mRNA export from nucleus|termination of RNA polymerase II transcription	catalytic step 2 spliceosome|nucleoplasm					0		all_cancers(87;6.23e-06)|Acute lymphoblastic leukemia(125;2.66e-08)|all_hematologic(75;1.13e-06)|all_epithelial(87;0.00159)|Colorectal(196;0.0488)		Epithelial(106;0.0221)|all cancers(137;0.0314)|OV - Ovarian serous cystadenocarcinoma(136;0.034)														---	---	---	---
TUBE1	51175	broad.mit.edu	37	6	112400625	112400626	+	Intron	DEL	AA	-	-	rs111683493		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112400625_112400626delAA	uc003pvq.2	-						TUBE1_uc003pvr.2_Intron	NM_016262	NP_057346			tubulin, epsilon 1						centrosome cycle|microtubule-based movement|protein polymerization	microtubule|pericentriolar material	GTP binding|GTPase activity|structural constituent of cytoskeleton			ovary(1)	1		all_cancers(87;0.0101)|all_hematologic(75;0.000258)|Colorectal(196;0.0466)|all_epithelial(87;0.1)		all cancers(137;0.0217)|OV - Ovarian serous cystadenocarcinoma(136;0.0613)|Epithelial(106;0.0636)|GBM - Glioblastoma multiforme(226;0.0972)|BRCA - Breast invasive adenocarcinoma(108;0.246)														---	---	---	---
RWDD1	51389	broad.mit.edu	37	6	116910213	116910213	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:116910213delT	uc003pxd.2	+						RWDD1_uc003pxb.2_Intron|RWDD1_uc003pxc.2_Intron	NM_015952	NP_057036			RWD domain containing 1 isoform a								protein binding			ovary(2)|central_nervous_system(1)	3		all_cancers(87;0.0314)|all_epithelial(87;0.0216)|Colorectal(196;0.234)		GBM - Glioblastoma multiforme(226;0.026)|all cancers(137;0.0312)|OV - Ovarian serous cystadenocarcinoma(136;0.0689)|Epithelial(106;0.161)														---	---	---	---
GOPC	57120	broad.mit.edu	37	6	117898489	117898489	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:117898489delA	uc003pxu.2	-						GOPC_uc003pxv.2_Intron|GOPC_uc010keg.1_5'Flank	NM_020399	NP_065132			golgi associated PDZ and coiled-coil motif						apical protein localization|cytoplasmic sequestering of CFTR protein|ER to Golgi vesicle-mediated transport|Golgi to plasma membrane transport|protein homooligomerization|protein transport	cell junction|dendrite|Golgi membrane|postsynaptic density|postsynaptic membrane|trans-Golgi network transport vesicle	cystic fibrosis transmembrane conductance regulator binding			ovary(1)	1		all_cancers(87;0.00844)|all_epithelial(87;0.0242)		GBM - Glioblastoma multiforme(226;0.0363)|OV - Ovarian serous cystadenocarcinoma(136;0.0821)|all cancers(137;0.0976)				O	ROS1	glioblastoma								---	---	---	---
NKAIN2	154215	broad.mit.edu	37	6	124979215	124979215	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:124979215delA	uc003pzo.2	+						NKAIN2_uc003pzn.1_Intron|NKAIN2_uc003pzp.2_Intron|NKAIN2_uc010keq.2_Intron|NKAIN2_uc010ker.2_Intron	NM_001040214	NP_001035304			T-cell lymphoma breakpoint-associated target 1							integral to membrane|plasma membrane					0				GBM - Glioblastoma multiforme(226;0.104)														---	---	---	---
PTPRK	5796	broad.mit.edu	37	6	128291226	128291226	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:128291226delA	uc003qbk.2	-	30					PTPRK_uc003qbj.2_3'UTR|PTPRK_uc010kfc.2_3'UTR|PTPRK_uc011ebu.1_3'UTR	NM_002844	NP_002835			protein tyrosine phosphatase, receptor type, K						cell migration|cellular response to reactive oxygen species|cellular response to UV|focal adhesion assembly|negative regulation of cell cycle|negative regulation of cell migration|negative regulation of keratinocyte proliferation|negative regulation of transcription, DNA-dependent|protein localization at cell surface|transforming growth factor beta receptor signaling pathway	adherens junction|cell surface|cell-cell junction|integral to plasma membrane|leading edge membrane	beta-catenin binding|gamma-catenin binding|protein kinase binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(3)|skin(2)|pancreas(1)|kidney(1)|central_nervous_system(1)	8				all cancers(137;0.0118)|GBM - Glioblastoma multiforme(226;0.0372)|OV - Ovarian serous cystadenocarcinoma(136;0.24)														---	---	---	---
L3MBTL3	84456	broad.mit.edu	37	6	130373911	130373911	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:130373911delT	uc003qbt.2	+						L3MBTL3_uc003qbu.2_Intron	NM_032438	NP_115814			l(3)mbt-like 3 isoform a						chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(5)|skin(1)	6				GBM - Glioblastoma multiforme(226;0.0266)|OV - Ovarian serous cystadenocarcinoma(155;0.154)														---	---	---	---
MED23	9439	broad.mit.edu	37	6	131942899	131942899	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:131942899delT	uc003qcs.1	-						MED23_uc003qcq.2_Intron|MED23_uc003qct.1_Intron|MED23_uc011ecb.1_Intron	NM_004830	NP_004821			mediator complex subunit 23 isoform a						regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	transcription factor complex	protein binding|transcription coactivator activity			ovary(1)|kidney(1)|central_nervous_system(1)	3	Breast(56;0.0753)			GBM - Glioblastoma multiforme(226;0.0115)|OV - Ovarian serous cystadenocarcinoma(155;0.0608)														---	---	---	---
ENPP1	5167	broad.mit.edu	37	6	132205919	132205920	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132205919_132205920insA	uc011ecf.1	+							NM_006208	NP_006199			ectonucleotide pyrophosphatase/phosphodiesterase						3'-phosphoadenosine 5'-phosphosulfate metabolic process|biomineral tissue development|cellular phosphate ion homeostasis|cellular response to insulin stimulus|generation of precursor metabolites and energy|immune response|inorganic diphosphate transport|negative regulation of cell growth|negative regulation of fat cell differentiation|negative regulation of glucose import|negative regulation of glycogen biosynthetic process|negative regulation of insulin receptor signaling pathway|negative regulation of protein autophosphorylation|nucleoside triphosphate catabolic process|phosphate metabolic process|sequestering of triglyceride|water-soluble vitamin metabolic process	basolateral plasma membrane|cell surface|extracellular space|integral to membrane	ATP binding|insulin receptor binding|metal ion binding|nucleic acid binding|nucleoside-triphosphate diphosphatase activity|nucleotide diphosphatase activity|phosphodiesterase I activity|polysaccharide binding|protein homodimerization activity|scavenger receptor activity			upper_aerodigestive_tract(2)|ovary(2)	4	Breast(56;0.0505)			GBM - Glioblastoma multiforme(226;0.0216)|OV - Ovarian serous cystadenocarcinoma(155;0.022)	Amifostine(DB01143)|Ribavirin(DB00811)													---	---	---	---
PEX7	5191	broad.mit.edu	37	6	137147252	137147252	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:137147252delT	uc003qhd.2	+						PEX7_uc010kgx.2_Intron	NM_000288	NP_000279			peroxisomal biogenesis factor 7						ether lipid biosynthetic process|protein import into peroxisome matrix	peroxisome	peroxisome matrix targeting signal-2 binding				0	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.000257)|OV - Ovarian serous cystadenocarcinoma(155;0.00492)														---	---	---	---
PHACTR2	9749	broad.mit.edu	37	6	144128096	144128098	+	Intron	DEL	AAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144128096_144128098delAAA	uc003qjq.3	+						PHACTR2_uc010khh.2_Intron|PHACTR2_uc010khi.2_Intron|PHACTR2_uc003qjr.3_Intron	NM_014721	NP_055536			phosphatase and actin regulator 2 isoform 3								actin binding|protein phosphatase inhibitor activity			ovary(2)	2				OV - Ovarian serous cystadenocarcinoma(155;1.58e-05)|GBM - Glioblastoma multiforme(68;0.0386)														---	---	---	---
UTRN	7402	broad.mit.edu	37	6	144843999	144843999	+	Intron	DEL	A	-	-	rs150930485		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144843999delA	uc003qkt.2	+							NM_007124	NP_009055			utrophin						muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)														---	---	---	---
SASH1	23328	broad.mit.edu	37	6	148867459	148867459	+	Intron	DEL	A	-	-	rs72199680		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:148867459delA	uc003qme.1	+						SASH1_uc003qmf.1_Intron	NM_015278	NP_056093			SAM and SH3 domain containing 1								protein binding			central_nervous_system(1)	1		Ovarian(120;0.0169)		OV - Ovarian serous cystadenocarcinoma(155;5.63e-11)|GBM - Glioblastoma multiforme(68;0.0701)														---	---	---	---
MTHFD1L	25902	broad.mit.edu	37	6	151363102	151363103	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151363102_151363103insT	uc003qob.2	+						MTHFD1L_uc011een.1_Intron|MTHFD1L_uc011eeo.1_Intron|MTHFD1L_uc003qoc.2_Intron	NM_015440	NP_056255			methylenetetrahydrofolate dehydrogenase (NADP+						folic acid-containing compound biosynthetic process|formate metabolic process|one-carbon metabolic process|tetrahydrofolate metabolic process	mitochondrion	ATP binding|formate-tetrahydrofolate ligase activity|protein homodimerization activity			ovary(3)|large_intestine(1)	4		Ovarian(120;0.128)		OV - Ovarian serous cystadenocarcinoma(155;8.7e-12)														---	---	---	---
MTHFD1L	25902	broad.mit.edu	37	6	151421133	151421133	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151421133delA	uc003qob.2	+						MTHFD1L_uc003qoc.2_Intron	NM_015440	NP_056255			methylenetetrahydrofolate dehydrogenase (NADP+						folic acid-containing compound biosynthetic process|formate metabolic process|one-carbon metabolic process|tetrahydrofolate metabolic process	mitochondrion	ATP binding|formate-tetrahydrofolate ligase activity|protein homodimerization activity			ovary(3)|large_intestine(1)	4		Ovarian(120;0.128)		OV - Ovarian serous cystadenocarcinoma(155;8.7e-12)														---	---	---	---
SYNE1	23345	broad.mit.edu	37	6	152552705	152552705	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152552705delA	uc010kiw.2	-						SYNE1_uc010kiv.2_Intron|SYNE1_uc003qos.3_Intron|SYNE1_uc003qot.3_Intron|SYNE1_uc003qou.3_Intron	NM_182961	NP_892006			spectrin repeat containing, nuclear envelope 1						cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)											HNSCC(10;0.0054)			---	---	---	---
SYNE1	23345	broad.mit.edu	37	6	152680765	152680766	+	Intron	DEL	GT	-	-	rs112850733		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152680765_152680766delGT	uc010kiw.2	-						SYNE1_uc003qot.3_Intron|SYNE1_uc003qou.3_Intron|SYNE1_uc010kja.1_Intron	NM_182961	NP_892006			spectrin repeat containing, nuclear envelope 1						cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)											HNSCC(10;0.0054)			---	---	---	---
SYNE1	23345	broad.mit.edu	37	6	152688715	152688715	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152688715delA	uc010kiw.2	-						SYNE1_uc003qot.3_Intron|SYNE1_uc003qou.3_Intron|SYNE1_uc010kja.1_5'UTR|SYNE1_uc003qov.2_Intron	NM_182961	NP_892006			spectrin repeat containing, nuclear envelope 1						cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)											HNSCC(10;0.0054)			---	---	---	---
SYNJ2	8871	broad.mit.edu	37	6	158508009	158508009	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:158508009delC	uc003qqx.1	+	23	3406	c.3331delC	c.(3331-3333)CCCfs	p.P1111fs	SYNJ2_uc003qqw.1_Frame_Shift_Del_p.P1111fs|SYNJ2_uc003qqy.1_Frame_Shift_Del_p.P824fs|SYNJ2_uc003qqz.1_Frame_Shift_Del_p.P728fs|SYNJ2_uc003qra.1_Frame_Shift_Del_p.P454fs|SYNJ2_uc010kjp.1_5'UTR	NM_003898	NP_003889	O15056	SYNJ2_HUMAN	synaptojanin 2	1111	Pro-rich.|Catalytic (By similarity).						nucleotide binding|phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity|RNA binding			skin(1)	1				OV - Ovarian serous cystadenocarcinoma(65;4.42e-18)|BRCA - Breast invasive adenocarcinoma(81;4.23e-05)														---	---	---	---
TULP4	56995	broad.mit.edu	37	6	158882444	158882444	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:158882444delA	uc003qrf.2	+						TULP4_uc011efo.1_Intron|TULP4_uc003qrg.2_Intron	NM_020245	NP_064630			tubby like protein 4 isoform 1						intracellular signal transduction|response to nutrient	cytoplasm	protein binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1		Breast(66;0.000781)|Ovarian(120;0.0308)|Lung SC(201;0.164)|Prostate(117;0.171)		OV - Ovarian serous cystadenocarcinoma(65;1.64e-18)|BRCA - Breast invasive adenocarcinoma(81;2.67e-05)														---	---	---	---
TMEM181	57583	broad.mit.edu	37	6	159004971	159004972	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:159004971_159004972delTT	uc003qrm.3	+						TMEM181_uc010kjr.1_Intron|TMEM181_uc003qri.1_Intron|TMEM181_uc003qrj.1_Intron|TMEM181_uc003qrk.1_Intron	NM_020823	NP_065874			G protein-coupled receptor 178						pathogenesis	integral to membrane	toxin binding			ovary(2)|central_nervous_system(1)	3		Breast(66;0.000776)|Ovarian(120;0.0303)		OV - Ovarian serous cystadenocarcinoma(65;8.15e-18)|BRCA - Breast invasive adenocarcinoma(81;1.38e-05)														---	---	---	---
EZR	7430	broad.mit.edu	37	6	159210276	159210276	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:159210276delT	uc003qrt.3	-						EZR_uc011efs.1_Intron|EZR_uc003qru.3_Intron	NM_003379	NP_003370			ezrin						actin filament bundle assembly|axon guidance|cytoskeletal anchoring at plasma membrane|leukocyte cell-cell adhesion|membrane to membrane docking|regulation of cell shape	actin filament|apical plasma membrane|basolateral plasma membrane|cortical cytoskeleton|cytosol|extrinsic to membrane|filopodium|microvillus membrane|nucleolus|ruffle membrane	actin filament binding|cell adhesion molecule binding			ovary(1)	1		Breast(66;0.000776)|Ovarian(120;0.0303)		OV - Ovarian serous cystadenocarcinoma(65;2.16e-17)|BRCA - Breast invasive adenocarcinoma(81;6.58e-06)														---	---	---	---
LPA	4018	broad.mit.edu	37	6	161085042	161085042	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:161085042delT	uc003qtl.2	-							NM_005577	NP_005568			lipoprotein Lp(a) precursor						blood circulation|lipid metabolic process|lipid transport|lipoprotein metabolic process|proteolysis|receptor-mediated endocytosis	plasma lipoprotein particle	apolipoprotein binding|endopeptidase inhibitor activity|fibronectin binding|heparin binding|serine-type endopeptidase activity			ovary(3)|skin(2)|pancreas(1)	6		Breast(66;0.000496)|Ovarian(120;0.0303)|Prostate(117;0.0965)		OV - Ovarian serous cystadenocarcinoma(65;2.5e-17)|BRCA - Breast invasive adenocarcinoma(81;6.48e-06)	Aminocaproic Acid(DB00513)													---	---	---	---
SFT2D1	113402	broad.mit.edu	37	6	166741969	166741969	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:166741969delT	uc003qux.2	-							NM_145169	NP_660152			SFT2 domain containing 1						protein transport|vesicle-mediated transport	integral to membrane				central_nervous_system(1)	1		Breast(66;0.000148)|Prostate(117;0.109)|Ovarian(120;0.199)		OV - Ovarian serous cystadenocarcinoma(33;2.63e-19)|BRCA - Breast invasive adenocarcinoma(81;4.92e-06)|GBM - Glioblastoma multiforme(31;4.58e-05)														---	---	---	---
RPS6KA2	6196	broad.mit.edu	37	6	166952429	166952429	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:166952429delT	uc003qvb.1	-						RPS6KA2_uc011ego.1_Intron|RPS6KA2_uc010kkl.1_Intron|RPS6KA2_uc003qvc.1_Intron|RPS6KA2_uc003qvd.1_Intron	NM_021135	NP_066958			ribosomal protein S6 kinase, 90kDa, polypeptide						axon guidance|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|stress-activated MAPK cascade|synaptic transmission|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			ovary(2)|lung(2)|skin(2)|large_intestine(1)|central_nervous_system(1)	8		Breast(66;2.04e-05)|Ovarian(120;0.0652)|Prostate(117;0.105)		OV - Ovarian serous cystadenocarcinoma(33;2.76e-18)|GBM - Glioblastoma multiforme(31;9.94e-06)|BRCA - Breast invasive adenocarcinoma(81;1.36e-05)														---	---	---	---
MLLT4	4301	broad.mit.edu	37	6	168276400	168276401	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:168276400_168276401delAA	uc003qwd.2	+						MLLT4_uc003qwb.1_Intron|MLLT4_uc003qwc.1_Intron	NM_001040001	NP_001035090			myeloid/lymphoid or mixed-lineage leukemia						adherens junction organization|cell adhesion|cell junction assembly|cell-cell signaling|signal transduction	adherens junction|cell-cell junction|cytosol|nucleus	protein C-terminus binding			ovary(2)|lung(1)|kidney(1)|central_nervous_system(1)	5		Breast(66;1.07e-05)|Ovarian(120;0.024)		Epithelial(4;2.38e-32)|OV - Ovarian serous cystadenocarcinoma(33;9.99e-23)|BRCA - Breast invasive adenocarcinoma(4;1.2e-11)|GBM - Glioblastoma multiforme(31;0.00117)				T	MLL	AL								---	---	---	---
C6orf70	55780	broad.mit.edu	37	6	170181412	170181412	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170181412delT	uc003qxg.1	+						C6orf70_uc011ehb.1_Intron|C6orf70_uc003qxh.1_Intron|C6orf70_uc010kky.1_Intron|C6orf70_uc003qxi.1_Intron	NM_018341	NP_060811			hypothetical protein LOC55780							integral to membrane				ovary(1)	1		Breast(66;5.08e-05)|Ovarian(120;0.208)		OV - Ovarian serous cystadenocarcinoma(33;1.2e-22)|BRCA - Breast invasive adenocarcinoma(81;1.49e-07)|GBM - Glioblastoma multiforme(31;0.00191)														---	---	---	---
LFNG	3955	broad.mit.edu	37	7	2566966	2566967	+	3'UTR	INS	-	TGTGCA	TGTGCA	rs150935549	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2566966_2566967insTGTGCA	uc003smf.2	+	8					LFNG_uc003smg.2_Intron	NM_001040167	NP_001035257			lunatic fringe isoform a						organ morphogenesis	extracellular region|integral to Golgi membrane	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity				0		Ovarian(82;0.0112)		OV - Ovarian serous cystadenocarcinoma(56;2.54e-14)														---	---	---	---
C7orf27	221927	broad.mit.edu	37	7	2580714	2580714	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2580714delC	uc003smi.2	-						C7orf27_uc003smh.3_Intron	NM_152743	NP_689956			hypothetical protein LOC221927 precursor						response to ionizing radiation	nucleus	protein binding				0		Ovarian(82;0.0779)		OV - Ovarian serous cystadenocarcinoma(56;2.91e-14)														---	---	---	---
KIAA0415	9907	broad.mit.edu	37	7	4820748	4820748	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4820748delT	uc003sne.2	+						KIAA0415_uc010ksp.2_Intron	NM_014855	NP_055670			hypothetical protein LOC9907						cell death|double-strand break repair via homologous recombination	cytoplasm|nucleus	protein binding			central_nervous_system(1)	1		Ovarian(82;0.0175)		UCEC - Uterine corpus endometrioid carcinoma (126;0.091)|OV - Ovarian serous cystadenocarcinoma(56;8.35e-15)														---	---	---	---
PMS2CL	441194	broad.mit.edu	37	7	6781178	6781178	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6781178delA	uc003squ.2	+						PMS2CL_uc003sqv.1_Intron					Homo sapiens PMS2CL mRNA for PMS2-C terminal -like, complete cds.												0																		---	---	---	---
MIOS	54468	broad.mit.edu	37	7	7625576	7625576	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:7625576delT	uc003srf.2	+						MIOS_uc003srg.2_Intron|MIOS_uc010ktq.2_Intron	NM_019005	NP_061878			missing oocyte, meiosis regulator, homolog												0																		---	---	---	---
THSD7A	221981	broad.mit.edu	37	7	11452108	11452108	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:11452108delA	uc003ssf.3	-							NM_015204	NP_056019			thrombospondin, type I, domain containing 7A							integral to membrane				ovary(3)	3				UCEC - Uterine corpus endometrioid carcinoma (126;0.163)											HNSCC(18;0.044)			---	---	---	---
DGKB	1607	broad.mit.edu	37	7	14620586	14620586	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:14620586delA	uc003ssz.2	-						DGKB_uc011jxt.1_Intron|DGKB_uc003sta.2_Intron|DGKB_uc011jxu.1_Intron	NM_004080	NP_004071			diacylglycerol kinase, beta isoform 1						activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|intracellular signal transduction|platelet activation	cytoplasm|plasma membrane	ATP binding|calcium ion binding|diacylglycerol kinase activity|protein binding			lung(5)|ovary(4)|breast(2)|skin(1)	12					Phosphatidylserine(DB00144)													---	---	---	---
HDAC9	9734	broad.mit.edu	37	7	18669150	18669150	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:18669150delA	uc003suh.2	+						HDAC9_uc003sue.2_Intron|HDAC9_uc011jyd.1_Intron|HDAC9_uc003sui.2_Intron|HDAC9_uc003suj.2_Intron|HDAC9_uc011jya.1_Intron|HDAC9_uc003sua.1_Intron|HDAC9_uc011jyb.1_Intron|HDAC9_uc003sud.1_Intron|HDAC9_uc011jyc.1_Intron|HDAC9_uc003suf.1_Intron|HDAC9_uc010kud.1_Intron|HDAC9_uc011jye.1_Intron|HDAC9_uc011jyf.1_Intron|HDAC9_uc010kue.1_Intron	NM_058176	NP_478056			histone deacetylase 9 isoform 1						B cell differentiation|cellular response to insulin stimulus|heart development|histone H3 deacetylation|histone H4 deacetylation|inflammatory response|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|peptidyl-lysine deacetylation|positive regulation of cell migration involved in sprouting angiogenesis|regulation of skeletal muscle fiber development|transcription, DNA-dependent	cytoplasm|histone deacetylase complex|histone methyltransferase complex|transcription factor complex	histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|histone deacetylase binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|protein binding|protein kinase C binding|repressing transcription factor binding|transcription corepressor activity			lung(2)|central_nervous_system(2)|kidney(1)	5	all_lung(11;0.187)				Valproic Acid(DB00313)													---	---	---	---
TMEM196	256130	broad.mit.edu	37	7	19765536	19765536	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:19765536delT	uc011jyg.1	-						TMEM196_uc003sur.2_Intron	NM_152774	NP_689987			transmembrane protein 196							integral to membrane					0																		---	---	---	---
DNAH11	8701	broad.mit.edu	37	7	21744039	21744039	+	Intron	DEL	T	-	-	rs2965401	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:21744039delT	uc003svc.2	+							NM_003777	NP_003768			dynein, axonemal, heavy chain 11						microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(8)|large_intestine(3)|pancreas(3)|central_nervous_system(1)	15														Kartagener_syndrome				---	---	---	---
DNAH11	8701	broad.mit.edu	37	7	21939668	21939669	+	Frame_Shift_Ins	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:21939668_21939669insA	uc003svc.2	+	82	13285_13286	c.13254_13255insA	c.(13252-13257)ACCAAAfs	p.T4418fs		NM_003777	NP_003768	Q96DT5	DYH11_HUMAN	dynein, axonemal, heavy chain 11	4418_4419					microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(8)|large_intestine(3)|pancreas(3)|central_nervous_system(1)	15														Kartagener_syndrome				---	---	---	---
RAPGEF5	9771	broad.mit.edu	37	7	22196602	22196602	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:22196602delT	uc003svg.2	-						RAPGEF5_uc011jyl.1_Intron	NM_012294	NP_036426			Rap guanine nucleotide exchange factor (GEF) 5						nervous system development|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	nucleus	GTP-dependent protein binding|Rap guanyl-nucleotide exchange factor activity			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	7	23604013	23604015	+	IGR	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:23604013_23604015delTTT								TRA2A (32357 upstream) : CLK2P (20320 downstream)																																			---	---	---	---
NPVF	64111	broad.mit.edu	37	7	25266178	25266178	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:25266178delT	uc003sxo.2	-							NM_022150	NP_071433			neuropeptide VF precursor						neuropeptide signaling pathway	extracellular region|membrane	G-protein coupled receptor activity			ovary(1)	1																		---	---	---	---
HNRNPA2B1	3181	broad.mit.edu	37	7	26236673	26236673	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:26236673delA	uc003sxr.3	-						HNRNPA2B1_uc003sxs.3_Intron	NM_031243	NP_112533			heterogeneous nuclear ribonucleoprotein A2/B1						RNA transport	catalytic step 2 spliceosome|cytoplasm|heterogeneous nuclear ribonucleoprotein complex|nucleolus|nucleoplasm	nucleotide binding|protein binding|protein binding|RNA binding|single-stranded telomeric DNA binding			ovary(1)|central_nervous_system(1)|skin(1)	3								T	ETV1	prostate								---	---	---	---
SCRN1	9805	broad.mit.edu	37	7	29976507	29976507	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:29976507delA	uc010kvp.2	-						SCRN1_uc011jzy.1_Intron|SCRN1_uc003tak.2_Intron|SCRN1_uc011jzz.1_Intron|SCRN1_uc011kaa.1_Intron|SCRN1_uc011jzw.1_Intron|SCRN1_uc011jzx.1_Intron	NM_001145515	NP_001138987			secernin 1 isoform c						exocytosis|proteolysis	cytoplasm|nuclear membrane	dipeptidase activity			ovary(2)	2																		---	---	---	---
FKBP14	55033	broad.mit.edu	37	7	30058821	30058821	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30058821delT	uc003tal.1	-						FKBP14_uc010kvq.1_Intron	NM_017946	NP_060416			FK506 binding protein 14 precursor						protein folding	endoplasmic reticulum lumen|membrane	calcium ion binding|FK506 binding|peptidyl-prolyl cis-trans isomerase activity				0																		---	---	---	---
PLEKHA8	84725	broad.mit.edu	37	7	30113605	30113605	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30113605delA	uc003tam.1	+						PLEKHA8_uc003tao.2_Intron|PLEKHA8_uc003tap.1_Intron|PLEKHA8_uc003tan.2_Intron	NM_032639	NP_116028			pleckstrin homology domain containing, family A						protein transport	cytoplasm	glycolipid binding|glycolipid transporter activity			breast(3)|ovary(1)	4																		---	---	---	---
BMPER	168667	broad.mit.edu	37	7	34118338	34118338	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:34118338delT	uc011kap.1	+							NM_133468	NP_597725			BMP-binding endothelial regulator precursor						blood vessel endothelial cell proliferation involved in sprouting angiogenesis|endothelial cell activation|negative regulation of BMP signaling pathway|positive regulation of ERK1 and ERK2 cascade|regulation of endothelial cell migration|regulation of pathway-restricted SMAD protein phosphorylation	extracellular space				ovary(2)|central_nervous_system(1)	3																		---	---	---	---
POU6F2	11281	broad.mit.edu	37	7	39246850	39246850	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:39246850delT	uc003thb.1	+						POU6F2_uc010kxo.2_Intron	NM_007252	NP_009183			POU class 6 homeobox 2 isoform 1						central nervous system development|ganglion mother cell fate determination|transcription from RNA polymerase II promoter|visual perception		sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(1)	1																		---	---	---	---
POU6F2	11281	broad.mit.edu	37	7	39491107	39491108	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:39491107_39491108insT	uc003thb.1	+							NM_007252	NP_009183			POU class 6 homeobox 2 isoform 1						central nervous system development|ganglion mother cell fate determination|transcription from RNA polymerase II promoter|visual perception		sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(1)	1																		---	---	---	---
C7orf25	79020	broad.mit.edu	37	7	42949153	42949153	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:42949153delT	uc003thw.2	-	2					C7orf25_uc010kxq.2_3'UTR|C7orf25_uc003thx.3_3'UTR|C7orf25_uc010kxr.2_3'UTR	NM_024054	NP_076959			hypothetical protein LOC79020 b											skin(1)	1																		---	---	---	---
BLVRA	644	broad.mit.edu	37	7	43846349	43846349	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:43846349delA	uc003tir.2	+						BLVRA_uc010kxv.2_Intron	NM_000712	NP_000703			biliverdin reductase A precursor						heme catabolic process	cytosol	biliverdin reductase activity|zinc ion binding			ovary(1)	1					NADH(DB00157)													---	---	---	---
ABCA13	154664	broad.mit.edu	37	7	48318519	48318519	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:48318519delA	uc003toq.2	+	18	7753	c.7728delA	c.(7726-7728)TTAfs	p.L2576fs	ABCA13_uc010kys.1_5'Flank	NM_152701	NP_689914	Q86UQ4	ABCAD_HUMAN	ATP binding cassette, sub-family A (ABC1),	2576					transport	integral to membrane	ATP binding|ATPase activity			ovary(5)|central_nervous_system(4)|skin(1)	10																		---	---	---	---
VOPP1	81552	broad.mit.edu	37	7	55565248	55565254	+	Intron	DEL	GGGGGGG	-	-	rs72020530		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:55565248_55565254delGGGGGGG	uc003tqs.2	-						VOPP1_uc003tqq.2_Intron|VOPP1_uc010kzh.2_Intron|VOPP1_uc010kzi.2_Intron|VOPP1_uc011kcr.1_Intron	NM_030796	NP_110423			EGFR-coamplified and overexpressed protein						regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic vesicle membrane|endosome|integral to organelle membrane	signal transducer activity				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	7	56635559	56635559	+	IGR	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:56635559delG								DKFZp434L192 (70582 upstream) : ZNF479 (551769 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	7	57216044	57216044	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:57216044delT								ZNF479 (8473 upstream) : ZNF716 (293839 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	7	65150817	65150817	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:65150817delC	uc003tud.1	-						INTS4L2_uc003tue.2_Intron					Homo sapiens hypothetical LOC441242, mRNA (cDNA clone MGC:87648 IMAGE:5267764), complete cds.																														---	---	---	---
GUSB	2990	broad.mit.edu	37	7	65439090	65439090	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:65439090delA	uc003tun.2	-						GUSB_uc011kdt.1_Intron	NM_000181	NP_000172			glucuronidase, beta precursor						glycosaminoglycan catabolic process	lysosome	beta-glucuronidase activity|cation binding				0																		---	---	---	---
TYW1	55253	broad.mit.edu	37	7	66582452	66582452	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:66582452delA	uc003tvn.2	+						TYW1_uc010lai.2_Intron|TYW1_uc011kef.1_Intron	NM_018264	NP_060734			radical S-adenosyl methionine and flavodoxin						tRNA processing		4 iron, 4 sulfur cluster binding|FMN binding|iron ion binding|oxidoreductase activity			skin(1)	1		Lung NSC(55;0.0846)|all_lung(88;0.183)																---	---	---	---
TYW1B	441250	broad.mit.edu	37	7	72236591	72236591	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72236591delA	uc011kej.1	-						TYW1B_uc011keh.1_Intron|TYW1B_uc011kek.1_Intron	NM_001145440	NP_001138912			tRNA-yW synthesizing protein 1 homolog B isoform						tRNA processing		4 iron, 4 sulfur cluster binding|FMN binding|iron ion binding|oxidoreductase activity				0																		---	---	---	---
STAG3L2	442582	broad.mit.edu	37	7	74300804	74300804	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:74300804delA	uc003ubj.3	-						STAG3L2_uc011kfj.1_Intron	NM_001025202	NP_001020373			STAG3-like							nucleus	binding				0																		---	---	---	---
PCLO	27445	broad.mit.edu	37	7	82783904	82783905	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82783904_82783905insA	uc003uhx.2	-						PCLO_uc003uhv.2_Intron	NM_033026	NP_149015			piccolo isoform 1						cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7																		---	---	---	---
KIAA1324L	222223	broad.mit.edu	37	7	86544190	86544191	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:86544190_86544191insA	uc011kha.1	-						KIAA1324L_uc003uif.1_Intron|KIAA1324L_uc011kgz.1_Intron|KIAA1324L_uc003uie.2_Intron	NM_001142749	NP_001136221			hypothetical protein LOC222223 isoform 1							integral to membrane				ovary(6)|skin(1)	7	Esophageal squamous(14;0.0058)																	---	---	---	---
DBF4	10926	broad.mit.edu	37	7	87507389	87507389	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87507389delA	uc003ujf.1	+	2	572	c.68delA	c.(67-69)GAAfs	p.E23fs	SLC25A40_uc003uje.2_5'Flank|DBF4_uc003ujh.1_5'UTR|DBF4_uc003ujg.1_5'UTR|DBF4_uc011khf.1_5'UTR	NM_006716	NP_006707	Q9UBU7	DBF4A_HUMAN	activator of S phase kinase	23					cell cycle checkpoint|DNA replication|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle	nucleoplasm	enzyme activator activity|nucleic acid binding|protein binding|zinc ion binding			lung(2)	2	Esophageal squamous(14;0.00202)	Breast(660;0.0334)																---	---	---	---
SRI	6717	broad.mit.edu	37	7	87835976	87835976	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87835976delT	uc003ujq.1	-						SRI_uc011khg.1_Intron|SRI_uc003ujr.1_Intron	NM_003130	NP_003121			sorcin isoform a						heart development|intracellular sequestering of iron ion|muscle organ development|regulation of action potential|regulation of heart contraction|regulation of striated muscle contraction|signal transduction	sarcoplasmic reticulum membrane	calcium channel regulator activity|calcium ion binding|receptor binding			upper_aerodigestive_tract(1)	1	Esophageal squamous(14;0.00202)																	---	---	---	---
C7orf63	79846	broad.mit.edu	37	7	89908833	89908833	+	Intron	DEL	G	-	-	rs71526681		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:89908833delG	uc010lep.2	+						C7orf63_uc003ukf.2_Intron|C7orf63_uc003ukg.2_Intron|C7orf63_uc011khj.1_Intron|C7orf63_uc011khk.1_5'Flank	NM_001039706	NP_001034795			hypothetical protein LOC79846 isoform 1								binding			ovary(1)	1																OREG0003793	type=REGULATORY REGION|Gene=AK024715|Dataset=Stanford ENCODE Dataset|EvidenceSubtype=Transient transfection luciferase assay	---	---	---	---
ANKIB1	54467	broad.mit.edu	37	7	92027348	92027348	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92027348delT	uc003ulw.2	+						ANKIB1_uc010lew.1_Intron	NM_019004	NP_061877			ankyrin repeat and IBR domain containing 1								protein binding|zinc ion binding			lung(1)	1	all_cancers(62;2.06e-09)|all_epithelial(64;9.24e-09)|Breast(17;0.0034)|all_lung(186;0.0509)|Lung NSC(181;0.0692)		STAD - Stomach adenocarcinoma(171;6.16e-05)|all cancers(6;0.00183)|Lung(22;0.123)|LUSC - Lung squamous cell carcinoma(200;0.225)															---	---	---	---
CDK6	1021	broad.mit.edu	37	7	92403884	92403884	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92403884delT	uc011khw.1	-						CDK6_uc010lez.2_Intron	NM_001259	NP_001250			cyclin-dependent kinase 6						cell dedifferentiation|cell division|G1 phase of mitotic cell cycle|gliogenesis|negative regulation of cell cycle|negative regulation of epithelial cell proliferation|negative regulation of osteoblast differentiation|positive regulation of cell-matrix adhesion|positive regulation of fibroblast proliferation|regulation of erythrocyte differentiation|regulation of gene expression|response to virus	cyclin-dependent protein kinase holoenzyme complex|cytosol|nucleus|ruffle	ATP binding|cyclin binding|cyclin-dependent protein kinase activity			central_nervous_system(1)|skin(1)	2	all_cancers(62;8.72e-12)|all_epithelial(64;3.65e-10)|Breast(17;0.000675)|all_lung(186;0.0392)|Lung NSC(181;0.053)|all_neural(327;0.219)|all_hematologic(106;0.237)		STAD - Stomach adenocarcinoma(4;6.16e-07)|GBM - Glioblastoma multiforme(5;1.2e-06)|all cancers(6;3.1e-05)|LUSC - Lung squamous cell carcinoma(200;0.225)|Lung(22;0.23)					T	MLLT10	ALL								---	---	---	---
DYNC1I1	1780	broad.mit.edu	37	7	95614280	95614280	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:95614280delA	uc003uoc.3	+	8	1062	c.785delA	c.(784-786)GAAfs	p.E262fs	DYNC1I1_uc003uod.3_Frame_Shift_Del_p.E245fs|DYNC1I1_uc003uob.2_Frame_Shift_Del_p.E225fs|DYNC1I1_uc003uoe.3_Frame_Shift_Del_p.E242fs|DYNC1I1_uc010lfl.2_Frame_Shift_Del_p.E251fs	NM_004411	NP_004402	O14576	DC1I1_HUMAN	dynein, cytoplasmic 1, intermediate chain 1	262					vesicle transport along microtubule	condensed chromosome kinetochore|cytoplasmic dynein complex|microtubule|perinuclear region of cytoplasm|spindle pole|vesicle	microtubule binding|microtubule motor activity			ovary(3)|kidney(1)	4	all_cancers(62;9.39e-10)|all_epithelial(64;2.28e-09)|Lung NSC(181;0.165)|all_lung(186;0.191)		STAD - Stomach adenocarcinoma(171;0.0957)															---	---	---	---
SLC25A13	10165	broad.mit.edu	37	7	95760968	95760968	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:95760968delA	uc003uof.3	-						SLC25A13_uc003uog.3_Intron|SLC25A13_uc011kik.1_Intron	NM_014251	NP_055066			solute carrier family 25, member 13 isoform 2						ATP biosynthetic process|gluconeogenesis|malate-aspartate shuttle|response to calcium ion	integral to plasma membrane|mitochondrial inner membrane	calcium ion binding|L-aspartate transmembrane transporter activity|L-glutamate transmembrane transporter activity			central_nervous_system(3)|skin(1)	4	all_cancers(62;7.75e-08)|all_epithelial(64;1.16e-07)		STAD - Stomach adenocarcinoma(171;0.194)		L-Aspartic Acid(DB00128)													---	---	---	---
TRRAP	8295	broad.mit.edu	37	7	98491411	98491411	+	Intron	DEL	T	-	-	rs78871243		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98491411delT	uc003upp.2	+						TRRAP_uc011kis.1_Intron	NM_003496	NP_003487			transformation/transcription domain-associated						histone deubiquitination|histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	NuA4 histone acetyltransferase complex|PCAF complex|STAGA complex|transcription factor TFTC complex	phosphotransferase activity, alcohol group as acceptor|protein binding|transcription cofactor activity			ovary(9)|large_intestine(8)|central_nervous_system(6)|skin(6)|stomach(5)|upper_aerodigestive_tract(1)|lung(1)|liver(1)	37	all_cancers(62;6.96e-09)|all_epithelial(64;4.86e-09)|Lung NSC(181;0.01)|all_lung(186;0.016)|Esophageal squamous(72;0.0274)		STAD - Stomach adenocarcinoma(171;0.215)															---	---	---	---
ZSCAN21	7589	broad.mit.edu	37	7	99661218	99661219	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99661218_99661219delAA	uc003uso.2	+						ZSCAN21_uc003usn.1_Intron	NM_145914	NP_666019			zinc finger protein 38						positive regulation of transcription, DNA-dependent|viral reproduction	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(3)	3	Lung NSC(181;0.0211)|all_lung(186;0.0323)|Esophageal squamous(72;0.0439)		STAD - Stomach adenocarcinoma(171;0.129)															---	---	---	---
COPS6	10980	broad.mit.edu	37	7	99687409	99687409	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99687409delA	uc003usu.2	+						COPS6_uc011kjf.1_Frame_Shift_Del_p.*125fs	NM_006833	NP_006824			COP9 signalosome subunit 6						cullin deneddylation|interspecies interaction between organisms	cytoplasm|signalosome	protein binding				0	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)		STAD - Stomach adenocarcinoma(171;0.129)															---	---	---	---
MCM7	4176	broad.mit.edu	37	7	99691154	99691154	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99691154delC	uc003usw.1	-						MCM7_uc003usv.1_Intron|MCM7_uc003usx.1_Intron	NM_005916	NP_005907			minichromosome maintenance complex component 7						cell cycle checkpoint|DNA strand elongation involved in DNA replication|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|regulation of phosphorylation|response to DNA damage stimulus|S phase of mitotic cell cycle	chromatin|MCM complex	ATP binding|protein binding				0	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)				Atorvastatin(DB01076)													---	---	---	---
STAG3	10734	broad.mit.edu	37	7	99801910	99801910	+	Intron	DEL	T	-	-	rs143599714	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99801910delT	uc003utx.1	+						STAG3_uc011kjk.1_Intron|GATS_uc003uty.3_Intron|GATS_uc003utz.3_Intron|GATS_uc003uua.3_Intron|GATS_uc010lgt.2_Intron|STAG3_uc003uub.1_Intron	NM_012447	NP_036579			stromal antigen 3						chromosome segregation|synaptonemal complex assembly	chromosome, centromeric region|meiotic cohesin complex|synaptonemal complex	binding			ovary(4)|skin(2)|lung(1)|kidney(1)	8	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)																	---	---	---	---
PVRIG	79037	broad.mit.edu	37	7	99817848	99817848	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99817848delG	uc003uue.2	+	4	602	c.230delG	c.(229-231)TGGfs	p.W77fs	GATS_uc003uty.3_Intron|GATS_uc003utz.3_Intron|GATS_uc003uua.3_Intron|GATS_uc010lgt.2_Intron|GATS_uc011kjl.1_Intron|GATS_uc010lgu.2_Intron|PVRIG_uc003uuf.1_Frame_Shift_Del_p.W77fs	NM_024070	NP_076975	Q6DKI7	PVRIG_HUMAN	poliovirus receptor related immunoglobulin	77	Helical; (Potential).					integral to membrane				skin(2)	2	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)																	---	---	---	---
ZCWPW1	55063	broad.mit.edu	37	7	100004130	100004130	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100004130delA	uc003uut.2	-						ZCWPW1_uc011kjq.1_Intron|ZCWPW1_uc003uur.2_Intron|ZCWPW1_uc003uus.2_Intron|ZCWPW1_uc011kjr.1_Intron|ZCWPW1_uc003uuu.1_Intron|ZCWPW1_uc011kjp.1_Intron	NM_017984	NP_060454			zinc finger, CW type with PWWP domain 1								zinc ion binding				0	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)																	---	---	---	---
ZAN	7455	broad.mit.edu	37	7	100369721	100369721	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100369721delT	uc003uwj.2	+						ZAN_uc003uwk.2_Intron|ZAN_uc003uwl.2_Intron|ZAN_uc010lhh.2_Intron|ZAN_uc010lhi.2_Intron|ZAN_uc011kkd.1_Intron|ZAN_uc011kke.1_5'Flank	NM_003386	NP_003377			zonadhesin isoform 3						binding of sperm to zona pellucida|cell-cell adhesion	integral to membrane|plasma membrane				ovary(4)|large_intestine(3)|central_nervous_system(2)|pancreas(2)	11	Lung NSC(181;0.041)|all_lung(186;0.0581)		STAD - Stomach adenocarcinoma(171;0.19)															---	---	---	---
EPHB4	2050	broad.mit.edu	37	7	100405271	100405271	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100405271delT	uc003uwn.1	-						EPHB4_uc003uwm.1_Intron|EPHB4_uc010lhj.1_Intron	NM_004444	NP_004435			EPH receptor B4 precursor						cell proliferation|organ morphogenesis|regulation of angiogenesis	cell surface|integral to plasma membrane	ATP binding|ephrin receptor activity			lung(4)|stomach(3)|skin(3)|central_nervous_system(2)|ovary(2)|breast(1)	15	Lung NSC(181;0.041)|all_lung(186;0.0581)																	---	---	---	---
EPHB4	2050	broad.mit.edu	37	7	100420298	100420298	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100420298delG	uc003uwn.1	-						EPHB4_uc003uwm.1_Intron|EPHB4_uc010lhj.1_Intron|EPHB4_uc011kkf.1_Intron|EPHB4_uc011kkg.1_Intron|EPHB4_uc011kkh.1_Intron	NM_004444	NP_004435			EPH receptor B4 precursor						cell proliferation|organ morphogenesis|regulation of angiogenesis	cell surface|integral to plasma membrane	ATP binding|ephrin receptor activity			lung(4)|stomach(3)|skin(3)|central_nervous_system(2)|ovary(2)|breast(1)	15	Lung NSC(181;0.041)|all_lung(186;0.0581)																	---	---	---	---
FBXL13	222235	broad.mit.edu	37	7	102667757	102667758	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:102667757_102667758insA	uc003vaq.2	-						FBXL13_uc010liq.1_5'Flank|FBXL13_uc010lir.1_Intron|FBXL13_uc003var.2_Intron|FBXL13_uc003vas.2_Intron|FBXL13_uc003vav.2_Intron	NM_145032	NP_659469			F-box and leucine-rich repeat protein 13 isoform												0																		---	---	---	---
SLC26A5	375611	broad.mit.edu	37	7	103015124	103015124	+	Intron	DEL	T	-	-	rs72245175		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:103015124delT	uc003vbz.2	-						SLC26A5_uc003vbt.1_Intron|SLC26A5_uc003vbu.1_Intron|SLC26A5_uc003vbv.1_Intron|SLC26A5_uc003vbw.2_Intron|SLC26A5_uc003vbx.2_Intron|SLC26A5_uc003vby.2_Intron|SLC26A5_uc010liy.2_Intron	NM_198999	NP_945350			prestin isoform a						regulation of cell shape|sensory perception of sound	integral to membrane	secondary active sulfate transmembrane transporter activity			ovary(1)	1																		---	---	---	---
RELN	5649	broad.mit.edu	37	7	103127001	103127001	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:103127001delA	uc003vca.2	-						RELN_uc010liz.2_Intron	NM_005045	NP_005036			reelin isoform a						axon guidance|cell adhesion|cerebral cortex tangential migration|glial cell differentiation|neuron migration|peptidyl-tyrosine phosphorylation|positive regulation of protein kinase activity|positive regulation of small GTPase mediated signal transduction|response to pain|spinal cord patterning	cytoplasm|dendrite|extracellular space|proteinaceous extracellular matrix	metal ion binding|protein serine/threonine/tyrosine kinase activity|serine-type peptidase activity			ovary(8)|upper_aerodigestive_tract(5)|large_intestine(2)|central_nervous_system(2)|skin(1)|pancreas(1)	19				COAD - Colon adenocarcinoma(1;8.98e-05)|Colorectal(1;0.00184)														---	---	---	---
NAMPT	10135	broad.mit.edu	37	7	105917290	105917290	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:105917290delA	uc003vdq.2	-						NAMPT_uc003vdr.1_Intron|NAMPT_uc011klu.1_Intron	NM_005746	NP_005737			nicotinamide phosphoribosyltransferase						cell-cell signaling|NAD biosynthetic process|nicotinamide metabolic process|positive regulation of cell proliferation|positive regulation of nitric-oxide synthase biosynthetic process|signal transduction|water-soluble vitamin metabolic process	cytosol	cytokine activity|nicotinamide phosphoribosyltransferase activity|nicotinate phosphoribosyltransferase activity|nicotinate-nucleotide diphosphorylase (carboxylating) activity			large_intestine(1)	1																		---	---	---	---
ST7	7982	broad.mit.edu	37	7	116772156	116772156	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:116772156delT	uc003vin.2	+						ST7_uc011knl.1_Intron|ST7_uc003vio.2_Intron|ST7_uc003viq.2_Intron|ST7_uc011knm.1_Intron|ST7_uc003vir.2_Intron|ST7OT2_uc003viu.2_Intron|ST7_uc011knn.1_Intron|ST7OT2_uc003viw.2_Intron|ST7_uc003vix.1_Intron	NM_021908	NP_068708			suppression of tumorigenicity 7 isoform b							integral to membrane	binding			central_nervous_system(1)|skin(1)	2	all_cancers(3;3.88e-07)|all_epithelial(6;3.42e-07)|Lung NSC(10;0.00072)|all_lung(10;0.000847)		STAD - Stomach adenocarcinoma(10;0.000512)	LUSC - Lung squamous cell carcinoma(290;0.133)														---	---	---	---
ASZ1	136991	broad.mit.edu	37	7	117067081	117067081	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117067081delT	uc003vjb.2	-						ASZ1_uc011kno.1_Intron|ASZ1_uc011knp.1_Intron	NM_130768	NP_570124			ankyrin repeat, SAM and basic leucine zipper						cell differentiation|DNA methylation involved in gamete generation|gene silencing by RNA|male meiosis|multicellular organismal development|piRNA metabolic process|spermatogenesis	pi-body	signal transducer activity			central_nervous_system(2)|ovary(1)	3	Lung NSC(10;0.00156)|all_lung(10;0.00175)		STAD - Stomach adenocarcinoma(10;0.000512)															---	---	---	---
CTTNBP2	83992	broad.mit.edu	37	7	117396508	117396508	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117396508delG	uc003vjf.2	-							NM_033427	NP_219499			cortactin binding protein 2											ovary(4)|central_nervous_system(1)	5	Lung NSC(10;0.0018)|all_lung(10;0.002)			LUSC - Lung squamous cell carcinoma(290;0.133)														---	---	---	---
CTTNBP2	83992	broad.mit.edu	37	7	117420473	117420473	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117420473delA	uc003vjf.2	-							NM_033427	NP_219499			cortactin binding protein 2											ovary(4)|central_nervous_system(1)	5	Lung NSC(10;0.0018)|all_lung(10;0.002)			LUSC - Lung squamous cell carcinoma(290;0.133)														---	---	---	---
CTTNBP2	83992	broad.mit.edu	37	7	117431024	117431024	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117431024delA	uc003vjf.2	-							NM_033427	NP_219499			cortactin binding protein 2											ovary(4)|central_nervous_system(1)	5	Lung NSC(10;0.0018)|all_lung(10;0.002)			LUSC - Lung squamous cell carcinoma(290;0.133)														---	---	---	---
ANKRD7	56311	broad.mit.edu	37	7	117874946	117874946	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:117874946delA	uc003vji.2	+							NM_019644	NP_062618			ankyrin repeat domain 7						male gonad development						0																		---	---	---	---
PTPRZ1	5803	broad.mit.edu	37	7	121597015	121597015	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:121597015delA	uc003vjy.2	+						PTPRZ1_uc003vjz.2_Intron	NM_002851	NP_002842			protein tyrosine phosphatase, receptor-type,						central nervous system development	integral to plasma membrane	protein binding|protein tyrosine/threonine phosphatase activity|transmembrane receptor protein tyrosine phosphatase activity			ovary(3)|large_intestine(2)|lung(2)|central_nervous_system(1)|kidney(1)	9																		---	---	---	---
PTPRZ1	5803	broad.mit.edu	37	7	121699528	121699529	+	Intron	INS	-	T	T	rs138736486	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:121699528_121699529insT	uc003vjy.2	+						PTPRZ1_uc003vjz.2_Intron|PTPRZ1_uc011knt.1_Intron	NM_002851	NP_002842			protein tyrosine phosphatase, receptor-type,						central nervous system development	integral to plasma membrane	protein binding|protein tyrosine/threonine phosphatase activity|transmembrane receptor protein tyrosine phosphatase activity			ovary(3)|large_intestine(2)|lung(2)|central_nervous_system(1)|kidney(1)	9																		---	---	---	---
CADPS2	93664	broad.mit.edu	37	7	122194577	122194578	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:122194577_122194578insA	uc010lkp.2	-						CADPS2_uc003vkg.3_Intron|CADPS2_uc010lkq.2_Intron	NM_017954	NP_060424			Ca2+-dependent activator protein for secretion 2						exocytosis|protein transport	cell junction|cytoplasmic vesicle membrane|synapse	lipid binding|metal ion binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
POT1	25913	broad.mit.edu	37	7	124486869	124486869	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:124486869delG	uc003vlm.2	-						POT1_uc011koe.1_Intron|POT1_uc003vlk.2_Intron|POT1_uc003vll.2_Intron|POT1_uc003vlo.2_Intron|POT1_uc003vln.2_Intron	NM_015450	NP_056265			protection of telomeres 1 isoform 1						DNA duplex unwinding|negative regulation of telomere maintenance via telomerase|positive regulation of DNA strand elongation|positive regulation of helicase activity|positive regulation of telomerase activity|positive regulation of telomere maintenance via telomerase|telomere capping|telomere formation via telomerase|telomere maintenance via telomerase	nuclear telomere cap complex|nucleoplasm	DEAD/H-box RNA helicase binding|single-stranded telomeric DNA binding|telomerase inhibitor activity			central_nervous_system(1)	1																		---	---	---	---
FSCN3	29999	broad.mit.edu	37	7	127236658	127236659	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127236658_127236659delAA	uc003vmd.1	+						FSCN3_uc011koh.1_Intron|FSCN3_uc010llc.1_Intron	NM_020369	NP_065102			fascin 3							actin cytoskeleton|cytoplasm	actin filament binding|protein binding, bridging			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	7	128102701	128102702	+	IGR	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128102701_128102702insT								C7orf68 (4230 upstream) : METTL2B (14081 downstream)																																			---	---	---	---
CCDC136	64753	broad.mit.edu	37	7	128432342	128432342	+	5'UTR	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128432342delC	uc003vnv.1	+	1					CCDC136_uc003vnu.1_Intron|CCDC136_uc003vnw.1_5'UTR	NM_022742	NP_073579			coiled-coil domain containing 136							integral to membrane	protein binding			ovary(2)	2																		---	---	---	---
NRF1	4899	broad.mit.edu	37	7	129348691	129348692	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:129348691_129348692insA	uc003voz.2	+						NRF1_uc003vpa.2_Intron|NRF1_uc011kpa.1_Intron|NRF1_uc003vpb.2_Intron	NM_005011	NP_005002			nuclear respiratory factor 1						generation of precursor metabolites and energy|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1																		---	---	---	---
AKR1B15	441282	broad.mit.edu	37	7	134252866	134252866	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:134252866delA	uc011kpr.1	+						AKR1B15_uc003vrt.2_Intron|AKR1B15_uc011kps.1_Intron	NM_001080538	NP_001074007			aldo-keto reductase family 1, member B15								oxidoreductase activity			ovary(1)	1																		---	---	---	---
KLRG2	346689	broad.mit.edu	37	7	139164127	139164127	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:139164127delA	uc003vvb.2	-						KLRG2_uc010lnc.2_Intron	NM_198508	NP_940910			killer cell lectin-like receptor subfamily G,							integral to membrane	sugar binding			central_nervous_system(1)	1	Melanoma(164;0.233)																	---	---	---	---
WEE2	494551	broad.mit.edu	37	7	141423218	141423218	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141423218delA	uc003vwn.2	+						FLJ40852_uc011krh.1_Intron|FLJ40852_uc010lnm.2_Intron|FLJ40852_uc010lnn.2_Intron|FLJ40852_uc003vwm.3_Intron|FLJ40852_uc010lno.2_Intron	NM_001105558	NP_001099028			WEE1 homolog 2						egg activation|female meiosis|female pronucleus assembly|meiotic metaphase II|meiotic prophase I|mitosis|negative regulation of oocyte development|regulation of meiosis I	centrosome|nucleus	ATP binding|magnesium ion binding|non-membrane spanning protein tyrosine kinase activity|protein serine/threonine kinase activity			ovary(1)|stomach(1)	2	Melanoma(164;0.0171)																	---	---	---	---
MGAM	8972	broad.mit.edu	37	7	141720899	141720899	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141720899delT	uc003vwy.2	+							NM_004668	NP_004659			maltase-glucoamylase						polysaccharide digestion|starch catabolic process	apical plasma membrane|integral to membrane	carbohydrate binding|glucan 1,4-alpha-glucosidase activity|maltose alpha-glucosidase activity			ovary(2)	2	Melanoma(164;0.0272)				Acarbose(DB00284)|Miglitol(DB00491)|Voglibose(DB04878)													---	---	---	---
ATG9B	285973	broad.mit.edu	37	7	150719924	150719924	+	Intron	DEL	A	-	-	rs5888425		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150719924delA	uc011kvc.1	-						ATG9B_uc003wig.3_Intron	NM_173681	NP_775952			ATG9 autophagy related 9 homolog B						autophagic vacuole assembly	autophagic vacuole membrane|cytoplasmic vesicle|integral to membrane				ovary(1)	1	all_neural(206;0.219)		OV - Ovarian serous cystadenocarcinoma(82;0.0121)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---
RHEB	6009	broad.mit.edu	37	7	151174299	151174299	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151174299delA	uc003wkh.1	-							NM_005614	NP_005605			Ras homolog enriched in brain precursor						cell cycle arrest|insulin receptor signaling pathway|positive regulation of TOR signaling cascade|small GTPase mediated signal transduction	cytosol|plasma membrane	GTP binding|GTPase activity|metal ion binding|protein binding			large_intestine(1)|lung(1)	2			OV - Ovarian serous cystadenocarcinoma(82;0.00306)	UCEC - Uterine corpus endometrioid carcinoma (81;0.174)														---	---	---	---
MLL3	58508	broad.mit.edu	37	7	151837032	151837032	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151837032delA	uc003wla.2	-						MLL3_uc003wkz.2_Intron|MLL3_uc003wkx.2_Intron|MLL3_uc003wky.2_Intron	NM_170606	NP_733751			myeloid/lymphoid or mixed-lineage leukemia 3						intracellular signal transduction|regulation of transcription, DNA-dependent|transcription, DNA-dependent		DNA binding|protein binding|zinc ion binding			large_intestine(27)|pancreas(13)|ovary(9)|central_nervous_system(8)|breast(3)|upper_aerodigestive_tract(1)|urinary_tract(1)|skin(1)	63	all_neural(206;0.187)	all_hematologic(28;0.0592)|Prostate(32;0.0906)	OV - Ovarian serous cystadenocarcinoma(82;0.00715)	UCEC - Uterine corpus endometrioid carcinoma (81;0.0597)|BRCA - Breast invasive adenocarcinoma(188;0.0462)				N		medulloblastoma								---	---	---	---
MLL3	58508	broad.mit.edu	37	7	151851246	151851246	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151851246delA	uc003wla.2	-						MLL3_uc003wkz.2_Intron|MLL3_uc003wkx.2_Intron|MLL3_uc003wky.2_Intron	NM_170606	NP_733751			myeloid/lymphoid or mixed-lineage leukemia 3						intracellular signal transduction|regulation of transcription, DNA-dependent|transcription, DNA-dependent		DNA binding|protein binding|zinc ion binding			large_intestine(27)|pancreas(13)|ovary(9)|central_nervous_system(8)|breast(3)|upper_aerodigestive_tract(1)|urinary_tract(1)|skin(1)	63	all_neural(206;0.187)	all_hematologic(28;0.0592)|Prostate(32;0.0906)	OV - Ovarian serous cystadenocarcinoma(82;0.00715)	UCEC - Uterine corpus endometrioid carcinoma (81;0.0597)|BRCA - Breast invasive adenocarcinoma(188;0.0462)				N		medulloblastoma								---	---	---	---
RBM33	155435	broad.mit.edu	37	7	155473256	155473256	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:155473256delT	uc010lqk.1	+						RBM33_uc003wme.2_Intron	NM_053043	NP_444271			RNA binding motif protein 33								nucleotide binding|RNA binding			ovary(1)	1	all_neural(206;0.101)	all_hematologic(28;0.0592)	OV - Ovarian serous cystadenocarcinoma(82;0.011)	UCEC - Uterine corpus endometrioid carcinoma (81;0.2)														---	---	---	---
UBE3C	9690	broad.mit.edu	37	7	157000646	157000646	+	Intron	DEL	T	-	-	rs111673497		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:157000646delT	uc010lqs.2	+						UBE3C_uc003wng.2_Intron	NM_014671	NP_055486			ubiquitin protein ligase E3C						protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus|proteasome complex	protein binding|ubiquitin-protein ligase activity			ovary(2)|lung(2)|large_intestine(1)	5		all_hematologic(28;0.0185)|all_epithelial(9;0.0664)	OV - Ovarian serous cystadenocarcinoma(82;0.00448)	UCEC - Uterine corpus endometrioid carcinoma (81;0.19)														---	---	---	---
DLGAP2	9228	broad.mit.edu	37	8	1497007	1497007	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:1497007delG	uc003wpl.2	+	2	245	c.148delG	c.(148-150)GGGfs	p.G50fs	DLGAP2_uc003wpm.2_Frame_Shift_Del_p.G50fs	NM_004745	NP_004736	Q9P1A6	DLGP2_HUMAN	discs large-associated protein 2	129					neuron-neuron synaptic transmission	cell junction|neurofilament|postsynaptic density|postsynaptic membrane	protein binding				0		Ovarian(12;0.0271)|Hepatocellular(245;0.0838)|Colorectal(14;0.0846)		BRCA - Breast invasive adenocarcinoma(11;0.000169)|READ - Rectum adenocarcinoma(644;0.171)														---	---	---	---
MCPH1	79648	broad.mit.edu	37	8	6390159	6390159	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:6390159delT	uc003wqi.2	+						ANGPT2_uc003wqj.3_Intron|ANGPT2_uc003wqk.3_Intron|ANGPT2_uc010lri.2_Intron|ANGPT2_uc003wql.3_Intron	NM_024596	NP_078872			microcephalin							microtubule organizing center				central_nervous_system(1)|skin(1)	2		Hepatocellular(245;0.0663)		Colorectal(4;0.0505)														---	---	---	---
AGPAT5	55326	broad.mit.edu	37	8	6612417	6612417	+	Intron	DEL	T	-	-	rs71687580		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:6612417delT	uc003wqo.2	+						AGPAT5_uc011kwm.1_Intron	NM_018361	NP_060831			1-acylglycerol-3-phosphate O-acyltransferase 5						phospholipid biosynthetic process	integral to membrane|mitochondrion	1-acylglycerol-3-phosphate O-acyltransferase activity				0			STAD - Stomach adenocarcinoma(24;0.0578)	READ - Rectum adenocarcinoma(644;0.156)|COAD - Colon adenocarcinoma(149;0.191)														---	---	---	---
ASAH1	427	broad.mit.edu	37	8	17914872	17914872	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:17914872delA	uc003wyl.2	-	14					ASAH1_uc010ltb.1_RNA|ASAH1_uc003wym.2_3'UTR|ASAH1_uc003wyn.2_3'UTR|ASAH1_uc003wyo.2_3'UTR	NM_177924	NP_808592			N-acylsphingosine amidohydrolase 1 isoform a						ceramide metabolic process	lysosome	ceramidase activity				0				Colorectal(111;0.0646)|COAD - Colon adenocarcinoma(73;0.228)														---	---	---	---
XPO7	23039	broad.mit.edu	37	8	21846489	21846489	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:21846489delT	uc003xaa.3	+						XPO7_uc010lti.2_Intron|XPO7_uc010ltk.2_Intron	NM_015024	NP_055839			exportin 7 isoform b						mRNA transport|protein export from nucleus|transmembrane transport	cytoplasm|nuclear pore	nuclear export signal receptor activity|protein transporter activity			ovary(1)|kidney(1)|breast(1)|central_nervous_system(1)|pancreas(1)	5				Colorectal(74;0.0187)|COAD - Colon adenocarcinoma(73;0.0724)														---	---	---	---
SLC39A14	23516	broad.mit.edu	37	8	22248227	22248227	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22248227delT	uc003xbq.3	+						SLC39A14_uc011kzg.1_Intron|SLC39A14_uc003xbp.3_Intron|SLC39A14_uc011kzh.1_Intron	NM_001128431	NP_001121903			solute carrier family 39 (zinc transporter),							endoplasmic reticulum|Golgi apparatus|integral to membrane|lamellipodium|plasma membrane	zinc ion transmembrane transporter activity				0				Colorectal(74;0.019)|COAD - Colon adenocarcinoma(73;0.0731)														---	---	---	---
SORBS3	10174	broad.mit.edu	37	8	22426860	22426862	+	Intron	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22426860_22426862delTTT	uc003xbv.2	+						SORBS3_uc003xbw.3_Intron	NM_005775	NP_005766			sorbin and SH3 domain containing 3 isoform 1						muscle contraction|positive regulation of stress fiber assembly	cytoskeleton|cytosol|nucleus	protein binding|structural constituent of cytoskeleton|vinculin binding				0		Prostate(55;0.0421)|Breast(100;0.102)		BRCA - Breast invasive adenocarcinoma(99;0.00566)|Colorectal(74;0.0146)|COAD - Colon adenocarcinoma(73;0.061)														---	---	---	---
BIN3	55909	broad.mit.edu	37	8	22487477	22487477	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22487477delT	uc003xcl.2	-	6	435	c.338delA	c.(337-339)AAGfs	p.K113fs	BIN3_uc003xck.2_Frame_Shift_Del_p.K65fs|BIN3_uc010ltw.2_Frame_Shift_Del_p.K59fs	NM_018688	NP_061158	Q9NQY0	BIN3_HUMAN	bridging integrator 3	113	BAR.				actin filament organization|barrier septum formation|cell cycle|protein localization|unidimensional cell growth	cytoplasm|cytoskeleton	cytoskeletal adaptor activity				0		Prostate(55;0.0424)|Breast(100;0.102)|all_epithelial(46;0.143)		BRCA - Breast invasive adenocarcinoma(99;0.00664)|Colorectal(74;0.0189)|COAD - Colon adenocarcinoma(73;0.0727)														---	---	---	---
EBF2	64641	broad.mit.edu	37	8	25708397	25708397	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:25708397delA	uc003xes.1	-						PPP2R2A_uc003xek.2_Intron|EBF2_uc010lug.1_Intron	NM_022659	NP_073150			early B-cell factor 2						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|metal ion binding			ovary(3)|skin(1)	4		all_cancers(63;0.0989)|Ovarian(32;2.74e-05)|all_epithelial(46;0.0608)|Prostate(55;0.0845)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0277)|Epithelial(17;3.29e-10)|Colorectal(74;0.00383)|COAD - Colon adenocarcinoma(73;0.00738)														---	---	---	---
EBF2	64641	broad.mit.edu	37	8	25890746	25890746	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:25890746delT	uc003xes.1	-						PPP2R2A_uc003xek.2_Intron|EBF2_uc003xet.1_Intron	NM_022659	NP_073150			early B-cell factor 2						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|metal ion binding			ovary(3)|skin(1)	4		all_cancers(63;0.0989)|Ovarian(32;2.74e-05)|all_epithelial(46;0.0608)|Prostate(55;0.0845)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0277)|Epithelial(17;3.29e-10)|Colorectal(74;0.00383)|COAD - Colon adenocarcinoma(73;0.00738)														---	---	---	---
PBK	55872	broad.mit.edu	37	8	27679715	27679715	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27679715delT	uc003xgi.2	-						PBK_uc011lap.1_Intron	NM_018492	NP_060962			PDZ binding kinase						mitosis		ATP binding|protein binding|protein serine/threonine kinase activity				0		Ovarian(32;0.000953)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0213)|KIRC - Kidney renal clear cell carcinoma(542;0.101)|Kidney(114;0.121)|Colorectal(74;0.141)														---	---	---	---
PBK	55872	broad.mit.edu	37	8	27690542	27690542	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27690542delA	uc003xgi.2	-						PBK_uc011lap.1_Intron	NM_018492	NP_060962			PDZ binding kinase						mitosis		ATP binding|protein binding|protein serine/threonine kinase activity				0		Ovarian(32;0.000953)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0213)|KIRC - Kidney renal clear cell carcinoma(542;0.101)|Kidney(114;0.121)|Colorectal(74;0.141)														---	---	---	---
Unknown	0	broad.mit.edu	37	8	28158144	28158144	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:28158144delA								ELP3 (109477 upstream) : PNOC (16505 downstream)																																			---	---	---	---
RNF122	79845	broad.mit.edu	37	8	33406740	33406740	+	Intron	DEL	A	-	-	rs71899502		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:33406740delA	uc003xjo.1	-							NM_024787	NP_079063			ring finger protein 122							endoplasmic reticulum|Golgi apparatus|integral to membrane	zinc ion binding				0				KIRC - Kidney renal clear cell carcinoma(67;0.0966)|Kidney(114;0.116)														---	---	---	---
KCNU1	157855	broad.mit.edu	37	8	36779849	36779849	+	Intron	DEL	A	-	-	rs68098747		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:36779849delA	uc010lvw.2	+						KCNU1_uc003xjw.2_Intron	NM_001031836	NP_001027006			potassium channel, subfamily U, member 1							voltage-gated potassium channel complex	binding|large conductance calcium-activated potassium channel activity|voltage-gated potassium channel activity			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(67;0.0504)|Kidney(114;0.0634)														---	---	---	---
DDHD2	23259	broad.mit.edu	37	8	38099572	38099572	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:38099572delA	uc003xlb.2	+						DDHD2_uc003xlc.2_Intron|DDHD2_uc011lbl.1_Intron	NM_015214	NP_056029			DDHD domain containing 2 isoform 1						lipid catabolic process	centrosome	hydrolase activity|metal ion binding			large_intestine(1)|ovary(1)	2	Colorectal(12;0.000442)	all_lung(54;0.0657)|Lung NSC(58;0.175)	BRCA - Breast invasive adenocarcinoma(5;3.76e-25)|COAD - Colon adenocarcinoma(9;0.0977)															---	---	---	---
LETM2	137994	broad.mit.edu	37	8	38265166	38265167	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:38265166_38265167delAA	uc003xlm.1	+						LETM2_uc003xll.1_Intron|LETM2_uc003xln.1_Intron|LETM2_uc003xlo.1_Intron	NM_144652	NP_653253			leucine zipper-EF-hand containing transmembrane							integral to membrane|mitochondrial inner membrane					0	all_cancers(2;6.77e-47)|all_epithelial(2;1.01e-50)|all_lung(3;1.25e-23)|Lung NSC(2;2.76e-23)|Colorectal(12;0.000442)|Esophageal squamous(3;0.00202)	all_lung(54;0.0657)|Hepatocellular(245;0.152)|Lung NSC(58;0.175)	Epithelial(3;1.17e-42)|all cancers(3;5.44e-38)|BRCA - Breast invasive adenocarcinoma(5;5.44e-27)|LUSC - Lung squamous cell carcinoma(2;7.12e-25)|Lung(2;4.49e-22)|COAD - Colon adenocarcinoma(9;0.114)															---	---	---	---
Unknown	0	broad.mit.edu	37	8	41926441	41926441	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:41926441delA								MYST3 (16936 upstream) : AP3M2 (84023 downstream)																																			---	---	---	---
POLB	5423	broad.mit.edu	37	8	42195937	42195941	+	5'Flank	DEL	GCCCC	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:42195937_42195941delGCCCC	uc003xoz.1	+						POLB_uc003xpa.1_5'Flank|POLB_uc011lcs.1_5'Flank	NM_002690	NP_002681			DNA-directed DNA polymerase beta						DNA-dependent DNA replication	cytoplasm|nucleoplasm|spindle microtubule	DNA-(apurinic or apyrimidinic site) lyase activity|DNA-directed DNA polymerase activity|enzyme binding|metal ion binding|microtubule binding			ovary(1)|breast(1)	2	all_cancers(6;1.42e-24)|all_epithelial(6;1.02e-25)|all_lung(13;2.58e-12)|Lung NSC(13;4.24e-11)|Ovarian(28;0.00769)|Prostate(17;0.0119)|Colorectal(14;0.1)|Lung SC(25;0.211)	all_lung(54;0.00671)|Lung NSC(58;0.0184)|Esophageal squamous(32;0.131)|Hepatocellular(245;0.133)|Renal(179;0.151)	BRCA - Breast invasive adenocarcinoma(8;3.18e-11)|Lung(22;0.00467)|OV - Ovarian serous cystadenocarcinoma(14;0.00523)|LUSC - Lung squamous cell carcinoma(45;0.024)		Cytarabine(DB00987)								DNA_polymerases_(catalytic_subunits)					---	---	---	---
POTEA	340441	broad.mit.edu	37	8	43216290	43216290	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:43216290delA	uc003xpz.1	+	13					POTEA_uc003xqa.1_3'UTR	NM_001005365	NP_001005365			POTE ankyrin domain family, member A isoform 2											ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	8	47507947	47507947	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:47507947delT								None (None upstream) : BEYLA (244561 downstream)																																			---	---	---	---
KIAA0146	23514	broad.mit.edu	37	8	48586215	48586215	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:48586215delC	uc003xqd.2	+						KIAA0146_uc011ldb.1_Intron|KIAA0146_uc010lxs.2_Intron|KIAA0146_uc011ldc.1_Intron|KIAA0146_uc011ldd.1_Intron|KIAA0146_uc003xqe.2_Intron|KIAA0146_uc003xqf.2_Intron|KIAA0146_uc011lde.1_Intron|KIAA0146_uc010lxt.2_Intron|KIAA0146_uc011ldf.1_Intron|KIAA0146_uc011ldg.1_5'UTR|KIAA0146_uc010lxv.1_Intron	NM_001080394	NP_001073863			hypothetical protein LOC23514												0		Lung NSC(58;0.175)																---	---	---	---
CHCHD7	79145	broad.mit.edu	37	8	57129756	57129756	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:57129756delT	uc003xsx.2	+						CHCHD7_uc003xss.2_Intron|CHCHD7_uc003xst.2_Intron|CHCHD7_uc003xsu.2_Intron|CHCHD7_uc003xsv.2_Intron|CHCHD7_uc003xsw.2_Intron	NM_001011671	NP_001011671			coiled-coil-helix-coiled-coil-helix domain										CHCHD7/PLAG1(12)	salivary_gland(12)	12		all_lung(136;0.0548)|Lung NSC(129;0.0718)|all_epithelial(80;0.125)	Epithelial(17;0.00159)|all cancers(17;0.0112)					T	PLAG1	salivary adenoma								---	---	---	---
LRRC67	286187	broad.mit.edu	37	8	67925535	67925535	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:67925535delT	uc003xxc.2	-							NM_001013626	NP_001013648			leucine rich repeat containing 67												0																		---	---	---	---
C8orf34	116328	broad.mit.edu	37	8	69699867	69699868	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:69699867_69699868delAA	uc010lyz.2	+						C8orf34_uc003xyb.2_Intron	NM_052958	NP_443190			hypothetical protein LOC116328						signal transduction		cAMP-dependent protein kinase regulator activity			large_intestine(1)	1			Epithelial(68;0.0117)|OV - Ovarian serous cystadenocarcinoma(28;0.0227)|all cancers(69;0.0502)															---	---	---	---
KCNB2	9312	broad.mit.edu	37	8	73531355	73531356	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:73531355_73531356insT	uc003xzb.2	+							NM_004770	NP_004761			potassium voltage-gated channel, Shab-related						regulation of smooth muscle contraction	voltage-gated potassium channel complex	delayed rectifier potassium channel activity|protein binding			skin(3)|large_intestine(1)|pancreas(1)|ovary(1)|central_nervous_system(1)	7	Breast(64;0.137)		Epithelial(68;0.105)															---	---	---	---
HNF4G	3174	broad.mit.edu	37	8	76463609	76463609	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:76463609delT	uc003yaq.2	+						HNF4G_uc003yar.2_Intron	NM_004133	NP_004124			hepatocyte nuclear factor 4, gamma						endocrine pancreas development|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)	1	Breast(64;0.0448)		BRCA - Breast invasive adenocarcinoma(89;0.161)															---	---	---	---
Unknown	0	broad.mit.edu	37	8	81472059	81472059	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:81472059delA								ZBTB10 (37451 upstream) : ZNF704 (78710 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	8	82538287	82538287	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:82538287delA								FABP12 (94737 upstream) : IMPA1 (30864 downstream)																																			---	---	---	---
E2F5	1875	broad.mit.edu	37	8	86089786	86089786	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:86089786delC	uc003ycz.3	+	1	168	c.131delC	c.(130-132)GCCfs	p.A44fs	E2F5_uc003yda.3_Frame_Shift_Del_p.A44fs	NM_001951	NP_001942	Q15329	E2F5_HUMAN	E2F transcription factor 5 isoform 1	44					G1 phase of mitotic cell cycle	transcription factor complex	DNA binding|sequence-specific DNA binding transcription factor activity|transcription factor binding			ovary(1)	1																		---	---	---	---
WWP1	11059	broad.mit.edu	37	8	87393245	87393245	+	Intron	DEL	T	-	-	rs79348529	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:87393245delT	uc003ydt.2	+						WWP1_uc010mai.2_Intron	NM_007013	NP_008944			WW domain containing E3 ubiquitin protein ligase						central nervous system development|entry of virus into host cell|negative regulation of transcription, DNA-dependent|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|signal transduction	cytoplasm|nucleus|plasma membrane|ubiquitin ligase complex	protein binding|ubiquitin-protein ligase activity			lung(1)|liver(1)	2																		---	---	---	---
FAM82B	51115	broad.mit.edu	37	8	87494083	87494083	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:87494083delT	uc003ydu.2	-						FAM82B_uc011lfz.1_Intron|FAM82B_uc011lga.1_Intron	NM_016033	NP_057117			regulator of microtubule dynamics 1							microtubule|spindle pole	binding			ovary(1)	1																		---	---	---	---
OSGIN2	734	broad.mit.edu	37	8	90936586	90936586	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:90936586delT	uc003yeg.2	+						OSGIN2_uc003yeh.2_Intron	NM_004337	NP_004328			oxidative stress induced growth inhibitor family						germ cell development|meiosis						0			BRCA - Breast invasive adenocarcinoma(11;0.0344)															---	---	---	---
CDH17	1015	broad.mit.edu	37	8	95214101	95214102	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95214101_95214102insT	uc003ygh.2	-						CDH17_uc011lgo.1_Intron|CDH17_uc011lgp.1_Intron	NM_004063	NP_004054			cadherin 17 precursor							integral to membrane	calcium ion binding			ovary(5)|skin(1)	6	Breast(36;4.65e-06)		BRCA - Breast invasive adenocarcinoma(8;0.00691)															---	---	---	---
KIAA1429	25962	broad.mit.edu	37	8	95541687	95541687	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95541687delA	uc003ygo.1	-						KIAA1429_uc003ygp.2_Intron|KIAA1429_uc010maz.1_5'Flank	NM_015496	NP_056311			hypothetical protein LOC25962 isoform 1						mRNA processing|RNA splicing	nucleus				ovary(1)|skin(1)	2	Breast(36;3.29e-05)		BRCA - Breast invasive adenocarcinoma(8;0.00185)															---	---	---	---
C8orf37	157657	broad.mit.edu	37	8	96264243	96264244	+	Intron	DEL	TA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:96264243_96264244delTA	uc003yho.1	-							NM_177965	NP_808880			hypothetical protein LOC157657												0	Breast(36;3.41e-05)																	---	---	---	---
VPS13B	157680	broad.mit.edu	37	8	100160439	100160439	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:100160439delA	uc003yiv.2	+						VPS13B_uc003yiw.2_Intron|VPS13B_uc003yit.2_Intron|VPS13B_uc003yiu.1_Intron|VPS13B_uc003yix.1_Intron	NM_017890	NP_060360			vacuolar protein sorting 13B isoform 5						protein transport					ovary(7)|skin(4)|lung(3)|central_nervous_system(2)|pancreas(2)|breast(1)|kidney(1)	20	Breast(36;3.73e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.00636)															---	---	---	---
SNX31	169166	broad.mit.edu	37	8	101585974	101585974	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101585974delA	uc003yjr.2	-	14					SNX31_uc011lha.1_3'UTR|SNX31_uc011lhb.1_3'UTR	NM_152628	NP_689841			sorting nexin 31						cell communication|protein transport		phosphatidylinositol binding				0	all_cancers(14;4.01e-05)|all_epithelial(15;1.26e-07)|Lung NSC(17;0.000453)|all_lung(17;0.00125)		Epithelial(11;1.21e-11)|all cancers(13;2.62e-09)|OV - Ovarian serous cystadenocarcinoma(57;3.22e-06)|STAD - Stomach adenocarcinoma(118;0.206)															---	---	---	---
PKHD1L1	93035	broad.mit.edu	37	8	110460747	110460747	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110460747delT	uc003yne.2	+							NM_177531	NP_803875			fibrocystin L precursor						immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)												HNSCC(38;0.096)			---	---	---	---
RAD21	5885	broad.mit.edu	37	8	117866427	117866427	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:117866427delT	uc003yod.2	-							NM_006265	NP_006256			RAD21 homolog						apoptosis|cell division|chromosome segregation|double-strand break repair|mitotic metaphase/anaphase transition|mitotic prometaphase|protein localization to chromatin|reciprocal meiotic recombination|regulation of transcription from RNA polymerase II promoter	chromosome, centromeric region|cohesin complex|nuclear chromosome|nucleoplasm	protein binding			lung(1)|skin(1)	2	all_cancers(13;1.21e-21)|Lung NSC(37;0.000134)|Ovarian(258;0.0172)																	---	---	---	---
ENPP2	5168	broad.mit.edu	37	8	120613134	120613136	+	Intron	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:120613134_120613136delTTT	uc003yot.1	-						ENPP2_uc003yos.1_Intron|ENPP2_uc010mdd.1_Intron	NM_001040092	NP_001035181			autotaxin isoform 2 preproprotein						cellular component movement|chemotaxis|G-protein coupled receptor protein signaling pathway|immune response|phosphate metabolic process|phosphatidylcholine catabolic process|regulation of cell migration	extracellular space|integral to plasma membrane	alkylglycerophosphoethanolamine phosphodiesterase activity|calcium ion binding|lysophospholipase activity|nucleic acid binding|nucleotide diphosphatase activity|phosphodiesterase I activity|polysaccharide binding|scavenger receptor activity|transcription factor binding|zinc ion binding			ovary(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)|large_intestine(1)|kidney(1)	7	Lung NSC(37;5.03e-06)|Ovarian(258;0.0249)|Hepatocellular(40;0.161)		STAD - Stomach adenocarcinoma(47;0.00185)															---	---	---	---
TAF2	6873	broad.mit.edu	37	8	120815954	120815954	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:120815954delT	uc003you.2	-							NM_003184	NP_003175			TBP-associated factor 2						G2/M transition of mitotic cell cycle|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	transcription factor TFIID complex|transcription factor TFTC complex	metallopeptidase activity|protein binding|transcription regulatory region DNA binding|zinc ion binding			large_intestine(2)|ovary(2)|kidney(1)|skin(1)	6	Lung NSC(37;9.35e-07)|Ovarian(258;0.011)|Hepatocellular(40;0.161)		STAD - Stomach adenocarcinoma(47;0.00185)															---	---	---	---
COL14A1	7373	broad.mit.edu	37	8	121209837	121209837	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:121209837delA	uc003yox.2	+						COL14A1_uc003yoy.2_Intron|COL14A1_uc010mde.1_Intron	NM_021110	NP_066933			collagen, type XIV, alpha 1 precursor						cell-cell adhesion|collagen fibril organization	collagen type XIV|extracellular space	collagen binding|extracellular matrix structural constituent|protein binding, bridging			ovary(4)|kidney(4)|skin(2)|pancreas(1)|central_nervous_system(1)	12	Lung NSC(37;6.52e-07)|Ovarian(258;0.00769)|Hepatocellular(40;0.161)		OV - Ovarian serous cystadenocarcinoma(1;6.47e-38)|STAD - Stomach adenocarcinoma(47;0.00503)															---	---	---	---
HAS2	3037	broad.mit.edu	37	8	122640781	122640781	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:122640781delT	uc003yph.2	-							NM_005328	NP_005319			hyaluronan synthase 2							integral to plasma membrane	hyaluronan synthase activity		HAS2/PLAG1(10)	soft_tissue(10)|ovary(5)	15	Lung NSC(37;3.12e-08)|Ovarian(258;0.0254)|Hepatocellular(40;0.0997)|all_neural(195;0.142)		STAD - Stomach adenocarcinoma(47;0.00503)															---	---	---	---
ASAP1	50807	broad.mit.edu	37	8	131140419	131140419	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:131140419delA	uc003yta.1	-						ASAP1_uc003ysz.1_Intron|ASAP1_uc011liw.1_Intron	NM_018482	NP_060952			development and differentiation enhancing factor						cilium morphogenesis|filopodium assembly|regulation of ARF GTPase activity|signal transduction	cytoplasm|membrane	ARF GTPase activator activity|cytoskeletal adaptor activity|SH3 domain binding|zinc ion binding			ovary(4)	4																		---	---	---	---
ASAP1	50807	broad.mit.edu	37	8	131227156	131227156	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:131227156delT	uc003yta.1	-						ASAP1_uc011liw.1_Intron	NM_018482	NP_060952			development and differentiation enhancing factor						cilium morphogenesis|filopodium assembly|regulation of ARF GTPase activity|signal transduction	cytoplasm|membrane	ARF GTPase activator activity|cytoskeletal adaptor activity|SH3 domain binding|zinc ion binding			ovary(4)	4																		---	---	---	---
TMEM71	137835	broad.mit.edu	37	8	133770870	133770870	+	Intron	DEL	T	-	-	rs11334814		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:133770870delT	uc003ytp.2	-						TMEM71_uc003ytn.2_Intron|TMEM71_uc003yto.2_Intron	NM_144649	NP_653250			transmembrane protein 71 isoform 1							integral to membrane				ovary(2)	2	all_neural(3;2.72e-06)|Medulloblastoma(3;7.08e-05)|Ovarian(258;0.00438)|Esophageal squamous(12;0.00507)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;4.46e-05)															---	---	---	---
NDRG1	10397	broad.mit.edu	37	8	134262922	134262922	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:134262922delA	uc003yuh.2	-						NDRG1_uc003yuf.1_Intron|NDRG1_uc003yug.2_Intron|NDRG1_uc010mee.2_Intron|NDRG1_uc010mef.2_Intron|NDRG1_uc011ljh.1_Intron|NDRG1_uc011lji.1_Intron	NM_001135242	NP_001128714			N-myc downstream regulated 1						cellular response to hypoxia|response to metal ion	cytoplasm|microtubule cytoskeleton|nucleus|plasma membrane	protein binding			ovary(4)	4	all_epithelial(106;4.26e-24)|Lung NSC(106;7.26e-07)|all_lung(105;2.77e-06)|Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0107)															---	---	---	---
COL22A1	169044	broad.mit.edu	37	8	139658944	139658944	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139658944delA	uc003yvd.2	-						COL22A1_uc011ljo.1_Intron	NM_152888	NP_690848			collagen, type XXII, alpha 1						cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)												HNSCC(7;0.00092)			---	---	---	---
LY6H	4062	broad.mit.edu	37	8	144240077	144240077	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144240077delG	uc011lka.1	-						LY6H_uc011lkb.1_Intron|LY6H_uc003yxt.2_Intron|LY6H_uc011lkc.1_Intron	NM_002347	NP_002338			lymphocyte antigen 6 complex, locus H isoform a						nervous system development|organ morphogenesis	anchored to membrane|plasma membrane					0	all_cancers(97;6.49e-11)|all_epithelial(106;2.77e-09)|Lung NSC(106;0.000167)|all_lung(105;0.000459)|Ovarian(258;0.0254)|Acute lymphoblastic leukemia(118;0.155)																	---	---	---	---
PARP10	84875	broad.mit.edu	37	8	145059434	145059434	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145059434delG	uc003zal.3	-	5	844	c.736delC	c.(736-738)CACfs	p.H246fs	PARP10_uc003zak.3_5'UTR|PARP10_uc011lku.1_Frame_Shift_Del_p.H258fs|PARP10_uc011lkv.1_RNA|PARP10_uc003zam.2_Frame_Shift_Del_p.H246fs|PARP10_uc010mfn.1_Frame_Shift_Del_p.H161fs|PARP10_uc010mfo.1_3'UTR	NM_032789	NP_116178	Q53GL7	PAR10_HUMAN	poly (ADP-ribose) polymerase family, member 10	246						Golgi apparatus|nucleolus	NAD+ ADP-ribosyltransferase activity|nucleotide binding			ovary(2)|upper_aerodigestive_tract(1)|lung(1)|breast(1)|pancreas(1)	6	all_cancers(97;8.2e-11)|all_epithelial(106;1.1e-09)|Lung NSC(106;5.89e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.31e-40)|Epithelial(56;1.16e-39)|all cancers(56;6.43e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)															---	---	---	---
SMARCA2	6595	broad.mit.edu	37	9	2161562	2161562	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:2161562delT	uc003zhc.2	+						SMARCA2_uc003zhd.2_Intron|SMARCA2_uc010mha.2_Intron|SMARCA2_uc011llw.1_Intron|SMARCA2_uc003zhf.2_Intron|SMARCA2_uc011llx.1_Intron|SMARCA2_uc003zhe.2_Intron|SMARCA2_uc003zhg.2_Intron|SMARCA2_uc010mhb.2_Intron	NM_003070	NP_003061			SWI/SNF-related matrix-associated						chromatin remodeling|negative regulation of cell growth|negative regulation of transcription from RNA polymerase II promoter|nervous system development	intermediate filament cytoskeleton|nBAF complex|npBAF complex|nuclear chromatin|nucleoplasm|SWI/SNF complex|WINAC complex	ATP binding|DNA-dependent ATPase activity|helicase activity|protein binding|RNA polymerase II transcription coactivator activity|transcription regulatory region DNA binding			ovary(2)|central_nervous_system(1)	3		all_lung(10;2.06e-09)|Lung NSC(10;2.43e-09)		GBM - Glioblastoma multiforme(50;0.0475)														---	---	---	---
JAK2	3717	broad.mit.edu	37	9	5126454	5126454	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:5126454delT	uc010mhm.2	+						JAK2_uc003ziw.2_Intron	NM_004972	NP_004963			Janus kinase 2						actin filament polymerization|activation of caspase activity by protein phosphorylation|activation of JAK2 kinase activity|blood coagulation|cellular component movement|erythrocyte differentiation|interferon-gamma-mediated signaling pathway|interleukin-12-mediated signaling pathway|JAK-STAT cascade involved in growth hormone signaling pathway|mammary gland epithelium development|mesoderm development|negative regulation of cell proliferation|negative regulation of DNA binding|positive regulation of apoptosis|positive regulation of cell-substrate adhesion|positive regulation of growth hormone receptor signaling pathway|positive regulation of nitric-oxide synthase 2 biosynthetic process|positive regulation of phosphatidylinositol 3-kinase cascade|positive regulation of tumor necrosis factor production|positive regulation of tyrosine phosphorylation of Stat3 protein|positive regulation of tyrosine phosphorylation of Stat5 protein|protein autophosphorylation|regulation of inflammatory response|regulation of interferon-gamma-mediated signaling pathway|response to antibiotic|response to lipopolysaccharide|STAT protein import into nucleus|tumor necrosis factor-mediated signaling pathway|tyrosine phosphorylation of STAT protein	caveola|cytoskeleton|cytosol|endomembrane system|nucleus	ATP binding|growth hormone receptor binding|heme binding|histone binding|histone kinase activity (H3-Y41 specific)|interleukin-12 receptor binding|non-membrane spanning protein tyrosine kinase activity|protein kinase binding|SH2 domain binding		PCM1/JAK2(30)|PAX5/JAK2(18)|ETV6/JAK2(11)|BCR/JAK2(6)|SSBP2/JAK2(4)|SEC31A/JAK2(4)	haematopoietic_and_lymphoid_tissue(28629)|lung(5)|breast(5)|ovary(1)|liver(1)	28641	all_hematologic(13;0.137)	Acute lymphoblastic leukemia(23;0.0198)|Breast(48;0.147)		GBM - Glioblastoma multiforme(50;0.0237)|Lung(218;0.133)			1	T|Mis|O	ETV6|PCM1|BCR	ALL|AML|MPD| CML				Polycythemia_Vera_Familial				---	---	---	---
Unknown	0	broad.mit.edu	37	9	5311805	5311805	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:5311805delT								RLN2 (7225 upstream) : RLN1 (23164 downstream)																																			---	---	---	---
C9orf46	55848	broad.mit.edu	37	9	5432077	5432078	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:5432077_5432078delAA	uc003zjc.2	-						C9orf46_uc003zjd.2_Intron	NM_018465	NP_060935			hypothetical protein LOC55848							integral to membrane				ovary(1)	1	all_hematologic(13;0.158)	Acute lymphoblastic leukemia(23;0.154)		GBM - Glioblastoma multiforme(50;0.00106)|Lung(218;0.125)														---	---	---	---
PTPRD	5789	broad.mit.edu	37	9	8331407	8331416	+	Intron	DEL	TTATTTTCAC	-	-	rs10976963		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:8331407_8331416delTTATTTTCAC	uc003zkk.2	-						PTPRD_uc003zkp.2_Intron|PTPRD_uc003zkq.2_Intron|PTPRD_uc003zkr.2_Intron|PTPRD_uc003zks.2_Intron|PTPRD_uc003zkl.2_Intron|PTPRD_uc003zkm.2_Intron|PTPRD_uc003zkn.2_Intron|PTPRD_uc003zko.2_Intron	NM_002839	NP_002830			protein tyrosine phosphatase, receptor type, D						transmembrane receptor protein tyrosine phosphatase signaling pathway	integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			lung(14)|large_intestine(3)|ovary(2)|breast(2)|urinary_tract(1)	22		all_cancers(3;3.38e-95)|all_epithelial(3;2.84e-91)|all_lung(3;7.3e-56)|Lung NSC(3;1.82e-52)|Renal(3;3.42e-19)|all_hematologic(3;0.000134)|all_neural(3;0.00409)|Acute lymphoblastic leukemia(23;0.0069)|Melanoma(3;0.0121)|Myeloproliferative disorder(4;0.0122)|Medulloblastoma(3;0.0144)|Lung SC(3;0.0301)|Ovarian(56;0.0694)|Hepatocellular(3;0.0824)		all cancers(1;3.38e-12)|Epithelial(1;2.12e-09)|STAD - Stomach adenocarcinoma(1;1.29e-07)|KIRC - Kidney renal clear cell carcinoma(3;5.49e-07)|Kidney(3;6.36e-07)|GBM - Glioblastoma multiforme(50;9.05e-05)|Lung(1;0.000189)|BRCA - Breast invasive adenocarcinoma(1;0.00178)|LUSC - Lung squamous cell carcinoma(1;0.0115)|LUAD - Lung adenocarcinoma(58;0.119)											TSP Lung(15;0.13)			---	---	---	---
FREM1	158326	broad.mit.edu	37	9	14759696	14759696	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:14759696delA	uc003zlm.2	-						FREM1_uc010mic.2_Intron|FREM1_uc003zlk.2_Intron|FREM1_uc003zll.2_Intron	NM_144966	NP_659403			FRAS1 related extracellular matrix 1 precursor						cell communication|multicellular organismal development	basement membrane|integral to membrane	metal ion binding|sugar binding			ovary(2)|breast(2)|pancreas(1)	5				GBM - Glioblastoma multiforme(50;3.53e-06)														---	---	---	---
TTC39B	158219	broad.mit.edu	37	9	15268145	15268145	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:15268145delT	uc003zlr.1	-						TTC39B_uc010mie.1_Intron|TTC39B_uc011lmq.1_Intron|TTC39B_uc011lmr.1_Intron|TTC39B_uc010mif.1_Intron|TTC39B_uc010mig.1_Intron|TTC39B_uc011lms.1_Intron	NM_152574	NP_689787			tetratricopeptide repeat domain 39B								binding			ovary(1)	1																		---	---	---	---
CNTLN	54875	broad.mit.edu	37	9	17388406	17388406	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:17388406delA	uc003zmz.2	+						CNTLN_uc003zmy.2_Intron|CNTLN_uc010mio.2_Intron	NM_017738	NP_060208			centlein isoform 1							centriole|membrane	two-component sensor activity			pancreas(1)	1				GBM - Glioblastoma multiforme(50;6.14e-10)														---	---	---	---
HAUS6	54801	broad.mit.edu	37	9	19082749	19082750	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:19082749_19082750insA	uc003znk.2	-						HAUS6_uc011lmz.1_Intron|HAUS6_uc003znl.1_Intron|HAUS6_uc003znm.1_Intron	NM_017645	NP_060115			HAUS augmin-like complex, subunit 6						cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|nucleus|spindle				ovary(2)	2																		---	---	---	---
MLLT3	4300	broad.mit.edu	37	9	20622309	20622310	+	5'UTR	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:20622309_20622310insC	uc003zoe.2	-	1					MLLT3_uc011lne.1_5'Flank|MLLT3_uc011lnf.1_5'Flank|MLLT3_uc003zof.2_5'UTR|MLLT3_uc011lng.1_5'Flank	NM_004529	NP_004520			myeloid/lymphoid or mixed-lineage leukemia						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding			lung(2)|ovary(1)	3				GBM - Glioblastoma multiforme(3;4.35e-105)|Lung(42;3.48e-06)|LUSC - Lung squamous cell carcinoma(42;7.92e-05)				T	MLL	ALL								---	---	---	---
Unknown	0	broad.mit.edu	37	9	39817161	39817161	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:39817161delA								LOC653501 (308273 upstream) : FAM74A1 (83039 downstream)																																			---	---	---	---
PIP5K1B	8395	broad.mit.edu	37	9	71534333	71534333	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:71534333delT	uc004agu.2	+						PIP5K1B_uc011lrq.1_Intron|PIP5K1B_uc004agv.2_Intron	NM_003558	NP_003549			phosphatidylinositol-4-phosphate 5-kinase, type							endomembrane system|membrane|uropod	1-phosphatidylinositol-4-phosphate 5-kinase activity|ATP binding|protein binding			stomach(1)	1				Lung(182;0.133)														---	---	---	---
TMC1	117531	broad.mit.edu	37	9	75430881	75430881	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:75430881delA	uc004aiz.1	+						TMC1_uc010moz.1_Intron|TMC1_uc004aja.1_Intron|TMC1_uc004ajb.1_Intron|TMC1_uc004ajc.1_Intron|TMC1_uc010mpa.1_Intron	NM_138691	NP_619636			transmembrane channel-like 1						sensory perception of sound	integral to membrane				ovary(1)	1																		---	---	---	---
PCSK5	5125	broad.mit.edu	37	9	78803332	78803333	+	Intron	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:78803332_78803333insG	uc004ajz.2	+						PCSK5_uc004aka.2_Intron|PCSK5_uc004akb.2_Intron	NM_006200	NP_006191			proprotein convertase subtilisin/kexin type 5						anterior/posterior pattern formation|cell-cell signaling|cytokine biosynthetic process|embryo implantation|embryonic digestive tract development|embryonic skeletal system development|heart development|kidney development|limb morphogenesis|nerve growth factor processing|nerve growth factor receptor signaling pathway|peptide biosynthetic process|renin secretion into blood stream|respiratory tube development|signal peptide processing|viral assembly, maturation, egress, and release	extracellular space|Golgi lumen|stored secretory granule	peptide binding|serine-type endopeptidase activity			ovary(2)|skin(1)	3																		---	---	---	---
PSAT1	29968	broad.mit.edu	37	9	80920988	80920989	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:80920988_80920989insT	uc004ala.2	+						PSAT1_uc004alb.2_Intron	NM_058179	NP_478059			phosphoserine aminotransferase 1 isoform 1						L-serine biosynthetic process|pyridoxine biosynthetic process		O-phospho-L-serine:2-oxoglutarate aminotransferase activity|pyridoxal phosphate binding			ovary(1)	1					L-Glutamic Acid(DB00142)|Pyridoxal Phosphate(DB00114)|Pyridoxine(DB00165)													---	---	---	---
NAA35	60560	broad.mit.edu	37	9	88618680	88618680	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88618680delT	uc004aoi.3	+						NAA35_uc004aoj.3_Intron	NM_024635	NP_078911			corneal wound healing-related protein						smooth muscle cell proliferation	cytoplasm|nucleus|plasma membrane				skin(2)|central_nervous_system(1)	3																		---	---	---	---
GOLM1	51280	broad.mit.edu	37	9	88667264	88667264	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88667264delT	uc004aol.2	-						GOLM1_uc010mqd.1_Intron|GOLM1_uc004aom.2_Intron	NM_016548	NP_057632			golgi membrane protein 1							Golgi apparatus|integral to plasma membrane					0																		---	---	---	---
C9orf153	389766	broad.mit.edu	37	9	88842231	88842234	+	3'UTR	DEL	TTTA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88842231_88842234delTTTA	uc004aoo.2	-	4					GOLM1_uc010mqd.1_Intron|C9orf153_uc004aon.2_Intron	NM_001010907	NP_001010907			hypothetical protein LOC389766												0																		---	---	---	---
ZCCHC6	79670	broad.mit.edu	37	9	88919729	88919729	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88919729delT	uc004aoq.2	-						ZCCHC6_uc010mqe.2_Intron|ZCCHC6_uc011ltf.1_Intron|ZCCHC6_uc004aor.2_Intron|ZCCHC6_uc004aos.2_Intron|ZCCHC6_uc004aot.2_Intron|ZCCHC6_uc004aou.2_Intron	NM_024617	NP_078893			zinc finger, CCHC domain containing 6						RNA 3'-end processing		nucleic acid binding|RNA uridylyltransferase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	9	93513664	93513665	+	IGR	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:93513664_93513665insG								DIRAS2 (108556 upstream) : SYK (50347 downstream)																																			---	---	---	---
IARS	3376	broad.mit.edu	37	9	95003101	95003101	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95003101delA	uc004art.1	-						IARS_uc004ars.1_Intron|IARS_uc004aru.3_Intron|IARS_uc010mqr.2_Intron|IARS_uc010mqt.2_Intron	NM_013417	NP_038203			isoleucine tRNA synthetase						isoleucyl-tRNA aminoacylation	cytosol|nucleus|soluble fraction	ATP binding|isoleucine-tRNA ligase activity|protein binding			ovary(1)|skin(1)	2					L-Isoleucine(DB00167)													---	---	---	---
FAM120A	23196	broad.mit.edu	37	9	96261004	96261004	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96261004delA	uc004atw.2	+						FAM120A_uc004atv.2_Intron|FAM120A_uc004atx.2_Intron|FAM120A_uc004aty.2_Intron	NM_014612	NP_055427			oxidative stress-associated Src activator							cytoplasm|plasma membrane	RNA binding				0																		---	---	---	---
PHF2	5253	broad.mit.edu	37	9	96422612	96422612	+	Frame_Shift_Del	DEL	A	-	-	rs76832193		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96422612delA	uc004aub.2	+	12	1615	c.1468delA	c.(1468-1470)AAAfs	p.K490fs	PHF2_uc011lug.1_Frame_Shift_Del_p.K373fs|PHF2_uc004auc.2_5'Flank	NM_005392	NP_005383	O75151	PHF2_HUMAN	PHD finger protein 2	490	Pro-rich.|Lys-rich.				liver development|negative regulation of chromatin silencing at rDNA|transcription, DNA-dependent	nucleolus	histone demethylase activity (H3-K9 specific)|iron ion binding|methylated histone residue binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|zinc ion binding			ovary(1)	1		Myeloproliferative disorder(762;0.0255)		OV - Ovarian serous cystadenocarcinoma(323;9.11e-28)														---	---	---	---
PHF2	5253	broad.mit.edu	37	9	96437140	96437140	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96437140delC	uc004aub.2	+						PHF2_uc011lug.1_Intron|PHF2_uc004auc.2_Intron	NM_005392	NP_005383			PHD finger protein 2						liver development|negative regulation of chromatin silencing at rDNA|transcription, DNA-dependent	nucleolus	histone demethylase activity (H3-K9 specific)|iron ion binding|methylated histone residue binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|zinc ion binding			ovary(1)	1		Myeloproliferative disorder(762;0.0255)		OV - Ovarian serous cystadenocarcinoma(323;9.11e-28)														---	---	---	---
Unknown	0	broad.mit.edu	37	9	97097144	97097145	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:97097144_97097145delTT	uc004auq.1	+											Homo sapiens cDNA FLJ37869 fis, clone BRSSN2017422.																														---	---	---	---
NCBP1	4686	broad.mit.edu	37	9	100433247	100433247	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:100433247delT	uc004axq.2	+							NM_002486	NP_002477			nuclear cap binding protein subunit 1, 80kDa						gene silencing by RNA|histone mRNA metabolic process|mRNA 3'-end processing|mRNA capping|mRNA cleavage|mRNA export from nucleus|ncRNA metabolic process|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|positive regulation of mRNA 3'-end processing|positive regulation of viral transcription|regulation of translational initiation|spliceosomal snRNP assembly|termination of RNA polymerase II transcription|transcription elongation from RNA polymerase II promoter|viral reproduction	cytosol|mRNA cap binding complex|nucleoplasm|ribonucleoprotein complex	protein binding|RNA cap binding			central_nervous_system(1)	1		Acute lymphoblastic leukemia(62;0.158)																---	---	---	---
XPA	7507	broad.mit.edu	37	9	100447080	100447080	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:100447080delT	uc004axr.3	-						XPA_uc004axs.3_Intron	NM_000380	NP_000371			xeroderma pigmentosum, complementation group A						nucleotide-excision repair, DNA damage removal	nucleoplasm	damaged DNA binding|metal ion binding|nucleotide binding|protein domain specific binding|protein homodimerization activity			breast(1)	1		Acute lymphoblastic leukemia(62;0.158)						Mis|N|F|S			skin basal cell|skin squamous cell|melanoma		NER	Xeroderma_Pigmentosum				---	---	---	---
ERP44	23071	broad.mit.edu	37	9	102822308	102822308	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:102822308delT	uc004bam.2	-						ERP44_uc010msy.2_Intron|ERP44_uc010msz.2_Intron	NM_015051	NP_055866			thioredoxin domain containing 4 (endoplasmic						cell redox homeostasis|glycoprotein metabolic process|protein folding|response to unfolded protein	endoplasmic reticulum lumen|endoplasmic reticulum membrane|ER-Golgi intermediate compartment	protein binding|protein disulfide isomerase activity				0																		---	---	---	---
RAD23B	5887	broad.mit.edu	37	9	110081279	110081279	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:110081279delT	uc004bde.2	+						RAD23B_uc011lwa.1_Intron|RAD23B_uc011lwb.1_Intron	NM_002874	NP_002865			UV excision repair protein RAD23 homolog B						nucleotide-excision repair, DNA damage recognition|nucleotide-excision repair, DNA damage removal|proteasomal ubiquitin-dependent protein catabolic process|regulation of proteasomal ubiquitin-dependent protein catabolic process	cytoplasm|nucleoplasm|proteasome complex|XPC complex	damaged DNA binding|polyubiquitin binding|single-stranded DNA binding			ovary(1)	1													Direct_reversal_of_damage|NER					---	---	---	---
PALM2-AKAP2	445815	broad.mit.edu	37	9	112704882	112704882	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:112704882delT	uc004bei.2	+						PALM2_uc004bef.2_Intron|PALM2_uc004beg.2_Intron|PALM2_uc004beh.3_Intron|PALM2-AKAP2_uc004bek.3_Intron|PALM2-AKAP2_uc004bej.3_Intron|PALM2-AKAP2_uc004bel.1_Intron	NM_001136562	NP_001130034			A kinase (PRKA) anchor protein 2 isoform 2								enzyme binding			ovary(3)|central_nervous_system(2)|skin(1)	6																		---	---	---	---
SUSD1	64420	broad.mit.edu	37	9	114814529	114814529	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:114814529delT	uc004bfu.2	-						SUSD1_uc010mui.2_Intron|SUSD1_uc010muj.2_Intron	NM_022486	NP_071931			sushi domain containing 1 precursor							integral to membrane	calcium ion binding				0																		---	---	---	---
RAB14	51552	broad.mit.edu	37	9	123943560	123943561	+	3'UTR	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:123943560_123943561insT	uc004blc.2	-	8						NM_016322	NP_057406			GTPase Rab14						embryo development|fibroblast growth factor receptor signaling pathway|Golgi to endosome transport|neurotransmitter secretion|protein transport|small GTPase mediated signal transduction	cytosol|early endosome membrane|Golgi membrane|Golgi stack|late endosome|lysosome|membrane fraction|nuclear outer membrane-endoplasmic reticulum membrane network|perinuclear region of cytoplasm|rough endoplasmic reticulum|trans-Golgi network transport vesicle	GDP binding|GTP binding|GTPase activity				0																		---	---	---	---
GAPVD1	26130	broad.mit.edu	37	9	128099158	128099158	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:128099158delT	uc010mwx.2	+						GAPVD1_uc011lzs.1_Intron|GAPVD1_uc004bpp.2_Intron|GAPVD1_uc004bpq.2_Intron|GAPVD1_uc004bpr.2_Intron|GAPVD1_uc004bps.2_Intron|GAPVD1_uc010mwy.1_Intron	NM_015635	NP_056450			GTPase activating protein and VPS9 domains 1						endocytosis|regulation of protein transport|regulation of small GTPase mediated signal transduction|signal transduction	cytosol|endosome|membrane	GTPase activating protein binding|GTPase activator activity|guanyl-nucleotide exchange factor activity			ovary(2)|central_nervous_system(1)|skin(1)	4																		---	---	---	---
MAPKAP1	79109	broad.mit.edu	37	9	128414242	128414242	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:128414242delT	uc004bpv.2	-						MAPKAP1_uc011lzu.1_5'Flank|MAPKAP1_uc011lzv.1_Intron|MAPKAP1_uc004bpw.2_Intron|MAPKAP1_uc004bpx.2_Intron|MAPKAP1_uc004bpy.2_Intron|MAPKAP1_uc004bpz.2_Intron|MAPKAP1_uc010mxa.2_Intron|MAPKAP1_uc010mxb.1_5'Flank|MAPKAP1_uc004bqa.2_Intron|MAPKAP1_uc010mxc.1_Intron	NM_001006617	NP_001006618			mitogen-activated protein kinase associated						nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|response to stress|T cell costimulation	cytoplasmic membrane-bounded vesicle|cytosol|nucleus|plasma membrane	Ras GTPase binding			ovary(2)|lung(2)	4																		---	---	---	---
RPL12	6136	broad.mit.edu	37	9	130211848	130211848	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130211848delC	uc004bqy.1	-						RPL12_uc004bqx.1_Intron|RPL12_uc004bqz.1_Intron|SNORA65_uc004bra.1_5'Flank|LRSAM1_uc004brb.1_5'Flank|LRSAM1_uc010mxk.1_5'Flank|LRSAM1_uc004brc.1_5'Flank|LRSAM1_uc004brd.1_5'Flank	NM_000976	NP_000967			ribosomal protein L12						endocrine pancreas development|translational elongation|translational termination|viral transcription	cytosol|ribosome	RNA binding|structural constituent of ribosome				0																		---	---	---	---
CCBL1	883	broad.mit.edu	37	9	131597418	131597418	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131597418delA	uc004bwh.2	-						CCBL1_uc004bwf.2_Intron|CCBL1_uc004bwg.2_Intron|CCBL1_uc010myn.2_Intron|CCBL1_uc004bwj.2_Intron|CCBL1_uc011mbl.1_Intron|CCBL1_uc004bwi.2_Intron|CCBL1_uc010myo.2_Intron	NM_004059	NP_004050			kynurenine aminotransferase I isoform a						kynurenine metabolic process|L-phenylalanine catabolic process|tryptophan catabolic process	cytosol|nucleus	1-aminocyclopropane-1-carboxylate synthase activity|cysteine-S-conjugate beta-lyase activity|glutamine-phenylpyruvate transaminase activity|kynurenine-oxoglutarate transaminase activity|L-glutamine:pyruvate aminotransferase activity|L-phenylalanine:pyruvate aminotransferase activity|protein homodimerization activity|pyridoxal phosphate binding			ovary(1)	1					L-Glutamine(DB00130)|Pyridoxal Phosphate(DB00114)													---	---	---	---
SH3GLB2	56904	broad.mit.edu	37	9	131783293	131783293	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131783293delA	uc004bwv.2	-						SH3GLB2_uc004bww.2_Intron|SH3GLB2_uc004bwx.1_Intron|SH3GLB2_uc011mbm.1_Intron	NM_020145	NP_064530			SH3-domain GRB2-like endophilin B2						filopodium assembly|signal transduction	cytoplasm|nucleus	cytoskeletal adaptor activity|SH3 domain binding				0																		---	---	---	---
LAMC3	10319	broad.mit.edu	37	9	133928189	133928189	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:133928189delC	uc004caa.1	+							NM_006059	NP_006050			laminin, gamma 3 precursor						cell adhesion	basement membrane|membrane	structural molecule activity			ovary(2)|pancreas(1)	3	all_hematologic(7;0.0028)	Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;5.06e-05)|Epithelial(140;0.000551)												OREG0019556	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
TTF1	7270	broad.mit.edu	37	9	135276754	135276754	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135276754delA	uc004cbl.2	-						TTF1_uc011mcp.1_Intron|TTF1_uc004cbm.2_Intron	NM_007344	NP_031370			transcription termination factor, RNA polymerase						negative regulation of DNA replication|regulation of transcription, DNA-dependent|termination of RNA polymerase I transcription	nucleolus|nucleoplasm	DNA binding			ovary(2)|upper_aerodigestive_tract(1)|pancreas(1)	4		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;4.25e-06)|Epithelial(140;9.09e-05)														---	---	---	---
TSC1	7248	broad.mit.edu	37	9	135785689	135785691	+	Intron	DEL	AAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135785689_135785691delAAA	uc004cca.2	-						TSC1_uc004ccb.3_Intron|TSC1_uc011mcq.1_Intron|TSC1_uc011mcr.1_Intron|TSC1_uc011mcs.1_Intron|TSC1_uc004ccc.1_3'UTR	NM_000368	NP_000359			tuberous sclerosis 1 protein isoform 1						activation of Rho GTPase activity|cell cycle arrest|cell-matrix adhesion|insulin receptor signaling pathway|negative regulation of cell proliferation|negative regulation of protein ubiquitination|negative regulation of TOR signaling cascade|negative regulation of translation|positive regulation of focal adhesion assembly|regulation of phosphoprotein phosphatase activity|regulation of stress fiber assembly|rRNA export from nucleus	cell cortex|lamellipodium|membrane|TSC1-TSC2 complex	chaperone binding|protein N-terminus binding	p.?(1)		lung(4)|central_nervous_system(3)|breast(2)|haematopoietic_and_lymphoid_tissue(1)|urinary_tract(1)|skin(1)|ovary(1)|bone(1)	14				OV - Ovarian serous cystadenocarcinoma(145;4.32e-08)|Epithelial(140;2.72e-06)				D|Mis|N|F|S			hamartoma|renal cell			Tuberous_Sclerosis				---	---	---	---
CEL	1056	broad.mit.edu	37	9	135939742	135939742	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135939742delG	uc010naa.1	+							NM_001807	NP_001798			carboxyl ester lipase precursor						cholesterol catabolic process|fatty acid catabolic process|intestinal cholesterol absorption|intestinal lipid catabolic process|pancreatic juice secretion|protein esterification	cytosol|extracellular space	acylglycerol lipase activity|carboxylesterase activity|heparin binding|sterol esterase activity|triglyceride lipase activity			pancreas(1)	1				OV - Ovarian serous cystadenocarcinoma(145;1.03e-40)|Epithelial(140;3.58e-37)|GBM - Glioblastoma multiforme(294;0.00164)|READ - Rectum adenocarcinoma(205;0.196)														---	---	---	---
REXO4	57109	broad.mit.edu	37	9	136272788	136272789	+	Intron	DEL	TT	-	-	rs35694504		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136272788_136272789delTT	uc004cdm.2	-						REXO4_uc011mde.1_Intron|REXO4_uc011mdf.1_Intron|REXO4_uc004cdn.2_Intron|REXO4_uc004cdo.2_Intron	NM_020385	NP_065118			XPMC2 prevents mitotic catastrophe 2 homolog							nucleolus	exonuclease activity|nucleic acid binding|sequence-specific DNA binding transcription factor activity				0				OV - Ovarian serous cystadenocarcinoma(145;8.58e-08)|Epithelial(140;9.55e-07)|all cancers(34;1.05e-05)												OREG0019587	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
KCNT1	57582	broad.mit.edu	37	9	138648984	138648984	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:138648984delC	uc011mdq.1	+						KCNT1_uc011mdr.1_Intron|KCNT1_uc010nbf.2_Intron|KCNT1_uc004cgo.1_Intron	NM_020822	NP_065873			potassium channel, subfamily T, member 1							membrane	binding|calcium-activated potassium channel activity			large_intestine(2)|ovary(1)|pancreas(1)	4		Myeloproliferative disorder(178;0.0821)		OV - Ovarian serous cystadenocarcinoma(145;2.11e-07)|Epithelial(140;1.57e-06)|all cancers(34;9.22e-05)														---	---	---	---
C9orf173	441476	broad.mit.edu	37	9	140146299	140146300	+	Frame_Shift_Ins	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140146299_140146300insC	uc004cmk.1	+	2	229_230	c.217_218insC	c.(217-219)ACCfs	p.T73fs	C9orf173_uc004cmj.1_Frame_Shift_Ins_p.T74fs|C9orf173_uc011meu.1_RNA|C9orf173_uc010ncd.1_RNA|C9orf173_uc011mev.1_Frame_Shift_Ins_p.T73fs|C9orf173_uc004cml.1_Frame_Shift_Ins_p.T73fs			Q8N7X2	CI173_HUMAN	SubName: Full=LOC441476 protein;	74										pancreas(1)	1																		---	---	---	---
LARP4B	23185	broad.mit.edu	37	10	890939	890939	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:890939delT	uc001ifs.1	-	5	528	c.487delA	c.(487-489)ACAfs	p.T163fs		NM_015155	NP_055970	Q92615	LAR4B_HUMAN	La ribonucleoprotein domain family, member 4B	163	HTH La-type RNA-binding.						nucleotide binding|RNA binding			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
NET1	10276	broad.mit.edu	37	10	5495005	5495005	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:5495005delT	uc001iia.2	+						NET1_uc010qar.1_Intron|NET1_uc001iib.2_Intron|NET1_uc010qas.1_Intron	NM_001047160	NP_001040625			neuroepithelial cell transforming gene 1 isoform						apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of cell growth|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|nucleus	Rho guanyl-nucleotide exchange factor activity			breast(1)	1																		---	---	---	---
PRPF18	8559	broad.mit.edu	37	10	13655956	13655956	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:13655956delT	uc001imp.2	+						PRPF18_uc001imq.2_Intron	NM_003675	NP_003666			PRP18 pre-mRNA processing factor 18 homolog						mRNA processing|RNA splicing	nuclear speck|spliceosomal complex				central_nervous_system(1)	1																		---	---	---	---
CUBN	8029	broad.mit.edu	37	10	16867091	16867091	+	Intron	DEL	A	-	-	rs76258142		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:16867091delA	uc001ioo.2	-							NM_001081	NP_001072			cubilin precursor						cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)													---	---	---	---
CUBN	8029	broad.mit.edu	37	10	16873086	16873086	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:16873086delA	uc001ioo.2	-							NM_001081	NP_001072			cubilin precursor						cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)													---	---	---	---
CACNB2	783	broad.mit.edu	37	10	18816363	18816363	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18816363delA	uc001ipr.2	+						CACNB2_uc009xjz.1_Intron|CACNB2_uc001ips.2_Intron|CACNB2_uc001ipt.2_Intron|CACNB2_uc010qcl.1_Intron|CACNB2_uc001ipu.2_Intron|CACNB2_uc001ipv.2_Intron|CACNB2_uc009xka.1_Intron|CACNB2_uc001ipw.2_Intron|CACNB2_uc001ipx.2_Intron|CACNB2_uc001ipz.2_Intron|CACNB2_uc001ipy.2_Intron|CACNB2_uc010qco.1_Intron|CACNB2_uc001iqa.2_Intron|NSUN6_uc001iqb.2_Intron	NM_201596	NP_963890			calcium channel, voltage-dependent, beta 2						axon guidance|neuromuscular junction development	integral to plasma membrane|sarcolemma|voltage-gated calcium channel complex	protein binding|voltage-gated calcium channel activity			large_intestine(1)|central_nervous_system(1)|skin(1)	3					Magnesium Sulfate(DB00653)|Verapamil(DB00661)													---	---	---	---
ARL5B	221079	broad.mit.edu	37	10	18964316	18964316	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18964316delT	uc001iqd.1	+	6					uc001iqe.2_5'Flank	NM_178815	NP_848930			ADP-ribosylation factor-like 8						small GTPase mediated signal transduction	intracellular	GTP binding			ovary(1)	1																		---	---	---	---
YME1L1	10730	broad.mit.edu	37	10	27434219	27434219	+	Intron	DEL	A	-	-	rs72362930		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:27434219delA	uc001iti.2	-						YME1L1_uc001itj.2_Intron|YME1L1_uc010qdl.1_Intron|YME1L1_uc009xkv.2_Intron	NM_139312	NP_647473			YME1-like 1 isoform 1						protein catabolic process|proteolysis	membrane|mitochondrion	ATP binding|metal ion binding|metalloendopeptidase activity|nucleoside-triphosphatase activity			ovary(1)	1																		---	---	---	---
MASTL	84930	broad.mit.edu	37	10	27470152	27470152	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:27470152delA	uc001itm.2	+						MASTL_uc001itl.2_Intron|MASTL_uc009xkw.1_Intron|MASTL_uc009xkx.1_Intron	NM_032844	NP_116233			microtubule associated serine/threonine						cell division|G2/M transition of mitotic cell cycle|mitosis|negative regulation of protein phosphatase type 2A activity|regulation of cell cycle|response to DNA damage stimulus	centrosome|cleavage furrow|nucleus	ATP binding|protein phosphatase 2A binding|protein serine/threonine kinase activity			stomach(1)|ovary(1)|lung(1)	3																		---	---	---	---
KIF5B	3799	broad.mit.edu	37	10	32307659	32307659	+	Intron	DEL	T	-	-	rs211377		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:32307659delT	uc001iwe.3	-							NM_004521	NP_004512			kinesin family member 5B						stress granule disassembly|vesicle transport along microtubule	kinesin complex|microtubule|perinuclear region of cytoplasm|vesicle	ATP binding|microtubule binding|microtubule motor activity		KIF5B/ALK(4)	lung(4)|ovary(1)	5		Prostate(175;0.0137)																---	---	---	---
Unknown	0	broad.mit.edu	37	10	35254677	35254677	+	IGR	DEL	T	-	-	rs150201909		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:35254677delT								PARD3 (150754 upstream) : CUL2 (44131 downstream)																																			---	---	---	---
ZNF37A	7587	broad.mit.edu	37	10	38385769	38385769	+	Intron	DEL	A	-	-	rs67793671		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:38385769delA	uc001izk.2	+						ZNF37A_uc001izl.2_Intron|ZNF37A_uc001izm.2_Intron	NM_001007094	NP_001007095			zinc finger protein 37a							nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			breast(1)	1																		---	---	---	---
LOC100133308	100133308	broad.mit.edu	37	10	45632590	45632591	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:45632590_45632591delTT	uc001jbz.2	-						LOC100133308_uc009xmq.1_Intron					Homo sapiens cDNA FLJ32851 fis, clone TESTI2003432.												0																		---	---	---	---
FAM21C	253725	broad.mit.edu	37	10	46238682	46238682	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:46238682delT	uc001jcu.2	+						FAM21C_uc001jcs.1_Intron|FAM21C_uc001jct.2_Intron|FAM21C_uc010qfi.1_Intron	NM_015262	NP_056077			hypothetical protein LOC253725											ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	10	48922840	48922841	+	IGR	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:48922840_48922841insC								FRMPD2L1 (59208 upstream) : FRMPD2 (441767 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	10	48980053	48980053	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:48980053delA	uc001jgc.1	+											full-length cDNA clone CS0DI009YC01 of Placenta Cot 25-normalized of Homo sapiens (human).																														---	---	---	---
C10orf72	196740	broad.mit.edu	37	10	50293937	50293937	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:50293937delA	uc001jhf.2	-							NM_001031746	NP_001026916			hypothetical protein LOC196740 isoform 1							integral to membrane|plasma membrane					0																		---	---	---	---
PCDH15	65217	broad.mit.edu	37	10	55663180	55663180	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55663180delA	uc001jju.1	-						PCDH15_uc010qhq.1_Intron|PCDH15_uc010qhr.1_Intron|PCDH15_uc010qhs.1_Intron|PCDH15_uc010qht.1_Intron|PCDH15_uc010qhu.1_Intron|PCDH15_uc001jjv.1_Intron|PCDH15_uc010qhv.1_Intron|PCDH15_uc010qhw.1_Intron|PCDH15_uc010qhx.1_Intron|PCDH15_uc010qhy.1_Intron|PCDH15_uc010qhz.1_Intron|PCDH15_uc010qia.1_Intron|PCDH15_uc010qib.1_Intron	NM_033056	NP_149045			protocadherin 15 isoform CD1-4 precursor						equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---
PCDH15	65217	broad.mit.edu	37	10	55721378	55721378	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55721378delA	uc001jju.1	-						PCDH15_uc010qhq.1_Intron|PCDH15_uc010qhr.1_Intron|PCDH15_uc010qhs.1_Intron|PCDH15_uc010qht.1_Intron|PCDH15_uc010qhu.1_Intron|PCDH15_uc001jjv.1_Intron|PCDH15_uc010qhv.1_Intron|PCDH15_uc010qhw.1_Intron|PCDH15_uc010qhx.1_Intron|PCDH15_uc010qhy.1_Intron|PCDH15_uc010qhz.1_Intron|PCDH15_uc010qia.1_Intron|PCDH15_uc010qib.1_Intron	NM_033056	NP_149045			protocadherin 15 isoform CD1-4 precursor						equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---
ANK3	288	broad.mit.edu	37	10	61824265	61824265	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:61824265delT	uc001jky.2	-						ANK3_uc001jkw.2_Intron|ANK3_uc009xpa.2_Intron|ANK3_uc001jkx.2_Intron|ANK3_uc010qih.1_Intron|ANK3_uc001jkz.3_Intron|ANK3_uc001jkv.2_Intron	NM_020987	NP_066267			ankyrin 3 isoform 1						establishment of protein localization|signal transduction	basolateral plasma membrane|cytoplasm|cytoskeleton	protein binding			skin(9)|ovary(6)|pancreas(2)|central_nervous_system(2)	19																		---	---	---	---
ZNF365	22891	broad.mit.edu	37	10	64159513	64159513	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64159513delA	uc001jly.3	+	5	1296	c.1234delA	c.(1234-1236)AAAfs	p.K412fs	ZNF365_uc001jmb.3_Intron|ZNF365_uc001jmc.2_Intron|ZNF365_uc001jlz.3_Frame_Shift_Del_p.K397fs|ZNF365_uc001jma.3_RNA	NM_014951	NP_055766	Q70YC4	TALAN_HUMAN	zinc finger protein 365 isoform A	Error:Variant_position_missing_in_Q70YC4_after_alignment										ovary(1)|skin(1)	2	Prostate(12;0.0297)|all_hematologic(501;0.228)																	---	---	---	---
SUPV3L1	6832	broad.mit.edu	37	10	70960397	70960397	+	Intron	DEL	A	-	-	rs35423280		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70960397delA	uc001jpe.1	+						SUPV3L1_uc010qjd.1_Intron	NM_003171	NP_003162			suppressor of var1, 3-like 1 precursor						DNA duplex unwinding	mitochondrial nucleoid|nucleus	ATP binding|DNA binding|DNA helicase activity|RNA binding			urinary_tract(1)|ovary(1)	2																		---	---	---	---
PPA1	5464	broad.mit.edu	37	10	71963161	71963161	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:71963161delT	uc001jqv.1	-							NM_021129	NP_066952			pyrophosphatase 1						diphosphate metabolic process|tRNA aminoacylation for protein translation	cytosol	inorganic diphosphatase activity|magnesium ion binding			breast(1)	1																		---	---	---	---
PCBD1	5092	broad.mit.edu	37	10	72644720	72644720	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72644720delT	uc001jrn.1	-							NM_000281	NP_000272			pterin-4 alpha-carbinolamine						L-phenylalanine catabolic process|regulation of transcription, DNA-dependent|tetrahydrobiopterin biosynthetic process|transcription, DNA-dependent	cytosol|nucleus	4-alpha-hydroxytetrahydrobiopterin dehydratase activity|identical protein binding|transcription coactivator activity				0																		---	---	---	---
OIT3	170392	broad.mit.edu	37	10	74653469	74653469	+	5'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:74653469delA	uc001jte.1	+	1					OIT3_uc009xqs.1_RNA	NM_152635	NP_689848			oncoprotein-induced transcript 3 precursor							nuclear envelope	calcium ion binding			ovary(2)	2	Prostate(51;0.0198)																	---	---	---	---
OIT3	170392	broad.mit.edu	37	10	74660043	74660043	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:74660043delC	uc001jte.1	+						OIT3_uc009xqs.1_Intron	NM_152635	NP_689848			oncoprotein-induced transcript 3 precursor							nuclear envelope	calcium ion binding			ovary(2)	2	Prostate(51;0.0198)																	---	---	---	---
AP3M1	26985	broad.mit.edu	37	10	75893990	75893990	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:75893990delA	uc001jwf.2	-						AP3M1_uc001jwg.2_Intron|AP3M1_uc001jwh.2_Intron|AP3M1_uc010qla.1_Intron	NM_207012	NP_996895			adaptor-related protein complex 3, mu 1 subunit						protein targeting to lysosome|vesicle-mediated transport	clathrin adaptor complex|Golgi apparatus|lysosome	protein binding				0	Prostate(51;0.0112)																	---	---	---	---
MYST4	23522	broad.mit.edu	37	10	76787932	76787932	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:76787932delT	uc001jwn.1	+						MYST4_uc001jwo.1_Intron|MYST4_uc001jwp.1_Intron	NM_012330	NP_036462			MYST histone acetyltransferase (monocytic						histone H3 acetylation|negative regulation of transcription, DNA-dependent|nucleosome assembly|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	MOZ/MORF histone acetyltransferase complex|nucleosome	DNA binding|histone acetyltransferase activity|transcription factor binding|zinc ion binding			central_nervous_system(5)|ovary(4)|lung(3)|breast(2)|skin(1)|prostate(1)	16	all_cancers(46;0.0347)|all_epithelial(25;0.00236)|Prostate(51;0.0112)|Ovarian(15;0.0964)							T	CREBBP	AML								---	---	---	---
MBL1P	8512	broad.mit.edu	37	10	81680656	81680656	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:81680656delA	uc001kbf.2	+						MBL1P_uc001kbg.1_RNA					Homo sapiens mannose-binding protein-A pseudogene (MBL1P1) mRNA sequence.												0																		---	---	---	---
DYDC1	143241	broad.mit.edu	37	10	82112110	82112111	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:82112110_82112111insT	uc001kbx.2	-						DYDC1_uc001kby.1_Intron|DYDC1_uc009xsr.1_Intron|DYDC2_uc001kbz.1_Intron|DYDC2_uc001kca.1_Intron	NM_138812	NP_620167			DPY30 domain containing 1												0			Colorectal(32;0.229)															---	---	---	---
FAM35A	54537	broad.mit.edu	37	10	88930220	88930220	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:88930220delT	uc001kei.3	+						FAM35A_uc001kej.3_Intron	NM_019054	NP_061927			hypothetical protein LOC54537											ovary(2)|skin(2)	4																		---	---	---	---
PANK1	53354	broad.mit.edu	37	10	91343951	91343951	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:91343951delA	uc001kgp.1	-	7					PANK1_uc001kgn.1_3'UTR|PANK1_uc001kgo.1_3'UTR|PANK1_uc009xtu.1_3'UTR	NM_148977	NP_683878			pantothenate kinase 1 isoform alpha						coenzyme A biosynthetic process|pantothenate metabolic process	cytosol|nucleus	ATP binding|pantothenate kinase activity				0					Bezafibrate(DB01393)													---	---	---	---
KIF20B	9585	broad.mit.edu	37	10	91497021	91497022	+	Intron	DEL	TT	-	-	rs72076248		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:91497021_91497022delTT	uc001kgs.1	+						KIF20B_uc001kgr.1_Intron|KIF20B_uc001kgt.1_Intron|KIF20B_uc009xtw.1_5'Flank	NM_016195	NP_057279			M-phase phosphoprotein 1						cell cycle arrest|cell division|microtubule-based movement|mitosis|regulation of mitosis	centrosome|microtubule|nucleolus|nucleoplasm|spindle	ATP binding|ATPase activity|microtubule motor activity|WW domain binding			ovary(1)|pancreas(1)|skin(1)	3																		---	---	---	---
IDE	3416	broad.mit.edu	37	10	94268091	94268091	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:94268091delA	uc001kia.2	-							NM_004969	NP_004960			insulin-degrading enzyme isoform 1 precursor						beta-amyloid metabolic process|bradykinin catabolic process|interspecies interaction between organisms|sex differentiation	cell surface|extracellular space|soluble fraction	ATP binding|metalloendopeptidase activity|protein homodimerization activity|signal transducer activity|zinc ion binding			ovary(2)|central_nervous_system(1)	3					Bacitracin(DB00626)|Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)													---	---	---	---
NOC3L	64318	broad.mit.edu	37	10	96109219	96109219	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96109219delG	uc001kjq.1	-						NOC3L_uc009xuk.1_Intron	NM_022451	NP_071896			nucleolar complex associated 3 homolog							nuclear speck|nucleolus	binding			ovary(1)	1		Colorectal(252;0.0897)																---	---	---	---
HELLS	3070	broad.mit.edu	37	10	96331305	96331305	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96331305delA	uc001kjt.2	+						HELLS_uc001kjs.2_Intron|HELLS_uc009xul.2_Intron|HELLS_uc009xum.2_Intron|HELLS_uc009xun.2_Intron|HELLS_uc009xuo.2_Intron|HELLS_uc001kju.2_Intron|HELLS_uc009xup.2_Intron|HELLS_uc009xuq.2_Intron|HELLS_uc009xur.2_Intron	NM_018063	NP_060533			helicase, lymphoid-specific						cell division|centromeric heterochromatin formation|lymphocyte proliferation|maintenance of DNA methylation|methylation-dependent chromatin silencing|mitosis|transcription, DNA-dependent	centromeric heterochromatin|nucleus	ATP binding|DNA binding|helicase activity			ovary(1)|kidney(1)	2		Colorectal(252;0.0429)		all cancers(201;2.13e-05)														---	---	---	---
SORBS1	10580	broad.mit.edu	37	10	97081967	97081967	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97081967delA	uc001kkp.2	-						SORBS1_uc001kkk.2_Intron|SORBS1_uc001kkl.2_Intron|SORBS1_uc001kkn.2_Intron|SORBS1_uc001kkm.2_Intron|SORBS1_uc001kko.2_Intron|SORBS1_uc001kkq.2_Intron|SORBS1_uc001kkr.2_Intron|SORBS1_uc001kks.2_Intron|SORBS1_uc001kkt.2_Intron|SORBS1_uc001kku.2_Intron|SORBS1_uc001kkv.2_Intron|SORBS1_uc001kkw.2_Intron|SORBS1_uc010qoe.1_Intron	NM_001034954	NP_001030126			sorbin and SH3 domain containing 1 isoform 3						focal adhesion assembly|glucose transport|insulin receptor signaling pathway|muscle contraction|positive regulation of establishment of protein localization in plasma membrane|positive regulation of glucose import|positive regulation of glycogen biosynthetic process|positive regulation of lipid biosynthetic process|stress fiber assembly	centrosome|cytosol|focal adhesion|membrane raft|nucleus|stress fiber|zonula adherens	actin binding|insulin receptor binding|SH3/SH2 adaptor activity			breast(1)	1		Colorectal(252;0.0429)		Epithelial(162;1.7e-06)|all cancers(201;6.52e-05)														---	---	---	---
ZNF518A	9849	broad.mit.edu	37	10	97918856	97918856	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97918856delA	uc001klp.2	+	6	3634	c.2777delA	c.(2776-2778)CAAfs	p.Q926fs	ZNF518A_uc001klo.1_Frame_Shift_Del_p.Q396fs|ZNF518A_uc001klq.2_Frame_Shift_Del_p.Q926fs|ZNF518A_uc001klr.2_Frame_Shift_Del_p.Q926fs	NM_014803	NP_055618	Q6AHZ1	Z518A_HUMAN	zinc finger protein 518	926					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(252;0.0815)		Epithelial(162;4.23e-08)|all cancers(201;1.85e-06)														---	---	---	---
Unknown	0	broad.mit.edu	37	10	98510007	98510009	+	IGR	DEL	AAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:98510007_98510009delAAA								PIK3AP1 (29728 upstream) : MIR607 (78417 downstream)																																			---	---	---	---
MMS19	64210	broad.mit.edu	37	10	99221731	99221731	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99221731delA	uc001kns.3	-						MMS19_uc001knq.2_5'Flank|MMS19_uc009xvs.2_Intron|MMS19_uc009xvt.2_Intron|MMS19_uc001knr.2_Intron|MMS19_uc010qox.1_Intron|MMS19_uc001knt.2_Intron|MMS19_uc001knu.1_Intron	NM_022362	NP_071757			MMS19 nucleotide excision repair homolog						chromosome segregation|nucleotide-excision repair|positive regulation of transcription, DNA-dependent|response to hormone stimulus|transcription, DNA-dependent|two-component signal transduction system (phosphorelay)	cytoplasm|holo TFIIH complex|MMXD complex	estrogen receptor binding|protein binding, bridging|receptor signaling complex scaffold activity|transcription coactivator activity				0		Colorectal(252;0.0846)		Epithelial(162;3.33e-10)|all cancers(201;2.74e-08)									Direct_reversal_of_damage|NER					---	---	---	---
CNNM1	26507	broad.mit.edu	37	10	101117211	101117211	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101117211delA	uc001kpp.3	+						CNNM1_uc009xwe.2_Intron|CNNM1_uc010qpi.1_Intron|CNNM1_uc009xwf.2_Intron|CNNM1_uc009xwg.2_5'Flank	NM_020348	NP_065081			cyclin M1						ion transport	integral to membrane|plasma membrane					0		Colorectal(252;0.234)		Epithelial(162;6.82e-10)|all cancers(201;5.62e-08)														---	---	---	---
CWF19L1	55280	broad.mit.edu	37	10	102006450	102006450	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102006450delA	uc001kqq.1	-						CWF19L1_uc001kqs.1_Intron|CWF19L1_uc001kqr.1_Intron|CWF19L1_uc001kqt.1_Intron|CWF19L1_uc010qpn.1_Intron	NM_018294	NP_060764			CWF19-like 1, cell cycle control								catalytic activity				0		Colorectal(252;0.117)		Epithelial(162;3.78e-10)|all cancers(201;3.1e-08)														---	---	---	---
C10orf76	79591	broad.mit.edu	37	10	103789686	103789686	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:103789686delT	uc009xwy.1	-						C10orf76_uc001kui.2_Intron	NM_024541	NP_078817			hypothetical protein LOC79591							integral to membrane					0		Colorectal(252;0.123)		Epithelial(162;2.41e-08)|all cancers(201;6.41e-07)														---	---	---	---
ARL3	403	broad.mit.edu	37	10	104449587	104449587	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:104449587delA	uc001kwa.2	-							NM_004311	NP_004302			ADP-ribosylation factor-like 3						cell cycle|cytokinesis|small GTPase mediated signal transduction	centrosome|cytoplasmic microtubule|Golgi membrane|midbody|nucleus|photoreceptor connecting cilium|spindle microtubule	GDP binding|GTP binding|metal ion binding|microtubule binding				0		Colorectal(252;0.122)		Epithelial(162;4.88e-09)|all cancers(201;1.29e-07)|BRCA - Breast invasive adenocarcinoma(275;0.22)														---	---	---	---
USMG5	84833	broad.mit.edu	37	10	105151824	105151824	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105151824delT	uc001kww.1	-						USMG5_uc001kwx.1_Intron	NM_032747	NP_116136			upregulated during skeletal muscle growth 5							integral to membrane					0		Colorectal(252;0.142)		Epithelial(162;3.94e-09)|all cancers(201;2.76e-08)|BRCA - Breast invasive adenocarcinoma(275;0.197)														---	---	---	---
CALHM2	51063	broad.mit.edu	37	10	105208932	105208932	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105208932delA	uc001kwz.2	-						CALHM2_uc001kxa.2_Intron|CALHM2_uc001kxc.2_Intron|CALHM2_uc001kxb.2_Intron|CALHM2_uc001kxd.1_3'UTR	NM_015916	NP_057000			calcium homeostasis modulator 2							integral to membrane				skin(1)	1																		---	---	---	---
SH3PXD2A	9644	broad.mit.edu	37	10	105452684	105452684	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105452684delC	uc001kxj.1	-						SH3PXD2A_uc010qqr.1_Intron|SH3PXD2A_uc010qqt.1_Intron|SH3PXD2A_uc009xxn.1_Intron|SH3PXD2A_uc010qqu.1_Intron	NM_014631	NP_055446			SH3 multiple domains 1						cell communication|superoxide metabolic process	cell junction|cell projection|cytoplasm|podosome	phosphatidylinositol binding|protein binding				0		Colorectal(252;0.0815)|Breast(234;0.131)		Epithelial(162;4.09e-10)|all cancers(201;2.73e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0119)														---	---	---	---
Unknown	0	broad.mit.edu	37	10	106059243	106059243	+	5'Flank	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:106059243delT	uc001kyd.1	+											Homo sapiens cDNA FLJ37540 fis, clone BRCAN2026117.																														---	---	---	---
Unknown	0	broad.mit.edu	37	10	107445676	107445676	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:107445676delT								SORCS3 (420683 upstream) : SORCS1 (887746 downstream)																																			---	---	---	---
TCF7L2	6934	broad.mit.edu	37	10	114918647	114918647	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:114918647delT	uc001lae.3	+						TCF7L2_uc001lac.3_Intron|TCF7L2_uc010qrk.1_Intron|TCF7L2_uc010qrl.1_Intron|TCF7L2_uc010qrm.1_Intron|TCF7L2_uc010qrn.1_Intron|TCF7L2_uc001lad.3_Intron|TCF7L2_uc001lag.3_Intron|TCF7L2_uc001laf.3_Intron|TCF7L2_uc010qro.1_Intron|TCF7L2_uc001lah.2_Intron|TCF7L2_uc010qrp.1_Intron|TCF7L2_uc010qrq.1_Intron|TCF7L2_uc010qrr.1_Intron|TCF7L2_uc010qrs.1_Intron|TCF7L2_uc010qrt.1_Intron|TCF7L2_uc010qru.1_Intron|TCF7L2_uc010qrv.1_Intron|TCF7L2_uc010qrw.1_Intron|TCF7L2_uc010qrx.1_Intron	NM_001146274	NP_001139746			transcription factor 7-like 2 isoform 1						anti-apoptosis|blood vessel development|canonical Wnt receptor signaling pathway involved in positive regulation of epithelial to mesenchymal transition|cell cycle arrest|cell proliferation|fat cell differentiation|glucose homeostasis|maintenance of DNA repeat elements|myoblast cell fate commitment|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of transcription from RNA polymerase II promoter|pancreas development|positive regulation of heparan sulfate proteoglycan biosynthetic process|positive regulation of insulin secretion|positive regulation of protein binding|positive regulation of protein export from nucleus|positive regulation of protein kinase B signaling cascade|positive regulation of transcription from RNA polymerase II promoter|regulation of hormone metabolic process|regulation of smooth muscle cell proliferation|response to glucose stimulus	beta-catenin-TCF7L2 complex|PML body|protein-DNA complex	armadillo repeat domain binding|beta-catenin binding|gamma-catenin binding|nuclear hormone receptor binding|protein kinase binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription factor binding|transcription regulatory region DNA binding			large_intestine(3)|ovary(1)	4		Breast(234;0.058)|Colorectal(252;0.0615)		Epithelial(162;0.00554)|all cancers(201;0.02)														---	---	---	---
TDRD1	56165	broad.mit.edu	37	10	115963690	115963690	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:115963690delA	uc001lbg.1	+						TDRD1_uc001lbf.2_Intron|TDRD1_uc001lbh.1_Intron|TDRD1_uc001lbi.1_Intron|TDRD1_uc010qsc.1_Intron|TDRD1_uc001lbj.2_Intron	NM_198795	NP_942090			tudor domain containing 1						DNA methylation involved in gamete generation|gene silencing by RNA|germ cell development|meiosis|multicellular organismal development|piRNA metabolic process|spermatogenesis	pi-body	nucleic acid binding|protein binding|zinc ion binding				0		Colorectal(252;0.172)|Breast(234;0.188)		Epithelial(162;0.0343)|all cancers(201;0.0754)														---	---	---	---
ABLIM1	3983	broad.mit.edu	37	10	116450448	116450448	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:116450448delT	uc001lbz.1	-											Homo sapiens cDNA FLJ25105 fis, clone CBR01442.						axon guidance|cytoskeleton organization|organ morphogenesis|visual perception	actin cytoskeleton|cytoplasm	actin binding|zinc ion binding			breast(1)	1		Colorectal(252;0.0373)|Breast(234;0.231)		Epithelial(162;0.0132)|all cancers(201;0.0383)														---	---	---	---
TRUB1	142940	broad.mit.edu	37	10	116710781	116710781	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:116710781delA	uc001lcd.2	+						TRUB1_uc010qsl.1_Intron	NM_139169	NP_631908			TruB pseudouridine (psi) synthase homolog 1						pseudouridine synthesis|tRNA processing		pseudouridine synthase activity|RNA binding				0		Colorectal(252;0.09)|Breast(234;0.174)|Lung NSC(174;0.245)		Epithelial(162;0.00879)|all cancers(201;0.0243)														---	---	---	---
C10orf46	143384	broad.mit.edu	37	10	120445457	120445459	+	3'UTR	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:120445457_120445459delTTT	uc001lds.1	-	9					C10orf46_uc010qst.1_Intron	NM_153810	NP_722517			chromosome 10 open reading frame 46						ubiquitin-dependent protein catabolic process	cullin-RING ubiquitin ligase complex	ubiquitin protein ligase binding				0		Lung NSC(174;0.142)|all_lung(145;0.175)		all cancers(201;0.0131)														---	---	---	---
TIAL1	7073	broad.mit.edu	37	10	121335157	121335157	+	3'UTR	DEL	T	-	-	rs73366847	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:121335157delT	uc001lei.1	-	12					TIAL1_uc001leh.1_3'UTR|TIAL1_uc001lej.1_3'UTR|TIAL1_uc001lek.1_3'UTR|TIAL1_uc009xzi.1_3'UTR	NM_003252	NP_003243			TIA-1 related protein isoform 1						apoptosis|defense response|induction of apoptosis|regulation of transcription from RNA polymerase II promoter	lysosome|nucleus|stress granule	nucleotide binding|RNA binding			ovary(1)	1		Lung NSC(174;0.094)|all_lung(145;0.123)		all cancers(201;0.00239)|BRCA - Breast invasive adenocarcinoma(275;0.0932)														---	---	---	---
C10orf120	399814	broad.mit.edu	37	10	124457494	124457495	+	Frame_Shift_Ins	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124457494_124457495insT	uc001lgn.2	-	3	794_795	c.762_763insA	c.(760-765)AAATGTfs	p.K254fs		NM_001010912	NP_001010912	Q5SQS8	CJ120_HUMAN	hypothetical protein LOC399814	254_255										kidney(1)	1		all_neural(114;0.169)|Glioma(114;0.222)																---	---	---	---
DOCK1	1793	broad.mit.edu	37	10	129141792	129141792	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:129141792delT	uc001ljt.2	+						DOCK1_uc010qun.1_Intron|DOCK1_uc009yaq.2_Intron	NM_001380	NP_001371			dedicator of cytokinesis 1						apoptosis|axon guidance|blood coagulation|integrin-mediated signaling pathway|phagocytosis, engulfment|small GTPase mediated signal transduction	cytosol|membrane	GTP binding|GTPase activator activity|GTPase binding|guanyl-nucleotide exchange factor activity|SH3 domain binding			central_nervous_system(4)|ovary(2)|lung(1)|breast(1)|kidney(1)	9		all_epithelial(44;2.3e-07)|all_lung(145;0.00466)|Lung NSC(174;0.00685)|Colorectal(57;0.0107)|Renal(717;0.0113)|Breast(234;0.0492)|all_neural(114;0.108)|all_hematologic(284;0.14)		BRCA - Breast invasive adenocarcinoma(275;0.0221)|Colorectal(40;0.115)														---	---	---	---
Unknown	0	broad.mit.edu	37	10	134624076	134624076	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:134624076delG	uc010qux.1	-							NM_017609	NP_060079			Homo sapiens cDNA, FLJ17989.																														---	---	---	---
VENTX	27287	broad.mit.edu	37	10	135051671	135051672	+	Intron	INS	-	G	G	rs143215010	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:135051671_135051672insG	uc010quy.1	+							NM_014468	NP_055283			VENT homeobox						multicellular organismal development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0		all_cancers(35;4.15e-10)|all_epithelial(44;2.07e-08)|Lung NSC(174;0.000845)|all_lung(145;0.00144)|all_neural(114;0.0299)|Melanoma(40;0.123)|Colorectal(31;0.172)|Glioma(114;0.203)		OV - Ovarian serous cystadenocarcinoma(35;7.8e-06)|Epithelial(32;9.31e-06)|all cancers(32;1.19e-05)														---	---	---	---
NUP98	4928	broad.mit.edu	37	11	3723472	3723473	+	Intron	DEL	AC	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:3723472_3723473delAC	uc001lyh.2	-						NUP98_uc001lyi.2_Intron|NUP98_uc001lyg.2_Intron	NM_016320	NP_057404			nucleoporin 98kD isoform 1						carbohydrate metabolic process|DNA replication|glucose transport|interspecies interaction between organisms|mitotic prometaphase|mRNA transport|nuclear pore organization|protein import into nucleus, docking|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|nuclear membrane|nucleoplasm|Nup107-160 complex	protein binding|structural constituent of nuclear pore|transporter activity			breast(4)|skin(3)|ovary(2)|central_nervous_system(1)|lung(1)|kidney(1)	12		Medulloblastoma(188;0.0025)|Breast(177;0.00328)|all_neural(188;0.0227)		BRCA - Breast invasive adenocarcinoma(625;0.0403)|LUSC - Lung squamous cell carcinoma(625;0.116)|Lung(200;0.199)				T	HOXA9|NSD1|WHSC1L1|DDX10|TOP1|HOXD13|PMX1|HOXA13|HOXD11|HOXA11|RAP1GDS1|HOXC11	AML								---	---	---	---
OR56A1	120796	broad.mit.edu	37	11	6049169	6049170	+	5'Flank	DEL	AA	-	-	rs111685831		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6049169_6049170delAA	uc010qzw.1	-							NM_001001917	NP_001001917			olfactory receptor, family 56, subfamily A,						sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|breast(1)	3		Medulloblastoma(188;0.00776)|all_neural(188;0.0652)|Breast(177;0.114)		Epithelial(150;7.01e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---
MICALCL	84953	broad.mit.edu	37	11	12316387	12316389	+	In_Frame_Del	DEL	CTA	-	-	rs3812754	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:12316387_12316389delCTA	uc001mkg.1	+	3	1700_1702	c.1409_1411delCTA	c.(1408-1413)CCTACA>CCA	p.T471del		NM_032867	NP_116256	Q6ZW33	MICLK_HUMAN	MICAL C-terminal like	471					cell differentiation|multicellular organismal development|spermatogenesis	cytoplasm	mitogen-activated protein kinase binding			skin(1)	1				Epithelial(150;0.00177)														---	---	---	---
FAR1	84188	broad.mit.edu	37	11	13749086	13749086	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:13749086delT	uc001mld.2	+							NM_032228	NP_115604			fatty acyl CoA reductase 1						ether lipid biosynthetic process	integral to membrane|peroxisomal matrix|peroxisomal membrane	protein binding			ovary(1)|skin(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	11	17250736	17250736	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17250736delA								PIK3C2A (21206 upstream) : NUCB2 (31151 downstream)																																			---	---	---	---
ZDHHC13	54503	broad.mit.edu	37	11	19167708	19167708	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:19167708delT	uc001mpi.2	+						ZDHHC13_uc001mpj.2_Intron	NM_019028	NP_061901			zinc finger, DHHC domain containing 13 isoform						positive regulation of I-kappaB kinase/NF-kappaB cascade	Golgi-associated vesicle membrane|integral to membrane	magnesium ion transmembrane transporter activity|palmitoyltransferase activity|signal transducer activity|zinc ion binding				0																		---	---	---	---
ZDHHC13	54503	broad.mit.edu	37	11	19197720	19197720	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:19197720delA	uc001mpi.2	+	17					ZDHHC13_uc001mpj.2_3'UTR	NM_019028	NP_061901			zinc finger, DHHC domain containing 13 isoform						positive regulation of I-kappaB kinase/NF-kappaB cascade	Golgi-associated vesicle membrane|integral to membrane	magnesium ion transmembrane transporter activity|palmitoyltransferase activity|signal transducer activity|zinc ion binding				0																		---	---	---	---
ANO5	203859	broad.mit.edu	37	11	22239726	22239726	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22239726delT	uc001mqi.2	+						ANO5_uc001mqj.2_Intron	NM_213599	NP_998764			anoctamin 5 isoform a							chloride channel complex|endoplasmic reticulum membrane	chloride channel activity			central_nervous_system(3)|ovary(1)	4																		---	---	---	---
ANO5	203859	broad.mit.edu	37	11	22247514	22247514	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22247514delT	uc001mqi.2	+						ANO5_uc001mqj.2_Intron	NM_213599	NP_998764			anoctamin 5 isoform a							chloride channel complex|endoplasmic reticulum membrane	chloride channel activity			central_nervous_system(3)|ovary(1)	4																		---	---	---	---
MPPED2	744	broad.mit.edu	37	11	30602049	30602049	+	5'Flank	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:30602049delA	uc001msr.2	-						MPPED2_uc001msq.3_Intron|MPPED2_uc009yji.2_Intron	NM_001584	NP_001575			metallophosphoesterase domain containing 2						nervous system development		hydrolase activity|metal ion binding			skin(1)	1																		---	---	---	---
ELP4	26610	broad.mit.edu	37	11	31561001	31561001	+	Intron	DEL	A	-	-	rs76954383		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31561001delA	uc001mtb.2	+						ELP4_uc001mta.1_Intron|ELP4_uc001mtc.2_Intron|ELP4_uc010rdz.1_Intron	NM_019040	NP_061913			elongation protein 4 homolog						histone acetylation|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	cytoplasm|DNA-directed RNA polymerase II, holoenzyme|Elongator holoenzyme complex|transcription elongation factor complex	phosphorylase kinase regulator activity|protein binding			upper_aerodigestive_tract(1)|ovary(1)|prostate(1)	3	Lung SC(675;0.225)																	---	---	---	---
PAX6	5080	broad.mit.edu	37	11	31823609	31823609	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31823609delA	uc001mtd.3	-						PAX6_uc001mte.3_Intron|PAX6_uc001mtg.3_Intron|PAX6_uc001mtf.3_Intron|PAX6_uc001mth.3_Intron|PAX6_uc009yjr.2_Intron	NM_001127612	NP_001121084			paired box gene 6 isoform a						blood vessel development|central nervous system development|cornea development in camera-type eye|glucose homeostasis|iris morphogenesis|negative regulation of neurogenesis|neuron fate commitment|pancreatic A cell development|positive regulation of transcription, DNA-dependent|response to wounding|visual perception	cytoplasm|nuclear chromatin	R-SMAD binding|RNA polymerase II core promoter sequence-specific DNA binding|sequence-specific DNA binding RNA polymerase II transcription factor activity|ubiquitin-protein ligase activity			lung(4)|ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	9	Lung SC(675;0.225)													Wilms_tumor-Aniridia-ambiguous_Genitals-mental_Retardation				---	---	---	---
NAT10	55226	broad.mit.edu	37	11	34160692	34160692	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:34160692delA	uc001mvk.2	+						NAT10_uc010ren.1_Intron	NM_024662	NP_078938			N-acetyltransferase 10 isoform a							nucleolus	ATP binding|N-acetyltransferase activity|protein binding			ovary(1)|skin(1)	2		Acute lymphoblastic leukemia(5;0.0119)|all_hematologic(20;0.0231)																---	---	---	---
CKAP5	9793	broad.mit.edu	37	11	46832848	46832848	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46832848delT	uc001ndi.1	-						CKAP5_uc009ylg.1_Intron|CKAP5_uc001ndj.1_Intron	NM_001008938	NP_001008938			colonic and hepatic tumor over-expressed protein						cell division|centrosome organization|establishment or maintenance of microtubule cytoskeleton polarity|G2/M transition of mitotic cell cycle|mitotic prometaphase|RNA transport|spindle organization	centrosome|cytosol	protein binding|protein binding			ovary(1)|skin(1)	2																		---	---	---	---
LRP4	4038	broad.mit.edu	37	11	46912172	46912172	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46912172delT	uc001ndn.3	-							NM_002334	NP_002325			low density lipoprotein receptor-related protein						endocytosis|negative regulation of canonical Wnt receptor signaling pathway|Wnt receptor signaling pathway	integral to membrane	calcium ion binding|receptor activity			skin(2)|upper_aerodigestive_tract(1)|ovary(1)	4				Lung(87;0.159)														---	---	---	---
FNBP4	23360	broad.mit.edu	37	11	47765831	47765831	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47765831delT	uc009ylv.2	-						FNBP4_uc001ngj.2_Intron|FNBP4_uc001ngl.2_Intron	NM_015308	NP_056123			formin binding protein 4											ovary(1)	1																		---	---	---	---
NUP160	23279	broad.mit.edu	37	11	47824822	47824823	+	Intron	INS	-	AGTC	AGTC	rs146066512	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47824822_47824823insAGTC	uc001ngm.2	-						NUP160_uc009ylw.2_Intron	NM_015231	NP_056046			nucleoporin 160kDa						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			ovary(4)|lung(1)|central_nervous_system(1)|skin(1)	7																		---	---	---	---
Unknown	0	broad.mit.edu	37	11	48967951	48967951	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48967951delA								OR4A47 (456679 upstream) : FOLH1 (200237 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	11	49426613	49426613	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:49426613delT								FOLH1 (196391 upstream) : LOC440040 (153467 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	11	55607224	55607225	+	IGR	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55607224_55607225insT								OR5D16 (12 upstream) : SPRYD5 (43548 downstream)																																			---	---	---	---
OR8H2	390151	broad.mit.edu	37	11	55872323	55872323	+	5'Flank	DEL	G	-	-	rs113669153		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55872323delG	uc010riy.1	+							NM_001005200	NP_001005200			olfactory receptor, family 8, subfamily H,						sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2	Esophageal squamous(21;0.00693)														HNSCC(53;0.14)			---	---	---	---
CTNND1	1500	broad.mit.edu	37	11	57558992	57558993	+	Frame_Shift_Del	DEL	CT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57558992_57558993delCT	uc001nmc.3	+	3	613_614	c.42_43delCT	c.(40-45)GCCTCTfs	p.A14fs	CTNND1_uc001nlf.1_Frame_Shift_Del_p.A14fs|CTNND1_uc001nlh.1_Frame_Shift_Del_p.A14fs|CTNND1_uc001nlu.3_Intron|CTNND1_uc001nlt.3_Intron|CTNND1_uc001nls.3_Intron|CTNND1_uc001nlw.3_Intron|CTNND1_uc001nmf.3_Frame_Shift_Del_p.A14fs|CTNND1_uc001nmd.3_5'UTR|CTNND1_uc001nlk.3_5'UTR|CTNND1_uc001nme.3_Frame_Shift_Del_p.A14fs|CTNND1_uc001nll.3_5'UTR|CTNND1_uc001nmg.3_5'UTR|CTNND1_uc001nlj.3_5'UTR|CTNND1_uc001nlr.3_5'UTR|CTNND1_uc001nlp.3_5'UTR|CTNND1_uc001nlx.3_Intron|CTNND1_uc001nlz.3_Intron|CTNND1_uc009ymn.2_Intron|CTNND1_uc001nlm.3_Frame_Shift_Del_p.A14fs|CTNND1_uc001nly.3_Intron|CTNND1_uc001nmb.3_Intron|CTNND1_uc001nma.3_Intron|CTNND1_uc001nmi.3_Intron|CTNND1_uc001nmh.3_Frame_Shift_Del_p.A14fs|CTNND1_uc001nlq.3_Intron|CTNND1_uc001nln.3_Frame_Shift_Del_p.A14fs|CTNND1_uc001nli.3_Frame_Shift_Del_p.A14fs|CTNND1_uc001nlo.3_Intron|CTNND1_uc001nlv.3_Intron	NM_001085458	NP_001078927	O60716	CTND1_HUMAN	catenin, delta 1 isoform 1ABC	14_15	Potential.				adherens junction organization|cell junction assembly|negative regulation of canonical Wnt receptor signaling pathway|regulation of transcription, DNA-dependent|transcription, DNA-dependent|Wnt receptor signaling pathway	cytosol|midbody|nucleus	cadherin binding|protein binding|receptor binding			breast(4)|ovary(1)|kidney(1)	6		all_epithelial(135;0.155)																---	---	---	---
MS4A6A	64231	broad.mit.edu	37	11	59945973	59945973	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:59945973delA	uc001nor.2	-						MS4A6A_uc001noq.2_Intron|MS4A6A_uc001nos.3_Intron|MS4A6A_uc009ymv.2_Intron|MS4A6A_uc001not.2_Intron|MS4A6A_uc010rla.1_Intron|MS4A6A_uc010rlb.1_Intron	NM_152852	NP_690591			membrane-spanning 4-domains, subfamily A, member							integral to membrane	receptor activity				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	11	60010336	60010336	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60010336delT								MS4A6A (58197 upstream) : MS4A4A (37803 downstream)																																			---	---	---	---
MS4A1	931	broad.mit.edu	37	11	60234644	60234644	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60234644delA	uc001npp.2	+						MS4A1_uc001npq.2_Intron|MS4A1_uc009yna.2_Intron|MS4A1_uc009ymz.2_Intron|MS4A1_uc010rlc.1_Intron	NM_152866	NP_690605			membrane-spanning 4-domains, subfamily A, member						B cell activation|immune response	integral to plasma membrane				ovary(3)|lung(2)	5					Ibritumomab(DB00078)|Rituximab(DB00073)|Tositumomab(DB00081)													---	---	---	---
PRPF19	27339	broad.mit.edu	37	11	60666410	60666410	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60666410delA	uc001nqf.2	-							NM_014502	NP_055317			PRP19/PSO4 pre-mRNA processing factor 19						DNA repair|protein polyubiquitination|spliceosome assembly	catalytic step 2 spliceosome|nuclear speck|spindle|ubiquitin ligase complex	DNA binding|identical protein binding|ubiquitin-ubiquitin ligase activity			ovary(1)	1																OREG0020994	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
CD6	923	broad.mit.edu	37	11	60783054	60783055	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:60783054_60783055delAA	uc001nqq.2	+						CD6_uc001nqp.2_Intron|CD6_uc001nqr.2_Intron|CD6_uc001nqs.2_Intron|CD6_uc001nqt.2_Intron	NM_006725	NP_006716			CD6 molecule precursor						cell adhesion	cell surface|integral to plasma membrane	scavenger receptor activity			pancreas(1)	1																		---	---	---	---
INCENP	3619	broad.mit.edu	37	11	61917392	61917392	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61917392delA	uc001nsw.1	+						INCENP_uc001nsx.1_Intron|INCENP_uc001nsy.1_Intron	NM_001040694	NP_001035784			inner centromere protein antigens 135/155kDa						chromosome segregation|cytokinesis|mitotic prometaphase	centromeric heterochromatin|condensed chromosome kinetochore|cytosol|microtubule|spindle	protein binding			lung(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	11	62799908	62799908	+	IGR	DEL	T	-	-	rs114064409	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62799908delT								SLC22A8 (16597 upstream) : SLC22A24 (47506 downstream)																																			---	---	---	---
PCNXL3	399909	broad.mit.edu	37	11	65391544	65391544	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65391544delC	uc001oey.2	+						PCNXL3_uc009yqn.2_5'Flank|PCNXL3_uc001oez.2_5'Flank	NM_032223	NP_115599			pecanex-like 3							integral to membrane					0																		---	---	---	---
RAB1B	81876	broad.mit.edu	37	11	66039143	66039143	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66039143delA	uc001ohf.2	+						uc001ohg.1_RNA	NM_030981	NP_112243			RAB1B, member RAS oncogene family						protein transport|small GTPase mediated signal transduction	Golgi apparatus|membrane	GTP binding|protein binding				0																		---	---	---	---
PC	5091	broad.mit.edu	37	11	66618408	66618409	+	Intron	DEL	GA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66618408_66618409delGA	uc001ojn.1	-						PC_uc001ojo.1_Intron|PC_uc001ojp.1_Intron|PC_uc001ojm.1_5'Flank	NM_022172	NP_071504			pyruvate carboxylase precursor						gluconeogenesis|lipid biosynthetic process	mitochondrial matrix	ATP binding|biotin binding|biotin carboxylase activity|metal ion binding|pyruvate carboxylase activity			ovary(2)|lung(1)|kidney(1)	4		Melanoma(852;0.0525)		Lung(977;0.153)|LUSC - Lung squamous cell carcinoma(976;0.227)	Biotin(DB00121)|Pyruvic acid(DB00119)													---	---	---	---
CLCF1	23529	broad.mit.edu	37	11	67134760	67134760	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67134760delG	uc001okq.2	-						LOC100130987_uc010rpo.1_Intron|CLCF1_uc010rpp.1_Intron	NM_013246	NP_037378			cardiotrophin-like cytokine factor 1 precursor						B cell differentiation|cytokine-mediated signaling pathway|JAK-STAT cascade|negative regulation of neuron apoptosis|positive regulation of astrocyte differentiation|positive regulation of B cell proliferation|positive regulation of immunoglobulin production|positive regulation of isotype switching to IgE isotypes|positive regulation of tyrosine phosphorylation of Stat3 protein	extracellular space	ciliary neurotrophic factor receptor binding|cytokine activity|growth factor activity|protein heterodimerization activity				0			BRCA - Breast invasive adenocarcinoma(15;2.39e-06)															---	---	---	---
CORO1B	57175	broad.mit.edu	37	11	67209168	67209168	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67209168delG	uc001olj.1	-						CORO1B_uc009yrs.1_Intron|CORO1B_uc001olk.1_Intron|CORO1B_uc009yrt.1_Intron|CORO1B_uc009yru.1_Intron|CORO1B_uc001oll.1_Intron|CORO1B_uc010rps.1_Intron|CORO1B_uc009yrv.1_Frame_Shift_Del_p.H164fs	NM_020441	NP_065174			coronin, actin binding protein, 1B						actin cytoskeleton organization	actin cytoskeleton|cytoplasm	actin filament binding			large_intestine(1)|ovary(1)	2			BRCA - Breast invasive adenocarcinoma(15;3.26e-06)															---	---	---	---
ARAP1	116985	broad.mit.edu	37	11	72466225	72466226	+	5'Flank	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72466225_72466226insG	uc001osu.2	-						ARAP1_uc001osv.2_Intron|STARD10_uc001osy.2_Intron|STARD10_uc001osz.3_Intron|STARD10_uc001ota.2_Intron|STARD10_uc001otb.2_Intron	NM_001040118	NP_001035207			ArfGAP with RhoGAP domain, ankyrin repeat and PH						actin filament reorganization involved in cell cycle|negative regulation of stress fiber assembly|positive regulation of Cdc42 GTPase activity|positive regulation of filopodium assembly|regulation of ARF GTPase activity|regulation of cell shape|regulation of cellular component movement|small GTPase mediated signal transduction	cytosol|Golgi cisterna membrane|plasma membrane	ARF GTPase activator activity|phosphatidylinositol-3,4,5-trisphosphate binding|protein binding|Rho GTPase activator activity|zinc ion binding			skin(1)	1																		---	---	---	---
FCHSD2	9873	broad.mit.edu	37	11	72712093	72712093	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72712093delT	uc009ytl.2	-	5	550	c.329delA	c.(328-330)AACfs	p.N110fs	FCHSD2_uc010rrg.1_Intron|FCHSD2_uc001oth.3_Frame_Shift_Del_p.N54fs|FCHSD2_uc001oti.2_Frame_Shift_Del_p.N69fs	NM_014824	NP_055639	O94868	FCSD2_HUMAN	FCH and double SH3 domains 2	110							protein binding			ovary(1)	1			BRCA - Breast invasive adenocarcinoma(5;3.3e-05)															---	---	---	---
POLD3	10714	broad.mit.edu	37	11	74305198	74305198	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:74305198delA	uc001ovf.1	+						POLD3_uc009yua.1_Intron	NM_006591	NP_006582			DNA-directed DNA polymerase delta 3						base-excision repair|DNA strand elongation involved in DNA replication|DNA synthesis involved in DNA repair|mismatch repair|nucleotide-excision repair, DNA gap filling|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication|transcription-coupled nucleotide-excision repair	delta DNA polymerase complex|nucleoplasm	DNA-directed DNA polymerase activity|protein binding			kidney(2)|ovary(1)	3	Breast(11;3.21e-06)																	---	---	---	---
UVRAG	7405	broad.mit.edu	37	11	75718406	75718406	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:75718406delT	uc001oxc.2	+						UVRAG_uc010rrw.1_Intron|UVRAG_uc001oxd.2_Intron|UVRAG_uc010rrx.1_Intron|UVRAG_uc009yuh.1_Intron	NM_003369	NP_003360			UV radiation resistance associated						DNA repair|positive regulation of autophagy	early endosome|late endosome|lysosome	protein binding			skin(4)|lung(2)	6																		---	---	---	---
ACER3	55331	broad.mit.edu	37	11	76730622	76730622	+	Intron	DEL	A	-	-	rs621257		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:76730622delA	uc009yum.1	+						ACER3_uc001oxu.2_Intron|ACER3_uc009yun.1_Intron|ACER3_uc009yuo.1_Intron|ACER3_uc010rsh.1_Intron|ACER3_uc010rsi.1_Intron|ACER3_uc010rsj.1_Intron	NM_018367	NP_060837			phytoceramidase, alkaline						ceramide metabolic process|phytosphingosine biosynthetic process|positive regulation of cell proliferation|sphingosine biosynthetic process	integral to endoplasmic reticulum membrane|integral to Golgi membrane	phytoceramidase activity				0																		---	---	---	---
ANKRD42	338699	broad.mit.edu	37	11	82921646	82921646	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:82921646delC	uc001ozz.1	+						ANKRD42_uc009yvi.1_Intron|ANKRD42_uc010rsv.1_Intron|ANKRD42_uc001paa.2_Intron|ANKRD42_uc001pab.1_Intron	NM_182603	NP_872409			ankyrin repeat domain 42											skin(1)	1																		---	---	---	---
CCDC90B	60492	broad.mit.edu	37	11	82989635	82989635	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:82989635delT	uc001pae.2	-						CCDC90B_uc001pac.2_Intron|CCDC90B_uc001pad.2_Intron|CCDC90B_uc001paf.2_Intron	NM_021825	NP_068597			coiled-coil domain containing 90B precursor							integral to membrane|mitochondrion|mitochondrion					0		Acute lymphoblastic leukemia(157;0.103)																---	---	---	---
Unknown	0	broad.mit.edu	37	11	89569194	89569194	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:89569194delA								TRIM49 (27451 upstream) : TRIM53 (6032 downstream)																																			---	---	---	---
NAALAD2	10003	broad.mit.edu	37	11	89925063	89925065	+	3'UTR	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:89925063_89925065delTTT	uc001pdf.3	+	19					NAALAD2_uc009yvx.2_3'UTR|NAALAD2_uc009yvy.2_3'UTR	NM_005467	NP_005458			N-acetylated alpha-linked acidic dipeptidase 2						proteolysis	integral to membrane	carboxypeptidase activity|dipeptidase activity|dipeptidyl-peptidase activity|metal ion binding|metallopeptidase activity|serine-type peptidase activity			pancreas(1)|skin(1)	2		Acute lymphoblastic leukemia(157;2.31e-05)|all_hematologic(158;0.00556)																---	---	---	---
HEPHL1	341208	broad.mit.edu	37	11	93796647	93796647	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:93796647delT	uc001pep.2	+							NM_001098672	NP_001092142			hephaestin-like 1 precursor						copper ion transport	integral to membrane	copper ion binding|oxidoreductase activity			ovary(3)	3		Acute lymphoblastic leukemia(157;2.34e-05)|all_hematologic(158;0.00824)																---	---	---	---
Unknown	0	broad.mit.edu	37	11	97158168	97158168	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:97158168delT								None (None upstream) : None (None downstream)																																			---	---	---	---
CNTN5	53942	broad.mit.edu	37	11	99942594	99942594	+	Intron	DEL	A	-	-	rs76748292		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:99942594delA	uc001pga.2	+						CNTN5_uc009ywv.1_Intron|CNTN5_uc001pfz.2_Intron|CNTN5_uc001pgb.2_Intron	NM_014361	NP_055176			contactin 5 isoform long						cell adhesion	anchored to membrane|plasma membrane	protein binding			skin(3)|ovary(2)|pancreas(2)|breast(1)	8		all_hematologic(158;1.22e-05)|Acute lymphoblastic leukemia(157;3.81e-05)|Melanoma(852;0.219)		BRCA - Breast invasive adenocarcinoma(274;0.00146)|KIRC - Kidney renal clear cell carcinoma(183;0.156)|Kidney(183;0.196)														---	---	---	---
DYNC2H1	79659	broad.mit.edu	37	11	103092697	103092697	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:103092697delT	uc001pho.2	+						DYNC2H1_uc001phn.1_Intron|DYNC2H1_uc009yxe.1_Intron	NM_001080463	NP_001073932			dynein, cytoplasmic 2, heavy chain 1						cell projection organization|Golgi organization|microtubule-based movement|multicellular organismal development	cilium axoneme|dynein complex|Golgi apparatus|microtubule|plasma membrane	ATP binding|ATPase activity|microtubule motor activity				0		Acute lymphoblastic leukemia(157;0.000966)|all_hematologic(158;0.00348)		BRCA - Breast invasive adenocarcinoma(274;0.000177)|Epithelial(105;0.0785)														---	---	---	---
AASDHPPT	60496	broad.mit.edu	37	11	105961907	105961907	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:105961907delT	uc001pjc.1	+						AASDHPPT_uc010rvn.1_Intron|AASDHPPT_uc001pjd.1_Intron	NM_015423	NP_056238			aminoadipate-semialdehyde						macromolecule biosynthetic process|pantothenate metabolic process	cytosol	holo-[acyl-carrier-protein] synthase activity|magnesium ion binding|protein binding				0		Melanoma(852;0.000878)|Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.0017)|Breast(348;0.0321)		BRCA - Breast invasive adenocarcinoma(274;5.78e-05)|Epithelial(105;0.00622)|all cancers(92;0.041)														---	---	---	---
ALKBH8	91801	broad.mit.edu	37	11	107427831	107427831	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:107427831delA	uc010rvr.1	-						ALKBH8_uc010rvq.1_5'Flank|ALKBH8_uc009yxp.2_Intron|ALKBH8_uc001pjl.2_Intron	NM_138775	NP_620130			alkB, alkylation repair homolog 8						response to DNA damage stimulus	cytosol|nucleus	metal ion binding|nucleotide binding|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors|protein binding|RNA binding|tRNA (uracil) methyltransferase activity				0		Melanoma(852;0.000288)|Acute lymphoblastic leukemia(157;0.000966)|all_hematologic(158;0.00301)|all_epithelial(67;0.00512)|Breast(348;0.104)		BRCA - Breast invasive adenocarcinoma(274;3.53e-05)|Epithelial(105;0.00029)|all cancers(92;0.00518)														---	---	---	---
NPAT	4863	broad.mit.edu	37	11	108064656	108064657	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:108064656_108064657insA	uc001pjz.3	-							NM_002519	NP_002510			nuclear protein,  ataxia-telangiectasia locus						positive regulation of transcription, DNA-dependent|regulation of transcription involved in G1/S phase of mitotic cell cycle	Cajal body	protein C-terminus binding|protein N-terminus binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription corepressor activity			ovary(2)	2		all_cancers(61;2.31e-10)|all_epithelial(67;1.11e-06)|Melanoma(852;2.55e-06)|Acute lymphoblastic leukemia(157;3.95e-05)|all_hematologic(158;0.00014)|Breast(348;0.0258)|all_neural(303;0.072)		BRCA - Breast invasive adenocarcinoma(274;1.05e-05)|Epithelial(105;3.01e-05)|all cancers(92;0.000816)|Colorectal(284;0.116)														---	---	---	---
KDELC2	143888	broad.mit.edu	37	11	108348150	108348150	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:108348150delA	uc001pkj.2	-						KDELC2_uc001pki.2_Intron	NM_153705	NP_714916			KDEL (Lys-Asp-Glu-Leu) containing 2 precursor							endoplasmic reticulum lumen				ovary(1)	1		all_cancers(61;1.38e-11)|all_epithelial(67;3.16e-07)|Melanoma(852;2.55e-06)|Acute lymphoblastic leukemia(157;3.95e-05)|all_hematologic(158;0.00014)|Breast(348;0.0258)|all_neural(303;0.072)		Epithelial(105;6.93e-06)|BRCA - Breast invasive adenocarcinoma(274;8.54e-06)|all cancers(92;0.00016)|OV - Ovarian serous cystadenocarcinoma(223;0.132)|Colorectal(284;0.14)														---	---	---	---
Unknown	0	broad.mit.edu	37	11	111759853	111759853	+	IGR	DEL	T	-	-	rs150833390		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:111759853delT								C11orf1 (5058 upstream) : CRYAB (19497 downstream)																																			---	---	---	---
C11orf57	55216	broad.mit.edu	37	11	111953316	111953316	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:111953316delA	uc001pmr.3	+	6	1180	c.499delA	c.(499-501)AAAfs	p.K167fs	C11orf57_uc001pmw.3_Frame_Shift_Del_p.K168fs|C11orf57_uc001pmt.3_Frame_Shift_Del_p.K168fs|C11orf57_uc001pmv.3_Frame_Shift_Del_p.K167fs|C11orf57_uc001pms.3_Frame_Shift_Del_p.K139fs	NM_001082970	NP_001076439	Q6ZUT1	CK057_HUMAN	hypothetical protein LOC55216 isoform b	167	Lys-rich.									breast(2)|ovary(1)	3		all_cancers(61;9.8e-15)|all_epithelial(67;6.57e-09)|Melanoma(852;1.91e-06)|all_hematologic(158;0.000405)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0112)|all_neural(223;0.0281)|Medulloblastoma(222;0.0425)		Epithelial(105;3.6e-07)|BRCA - Breast invasive adenocarcinoma(274;6.17e-07)|all cancers(92;7.01e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.0521)														---	---	---	---
NCAM1	4684	broad.mit.edu	37	11	112832277	112832278	+	5'UTR	DEL	GG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:112832277_112832278delGG	uc009yyq.1	+	1					NCAM1_uc001pno.2_5'UTR|uc001pnn.2_Intron	NM_001076682	NP_001070150			neural cell adhesion molecule 1 isoform 3						axon guidance|interferon-gamma-mediated signaling pathway	anchored to membrane|extracellular region|Golgi membrane|integral to membrane				ovary(1)	1		all_cancers(61;5.82e-19)|all_epithelial(67;6.87e-12)|Melanoma(852;1.99e-05)|all_hematologic(158;3.66e-05)|Acute lymphoblastic leukemia(157;0.00119)|Breast(348;0.0109)|all_neural(223;0.0299)|Medulloblastoma(222;0.0458)|Renal(330;0.198)|Prostate(24;0.207)		BRCA - Breast invasive adenocarcinoma(274;1.78e-05)|Epithelial(105;0.000114)|all cancers(92;0.000467)|OV - Ovarian serous cystadenocarcinoma(223;0.212)														---	---	---	---
ANKK1	255239	broad.mit.edu	37	11	113266216	113266217	+	Intron	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113266216_113266217insG	uc001pny.2	+							NM_178510	NP_848605			ankyrin repeat and kinase domain containing 1								ATP binding|protein serine/threonine kinase activity			lung(5)|stomach(1)|ovary(1)|breast(1)	8		all_cancers(61;1.53e-11)|all_epithelial(67;3e-06)|Melanoma(852;4.04e-05)|all_hematologic(158;0.000315)|Acute lymphoblastic leukemia(157;0.000966)|Breast(348;0.0461)|Medulloblastoma(222;0.0523)|all_neural(223;0.0663)|Prostate(24;0.194)		BRCA - Breast invasive adenocarcinoma(274;4.82e-06)|Epithelial(105;5.41e-05)|all cancers(92;0.000442)|OV - Ovarian serous cystadenocarcinoma(223;0.238)														---	---	---	---
CD3G	917	broad.mit.edu	37	11	118220583	118220583	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118220583delA	uc001psu.2	+	3	285	c.205delA	c.(205-207)AAAfs	p.K69fs	CD3G_uc009zaa.1_Frame_Shift_Del_p.K9fs	NM_000073	NP_000064	P09693	CD3G_HUMAN	CD3G antigen, gamma polypeptide precursor	69	Extracellular (Potential).|Ig-like.				establishment or maintenance of cell polarity|protein complex assembly|protein transport|regulation of apoptosis|T cell activation|T cell costimulation|T cell receptor signaling pathway	integral to plasma membrane|T cell receptor complex	protein heterodimerization activity|receptor signaling complex scaffold activity|T cell receptor binding|transmembrane receptor activity				0	all_hematologic(175;0.046)	Medulloblastoma(222;0.0425)|Breast(348;0.181)|all_hematologic(192;0.196)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;3.04e-05)														---	---	---	---
UBE4A	9354	broad.mit.edu	37	11	118242093	118242093	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118242093delC	uc001psw.2	+						UBE4A_uc001psv.2_Intron	NM_004788	NP_004779			ubiquitination factor E4A						ubiquitin-dependent protein catabolic process	ubiquitin ligase complex	protein binding			ovary(2)|upper_aerodigestive_tract(1)|breast(1)|kidney(1)	5	all_hematologic(175;0.046)	Medulloblastoma(222;0.0425)|Breast(348;0.181)|all_hematologic(192;0.196)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;3.28e-05)														---	---	---	---
RPS25	6230	broad.mit.edu	37	11	118888388	118888388	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118888388delA	uc001pun.2	-						TRAPPC4_uc010ryn.1_5'Flank|TRAPPC4_uc010ryo.1_5'Flank|TRAPPC4_uc010ryp.1_5'Flank|TRAPPC4_uc001pup.2_5'Flank|TRAPPC4_uc010ryq.1_5'Flank	NM_001028	NP_001019			ribosomal protein S25						endocrine pancreas development|translational elongation|translational termination|viral transcription	cytosolic small ribosomal subunit|nucleolus	protein binding|RNA binding				0	all_hematologic(175;0.0839)	Medulloblastoma(222;0.0425)|all_neural(223;0.112)|all_hematologic(192;0.207)		BRCA - Breast invasive adenocarcinoma(274;7.55e-05)														---	---	---	---
C11orf63	79864	broad.mit.edu	37	11	122775729	122775729	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:122775729delT	uc001pym.2	+						C11orf63_uc001pyl.1_Intron	NM_024806	NP_079082			hypothetical protein LOC79864 isoform 1											ovary(3)	3		Breast(109;0.00249)|Lung NSC(97;0.0177)|all_lung(97;0.018)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;5.34e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0311)														---	---	---	---
GRAMD1B	57476	broad.mit.edu	37	11	123488932	123488932	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123488932delT	uc001pyx.2	+						GRAMD1B_uc001pyw.2_Intron|GRAMD1B_uc010rzw.1_Intron|GRAMD1B_uc010rzx.1_Intron|GRAMD1B_uc001pyy.2_Intron	NM_020716	NP_065767			GRAM domain containing 1B							integral to membrane				ovary(1)	1		Breast(109;0.00204)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;7.32e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0394)														---	---	---	---
SIAE	54414	broad.mit.edu	37	11	124508689	124508689	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124508689delT	uc001qan.2	-							NM_170601	NP_733746			sialate O-acetylesterase precursor							extracellular region|lysosome	carboxylesterase activity|sialate O-acetylesterase activity				0	all_hematologic(175;0.215)	Breast(109;0.00109)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.63e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0243)														---	---	---	---
EI24	9538	broad.mit.edu	37	11	125452395	125452395	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:125452395delA	uc001qca.2	+						EI24_uc001qcb.2_Intron|EI24_uc010sbd.1_Intron|EI24_uc009zbl.2_Intron|EI24_uc001qcc.2_Intron|EI24_uc010sbe.1_Intron|EI24_uc010sbf.1_Intron	NM_004879	NP_004870			etoposide induced 2.4 isoform 1						apoptosis|autophagy|induction of apoptosis|negative regulation of cell growth	endoplasmic reticulum membrane|integral to membrane|nuclear membrane				ovary(1)	1	all_hematologic(175;0.228)	Breast(109;0.0021)|Lung NSC(97;0.0126)|all_lung(97;0.0132)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;5.64e-07)|OV - Ovarian serous cystadenocarcinoma(99;0.0975)														---	---	---	---
NCAPD3	23310	broad.mit.edu	37	11	134086631	134086631	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:134086631delA	uc001qhd.1	-						NCAPD3_uc010scm.1_Intron|NCAPD3_uc009zda.1_Intron	NM_015261	NP_056076			non-SMC condensin II complex, subunit D3						cell division|mitotic chromosome condensation	nuclear centromeric heterochromatin|nuclear condensin complex	methylated histone residue binding			ovary(2)|upper_aerodigestive_tract(1)|lung(1)|kidney(1)	5	all_hematologic(175;0.127)	all_cancers(12;1.68e-21)|all_epithelial(12;5.86e-16)|all_lung(97;1.19e-05)|Lung NSC(97;2.76e-05)|Breast(109;0.000182)|Medulloblastoma(222;0.0245)|all_neural(223;0.0505)|Esophageal squamous(93;0.0559)		Epithelial(10;8.74e-10)|BRCA - Breast invasive adenocarcinoma(10;1e-08)|all cancers(11;1.46e-08)|OV - Ovarian serous cystadenocarcinoma(99;0.00345)|Lung(977;0.227)														---	---	---	---
C12orf4	57102	broad.mit.edu	37	12	4639391	4639391	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:4639391delA	uc001qms.2	-						C12orf4_uc001qmt.2_Intron	NM_020374	NP_065107			hypothetical protein LOC57102												0			Colorectal(7;0.00165)|COAD - Colon adenocarcinoma(12;0.0229)	BRCA - Breast invasive adenocarcinoma(232;0.0281)														---	---	---	---
ANO2	57101	broad.mit.edu	37	12	5941834	5941834	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:5941834delA	uc001qnm.2	-							NM_020373	NP_065106			anoctamin 2							chloride channel complex|plasma membrane	intracellular calcium activated chloride channel activity			ovary(4)|large_intestine(2)|central_nervous_system(1)	7																		---	---	---	---
IFFO1	25900	broad.mit.edu	37	12	6657973	6657974	+	Frame_Shift_Ins	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6657973_6657974insC	uc001qpd.1	-	5	1123_1124	c.1089_1090insG	c.(1087-1092)GGGCGGfs	p.G363fs	IFFO1_uc001qoy.2_RNA|IFFO1_uc001qpa.1_Frame_Shift_Ins_p.G3fs|IFFO1_uc001qpb.1_Frame_Shift_Ins_p.G40fs|IFFO1_uc001qpe.1_RNA|IFFO1_uc010sfe.1_Frame_Shift_Ins_p.G374fs|IFFO1_uc001qpf.1_Frame_Shift_Ins_p.G366fs|IFFO1_uc001qoz.1_Frame_Shift_Ins_p.G3fs|IFFO1_uc001qpc.1_Frame_Shift_Ins_p.G366fs|IFFO1_uc001qpg.2_Frame_Shift_Ins_p.G3fs	NM_080730	NP_542768	Q0D2I5	IFFO1_HUMAN	intermediate filament family orphan isoform 2	363_364						intermediate filament					0																		---	---	---	---
IFFO1	25900	broad.mit.edu	37	12	6664650	6664652	+	In_Frame_Del	DEL	GGA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6664650_6664652delGGA	uc001qpd.1	-	1	578_580	c.544_546delTCC	c.(544-546)TCCdel	p.S182del	IFFO1_uc001qpe.1_RNA|IFFO1_uc010sfe.1_In_Frame_Del_p.S182del|IFFO1_uc001qpf.1_In_Frame_Del_p.S182del|IFFO1_uc001qpc.1_In_Frame_Del_p.S182del	NM_080730	NP_542768	Q0D2I5	IFFO1_HUMAN	intermediate filament family orphan isoform 2	182	Poly-Ser.					intermediate filament					0																		---	---	---	---
PZP	5858	broad.mit.edu	37	12	9346942	9346943	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9346942_9346943insA	uc001qvl.2	-						PZP_uc009zgl.2_Intron	NM_002864	NP_002855			pregnancy-zone protein precursor											ovary(3)|upper_aerodigestive_tract(1)|large_intestine(1)	5																		---	---	---	---
CLEC7A	64581	broad.mit.edu	37	12	10279790	10279790	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10279790delA	uc001qxg.2	-						CLEC7A_uc001qxe.3_Intron|CLEC7A_uc001qxf.2_Intron|CLEC7A_uc001qxh.2_Intron|CLEC7A_uc001qxi.2_Intron|CLEC7A_uc001qxj.2_Intron|CLEC7A_uc009zhg.1_Intron|CLEC7A_uc001qxk.1_Intron|CLEC7A_uc001qxl.1_Intron|CLEC7A_uc010sgy.1_Intron|CLEC7A_uc001qxm.1_Intron	NM_197947	NP_922938			dendritic cell-associated C-type lectin 1						carbohydrate mediated signaling|defense response to protozoan|inflammatory response|innate immune response|phagocytosis, recognition|T cell activation	cytoplasm|integral to membrane	metal ion binding|MHC protein binding|sugar binding			central_nervous_system(1)	1																		---	---	---	---
LOH12CR1	118426	broad.mit.edu	37	12	12510571	12510571	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12510571delA	uc001ral.2	+						LOH12CR1_uc009zhu.2_Intron|LOH12CR2_uc001rak.2_5'Flank	NM_058169	NP_477517			LOH1CR12											ovary(1)	1		Prostate(47;0.0802)		BRCA - Breast invasive adenocarcinoma(232;0.0205)														---	---	---	---
PDE3A	5139	broad.mit.edu	37	12	20523324	20523324	+	Intron	DEL	T	-	-	rs71988327		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:20523324delT	uc001reh.1	+							NM_000921	NP_000912			phosphodiesterase 3A						lipid metabolic process|platelet activation|signal transduction	cytosol|integral to membrane	3',5'-cyclic-AMP phosphodiesterase activity|3',5'-cyclic-GMP phosphodiesterase activity|cGMP-inhibited cyclic-nucleotide phosphodiesterase activity|metal ion binding			ovary(3)|upper_aerodigestive_tract(1)	4	Esophageal squamous(101;0.125)	Breast(259;0.134)			Aminophylline(DB01223)|Amrinone(DB01427)|Anagrelide(DB00261)|Cilostazol(DB01166)|Enoximone(DB04880)|Milrinone(DB00235)|Theophylline(DB00277)													---	---	---	---
SLCO1C1	53919	broad.mit.edu	37	12	20892989	20892989	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:20892989delA	uc001rej.3	+						SLCO1C1_uc010sii.1_Intron|SLCO1C1_uc010sij.1_Intron|SLCO1C1_uc009zip.2_Intron|SLCO1C1_uc001rei.2_Intron|SLCO1C1_uc010sik.1_Intron	NM_017435	NP_059131			solute carrier organic anion transporter family,						sodium-independent organic anion transport	integral to membrane|plasma membrane	thyroid hormone transmembrane transporter activity			ovary(5)|pancreas(1)|skin(1)	7	Esophageal squamous(101;0.149)																	---	---	---	---
KIAA0528	9847	broad.mit.edu	37	12	22637469	22637469	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:22637469delT	uc001rfq.2	-						KIAA0528_uc010sir.1_Intron|KIAA0528_uc010sis.1_Intron|KIAA0528_uc010sit.1_Intron|KIAA0528_uc010siu.1_Intron|KIAA0528_uc001rfr.2_Intron|KIAA0528_uc009ziy.1_Intron	NM_014802	NP_055617			hypothetical protein LOC9847								protein binding			ovary(1)|large_intestine(1)|breast(1)|central_nervous_system(1)	4																		---	---	---	---
KIAA0528	9847	broad.mit.edu	37	12	22659570	22659571	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:22659570_22659571insA	uc001rfq.2	-						KIAA0528_uc010sir.1_Intron|KIAA0528_uc010sis.1_Intron|KIAA0528_uc010sit.1_Intron|KIAA0528_uc010siu.1_Intron|KIAA0528_uc001rfr.2_Intron|KIAA0528_uc009ziy.1_Intron	NM_014802	NP_055617			hypothetical protein LOC9847								protein binding			ovary(1)|large_intestine(1)|breast(1)|central_nervous_system(1)	4																		---	---	---	---
SOX5	6660	broad.mit.edu	37	12	23894012	23894012	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:23894012delA	uc001rfw.2	-						SOX5_uc001rfx.2_Intron|SOX5_uc001rfy.2_Intron|SOX5_uc010siv.1_Intron|SOX5_uc010siw.1_Intron|SOX5_uc001rfz.1_Intron	NM_006940	NP_008871			SRY (sex determining region Y)-box 5 isoform a						transcription from RNA polymerase II promoter	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity			ovary(5)|lung(1)	6																		---	---	---	---
BHLHE41	79365	broad.mit.edu	37	12	26277871	26277871	+	5'UTR	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:26277871delC	uc001rhb.2	-	1						NM_030762	NP_110389			basic helix-loop-helix domain containing, class						cell differentiation|cell proliferation|organ morphogenesis	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
ARNTL2	56938	broad.mit.edu	37	12	27540143	27540143	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:27540143delT	uc001rht.1	+						ARNTL2_uc001rhw.2_Intron|ARNTL2_uc010sjp.1_Intron|ARNTL2_uc001rhu.1_Intron|ARNTL2_uc009zji.1_Intron|ARNTL2_uc001rhv.1_Intron	NM_020183	NP_064568			aryl hydrocarbon receptor nuclear						circadian rhythm|entrainment of circadian clock|regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|signal transducer activity			ovary(1)|skin(1)	2	Colorectal(261;0.0847)|Lung SC(9;0.184)																	---	---	---	---
PPFIBP1	8496	broad.mit.edu	37	12	27800899	27800899	+	Intron	DEL	A	-	-	rs112008008		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:27800899delA	uc001ric.1	+						PPFIBP1_uc010sjr.1_Intron|PPFIBP1_uc001rib.1_Intron|PPFIBP1_uc001ria.2_Intron|PPFIBP1_uc001rid.1_Intron	NM_003622	NP_003613			PTPRF interacting protein binding protein 1						cell adhesion	plasma membrane	protein binding		PPFIBP1/ALK(3)	soft_tissue(3)|kidney(1)|skin(1)	5	Lung SC(9;0.0873)																	---	---	---	---
PPFIBP1	8496	broad.mit.edu	37	12	27826780	27826780	+	Intron	DEL	T	-	-	rs2052673	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:27826780delT	uc001ric.1	+						PPFIBP1_uc010sjr.1_Intron|PPFIBP1_uc001rib.1_Intron|PPFIBP1_uc001ria.2_Intron|PPFIBP1_uc001rid.1_Intron|PPFIBP1_uc001rif.1_5'Flank	NM_003622	NP_003613			PTPRF interacting protein binding protein 1						cell adhesion	plasma membrane	protein binding		PPFIBP1/ALK(3)	soft_tissue(3)|kidney(1)|skin(1)	5	Lung SC(9;0.0873)																	---	---	---	---
LRRK2	120892	broad.mit.edu	37	12	40702752	40702752	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:40702752delA	uc001rmg.3	+						LRRK2_uc009zjw.2_Intron|LRRK2_uc001rmi.2_Intron	NM_198578	NP_940980			leucine-rich repeat kinase 2						activation of MAPKK activity|determination of adult lifespan|exploration behavior|intracellular distribution of mitochondria|negative regulation of branching morphogenesis of a nerve|negative regulation of dendritic spine morphogenesis|negative regulation of neuroblast proliferation|negative regulation of neuron maturation|neuromuscular junction development|neuron death|peptidyl-serine phosphorylation|positive regulation of autophagy|positive regulation of dopamine receptor signaling pathway|positive regulation of programmed cell death|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein phosphorylation|positive regulation of protein ubiquitination|protein autophosphorylation|regulation of kidney size|regulation of locomotion|regulation of membrane potential|response to oxidative stress|small GTPase mediated signal transduction|tangential migration from the subventricular zone to the olfactory bulb	external side of mitochondrial outer membrane	ATP binding|GTP binding|GTP-dependent protein kinase activity|GTPase activator activity|MAP kinase kinase activity|protein homodimerization activity|tubulin binding			ovary(12)|stomach(5)|upper_aerodigestive_tract(2)|lung(2)|large_intestine(1)|urinary_tract(1)|pancreas(1)	24	all_cancers(12;0.00108)|Breast(8;0.218)	Lung NSC(34;0.0942)|all_lung(34;0.11)																---	---	---	---
ADAMTS20	80070	broad.mit.edu	37	12	43820983	43820983	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:43820983delA	uc010skx.1	-						ADAMTS20_uc001rno.1_Intron	NM_025003	NP_079279			a disintegrin-like and metalloprotease with							proteinaceous extracellular matrix	zinc ion binding			central_nervous_system(5)|ovary(4)|lung(3)|large_intestine(2)|skin(2)|urinary_tract(1)|kidney(1)|pancreas(1)	19	all_cancers(12;2.6e-05)|Lung SC(27;0.184)	Lung NSC(34;0.0569)|all_lung(34;0.129)		GBM - Glioblastoma multiforme(48;0.0473)														---	---	---	---
ADAMTS20	80070	broad.mit.edu	37	12	43837404	43837405	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:43837404_43837405delTT	uc010skx.1	-							NM_025003	NP_079279			a disintegrin-like and metalloprotease with							proteinaceous extracellular matrix	zinc ion binding			central_nervous_system(5)|ovary(4)|lung(3)|large_intestine(2)|skin(2)|urinary_tract(1)|kidney(1)|pancreas(1)	19	all_cancers(12;2.6e-05)|Lung SC(27;0.184)	Lung NSC(34;0.0569)|all_lung(34;0.129)		GBM - Glioblastoma multiforme(48;0.0473)														---	---	---	---
SENP1	29843	broad.mit.edu	37	12	48458896	48458896	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48458896delT	uc001rqx.2	-	12	1673	c.1227delA	c.(1225-1227)AAAfs	p.K409fs	SENP1_uc001rqw.2_Frame_Shift_Del_p.K409fs|SENP1_uc001rqy.2_Frame_Shift_Del_p.K210fs|SENP1_uc001rqz.2_Frame_Shift_Del_p.K210fs|SENP1_uc009zkx.2_Frame_Shift_Del_p.K409fs	NM_014554	NP_055369	Q9P0U3	SENP1_HUMAN	sentrin/SUMO-specific protease 1	409					activation of caspase activity|induction of apoptosis by extracellular signals|protein desumoylation|proteolysis	cytoplasm|nucleus	endopeptidase activity|SUMO-specific protease activity	p.G410fs*3(1)		pancreas(2)|lung(1)	3		Acute lymphoblastic leukemia(13;0.108)|all_hematologic(14;0.214)																---	---	---	---
C12orf54	121273	broad.mit.edu	37	12	48882265	48882265	+	Intron	DEL	A	-	-	rs71439447		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48882265delA	uc001rrr.2	+						C12orf54_uc009zky.1_Intron	NM_152319	NP_689532			hypothetical protein LOC121273												0																		---	---	---	---
LALBA	3906	broad.mit.edu	37	12	48963167	48963167	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48963167delA	uc001rrt.2	-							NM_002289	NP_002280			lactalbumin, alpha- precursor						cell-cell signaling|defense response to bacterium|induction of apoptosis|lactose biosynthetic process|signal transduction	extracellular space	calcium ion binding|lactose synthase activity				0																		---	---	---	---
TUBA1A	7846	broad.mit.edu	37	12	49580022	49580022	+	Intron	DEL	A	-	-	rs12822187		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49580022delA	uc009zlf.2	-						TUBA1B_uc001rto.2_Intron|TUBA1A_uc001rtp.2_Intron|TUBA1A_uc001rtq.2_Intron|TUBA1A_uc001rtr.2_Intron|TUBA1A_uc009zlg.2_Intron	NM_006009	NP_006000			tubulin, alpha 1a						'de novo' posttranslational protein folding|G2/M transition of mitotic cell cycle|microtubule-based movement|protein polymerization	cytosol|microtubule	GTP binding|GTPase activity|structural molecule activity				0																		---	---	---	---
KCNH3	23416	broad.mit.edu	37	12	49943832	49943832	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49943832delC	uc001ruh.1	+						KCNH3_uc010smj.1_Intron	NM_012284	NP_036416			potassium voltage-gated channel, subfamily H						regulation of transcription, DNA-dependent	integral to membrane	two-component sensor activity|voltage-gated potassium channel activity				0																		---	---	---	---
MCRS1	10445	broad.mit.edu	37	12	49960391	49960391	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49960391delG	uc001ruk.1	-						MCRS1_uc001rui.1_5'Flank|MCRS1_uc001ruj.1_5'UTR|MCRS1_uc001rul.1_Intron|MCRS1_uc009zlj.1_Intron|MCRS1_uc001rum.1_Intron|MCRS1_uc001run.1_Intron	NM_006337	NP_006328			microspherule protein 1 isoform 1						DNA recombination|DNA repair|protein modification process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|Ino80 complex|MLL1 complex|nucleolus	protein binding			large_intestine(1)	1																		---	---	---	---
RACGAP1	29127	broad.mit.edu	37	12	50388297	50388297	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50388297delA	uc001rvt.2	-						RACGAP1_uc009zlm.1_Intron|RACGAP1_uc001rvs.2_Intron|RACGAP1_uc001rvu.2_Intron	NM_013277	NP_037409			Rac GTPase activating protein 1						blood coagulation|cytokinesis, actomyosin contractile ring assembly|cytokinesis, initiation of separation|embryo development|microtubule-based movement|neuroblast proliferation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction|spermatogenesis|sulfate transport	acrosomal vesicle|cytosol|microtubule|midbody|nucleus|spindle	alpha-tubulin binding|beta-tubulin binding|gamma-tubulin binding|GTPase activator activity|metal ion binding			kidney(1)	1																		---	---	---	---
LARP4	113251	broad.mit.edu	37	12	50834163	50834163	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50834163delA	uc001rwp.1	+						LARP4_uc001rwo.1_Intron|LARP4_uc001rwq.1_Intron|LARP4_uc001rwr.1_Intron|LARP4_uc001rws.1_Intron|LARP4_uc009zlr.1_Intron|LARP4_uc001rwt.1_5'Flank|LARP4_uc001rwm.2_Intron|LARP4_uc001rwn.2_Intron	NM_052879	NP_443111			c-Mpl binding protein isoform a								nucleotide binding|RNA binding			ovary(1)	1																		---	---	---	---
DIP2B	57609	broad.mit.edu	37	12	51034721	51034721	+	Intron	DEL	C	-	-	rs2731436	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51034721delC	uc001rwv.2	+						DIP2B_uc001rwu.2_Intron|DIP2B_uc009zls.1_Intron	NM_173602	NP_775873			DIP2 disco-interacting protein 2 homolog B							nucleus	catalytic activity|transcription factor binding			ovary(4)|breast(1)|pancreas(1)	6																		---	---	---	---
SPRYD3	84926	broad.mit.edu	37	12	53470733	53470733	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53470733delA	uc001sbt.1	-						SPRYD3_uc010snw.1_Intron	NM_032840	NP_116229			SPRY domain containing 3											central_nervous_system(1)	1																		---	---	---	---
HOXC12	3228	broad.mit.edu	37	12	54348555	54348559	+	5'Flank	DEL	GGGAT	-	-	rs72049639		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54348555_54348559delGGGAT	uc010soq.1	+							NM_173860	NP_776272			homeobox C12						multicellular organismal development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			upper_aerodigestive_tract(1)	1																		---	---	---	---
OR6C70	390327	broad.mit.edu	37	12	55863619	55863619	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:55863619delA	uc010spn.1	-	1	304	c.304delT	c.(304-306)TACfs	p.Y102fs		NM_001005499	NP_001005499	A6NIJ9	O6C70_HUMAN	olfactory receptor, family 6, subfamily C,	102	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1																		---	---	---	---
ERBB3	2065	broad.mit.edu	37	12	56493246	56493246	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56493246delT	uc001sjh.2	+						ERBB3_uc009zoj.2_Intron|ERBB3_uc010sqb.1_Intron|ERBB3_uc010sqc.1_Intron|ERBB3_uc009zok.2_Intron|ERBB3_uc001sjk.2_Intron|ERBB3_uc001sjl.2_Intron	NM_001982	NP_001973			erbB-3 isoform 1 precursor						cranial nerve development|heart development|negative regulation of cell adhesion|negative regulation of neuron apoptosis|negative regulation of secretion|negative regulation of signal transduction|neuron apoptosis|phosphatidylinositol 3-kinase cascade|positive regulation of phosphatidylinositol 3-kinase cascade|regulation of cell proliferation|Schwann cell differentiation|transmembrane receptor protein tyrosine kinase signaling pathway|wound healing	basolateral plasma membrane|extracellular space|integral to plasma membrane|receptor complex	ATP binding|growth factor binding|protein heterodimerization activity|protein homodimerization activity|protein tyrosine kinase activator activity|receptor signaling protein tyrosine kinase activity|transmembrane receptor protein tyrosine kinase activity			lung(3)|central_nervous_system(2)|stomach(1)|ovary(1)|skin(1)	8			OV - Ovarian serous cystadenocarcinoma(18;0.112)															---	---	---	---
PA2G4	5036	broad.mit.edu	37	12	56505493	56505494	+	Intron	INS	-	AT	AT	rs143474707	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56505493_56505494insAT	uc001sjm.2	+						PA2G4_uc009zol.2_Intron|PA2G4_uc009zom.2_Intron	NM_006191	NP_006182			ErbB3-binding protein 1						cell cycle arrest|cell proliferation|negative regulation of transcription, DNA-dependent|regulation of translation|rRNA processing	cytoplasm|nucleolus|ribonucleoprotein complex	DNA binding|RNA binding|sequence-specific DNA binding transcription factor activity|ubiquitin protein ligase binding				0			OV - Ovarian serous cystadenocarcinoma(18;0.0739)															---	---	---	---
TIMELESS	8914	broad.mit.edu	37	12	56816604	56816604	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56816604delC	uc001slf.2	-							NM_003920	NP_003911			timeless homolog						cell division|circadian rhythm|detection of abiotic stimulus|mitosis|morphogenesis of an epithelium|negative regulation of transcription, DNA-dependent|regulation of S phase|response to DNA damage stimulus|transcription, DNA-dependent	nuclear chromatin				ovary(5)|breast(2)|pancreas(1)	8																		---	---	---	---
PIP4K2C	79837	broad.mit.edu	37	12	57989486	57989487	+	Intron	DEL	AA	-	-	rs72197760		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57989486_57989487delAA	uc001sou.2	+						PIP4K2C_uc001sot.2_Intron|PIP4K2C_uc010srs.1_Intron|PIP4K2C_uc010srt.1_Intron	NM_001146258	NP_001139730			phosphatidylinositol-5-phosphate 4-kinase, type							cytoplasm|membrane	1-phosphatidylinositol-5-phosphate 4-kinase activity|ATP binding|identical protein binding			central_nervous_system(2)|lung(1)	3	Melanoma(17;0.122)																	---	---	---	---
MON2	23041	broad.mit.edu	37	12	62929648	62929648	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:62929648delG	uc001sre.2	+						MON2_uc009zqj.2_Intron|MON2_uc010ssl.1_Intron|MON2_uc010ssm.1_Intron|MON2_uc010ssn.1_Intron|MON2_uc001srf.2_Intron	NM_015026	NP_055841			MON2 homolog						Golgi to endosome transport|protein transport	cytoplasm	ARF guanyl-nucleotide exchange factor activity|binding			central_nervous_system(2)	2			BRCA - Breast invasive adenocarcinoma(9;0.218)	GBM - Glioblastoma multiforme(28;0.128)														---	---	---	---
RAP1B	5908	broad.mit.edu	37	12	69020555	69020555	+	Intron	DEL	T	-	-	rs74812051		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:69020555delT	uc001sub.2	+						RAP1B_uc010ste.1_Intron|RAP1B_uc001suc.2_Intron|RAP1B_uc010stf.1_Intron|RAP1B_uc010stg.1_Intron|RAP1B_uc010sth.1_Intron|RAP1B_uc010sti.1_Intron	NM_001089704	NP_001083173			SubName: Full=Ras-related protein Rap-1A; SubName: Full=cDNA FLJ75985, highly similar to Homo sapiens RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2, mRNA; SubName: Full=RAP1A, member of RAS oncogene family;						blood coagulation|energy reserve metabolic process|regulation of establishment of cell polarity|regulation of insulin secretion	cell-cell junction|cytosol	GDP binding|GTP binding|GTPase activity|protein binding				0	Breast(13;1.24e-05)		Lung(24;0.000131)|LUAD - Lung adenocarcinoma(15;0.00107)|STAD - Stomach adenocarcinoma(21;0.00694)	GBM - Glioblastoma multiforme(7;0.000306)														---	---	---	---
GLIPR1L2	144321	broad.mit.edu	37	12	75804168	75804168	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:75804168delA	uc001sxr.1	+						GLIPR1L2_uc001sxp.1_Intron|GLIPR1L2_uc001sxq.1_Intron	NM_152436	NP_689649			GLI pathogenesis-related 1 like 2							integral to membrane				ovary(1)	1																		---	---	---	---
NAP1L1	4673	broad.mit.edu	37	12	76468066	76468066	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:76468066delA	uc001sxw.2	-						NAP1L1_uc001sxz.2_Intron|NAP1L1_uc001sxx.2_Intron|NAP1L1_uc001sxy.2_Intron|NAP1L1_uc010sty.1_Intron|NAP1L1_uc010stz.1_Intron|NAP1L1_uc010sua.1_Intron|NAP1L1_uc001syb.2_Intron|NAP1L1_uc001sya.2_Intron|NAP1L1_uc001syc.2_Intron	NM_139207	NP_631946			nucleosome assembly protein 1-like 1						DNA replication|nucleosome assembly|positive regulation of cell proliferation	chromatin assembly complex|melanosome	protein binding			ovary(1)|skin(1)	2		Colorectal(145;0.09)																---	---	---	---
Unknown	0	broad.mit.edu	37	12	80645584	80645585	+	IGR	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:80645584_80645585insT								PPP1R12A (316349 upstream) : PTPRQ (192541 downstream)																																			---	---	---	---
ACSS3	79611	broad.mit.edu	37	12	81648873	81648873	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:81648873delT	uc001szl.1	+	16					ACSS3_uc001szm.1_3'UTR|ACSS3_uc001szn.1_3'UTR	NM_024560	NP_078836			acyl-CoA synthetase short-chain family member 3							mitochondrion	acetate-CoA ligase activity|ATP binding			ovary(1)|lung(1)|central_nervous_system(1)|skin(1)	4																		---	---	---	---
PPFIA2	8499	broad.mit.edu	37	12	81655693	81655693	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:81655693delT	uc001szo.1	-						PPFIA2_uc010sue.1_Intron|PPFIA2_uc010sug.1_Intron|PPFIA2_uc010suh.1_Intron|PPFIA2_uc010suf.1_Intron|PPFIA2_uc009zsh.2_Intron	NM_003625	NP_003616			PTPRF interacting protein alpha 2											ovary(3)|lung(2)|pancreas(1)	6																		---	---	---	---
LRRIQ1	84125	broad.mit.edu	37	12	85554294	85554294	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:85554294delT	uc001tac.2	+							NM_001079910	NP_001073379			leucine-rich repeats and IQ motif containing 1											ovary(4)|central_nervous_system(1)|skin(1)	6				GBM - Glioblastoma multiforme(134;0.212)														---	---	---	---
CEP290	80184	broad.mit.edu	37	12	88514121	88514121	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:88514121delT	uc001tar.2	-						CEP290_uc001tat.2_Intron|CEP290_uc009zsl.1_Intron	NM_025114	NP_079390			centrosomal protein 290kDa						cilium assembly|eye photoreceptor cell development|G2/M transition of mitotic cell cycle|hindbrain development|otic vesicle formation|positive regulation of transcription, DNA-dependent|pronephros development|protein transport	cell surface|centrosome|cytosol|nucleus|photoreceptor connecting cilium	protein binding			ovary(5)|breast(1)|pancreas(1)	7																		---	---	---	---
TMTC3	160418	broad.mit.edu	37	12	88542053	88542053	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:88542053delT	uc001tau.2	+						TMTC3_uc009zsm.2_Intron	NM_181783	NP_861448			transmembrane and tetratricopeptide repeat							integral to membrane	binding			skin(1)	1																		---	---	---	---
POC1B	282809	broad.mit.edu	37	12	89853510	89853510	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:89853510delA	uc001tbc.2	-						POC1B_uc001tba.2_Intron|POC1B_uc001tbb.2_Intron|POC1B_uc010sun.1_Intron|POC1B_uc009zsp.2_Intron|POC1B_uc009zsq.2_Intron	NM_172240	NP_758440			WD repeat domain 51B						cell projection organization	centriole|microtubule basal body				ovary(1)	1																		---	---	---	---
SNRPF	6636	broad.mit.edu	37	12	96259866	96259866	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:96259866delT	uc001tej.2	+	4						NM_003095	NP_003086			small nuclear ribonucleoprotein polypeptide F						histone mRNA metabolic process|ncRNA metabolic process|spliceosomal snRNP assembly|termination of RNA polymerase II transcription	catalytic step 2 spliceosome|cytosol|nucleoplasm|U12-type spliceosomal complex|U7 snRNP	protein binding|RNA binding				0																		---	---	---	---
CCDC38	120935	broad.mit.edu	37	12	96292432	96292432	+	Frame_Shift_Del	DEL	T	-	-	rs142628960		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:96292432delT	uc001tek.1	-	6	681	c.447delA	c.(445-447)AAAfs	p.K149fs		NM_182496	NP_872302	Q502W7	CCD38_HUMAN	coiled-coil domain containing 38	149	Potential.									skin(1)	1																		---	---	---	---
ELK3	2004	broad.mit.edu	37	12	96653864	96653865	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:96653864_96653865insT	uc001teo.1	+							NM_005230	NP_005221			ELK3 protein						negative regulation of transcription, DNA-dependent|signal transduction	mitochondrion	protein binding|purine-rich negative regulatory element binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(1)	1	all_cancers(2;0.00173)																	---	---	---	---
UHRF1BP1L	23074	broad.mit.edu	37	12	100443930	100443930	+	Intron	DEL	A	-	-	rs150785024		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100443930delA	uc001tgq.2	-						UHRF1BP1L_uc001tgp.2_Intron	NM_015054	NP_055869			UHRF1 (ICBP90) binding protein 1-like isoform a											ovary(2)	2																		---	---	---	---
UHRF1BP1L	23074	broad.mit.edu	37	12	100464069	100464069	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100464069delT	uc001tgq.2	-						UHRF1BP1L_uc001tgr.2_Intron|UHRF1BP1L_uc001tgp.2_Intron	NM_015054	NP_055869			UHRF1 (ICBP90) binding protein 1-like isoform a											ovary(2)	2																		---	---	---	---
SLC5A8	160728	broad.mit.edu	37	12	101584434	101584434	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101584434delA	uc001thz.3	-							NM_145913	NP_666018			solute carrier family 5 (iodide transporter),						apoptosis|sodium ion transport	apical plasma membrane|integral to membrane	monocarboxylic acid transmembrane transporter activity|passive transmembrane transporter activity|symporter activity				0																		---	---	---	---
UTP20	27340	broad.mit.edu	37	12	101700103	101700104	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101700103_101700104delTT	uc001tia.1	+							NM_014503	NP_055318			down-regulated in metastasis						endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|negative regulation of cell proliferation	90S preribosome|cytoplasm|nucleolus|nucleoplasm|preribosome, small subunit precursor|small-subunit processome	protein binding			ovary(2)|breast(2)	4																		---	---	---	---
UTP20	27340	broad.mit.edu	37	12	101701820	101701820	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101701820delA	uc001tia.1	+							NM_014503	NP_055318			down-regulated in metastasis						endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|negative regulation of cell proliferation	90S preribosome|cytoplasm|nucleolus|nucleoplasm|preribosome, small subunit precursor|small-subunit processome	protein binding			ovary(2)|breast(2)	4																		---	---	---	---
SYCP3	50511	broad.mit.edu	37	12	102122901	102122901	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:102122901delT	uc001tiq.2	-	8	775	c.643delA	c.(643-645)ATTfs	p.I215fs	CHPT1_uc001tip.1_3'UTR|SYCP3_uc001tir.2_Frame_Shift_Del_p.I215fs|SYCP3_uc001tis.2_Frame_Shift_Del_p.I215fs	NM_153694	NP_710161	Q8IZU3	SYCP3_HUMAN	synaptonemal complex protein 3	215	Potential.|Gln-rich.				cell division|male meiosis I|spermatogenesis, exchange of chromosomal proteins	nucleus	DNA binding				0																		---	---	---	---
HSP90B1	7184	broad.mit.edu	37	12	104340286	104340286	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104340286delT	uc001tkb.1	+						HSP90B1_uc010swg.1_Intron|HSP90B1_uc009zui.1_Intron	NM_003299	NP_003290			heat shock protein 90kDa beta, member 1						actin rod assembly|anti-apoptosis|cellular response to ATP|ER-associated protein catabolic process|protein folding|protein transport|regulation of phosphoprotein phosphatase activity|response to hypoxia|sequestering of calcium ion	cytosol|endoplasmic reticulum lumen|endoplasmic reticulum membrane|melanosome|microsome|midbody|perinuclear region of cytoplasm	ATP binding|calcium ion binding|low-density lipoprotein particle receptor binding|protein phosphatase binding|RNA binding|unfolded protein binding|virion binding			ovary(2)|skin(1)	3					Rifabutin(DB00615)													---	---	---	---
GLT8D2	83468	broad.mit.edu	37	12	104396751	104396752	+	Intron	DEL	AG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104396751_104396752delAG	uc001tkh.1	-						GLT8D2_uc001tki.1_Intron	NM_031302	NP_112592			glycosyltransferase 8 domain containing 2							integral to membrane	transferase activity, transferring glycosyl groups			ovary(1)|skin(1)	2																		---	---	---	---
APPL2	55198	broad.mit.edu	37	12	105570796	105570797	+	Splice_Site	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:105570796_105570797insG	uc001tlf.1	-	19	1890	c.1672_splice	c.e19-1	p.F558_splice	APPL2_uc010swt.1_Splice_Site_p.F515_splice|APPL2_uc001tlg.1_Splice_Site_p.F312_splice|APPL2_uc010swu.1_Splice_Site_p.F564_splice	NM_018171	NP_060641			adaptor protein, phosphotyrosine interaction, PH						cell cycle|cell proliferation|signal transduction	early endosome membrane|nucleus	protein binding			upper_aerodigestive_tract(1)	1																		---	---	---	---
NUAK1	9891	broad.mit.edu	37	12	106466409	106466410	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:106466409_106466410insT	uc001tlj.1	-							NM_014840	NP_055655			AMPK-related protein kinase 5								ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
IFT81	28981	broad.mit.edu	37	12	110584651	110584651	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:110584651delA	uc001tqi.2	+						IFT81_uc001tqh.2_Intron|IFT81_uc001tqj.2_Intron|IFT81_uc001tqg.2_Intron	NM_001143779	NP_001137251			intraflagellar transport 81-like isoform 1						cell differentiation|multicellular organismal development|spermatogenesis	intraflagellar transport particle B|microtubule-based flagellum				ovary(1)	1																		---	---	---	---
PTPN11	5781	broad.mit.edu	37	12	112939837	112939837	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112939837delT	uc001ttx.2	+							NM_002834	NP_002825			protein tyrosine phosphatase, non-receptor type						axon guidance|cell junction assembly|ephrin receptor signaling pathway|epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|interferon-gamma-mediated signaling pathway|leukocyte migration|platelet activation|regulation of cell adhesion mediated by integrin|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|T cell costimulation|type I interferon-mediated signaling pathway	cytosol	non-membrane spanning protein tyrosine phosphatase activity|protein binding			haematopoietic_and_lymphoid_tissue(375)|lung(6)|autonomic_ganglia(2)|soft_tissue(2)|central_nervous_system(2)|large_intestine(1)|skin(1)|ovary(1)|NS(1)|kidney(1)	392								Mis		JMML|AML|MDS		Noonan Syndrome		Noonan_syndrome				---	---	---	---
MED13L	23389	broad.mit.edu	37	12	116428705	116428705	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:116428705delT	uc001tvw.2	-							NM_015335	NP_056150			mediator complex subunit 13-like						regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent					skin(4)|ovary(2)|upper_aerodigestive_tract(1)|lung(1)	8	all_neural(191;0.117)|Medulloblastoma(191;0.163)			BRCA - Breast invasive adenocarcinoma(302;0.0407)														---	---	---	---
FBXO21	23014	broad.mit.edu	37	12	117612801	117612802	+	Intron	DEL	AA	-	-	rs138433024		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:117612801_117612802delAA	uc001twk.2	-						FBXO21_uc001twj.2_Intron|FBXO21_uc009zwq.2_Intron	NM_033624	NP_296373			F-box only protein 21 isoform 1						ubiquitin-dependent protein catabolic process	ubiquitin ligase complex	ubiquitin-protein ligase activity			kidney(1)	1	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)			BRCA - Breast invasive adenocarcinoma(302;0.0291)														---	---	---	---
KSR2	283455	broad.mit.edu	37	12	117965154	117965157	+	Intron	DEL	ACAC	-	-	rs7309204		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:117965154_117965157delACAC	uc001two.2	-							NM_173598	NP_775869			kinase suppressor of ras 2						intracellular signal transduction	cytoplasm|membrane	ATP binding|metal ion binding|protein serine/threonine kinase activity			lung(10)|central_nervous_system(2)|stomach(1)|large_intestine(1)|breast(1)	15	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---
KSR2	283455	broad.mit.edu	37	12	118406112	118406112	+	5'Flank	DEL	A	-	-	rs7309205	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:118406112delA	uc001two.2	-							NM_173598	NP_775869			kinase suppressor of ras 2						intracellular signal transduction	cytoplasm|membrane	ATP binding|metal ion binding|protein serine/threonine kinase activity			lung(10)|central_nervous_system(2)|stomach(1)|large_intestine(1)|breast(1)	15	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---
COQ5	84274	broad.mit.edu	37	12	120960838	120960838	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:120960838delA	uc001tyn.2	-						COQ5_uc001tyo.2_Intron|COQ5_uc010szj.1_Intron	NM_032314	NP_115690			coenzyme Q5 homolog, methyltransferase						ubiquinone biosynthetic process	mitochondrion	methyltransferase activity			ovary(1)	1	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---
Unknown	0	broad.mit.edu	37	12	121354661	121354661	+	IGR	DEL	A	-	-	rs35709164		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:121354661delA								SPPL3 (12510 upstream) : C12orf27 (52980 downstream)																																			---	---	---	---
RNF34	80196	broad.mit.edu	37	12	121840361	121840361	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:121840361delA	uc001ual.1	+						RNF34_uc010szw.1_Intron|RNF34_uc001uak.1_Intron|RNF34_uc001uam.1_Intron	NM_025126	NP_079402			ring finger protein 34 isoform 2						apoptosis	endomembrane system|membrane|nuclear speck	ligase activity|zinc ion binding				0	all_neural(191;0.0684)|Medulloblastoma(191;0.0922)			OV - Ovarian serous cystadenocarcinoma(86;0.000432)|Epithelial(86;0.00233)														---	---	---	---
TMEM120B	144404	broad.mit.edu	37	12	122181462	122181462	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:122181462delA	uc001ubc.3	+						TMEM120B_uc009zxh.2_Intron	NM_001080825	NP_001074294			transmembrane protein 120B							integral to membrane					0	all_neural(191;0.0684)|Medulloblastoma(191;0.0922)			OV - Ovarian serous cystadenocarcinoma(86;5.75e-05)|Epithelial(86;0.000128)|BRCA - Breast invasive adenocarcinoma(302;0.238)														---	---	---	---
KNTC1	9735	broad.mit.edu	37	12	123058773	123058773	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123058773delT	uc001ucv.2	+						KNTC1_uc010taf.1_Intron	NM_014708	NP_055523			Rough Deal homolog, centromere/kinetochore						cell division|mitotic cell cycle checkpoint|mitotic prometaphase|protein complex assembly|regulation of exit from mitosis	condensed chromosome kinetochore|cytosol|kinetochore microtubule|nucleus|spindle pole	protein binding			ovary(5)|kidney(3)|lung(1)|central_nervous_system(1)	10	all_neural(191;0.0837)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;7.21e-05)|Epithelial(86;0.000178)|BRCA - Breast invasive adenocarcinoma(302;0.217)														---	---	---	---
RILPL1	353116	broad.mit.edu	37	12	123970064	123970064	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123970064delA	uc001ufe.2	-						RILPL1_uc001ufd.2_Intron|RILPL1_uc010tas.1_Intron	NM_178314	NP_847884			Rab interacting lysosomal protein-like 1						neuroprotection	cytosol					0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000224)|Epithelial(86;0.00067)|all cancers(50;0.00836)|BRCA - Breast invasive adenocarcinoma(302;0.197)														---	---	---	---
DNAH10	196385	broad.mit.edu	37	12	124285564	124285564	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124285564delA	uc001uft.3	+						DNAH10_uc010tav.1_Intron|DNAH10_uc010taw.1_Intron	NM_207437	NP_997320			dynein, axonemal, heavy chain 10						microtubule-based movement	cilium axoneme|cytoplasm|dynein complex|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(3)|skin(2)|central_nervous_system(1)	6	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000207)|Epithelial(86;0.000556)|all cancers(50;0.00346)														---	---	---	---
GLT1D1	144423	broad.mit.edu	37	12	129384092	129384095	+	Intron	DEL	TTTT	-	-	rs34973787		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:129384092_129384095delTTTT	uc010tbh.1	+						GLT1D1_uc001uhx.1_Intron|GLT1D1_uc001uhy.1_Intron	NM_144669	NP_653270			glycosyltransferase 1 domain containing 1						biosynthetic process	extracellular region	transferase activity, transferring glycosyl groups				0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;3.97e-06)|Epithelial(86;3.97e-05)|all cancers(50;0.00019)														---	---	---	---
GOLGA3	2802	broad.mit.edu	37	12	133363543	133363544	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:133363543_133363544delTT	uc001ukz.1	-						GOLGA3_uc001ula.1_Intron|GOLGA3_uc001ulb.2_Intron	NM_005895	NP_005886			Golgi autoantigen, golgin subfamily a, 3						intra-Golgi vesicle-mediated transport	Golgi cisterna membrane|Golgi transport complex	protein binding|transporter activity			ovary(3)|central_nervous_system(2)|pancreas(1)	6	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0176)|Lung NSC(355;0.204)		OV - Ovarian serous cystadenocarcinoma(86;2.27e-08)|Epithelial(86;3.34e-07)|all cancers(50;9.4e-06)														---	---	---	---
ZMYM2	7750	broad.mit.edu	37	13	20638677	20638677	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:20638677delA	uc001umr.2	+	20	3422	c.3124delA	c.(3124-3126)AAAfs	p.K1042fs	ZMYM2_uc001ums.2_Frame_Shift_Del_p.K1042fs|ZMYM2_uc001umt.2_Frame_Shift_Del_p.K1042fs|ZMYM2_uc001umv.2_Frame_Shift_Del_p.K422fs|ZMYM2_uc001umw.2_Frame_Shift_Del_p.K495fs	NM_003453	NP_003444	Q9UBW7	ZMYM2_HUMAN	zinc finger protein 198	1042					regulation of transcription, DNA-dependent|transcription, DNA-dependent	PML body	ubiquitin conjugating enzyme binding|zinc ion binding			lung(3)|ovary(2)|prostate(1)	6		all_cancers(29;8.65e-21)|all_epithelial(30;1.04e-18)|all_lung(29;6.75e-18)|Lung SC(185;0.0262)|Ovarian(182;0.162)		all cancers(112;0.000148)|Epithelial(112;0.000249)|OV - Ovarian serous cystadenocarcinoma(117;0.00816)|Lung(94;0.0173)|LUSC - Lung squamous cell carcinoma(192;0.0856)														---	---	---	---
Unknown	0	broad.mit.edu	37	13	21677699	21677699	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:21677699delA								LATS2 (41977 upstream) : SAP18 (36954 downstream)																																			---	---	---	---
LOC374491	374491	broad.mit.edu	37	13	25141203	25141203	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25141203delA	uc001upm.2	+											Homo sapiens mRNA; cDNA DKFZp434J0717 (from clone DKFZp434J0717).												0																		---	---	---	---
PDS5B	23047	broad.mit.edu	37	13	33344888	33344888	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:33344888delA	uc010abf.2	+	33	4319	c.4161delA	c.(4159-4161)CCAfs	p.P1387fs	PDS5B_uc010abg.2_RNA	NM_015032	NP_055847	Q9NTI5	PDS5B_HUMAN	PDS5, regulator of cohesion maintenance, homolog	1387					cell division|cell proliferation|mitotic sister chromatid cohesion|negative regulation of cell proliferation	chromatin|nucleus	ATP binding|DNA binding|identical protein binding			ovary(2)|lung(1)|pancreas(1)	4		Lung SC(185;0.0367)		all cancers(112;5.55e-06)|Epithelial(112;2.7e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.00303)|BRCA - Breast invasive adenocarcinoma(63;0.0204)														---	---	---	---
KL	9365	broad.mit.edu	37	13	33637746	33637746	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:33637746delA	uc001uus.2	+							NM_004795	NP_004786			klotho precursor						aging|carbohydrate metabolic process|insulin receptor signaling pathway|positive regulation of bone mineralization	extracellular space|extracellular space|integral to membrane|integral to plasma membrane|membrane fraction|soluble fraction	beta-glucosidase activity|beta-glucuronidase activity|cation binding|fibroblast growth factor binding|hormone activity|signal transducer activity|vitamin D binding			large_intestine(1)|ovary(1)|skin(1)	3	all_epithelial(80;0.133)	Ovarian(182;1.78e-06)|Breast(139;4.08e-05)|Hepatocellular(188;0.00886)|Lung SC(185;0.0262)		GBM - Glioblastoma multiforme(144;7.13e-230)|all cancers(112;1.33e-165)|OV - Ovarian serous cystadenocarcinoma(117;1.09e-113)|Epithelial(112;3.79e-112)|Lung(94;8.52e-27)|LUSC - Lung squamous cell carcinoma(192;1.4e-13)|Kidney(163;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(186;5.63e-08)|BRCA - Breast invasive adenocarcinoma(63;1.41e-05)														---	---	---	---
NAA16	79612	broad.mit.edu	37	13	41941505	41941505	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:41941505delT	uc001uyf.2	+						NAA16_uc010tfg.1_Intron	NM_024561	NP_078837			NMDA receptor regulated 1-like protein isoform						N-terminal protein amino acid acetylation|positive regulation of transcription, DNA-dependent	cytoplasm|transcription factor complex	binding			central_nervous_system(1)	1																		---	---	---	---
KIAA0564	23078	broad.mit.edu	37	13	42306420	42306420	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:42306420delA	uc001uyj.2	-						KIAA0564_uc001uyk.2_Intron	NM_015058	NP_055873			hypothetical protein LOC23078 isoform a							extracellular region	ATP binding|ATPase activity			ovary(3)|upper_aerodigestive_tract(1)|kidney(1)|skin(1)	6		Lung NSC(96;4.61e-06)|Prostate(109;0.0167)|Lung SC(185;0.0262)|Breast(139;0.0854)|Hepatocellular(98;0.114)		OV - Ovarian serous cystadenocarcinoma(117;0.000368)|GBM - Glioblastoma multiforme(144;0.0033)|BRCA - Breast invasive adenocarcinoma(63;0.0969)														---	---	---	---
KIAA0564	23078	broad.mit.edu	37	13	42393543	42393543	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:42393543delA	uc001uyj.2	-						KIAA0564_uc001uyk.2_Intron	NM_015058	NP_055873			hypothetical protein LOC23078 isoform a							extracellular region	ATP binding|ATPase activity			ovary(3)|upper_aerodigestive_tract(1)|kidney(1)|skin(1)	6		Lung NSC(96;4.61e-06)|Prostate(109;0.0167)|Lung SC(185;0.0262)|Breast(139;0.0854)|Hepatocellular(98;0.114)		OV - Ovarian serous cystadenocarcinoma(117;0.000368)|GBM - Glioblastoma multiforme(144;0.0033)|BRCA - Breast invasive adenocarcinoma(63;0.0969)														---	---	---	---
C13orf31	144811	broad.mit.edu	37	13	44464520	44464520	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:44464520delA	uc010acg.2	+						C13orf31_uc001uzf.3_Intron	NM_001128303	NP_001121775			hypothetical protein LOC144811												0		Lung NSC(96;0.000163)|all_hematologic(4;0.0127)|Prostate(109;0.0233)|Hepatocellular(98;0.0268)|Breast(139;0.0364)|Lung SC(185;0.0367)|Acute lymphoblastic leukemia(4;0.138)		GBM - Glioblastoma multiforme(144;0.000573)|BRCA - Breast invasive adenocarcinoma(63;0.121)														---	---	---	---
C13orf18	80183	broad.mit.edu	37	13	46935559	46935559	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:46935559delT	uc010acl.2	-						C13orf18_uc001vbf.3_Intron|C13orf18_uc001vbg.3_Intron|C13orf18_uc010tfz.1_Intron|C13orf18_uc010acm.2_Intron|C13orf18_uc010acn.2_Intron|C13orf18_uc001vbe.3_Intron|C13orf18_uc001vbh.3_Intron|C13orf18_uc001vbi.3_Intron|C13orf18_uc010aco.1_Intron	NM_025113	NP_079389			hypothetical protein LOC80183												0		Lung NSC(96;2.31e-05)|Breast(56;8.04e-05)|Prostate(109;0.00217)|Hepatocellular(98;0.0207)|Lung SC(185;0.0262)	KIRC - Kidney renal clear cell carcinoma(16;0.234)	GBM - Glioblastoma multiforme(144;2.19e-05)														---	---	---	---
SUCLA2	8803	broad.mit.edu	37	13	48570872	48570873	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:48570872_48570873insT	uc001vbs.2	-						SUCLA2_uc010tgb.1_Intron|SUCLA2_uc010tgc.1_Intron|SUCLA2_uc010tgd.1_Intron|SUCLA2_uc001vbt.1_Intron|SUCLA2_uc001vbu.1_Intron	NM_003850	NP_003841			succinate-CoA ligase, ADP-forming, beta subunit						succinyl-CoA pathway|tricarboxylic acid cycle	mitochondrial matrix	ATP binding|metal ion binding|protein binding|succinate-CoA ligase (ADP-forming) activity			central_nervous_system(1)	1		all_cancers(8;1.13e-24)|all_epithelial(8;1.78e-13)|all_lung(13;2.85e-06)|Breast(56;0.000141)|Lung NSC(96;0.000226)|all_hematologic(8;0.000885)|Prostate(109;0.00132)|Acute lymphoblastic leukemia(8;0.0167)|Myeloproliferative disorder(33;0.039)|Hepatocellular(98;0.0556)|Lung SC(185;0.102)|Glioma(44;0.236)		GBM - Glioblastoma multiforme(144;2.1e-06)	Succinic acid(DB00139)													---	---	---	---
FAM10A4	145165	broad.mit.edu	37	13	50747070	50747071	+	3'UTR	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:50747070_50747071insG	uc001vej.2	+	1					DLEU1_uc010adl.1_Intron|DLEU1_uc001vee.1_Intron|DLEU1_uc010adm.1_Intron|DLEU1_uc010adn.1_Intron|DLEU1_uc001vef.1_Intron|DLEU1_uc001veg.1_Intron|DLEU1_uc010tgn.1_Intron|DLEU1_uc001vei.1_Intron|DLEU1_uc010ado.1_Intron|DLEU1_uc010adp.1_Intron	NR_002183				SubName: Full=ST13 protein;												0																		---	---	---	---
ATP7B	540	broad.mit.edu	37	13	52541371	52541371	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:52541371delT	uc001vfw.2	-						ATP7B_uc010adv.2_Intron|ATP7B_uc001vfx.2_Intron|ATP7B_uc001vfy.2_Intron|ATP7B_uc010tgt.1_Intron|ATP7B_uc010tgu.1_Intron|ATP7B_uc010tgv.1_Intron|ATP7B_uc010tgw.1_Intron	NM_000053	NP_000044			ATPase, Cu++ transporting, beta polypeptide						ATP biosynthetic process|cellular copper ion homeostasis|copper ion import|response to copper ion|sequestering of calcium ion	Golgi membrane|integral to plasma membrane|late endosome|mitochondrion	ATP binding|copper ion binding|copper-exporting ATPase activity|protein binding			ovary(1)|central_nervous_system(1)|skin(1)	3		Breast(56;0.000207)|Lung NSC(96;0.000845)|Prostate(109;0.0235)|Hepatocellular(98;0.065)|all_neural(104;0.19)		GBM - Glioblastoma multiforme(99;5.25e-08)										Wilson_disease				---	---	---	---
PIBF1	10464	broad.mit.edu	37	13	73589915	73589915	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:73589915delA	uc001vjc.2	+						PIBF1_uc010aep.2_Intron	NM_006346	NP_006337			progesterone-induced blocking factor 1							centrosome				ovary(1)|breast(1)	2		Prostate(6;0.00191)|Breast(118;0.0736)|Acute lymphoblastic leukemia(28;0.0865)		GBM - Glioblastoma multiforme(99;0.000664)														---	---	---	---
KLF5	688	broad.mit.edu	37	13	73637032	73637032	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:73637032delT	uc001vje.2	+						KLF5_uc001vjd.2_Intron	NM_001730	NP_001721			Kruppel-like factor 5						transcription from RNA polymerase II promoter	nucleus	DNA binding|zinc ion binding			large_intestine(1)|ovary(1)|pancreas(1)	3		Prostate(6;0.00187)|Breast(118;0.0735)		GBM - Glioblastoma multiforme(99;0.0011)														---	---	---	---
TBC1D4	9882	broad.mit.edu	37	13	75923076	75923077	+	Intron	DEL	AG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:75923076_75923077delAG	uc001vjl.1	-						TBC1D4_uc010aer.2_Intron|TBC1D4_uc010aes.2_Intron	NM_014832	NP_055647			TBC1 domain family, member 4							cytoplasm	Rab GTPase activator activity			ovary(4)|central_nervous_system(1)|skin(1)	6		Prostate(6;0.014)|Breast(118;0.0982)		GBM - Glioblastoma multiforme(99;0.0116)														---	---	---	---
ABCC4	10257	broad.mit.edu	37	13	95838867	95838868	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:95838867_95838868insA	uc001vmd.3	-						ABCC4_uc010afk.2_Intron|ABCC4_uc001vme.2_Intron|ABCC4_uc010tih.1_Intron|ABCC4_uc001vmf.2_Intron|ABCC4_uc010afl.1_Intron|ABCC4_uc010afm.1_Intron	NM_005845	NP_005836			ATP-binding cassette, sub-family C, member 4						platelet activation|platelet degranulation	integral to membrane|membrane fraction|plasma membrane|platelet dense granule membrane	15-hydroxyprostaglandin dehydrogenase (NAD+) activity|ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|chloride channel activity			central_nervous_system(3)|skin(1)	4	all_neural(89;0.0878)|Medulloblastoma(90;0.163)				Cefazolin(DB01327)													---	---	---	---
UGGT2	55757	broad.mit.edu	37	13	96512945	96512945	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:96512945delT	uc001vmt.2	-							NM_020121	NP_064506			UDP-glucose ceramide glucosyltransferase-like 2						post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine	endoplasmic reticulum lumen|ER-Golgi intermediate compartment	UDP-glucose:glycoprotein glucosyltransferase activity			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
UGGT2	55757	broad.mit.edu	37	13	96579721	96579729	+	Intron	DEL	TTTCTTTTT	-	-	rs71211699		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:96579721_96579729delTTTCTTTTT	uc001vmt.2	-							NM_020121	NP_064506			UDP-glucose ceramide glucosyltransferase-like 2						post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine	endoplasmic reticulum lumen|ER-Golgi intermediate compartment	UDP-glucose:glycoprotein glucosyltransferase activity			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
IPO5	3843	broad.mit.edu	37	13	98666535	98666535	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:98666535delA	uc001vne.2	+							NM_002271	NP_002262			importin 5						interspecies interaction between organisms|NLS-bearing substrate import into nucleus|ribosomal protein import into nucleus	cytoplasm|nuclear pore|nucleolus	GTPase inhibitor activity|protein transporter activity|Ran GTPase binding			ovary(1)|lung(1)|skin(1)	3																		---	---	---	---
UBAC2	337867	broad.mit.edu	37	13	99896655	99896656	+	Intron	DEL	AC	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:99896655_99896656delAC	uc001voa.3	+						UBAC2_uc010tiu.1_Intron|UBAC2_uc001vob.3_Intron|UBAC2_uc010tiv.1_Intron|UBAC2_uc001vod.2_Intron|UBAC2_uc001voc.2_Intron|UBAC2_uc010tiw.1_Intron	NM_001144072	NP_001137544			UBA domain containing 2 isoform 1							integral to membrane				ovary(1)	1	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)																	---	---	---	---
PCCA	5095	broad.mit.edu	37	13	100925452	100925452	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:100925452delT	uc001voo.2	+	12	955	c.917delT	c.(916-918)ATTfs	p.I306fs	PCCA_uc010aga.2_Frame_Shift_Del_p.I280fs|PCCA_uc010tiz.1_Frame_Shift_Del_p.I306fs	NM_000282	NP_000273	P05165	PCCA_HUMAN	propionyl-Coenzyme A carboxylase, alpha	306	ATP-grasp.|Biotin carboxylation.				fatty acid beta-oxidation	mitochondrial matrix	ATP binding|biotin binding|biotin carboxylase activity|enzyme binding|metal ion binding|propionyl-CoA carboxylase activity			skin(2)	2	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)				Biotin(DB00121)													---	---	---	---
COL4A1	1282	broad.mit.edu	37	13	110861640	110861640	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:110861640delT	uc001vqw.3	-						COL4A1_uc010agl.2_Intron	NM_001845	NP_001836			alpha 1 type IV collagen preproprotein						angiogenesis|axon guidance		extracellular matrix structural constituent|platelet-derived growth factor binding			ovary(3)|lung(1)|central_nervous_system(1)|pancreas(1)	6	all_cancers(4;9.8e-13)|all_epithelial(4;9.66e-08)|all_lung(23;3.75e-06)|Lung NSC(43;0.000274)|Colorectal(4;0.00178)|all_neural(89;0.00459)|Medulloblastoma(90;0.00596)|Lung SC(71;0.0604)	Breast(118;0.2)	BRCA - Breast invasive adenocarcinoma(86;0.11)|all cancers(43;0.145)															---	---	---	---
C13orf28	122258	broad.mit.edu	37	13	113055359	113055359	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:113055359delT	uc001vsd.1	+							NM_145248	NP_660291			hypothetical protein LOC122258 precursor							extracellular region					0	all_lung(23;0.000633)|Lung NSC(43;0.0161)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Hepatocellular(20;0.0997)|Medulloblastoma(90;0.163)																	---	---	---	---
Unknown	0	broad.mit.edu	37	14	19408019	19408019	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:19408019delA								OR11H12 (29447 upstream) : POTEG (145346 downstream)																																			---	---	---	---
TEP1	7011	broad.mit.edu	37	14	20863900	20863900	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20863900delC	uc001vxe.2	-						TEP1_uc010tlf.1_Intron|TEP1_uc010tlg.1_Intron	NM_007110	NP_009041			telomerase-associated protein 1						telomere maintenance via recombination	chromosome, telomeric region|cytoplasm|nuclear matrix|soluble fraction|telomerase holoenzyme complex	ATP binding|RNA binding			ovary(5)	5	all_cancers(95;0.00123)	all_lung(585;0.235)	Epithelial(56;7.42e-08)|all cancers(55;6.46e-07)	GBM - Glioblastoma multiforme(265;0.028)|READ - Rectum adenocarcinoma(17;0.233)														---	---	---	---
IPO4	79711	broad.mit.edu	37	14	24659174	24659174	+	5'Flank	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24659174delT	uc001wmv.1	-						IPO4_uc001wmu.2_5'Flank|IPO4_uc001wmx.1_5'Flank|IPO4_uc001wmy.1_5'Flank|IPO4_uc010tnz.1_5'Flank|IPO4_uc001wmw.1_5'Flank|IPO4_uc001wmz.1_Intron|TM9SF1_uc010toa.1_Intron|TM9SF1_uc001wna.1_Intron|TM9SF1_uc010tob.1_Intron|TM9SF1_uc001wnb.1_Intron	NM_024658	NP_078934			importin 4						intracellular protein transport	cytoplasm|nucleus	protein binding|protein transporter activity			kidney(1)	1				GBM - Glioblastoma multiforme(265;0.0087)														---	---	---	---
PRKD1	5587	broad.mit.edu	37	14	30068407	30068407	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:30068407delA	uc001wqh.2	-							NM_002742	NP_002733			protein kinase D1						cell proliferation|intracellular signal transduction|sphingolipid metabolic process	cytosol|integral to plasma membrane	ATP binding|metal ion binding|protein binding|protein kinase C activity			lung(3)|large_intestine(2)|ovary(2)|skin(1)	8	Hepatocellular(127;0.0604)		LUAD - Lung adenocarcinoma(48;0.00527)|Lung(238;0.0252)	GBM - Glioblastoma multiforme(265;0.00888)														---	---	---	---
AP4S1	11154	broad.mit.edu	37	14	31553965	31553965	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31553965delT	uc001wqy.3	+						AP4S1_uc001wqw.3_Intron|AP4S1_uc001wqx.3_Intron|AP4S1_uc010amh.2_Intron|AP4S1_uc001wqz.3_Intron	NM_001128126	NP_001121598			adaptor-related protein complex 4, sigma 1							coated pit|Golgi apparatus	protein transporter activity				0	Hepatocellular(127;0.0877)|Breast(36;0.176)		LUAD - Lung adenocarcinoma(48;0.00292)|Lung(238;0.0164)|BRCA - Breast invasive adenocarcinoma(188;0.221)	GBM - Glioblastoma multiforme(265;0.00553)														---	---	---	---
HEATR5A	25938	broad.mit.edu	37	14	31778080	31778081	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31778080_31778081insA	uc001wrf.3	-						HEATR5A_uc010ami.2_Intron	NM_015473	NP_056288			HEAT repeat containing 5A								binding			ovary(1)	1	Hepatocellular(127;0.0877)|Breast(36;0.137)		LUAD - Lung adenocarcinoma(48;0.00292)|Lung(238;0.0164)|BRCA - Breast invasive adenocarcinoma(188;0.0797)|STAD - Stomach adenocarcinoma(7;0.173)	GBM - Glioblastoma multiforme(265;0.0059)														---	---	---	---
Unknown	0	broad.mit.edu	37	14	31931925	31931928	+	IGR	DEL	AAAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31931925_31931928delAAAA								HEATR5A (5245 upstream) : NUBPL (98663 downstream)																																			---	---	---	---
BAZ1A	11177	broad.mit.edu	37	14	35280353	35280354	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:35280353_35280354delTT	uc001wsk.2	-						BAZ1A_uc001wsl.2_Intron|BAZ1A_uc001wsm.1_Intron	NM_013448	NP_038476			bromodomain adjacent to zinc finger domain, 1A						chromatin remodeling|regulation of transcription, DNA-dependent|transcription, DNA-dependent	ACF complex	zinc ion binding			lung(2)|central_nervous_system(2)|ovary(1)|breast(1)|skin(1)	7	Breast(36;0.0388)|Hepatocellular(127;0.158)		LUAD - Lung adenocarcinoma(48;7.23e-05)|Lung(238;0.00019)|Epithelial(34;0.0793)|all cancers(34;0.175)	GBM - Glioblastoma multiforme(112;0.0659)														---	---	---	---
PSMA6	5687	broad.mit.edu	37	14	35781862	35781862	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:35781862delT	uc001wtd.2	+						KIAA0391_uc001wta.2_Intron|PSMA6_uc010tpt.1_Intron|PSMA6_uc010tpu.1_Intron	NM_002791	NP_002782			proteasome alpha 6 subunit						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of NF-kappaB transcription factor activity|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	mitochondrion|nuclear matrix|polysome|proteasome core complex, alpha-subunit complex|sarcomere	NF-kappaB binding|purine ribonucleoside triphosphate binding|RNA binding|threonine-type endopeptidase activity				0	Breast(36;0.0519)|Hepatocellular(127;0.158)		Lung(238;3.81e-05)|LUAD - Lung adenocarcinoma(48;5.59e-05)|Epithelial(34;0.00342)|all cancers(34;0.00973)	GBM - Glioblastoma multiforme(112;0.0234)														---	---	---	---
RALGAPA1	253959	broad.mit.edu	37	14	36094781	36094781	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:36094781delA	uc001wti.2	-						RALGAPA1_uc010amp.2_Intron|RALGAPA1_uc001wtj.2_Intron|RALGAPA1_uc010tpv.1_Intron|RALGAPA1_uc010tpw.1_Intron	NM_014990	NP_055805			Ral GTPase activating protein, alpha subunit 1						activation of Ral GTPase activity	cytosol|mitochondrion|nucleus	protein heterodimerization activity|Ral GTPase activator activity			ovary(3)|breast(1)	4																		---	---	---	---
RALGAPA1	253959	broad.mit.edu	37	14	36096150	36096150	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:36096150delA	uc001wti.2	-						RALGAPA1_uc010amp.2_Intron|RALGAPA1_uc001wtj.2_Intron|RALGAPA1_uc010tpv.1_Intron|RALGAPA1_uc010tpw.1_Intron	NM_014990	NP_055805			Ral GTPase activating protein, alpha subunit 1						activation of Ral GTPase activity	cytosol|mitochondrion|nucleus	protein heterodimerization activity|Ral GTPase activator activity			ovary(3)|breast(1)	4																		---	---	---	---
Unknown	0	broad.mit.edu	37	14	39855714	39855714	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:39855714delT								CTAGE5 (35319 upstream) : FBXO33 (11164 downstream)																																			---	---	---	---
LRFN5	145581	broad.mit.edu	37	14	42373608	42373608	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:42373608delT	uc001wvm.2	+	6					LRFN5_uc010ana.2_3'UTR	NM_152447	NP_689660			leucine rich repeat and fibronectin type III							integral to membrane				ovary(5)|pancreas(2)|central_nervous_system(1)	8			LUAD - Lung adenocarcinoma(50;0.0223)|Lung(238;0.0728)	GBM - Glioblastoma multiforme(112;0.00847)											HNSCC(30;0.082)			---	---	---	---
Unknown	0	broad.mit.edu	37	14	44546597	44546598	+	IGR	DEL	TT	-	-	rs58499747	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:44546597_44546598delTT								None (None upstream) : FSCB (426757 downstream)																																			---	---	---	---
FANCM	57697	broad.mit.edu	37	14	45653204	45653205	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:45653204_45653205insA	uc001wwd.3	+						FANCM_uc010anf.2_Intron|FANCM_uc001wwe.3_Intron|FANCM_uc010ang.2_Intron	NM_020937	NP_065988			Fanconi anemia, complementation group M						DNA repair	Fanconi anaemia nuclear complex	ATP binding|ATP-dependent helicase activity|chromatin binding|DNA binding|nuclease activity|protein binding			ovary(3)|lung(2)|breast(2)	7													Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia				---	---	---	---
SDCCAG1	9147	broad.mit.edu	37	14	50069063	50069063	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50069063delT	uc010anj.1	-						PPIL5_uc001wwn.2_Intron|PPIL5_uc001wwo.2_Intron|PPIL5_uc010ank.2_Intron|PPIL5_uc001wwp.2_Intron	NM_004713	NP_004704			serologically defined colon cancer antigen 1							cytoplasm|nucleus					0	all_epithelial(31;0.000822)|Breast(41;0.0117)	all_lung(585;1.02e-05)		OV - Ovarian serous cystadenocarcinoma(311;5.99e-34)														---	---	---	---
SDCCAG1	9147	broad.mit.edu	37	14	50292784	50292785	+	Intron	DEL	AC	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50292784_50292785delAC	uc001wxc.2	-						SDCCAG1_uc010anj.1_Intron|SDCCAG1_uc010tqi.1_Intron|SDCCAG1_uc001wxe.2_Intron|SDCCAG1_uc001wxd.1_Intron|SDCCAG1_uc010anq.1_Intron	NM_004713	NP_004704			serologically defined colon cancer antigen 1							cytoplasm|nucleus					0	all_epithelial(31;0.000822)|Breast(41;0.0117)	all_lung(585;1.02e-05)		OV - Ovarian serous cystadenocarcinoma(311;5.99e-34)														---	---	---	---
SOS2	6655	broad.mit.edu	37	14	50600691	50600691	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50600691delC	uc001wxs.3	-						SOS2_uc010tql.1_Intron	NM_006939	NP_008870			son of sevenless homolog 2						apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	DNA binding|protein binding|Rho guanyl-nucleotide exchange factor activity			ovary(2)	2	all_epithelial(31;0.000822)|Breast(41;0.0065)																	---	---	---	---
MAP4K5	11183	broad.mit.edu	37	14	50930796	50930796	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50930796delT	uc001wya.2	-	12	1113	c.793delA	c.(793-795)AGAfs	p.R265fs	MAP4K5_uc001wyb.2_Frame_Shift_Del_p.R265fs|MAP4K5_uc010anv.1_Frame_Shift_Del_p.R265fs	NM_006575	NP_006566	Q9Y4K4	M4K5_HUMAN	mitogen-activated protein kinase kinase kinase	265	Protein kinase.				activation of JUN kinase activity	cytoplasm	ATP binding|protein binding|protein serine/threonine kinase activity|small GTPase regulator activity	p.R265fs*8(1)		large_intestine(1)	1	all_epithelial(31;0.000415)|Breast(41;0.0102)																	---	---	---	---
PTGDR	5729	broad.mit.edu	37	14	52741747	52741747	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52741747delA	uc001wzq.2	+	2						NM_000953	NP_000944			prostaglandin D2 receptor							integral to membrane|plasma membrane	prostaglandin D receptor activity|protein binding			ovary(1)|lung(1)|central_nervous_system(1)|skin(1)	4	Breast(41;0.0639)|all_epithelial(31;0.0887)				Nedocromil(DB00716)													---	---	---	---
CDKN3	1033	broad.mit.edu	37	14	54868069	54868069	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:54868069delT	uc001xap.2	+						CDKN3_uc001xar.2_Intron|CDKN3_uc001xaq.2_Intron|CDKN3_uc010aoi.1_Intron|CDKN3_uc001xas.1_Intron|CDKN3_uc010aoj.1_Intron	NM_005192	NP_005183			cyclin-dependent kinase inhibitor 3 isoform 1						cell cycle arrest|G1/S transition of mitotic cell cycle|negative regulation of cell proliferation|regulation of cyclin-dependent protein kinase activity	perinuclear region of cytoplasm	protein binding|protein serine/threonine phosphatase activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity				0																		---	---	---	---
GMFB	2764	broad.mit.edu	37	14	54944919	54944919	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:54944919delA	uc010tqz.1	-						GMFB_uc001xaw.1_Intron	NM_004124	NP_004115			glia maturation factor, beta						nervous system development|protein phosphorylation	intracellular	actin binding|enzyme activator activity|growth factor activity|protein kinase inhibitor activity|signal transducer activity				0																		---	---	---	---
C14orf37	145407	broad.mit.edu	37	14	58690726	58690726	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:58690726delT	uc010tro.1	-						ACTR10_uc001xdf.2_Intron|ACTR10_uc001xdg.2_Intron|ACTR10_uc001xdh.2_Intron|ACTR10_uc010trp.1_Intron|ACTR10_uc010apc.2_Intron	NM_001001872	NP_001001872			hypothetical protein LOC145407 precursor							integral to membrane	binding				0																		---	---	---	---
SYNE2	23224	broad.mit.edu	37	14	64520527	64520528	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64520527_64520528insA	uc001xgm.2	+						SYNE2_uc001xgl.2_Intron|SYNE2_uc010apw.1_5'Flank	NM_015180	NP_055995			spectrin repeat containing, nuclear envelope 2						centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)														---	---	---	---
MPP5	64398	broad.mit.edu	37	14	67799713	67799714	+	3'UTR	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:67799713_67799714insA	uc001xjc.2	+	15					MPP5_uc001xjd.2_3'UTR|ATP6V1D_uc001xje.2_Intron	NM_022474	NP_071919			membrane protein, palmitoylated 5						tight junction assembly	cytoplasm|endomembrane system|tight junction	protein domain specific binding			ovary(1)	1				all cancers(60;0.000388)|OV - Ovarian serous cystadenocarcinoma(108;0.00762)|BRCA - Breast invasive adenocarcinoma(234;0.0106)														---	---	---	---
ATP6V1D	51382	broad.mit.edu	37	14	67809927	67809927	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:67809927delT	uc001xjf.2	-						ATP6V1D_uc001xje.2_Intron	NM_015994	NP_057078			H(+)-transporting two-sector ATPase						ATP hydrolysis coupled proton transport|cellular iron ion homeostasis|insulin receptor signaling pathway|transferrin transport	cytosol|proton-transporting two-sector ATPase complex, catalytic domain|vacuolar proton-transporting V-type ATPase complex	protein binding|proton-transporting ATPase activity, rotational mechanism			ovary(1)|lung(1)	2				all cancers(60;0.000739)|OV - Ovarian serous cystadenocarcinoma(108;0.00597)|BRCA - Breast invasive adenocarcinoma(234;0.00957)														---	---	---	---
Unknown	0	broad.mit.edu	37	14	69329316	69329316	+	IGR	DEL	T	-	-	rs142085769		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:69329316delT								C14orf181 (66126 upstream) : ACTN1 (11525 downstream)																																			---	---	---	---
DCAF4	26094	broad.mit.edu	37	14	73409680	73409680	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:73409680delC	uc001xng.2	+						DCAF4_uc001xnj.2_Intron|DCAF4_uc010ttr.1_Intron|DCAF4_uc001xnh.2_Intron|DCAF4_uc010tts.1_Intron|DCAF4_uc010ttt.1_Intron|DCAF4_uc001xni.2_Intron|DCAF4_uc001xnk.2_Intron	NM_015604	NP_056419			DDB1 and CUL4 associated factor 4 isoform 1							CUL4 RING ubiquitin ligase complex				ovary(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
RBM25	58517	broad.mit.edu	37	14	73572895	73572895	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:73572895delT	uc001xno.2	+						RBM25_uc010ttu.1_Intron|RBM25_uc001xnp.2_Intron	NM_021239	NP_067062			RNA binding motif protein 25						apoptosis|mRNA processing|regulation of alternative nuclear mRNA splicing, via spliceosome|RNA splicing	cytoplasm|nuclear speck	mRNA binding|nucleotide binding|protein binding			central_nervous_system(2)|ovary(1)|breast(1)	4				BRCA - Breast invasive adenocarcinoma(234;0.00362)|OV - Ovarian serous cystadenocarcinoma(108;0.0688)														---	---	---	---
NUMB	8650	broad.mit.edu	37	14	73744101	73744101	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:73744101delC	uc001xny.1	-						NUMB_uc010aro.1_Intron|NUMB_uc010arp.1_Intron|NUMB_uc010arq.1_Intron|NUMB_uc010arr.1_Intron|NUMB_uc001xoa.1_Intron|NUMB_uc001xnz.1_Intron|NUMB_uc001xob.1_Intron|NUMB_uc001xod.1_Intron|NUMB_uc001xoc.1_Intron|NUMB_uc010ars.1_Intron|NUMB_uc010ttz.1_Intron|NUMB_uc001xoe.2_RNA	NM_001005743	NP_001005743			numb homolog isoform 1						axon guidance|lateral ventricle development|neuroblast division in subventricular zone|positive regulation of neurogenesis	integral to plasma membrane				ovary(2)|central_nervous_system(1)|skin(1)	4				BRCA - Breast invasive adenocarcinoma(234;0.00471)|OV - Ovarian serous cystadenocarcinoma(108;0.161)														---	---	---	---
TTLL5	23093	broad.mit.edu	37	14	76420596	76420604	+	Intron	DEL	AAAAAAAAA	-	-	rs72196927		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:76420596_76420604delAAAAAAAAA	uc001xrx.2	+						TTLL5_uc001xsa.2_Intron	NM_015072	NP_055887			tubulin tyrosine ligase-like family, member 5						protein modification process|transcription, DNA-dependent	centrosome|cilium|microtubule basal body|nucleus	tubulin-tyrosine ligase activity			ovary(2)|central_nervous_system(1)	3				BRCA - Breast invasive adenocarcinoma(234;0.029)														---	---	---	---
SEL1L	6400	broad.mit.edu	37	14	81994258	81994258	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:81994258delA	uc010tvv.1	-						SEL1L_uc001xvo.3_Intron	NM_005065	NP_005056			sel-1 suppressor of lin-12-like precursor						Notch signaling pathway	endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(234;0.0299)														---	---	---	---
SPATA7	55812	broad.mit.edu	37	14	88895671	88895671	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:88895671delT	uc001xwq.2	+						SPATA7_uc001xwr.2_Intron|SPATA7_uc001xws.2_Intron|SPATA7_uc001xwt.2_Intron|SPATA7_uc001xwu.2_5'Flank	NM_018418	NP_060888			spermatogenesis-associated protein 7 isoform a						response to stimulus|visual perception					ovary(1)	1																		---	---	---	---
CCDC88C	440193	broad.mit.edu	37	14	91810086	91810086	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:91810086delA	uc010aty.2	-						CCDC88C_uc010twk.1_Intron	NM_001080414	NP_001073883			DVL-binding protein DAPLE						microtubule cytoskeleton organization|protein destabilization|protein homooligomerization|regulation of protein phosphorylation|Wnt receptor signaling pathway	cytoplasm|insoluble fraction	microtubule binding|PDZ domain binding|protein self-association			ovary(3)	3		all_cancers(154;0.0468)																---	---	---	---
CPSF2	53981	broad.mit.edu	37	14	92623949	92623949	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:92623949delT	uc001yah.1	+							NM_017437	NP_059133			cleavage and polyadenylation specific factor 2						histone mRNA 3'-end processing|mRNA export from nucleus|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	mRNA cleavage and polyadenylation specificity factor complex	hydrolase activity|protein binding|RNA binding			ovary(2)	2		all_cancers(154;0.0766)		COAD - Colon adenocarcinoma(157;0.222)														---	---	---	---
BTBD7	55727	broad.mit.edu	37	14	93708433	93708433	+	3'UTR	DEL	A	-	-	rs72253031		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:93708433delA	uc001ybo.2	-	11					BTBD7_uc010aur.2_3'UTR|BTBD7_uc010two.1_3'UTR|BTBD7_uc001ybp.2_3'UTR	NM_001002860	NP_001002860			BTB (POZ) domain containing 7 isoform 1											pancreas(1)	1		all_cancers(154;0.08)		Epithelial(152;0.196)|COAD - Colon adenocarcinoma(157;0.212)|all cancers(159;0.223)														---	---	---	---
BTBD7	55727	broad.mit.edu	37	14	93720139	93720139	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:93720139delA	uc001ybo.2	-						BTBD7_uc010aur.2_Intron|BTBD7_uc010two.1_Intron|BTBD7_uc001ybp.2_Intron	NM_001002860	NP_001002860			BTB (POZ) domain containing 7 isoform 1											pancreas(1)	1		all_cancers(154;0.08)		Epithelial(152;0.196)|COAD - Colon adenocarcinoma(157;0.212)|all cancers(159;0.223)														---	---	---	---
KIAA1409	57578	broad.mit.edu	37	14	94139535	94139535	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94139535delT	uc001ybv.1	+						KIAA1409_uc001ybs.1_Intron	NM_020818	NP_065869			hypothetical protein LOC57578							integral to membrane				ovary(10)|skin(4)|large_intestine(3)	17		all_cancers(154;0.0354)|all_epithelial(191;0.216)		Epithelial(152;0.188)														---	---	---	---
ASB2	51676	broad.mit.edu	37	14	94417111	94417111	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94417111delC	uc001ycc.1	-						ASB2_uc001ycd.2_Intron|ASB2_uc001yce.1_Intron	NM_016150	NP_057234			ankyrin repeat and SOCS box-containing protein						intracellular signal transduction					ovary(1)|pancreas(1)	2		all_cancers(154;0.13)		COAD - Colon adenocarcinoma(157;0.217)|Epithelial(152;0.232)														---	---	---	---
ATG2B	55102	broad.mit.edu	37	14	96811383	96811384	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:96811383_96811384delAA	uc001yfi.2	-							NM_018036	NP_060506			ATG2 autophagy related 2 homolog B											ovary(1)|kidney(1)|skin(1)	3		all_cancers(154;0.0462)|all_epithelial(191;0.123)|Melanoma(154;0.155)		Epithelial(152;0.21)|COAD - Colon adenocarcinoma(157;0.244)														---	---	---	---
PAPOLA	10914	broad.mit.edu	37	14	96998599	96998599	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:96998599delT	uc001yfq.2	+						PAPOLA_uc001yfp.2_Intron|PAPOLA_uc001yfr.2_Intron|PAPOLA_uc010twv.1_Intron|PAPOLA_uc010avp.2_Intron	NM_032632	NP_116021			poly(A) polymerase alpha						mRNA polyadenylation|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	cytoplasm|nucleoplasm	ATP binding|magnesium ion binding|manganese ion binding|polynucleotide adenylyltransferase activity|RNA binding				0		all_cancers(154;0.0555)|all_epithelial(191;0.149)|Melanoma(154;0.155)		COAD - Colon adenocarcinoma(157;0.213)														---	---	---	---
PAPOLA	10914	broad.mit.edu	37	14	97022124	97022124	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:97022124delT	uc001yfq.2	+						PAPOLA_uc001yfr.2_Intron|PAPOLA_uc010twv.1_Intron|PAPOLA_uc010avp.2_Intron	NM_032632	NP_116021			poly(A) polymerase alpha						mRNA polyadenylation|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	cytoplasm|nucleoplasm	ATP binding|magnesium ion binding|manganese ion binding|polynucleotide adenylyltransferase activity|RNA binding				0		all_cancers(154;0.0555)|all_epithelial(191;0.149)|Melanoma(154;0.155)		COAD - Colon adenocarcinoma(157;0.213)														---	---	---	---
DYNC1H1	1778	broad.mit.edu	37	14	102450010	102450010	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:102450010delT	uc001yks.2	+							NM_001376	NP_001367			cytoplasmic dynein 1 heavy chain 1						cytoplasmic mRNA processing body assembly|G2/M transition of mitotic cell cycle|microtubule-based movement|mitotic spindle organization|stress granule assembly|transport	centrosome|cytoplasmic dynein complex|cytosol|Golgi apparatus|microtubule	ATP binding|ATPase activity, coupled|microtubule motor activity|protein binding			ovary(7)|central_nervous_system(2)|pancreas(1)	10																		---	---	---	---
HSP90AA1	3320	broad.mit.edu	37	14	102551255	102551260	+	In_Frame_Del	DEL	TTCTTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:102551255_102551260delTTCTTT	uc001yku.3	-	5	929_934	c.739_744delAAAGAA	c.(739-744)AAAGAAdel	p.KE247del	HSP90AA1_uc001ykv.3_In_Frame_Del_p.KE369del|HSP90AA1_uc001ykw.1_In_Frame_Del_p.KE68del|HSP90AA1_uc001ykx.1_In_Frame_Del_p.KE236del	NM_005348	NP_005339	P07900	HS90A_HUMAN	heat shock 90kDa protein 1, alpha isoform 2	247_248					axon guidance|cellular chaperone-mediated protein complex assembly|G2/M transition of mitotic cell cycle|nitric oxide metabolic process|positive regulation of nitric oxide biosynthetic process|protein import into mitochondrial outer membrane|protein refolding|regulation of nitric-oxide synthase activity|response to unfolded protein|signal transduction	cytosol|melanosome|plasma membrane	ATP binding|ATPase activity|nitric-oxide synthase regulator activity|protein homodimerization activity|TPR domain binding|unfolded protein binding			ovary(2)|central_nervous_system(2)|prostate(1)|lung(1)|breast(1)	7					Rifabutin(DB00615)													---	---	---	---
EIF5	1983	broad.mit.edu	37	14	103802304	103802304	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103802304delT	uc001ymq.2	+						EIF5_uc001ymr.2_Intron|EIF5_uc001yms.2_Intron|EIF5_uc001ymt.2_Intron|EIF5_uc001ymu.2_Intron|SNORA28_uc001ymv.1_5'Flank	NM_001969	NP_001960			eukaryotic translation initiation factor 5						regulation of translational initiation|RNA metabolic process	cytosol	GTP binding|GTPase activity|translation initiation factor activity			pancreas(1)|breast(1)|skin(1)	3		Melanoma(154;0.155)	Epithelial(46;0.182)															---	---	---	---
KLC1	3831	broad.mit.edu	37	14	104040416	104040429	+	Intron	DEL	TTTTTTTTTTTTTT	-	-	rs11337243		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:104040416_104040429delTTTTTTTTTTTTTT	uc010tyd.1	+						C14orf153_uc001ynl.3_Intron|C14orf153_uc010tyc.1_Intron	NM_005552	NP_005543			kinesin light chain 1 isoform 1						blood coagulation|microtubule-based movement|stress granule disassembly	cytosol|kinesin complex|microtubule	microtubule motor activity|protein binding				0		Melanoma(154;0.155)|all_epithelial(191;0.19)																---	---	---	---
TDRD9	122402	broad.mit.edu	37	14	104492672	104492672	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:104492672delA	uc001yom.3	+						TDRD9_uc001yon.3_Intron	NM_153046	NP_694591			tudor domain containing 9						cell differentiation|DNA methylation involved in gamete generation|fertilization|gene silencing by RNA|male meiosis|multicellular organismal development|piRNA metabolic process|spermatogenesis	nucleus|piP-body	ATP binding|ATP-dependent helicase activity|nucleic acid binding			ovary(2)|central_nervous_system(1)	3		all_cancers(154;0.109)|Melanoma(154;0.0525)|all_epithelial(191;0.0768)																---	---	---	---
ADAM6	8755	broad.mit.edu	37	14	106067674	106067674	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:106067674delC	uc010tyt.1	-						uc001yrs.2_Intron|uc001yrt.2_Intron|uc001yrw.1_Intron|uc001yrx.1_Intron|uc001yrv.1_5'Flank|uc001yru.2_5'Flank|uc010axq.1_5'Flank					Parts of antibodies, mostly variable regions.												0																		---	---	---	---
CYFIP1	23191	broad.mit.edu	37	15	22958137	22958137	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22958137delT	uc001yus.2	+						CYFIP1_uc001yut.2_Intron|CYFIP1_uc010aya.1_Intron|CYFIP1_uc001yuu.2_Intron	NM_014608	NP_055423			cytoplasmic FMR1 interacting protein 1 isoform						axon extension|lamellipodium assembly|regulation of cell shape|ruffle organization	cell junction|lamellipodium|mRNA cap binding complex|perinuclear region of cytoplasm|ruffle|synapse|synaptosome	actin filament binding|Rac GTPase binding			ovary(4)|pancreas(3)|liver(1)|skin(1)	9		all_cancers(20;2.26e-25)|all_epithelial(15;2.1e-22)|Lung NSC(15;3.36e-17)|all_lung(15;1.04e-16)|Breast(32;0.000776)|Colorectal(260;0.0488)		all cancers(64;2.22e-06)|Epithelial(43;1.49e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00101)														---	---	---	---
CYFIP1	23191	broad.mit.edu	37	15	22980298	22980298	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22980298delT	uc001yus.2	+						CYFIP1_uc001yut.2_Intron|CYFIP1_uc010aya.1_Intron|CYFIP1_uc001yuu.2_Intron|CYFIP1_uc001yuv.2_Intron	NM_014608	NP_055423			cytoplasmic FMR1 interacting protein 1 isoform						axon extension|lamellipodium assembly|regulation of cell shape|ruffle organization	cell junction|lamellipodium|mRNA cap binding complex|perinuclear region of cytoplasm|ruffle|synapse|synaptosome	actin filament binding|Rac GTPase binding			ovary(4)|pancreas(3)|liver(1)|skin(1)	9		all_cancers(20;2.26e-25)|all_epithelial(15;2.1e-22)|Lung NSC(15;3.36e-17)|all_lung(15;1.04e-16)|Breast(32;0.000776)|Colorectal(260;0.0488)		all cancers(64;2.22e-06)|Epithelial(43;1.49e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00101)														---	---	---	---
HERC2P2	400322	broad.mit.edu	37	15	23299147	23299147	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:23299147delA	uc001yvq.2	-						HERC2P2_uc001yvo.3_Intron|HERC2P2_uc001yvp.3_Intron					Homo sapiens mRNA for KIAA0393 protein, partial cds.												0																		---	---	---	---
PAR4	347745	broad.mit.edu	37	15	25449309	25449309	+	RNA	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25449309delC	uc001yzk.1	+	8		c.1224delC			PAR4_uc010ayo.1_Intron|SNORD115-17_uc001yzp.1_5'Flank|SNORD115-20_uc001yzq.1_5'Flank					Homo sapiens clone Rt-13I SNURF-SNRPN mRNA, downstream untranslated exons, alternatively spliced.												0																		---	---	---	---
TJP1	7082	broad.mit.edu	37	15	30020390	30020391	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:30020390_30020391delTT	uc001zcr.2	-						TJP1_uc010azl.2_Intron|TJP1_uc001zcq.2_Intron|TJP1_uc001zcs.2_Intron	NM_003257	NP_003248			tight junction protein 1 isoform a						cell-cell junction assembly|cellular component disassembly involved in apoptosis	basolateral plasma membrane|cell-cell adherens junction|Golgi apparatus|tight junction				ovary(4)|central_nervous_system(1)|pancreas(1)	6		all_lung(180;7.48e-11)|Breast(32;0.000153)		all cancers(64;3.29e-10)|Epithelial(43;5.34e-09)|BRCA - Breast invasive adenocarcinoma(123;0.0034)|GBM - Glioblastoma multiforme(186;0.0139)|Lung(196;0.186)														---	---	---	---
FMN1	342184	broad.mit.edu	37	15	33192039	33192039	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:33192039delA	uc001zhf.3	-							NM_001103184	NP_001096654			formin 1						actin cytoskeleton organization	actin cytoskeleton|adherens junction|cytoplasm|nucleus	actin binding			ovary(1)	1		all_lung(180;1.14e-07)		all cancers(64;3.05e-15)|Epithelial(43;1.67e-10)|GBM - Glioblastoma multiforme(186;4.95e-05)|BRCA - Breast invasive adenocarcinoma(123;0.0262)														---	---	---	---
C15orf29	79768	broad.mit.edu	37	15	34437700	34437700	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34437700delA	uc001zhp.2	-							NM_024713	NP_078989			hypothetical protein LOC79768							nucleolus				ovary(1)	1		all_lung(180;1.86e-06)		all cancers(64;5.49e-18)|GBM - Glioblastoma multiforme(113;8.91e-07)|BRCA - Breast invasive adenocarcinoma(123;0.026)|Lung(196;0.229)														---	---	---	---
FAM98B	283742	broad.mit.edu	37	15	38765700	38765700	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:38765700delT	uc001zkb.1	+						FAM98B_uc001zkc.2_Intron	NM_001042429	NP_001035894			family with sequence similarity 98, member B							tRNA-splicing ligase complex	protein binding			ovary(1)	1		all_cancers(109;3.11e-17)|all_epithelial(112;2.64e-15)|Lung NSC(122;2.11e-11)|all_lung(180;5.61e-10)|Melanoma(134;0.0574)		GBM - Glioblastoma multiforme(113;9e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0209)														---	---	---	---
MGA	23269	broad.mit.edu	37	15	41991377	41991377	+	Intron	DEL	T	-	-	rs71831226		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41991377delT	uc001zog.1	+						MGA_uc010ucy.1_Intron|MGA_uc010ucz.1_Intron	NM_001080541	NP_001074010			MAX-interacting protein isoform 2							MLL1 complex	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(6)|kidney(3)|upper_aerodigestive_tract(1)|haematopoietic_and_lymphoid_tissue(1)|skin(1)	12		all_cancers(109;0.00356)|all_epithelial(112;0.0413)|all_lung(180;0.18)|Ovarian(310;0.238)		OV - Ovarian serous cystadenocarcinoma(18;1.41e-18)|GBM - Glioblastoma multiforme(113;2.15e-06)|COAD - Colon adenocarcinoma(120;0.031)|Lung(196;0.0721)|BRCA - Breast invasive adenocarcinoma(123;0.0964)|Colorectal(105;0.0998)|LUSC - Lung squamous cell carcinoma(244;0.235)														---	---	---	---
CAPN3	825	broad.mit.edu	37	15	42646646	42646646	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42646646delA	uc010udf.1	+	1	109	c.43delA	c.(43-45)AAAfs	p.K15fs	CAPN3_uc001zpk.1_5'UTR|CAPN3_uc001zpl.1_Frame_Shift_Del_p.K15fs|CAPN3_uc010udg.1_Frame_Shift_Del_p.K15fs	NM_212465	NP_997630	P20807	CAN3_HUMAN	calpain 3 isoform f	Error:Variant_position_missing_in_P20807_after_alignment					muscle organ development|proteolysis	cytoplasm	calcium ion binding|calcium-dependent cysteine-type endopeptidase activity|signal transducer activity			central_nervous_system(1)	1		all_cancers(109;1.65e-16)|all_epithelial(112;8.34e-15)|Lung NSC(122;3.56e-09)|all_lung(180;1.68e-08)|Melanoma(134;0.0574)|Colorectal(260;0.152)		GBM - Glioblastoma multiforme(94;7.36e-07)														---	---	---	---
Unknown	0	broad.mit.edu	37	15	44023811	44023811	+	5'Flank	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:44023811delT	uc010uec.1	-											Homo sapiens cDNA FLJ16411 fis, clone BRACE2016362.																														---	---	---	---
CTDSPL2	51496	broad.mit.edu	37	15	44741008	44741008	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:44741008delA	uc001ztr.2	+						CTDSPL2_uc001zts.2_Intron|CTDSPL2_uc001ztt.2_Intron	NM_016396	NP_057480			CTD (carboxy-terminal domain, RNA polymerase II,								phosphoprotein phosphatase activity				0		all_cancers(109;4.36e-14)|all_epithelial(112;9.8e-12)|Lung NSC(122;1.66e-07)|all_lung(180;1.47e-06)|Melanoma(134;0.0122)		all cancers(107;1.02e-20)|GBM - Glioblastoma multiforme(94;1.49e-06)|COAD - Colon adenocarcinoma(120;0.0857)|Colorectal(105;0.0905)														---	---	---	---
SLC28A2	9153	broad.mit.edu	37	15	45561372	45561372	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45561372delA	uc001zva.2	+							NM_004212	NP_004203			solute carrier family 28 (sodium-coupled						nucleobase, nucleoside and nucleotide metabolic process	integral to plasma membrane|membrane fraction	nucleoside binding|nucleoside:sodium symporter activity|purine nucleoside transmembrane transporter activity			ovary(4)	4		all_cancers(109;8.53e-07)|all_epithelial(112;1.39e-05)|Lung NSC(122;8.3e-05)|all_lung(180;0.000547)|Melanoma(134;0.0417)		all cancers(107;3.77e-16)|GBM - Glioblastoma multiforme(94;2.71e-06)														---	---	---	---
Unknown	0	broad.mit.edu	37	15	45902861	45902861	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45902861delA								PLDN (953 upstream) : SQRDL (20485 downstream)																																			---	---	---	---
MYEF2	50804	broad.mit.edu	37	15	48449998	48449998	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48449998delA	uc001zwi.3	-						MYEF2_uc001zwj.3_Intron|MYEF2_uc001zwl.2_Intron	NM_016132	NP_057216			myelin expression factor 2						transcription, DNA-dependent	Golgi apparatus|nucleus	DNA binding|nucleotide binding|RNA binding			lung(2)|ovary(1)	3		all_lung(180;0.00217)		all cancers(107;3.73e-10)|GBM - Glioblastoma multiforme(94;7.81e-07)														---	---	---	---
SLC12A1	6557	broad.mit.edu	37	15	48526950	48526951	+	Intron	DEL	AA	-	-	rs77430774		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48526950_48526951delAA	uc001zwn.3	+						SLC12A1_uc010uew.1_Intron|SLC12A1_uc010bem.2_Intron|SLC12A1_uc010uex.1_Intron|SLC12A1_uc001zwq.3_Intron|SLC12A1_uc001zwr.3_Intron	NM_000338	NP_000329			sodium potassium chloride cotransporter 2						potassium ion transport|sodium ion transport	integral to membrane|membrane fraction	sodium:potassium:chloride symporter activity			ovary(1)|central_nervous_system(1)	2		all_lung(180;0.00219)		all cancers(107;1.76e-09)|GBM - Glioblastoma multiforme(94;1.48e-06)	Bumetanide(DB00887)|Chlormerodrin(DB00534)|Chlorthalidone(DB00310)|Ethacrynic acid(DB00903)|Furosemide(DB00695)|Hydroflumethiazide(DB00774)|Methyclothiazide(DB00232)|Metolazone(DB00524)|Potassium Chloride(DB00761)|Torasemide(DB00214)|Trichlormethiazide(DB01021)													---	---	---	---
CEP152	22995	broad.mit.edu	37	15	49059021	49059021	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:49059021delA	uc001zwy.2	-						CEP152_uc001zwz.2_Intron|CEP152_uc001zxa.1_Intron	NM_014985	NP_055800			centrosomal protein 152kDa						centrosome duplication|G2/M transition of mitotic cell cycle	centrosome|cytosol	protein kinase binding			lung(2)	2		all_lung(180;0.0428)		all cancers(107;1.08e-07)|GBM - Glioblastoma multiforme(94;2.32e-06)														---	---	---	---
CEP152	22995	broad.mit.edu	37	15	49097636	49097636	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:49097636delT	uc001zwy.2	-						CEP152_uc001zwz.2_Intron|CEP152_uc001zxa.1_Intron	NM_014985	NP_055800			centrosomal protein 152kDa						centrosome duplication|G2/M transition of mitotic cell cycle	centrosome|cytosol	protein kinase binding			lung(2)	2		all_lung(180;0.0428)		all cancers(107;1.08e-07)|GBM - Glioblastoma multiforme(94;2.32e-06)														---	---	---	---
AP4E1	23431	broad.mit.edu	37	15	51221550	51221551	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:51221550_51221551delTT	uc001zyx.1	+						AP4E1_uc010ufi.1_Intron|AP4E1_uc010ufj.1_Intron|AP4E1_uc010ufk.1_Intron	NM_007347	NP_031373			adaptor-related protein complex 4, epsilon 1						intracellular protein transport|vesicle-mediated transport	COPI vesicle coat	binding|structural molecule activity				0				all cancers(107;0.000893)|GBM - Glioblastoma multiforme(94;0.00364)														---	---	---	---
LEO1	123169	broad.mit.edu	37	15	52239785	52239786	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:52239785_52239786delTT	uc002abo.2	-						LEO1_uc010bfd.2_Intron	NM_138792	NP_620147			Leo1, Paf1/RNA polymerase II complex component,						histone H2B ubiquitination|histone monoubiquitination|regulation of transcription, DNA-dependent|transcription, DNA-dependent	Cdc73/Paf1 complex	protein binding				0				all cancers(107;0.00264)														---	---	---	---
GTF2A2	2958	broad.mit.edu	37	15	59942804	59942804	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59942804delA	uc002agg.2	-							NM_004492	NP_004483			general transcription factor IIA, 2, 12kDa						interspecies interaction between organisms|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|RNA polymerase II transcriptional preinitiation complex assembly|transcription elongation from RNA polymerase II promoter|viral reproduction	transcription factor TFIIA complex	protein heterodimerization activity|protein homodimerization activity|TBP-class protein binding|transcription coactivator activity			central_nervous_system(2)	2																		---	---	---	---
BNIP2	663	broad.mit.edu	37	15	59963289	59963290	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59963289_59963290delAA	uc010uhc.1	-						BNIP2_uc002agi.3_5'Flank|BNIP2_uc010uhb.1_Intron	NM_004330	NP_004321			BCL2/adenovirus E1B 19kD interacting protein 2						anti-apoptosis|apoptosis|positive regulation of muscle cell differentiation	nuclear envelope|perinuclear region of cytoplasm	calcium ion binding|GTPase activator activity|protein binding			ovary(1)	1																		---	---	---	---
VPS13C	54832	broad.mit.edu	37	15	62259664	62259665	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:62259664_62259665insA	uc002agz.2	-						VPS13C_uc002aha.2_Intron|VPS13C_uc002ahb.1_Intron|VPS13C_uc002ahc.1_Intron	NM_020821	NP_065872			vacuolar protein sorting 13C protein isoform 2A						protein localization					ovary(2)	2																		---	---	---	---
RAB8B	51762	broad.mit.edu	37	15	63552040	63552040	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63552040delT	uc002alz.2	+						RAB8B_uc010uih.1_Intron	NM_016530	NP_057614			RAB8B, member RAS oncogene family						protein transport|small GTPase mediated signal transduction	plasma membrane	GTP binding|GTPase activity			ovary(1)|kidney(1)	2																		---	---	---	---
PIF1	80119	broad.mit.edu	37	15	65110067	65110067	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65110067delA	uc002ant.2	-						PIF1_uc002anr.2_Intron|PIF1_uc002ans.2_Intron|PIF1_uc010uiq.1_Intron	NM_025049	NP_079325			DNA helicase homolog PIF1						negative regulation of telomerase activity|regulation of telomere maintenance|viral genome replication	nuclear chromosome, telomeric region	ATP binding|ATP-dependent 5'-3' DNA helicase activity|ATP-dependent 5'-3' DNA/RNA helicase activity|magnesium ion binding|single-stranded DNA-dependent ATP-dependent DNA helicase activity|telomeric DNA binding				0																		---	---	---	---
MTFMT	123263	broad.mit.edu	37	15	65314154	65314154	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65314154delA	uc002aof.3	-							NM_139242	NP_640335			mitochondrial methionyl-tRNA formyltransferase							mitochondrion	methionyl-tRNA formyltransferase activity|methyltransferase activity			ovary(2)	2					Tetrahydrofolic acid(DB00116)													---	---	---	---
PTPLAD1	51495	broad.mit.edu	37	15	65864372	65864373	+	Intron	DEL	TC	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65864372_65864373delTC	uc002apc.2	+						PTPLAD1_uc002apb.1_Intron|PTPLAD1_uc010uiw.1_Intron	NM_016395	NP_057479			protein tyrosine phosphatase-like A domain						activation of JUN kinase activity|fatty acid biosynthetic process|I-kappaB kinase/NF-kappaB cascade|Rac protein signal transduction	endoplasmic reticulum membrane|integral to membrane	GTPase activator activity|lyase activity|protein binding				0																		---	---	---	---
AAGAB	79719	broad.mit.edu	37	15	67496224	67496225	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:67496224_67496225delTT	uc002aqk.3	-						AAGAB_uc002aql.2_Intron|AAGAB_uc010uju.1_Intron	NM_024666	NP_078942			alpha- and gamma-adaptin-binding protein p34						protein transport	cytoplasm					0																		---	---	---	---
UACA	55075	broad.mit.edu	37	15	70987451	70987451	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:70987451delA	uc002asr.2	-						UACA_uc010uke.1_Intron|UACA_uc002asq.2_Intron|UACA_uc010bin.1_Intron	NM_018003	NP_060473			uveal autoantigen with coiled-coil domains and							cytoskeleton|extracellular region				ovary(2)|pancreas(1)|skin(1)	4																		---	---	---	---
NEO1	4756	broad.mit.edu	37	15	73585503	73585503	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:73585503delT	uc002avm.3	+						NEO1_uc010ukx.1_Intron|NEO1_uc010uky.1_Intron|NEO1_uc010ukz.1_Intron|NEO1_uc002avn.3_Intron	NM_002499	NP_002490			neogenin homolog 1 precursor						axon guidance|cell adhesion|positive regulation of muscle cell differentiation	Golgi apparatus|integral to plasma membrane|nucleus				pancreas(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	15	75541371	75541371	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75541371delT								C15orf39 (36863 upstream) : GOLGA6C (9528 downstream)																																			---	---	---	---
SIN3A	25942	broad.mit.edu	37	15	75676395	75676396	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75676395_75676396delTT	uc002bai.2	-						SIN3A_uc002baj.2_Intron|SIN3A_uc010uml.1_Intron	NM_015477	NP_056292			transcriptional co-repressor Sin3A						blood coagulation|cellular lipid metabolic process|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus|Sin3 complex	protein binding			skin(3)|ovary(1)|lung(1)	5																		---	---	---	---
SIN3A	25942	broad.mit.edu	37	15	75706706	75706706	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75706706delA	uc002bai.2	-						SIN3A_uc002baj.2_Intron|SIN3A_uc010uml.1_Intron	NM_015477	NP_056292			transcriptional co-repressor Sin3A						blood coagulation|cellular lipid metabolic process|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus|Sin3 complex	protein binding			skin(3)|ovary(1)|lung(1)	5																		---	---	---	---
SCAPER	49855	broad.mit.edu	37	15	77096991	77096991	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:77096991delA	uc002bby.2	-						SCAPER_uc002bbx.2_Intron|SCAPER_uc002bbz.1_Intron|SCAPER_uc002bca.1_Intron|SCAPER_uc002bcb.1_Intron|SCAPER_uc002bcc.1_Intron	NM_020843	NP_065894			S-phase cyclin A-associated protein in the ER							endoplasmic reticulum|nucleus	zinc ion binding			large_intestine(1)|lung(1)|ovary(1)	3																		---	---	---	---
WDR61	80349	broad.mit.edu	37	15	78587083	78587083	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:78587083delT	uc002bdn.2	-						WDR61_uc002bdo.2_Intron|WDR61_uc010umz.1_Intron|WDR61_uc010una.1_Intron|WDR61_uc010blc.1_3'UTR	NM_025234	NP_079510			WD repeat domain 61								protein binding			ovary(1)|skin(1)	2																		---	---	---	---
C15orf26	161502	broad.mit.edu	37	15	81436282	81436282	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:81436282delT	uc002bgb.2	+							NM_173528	NP_775799			hypothetical protein LOC161502												0																		---	---	---	---
CPEB1	64506	broad.mit.edu	37	15	83222172	83222172	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:83222172delA	uc002bit.2	-						CPEB1_uc002biq.2_Intron|CPEB1_uc002bir.2_Intron|CPEB1_uc002bis.2_Intron|CPEB1_uc010uod.1_Intron|CPEB1_uc010uoe.1_Intron|CPEB1_uc002biu.2_Intron|CPEB1_uc010uof.1_Intron|CPEB1_uc002biv.2_Intron|CPEB1_uc002bip.2_Intron	NM_001079533	NP_001073001			cytoplasmic polyadenylation element binding						mRNA processing|regulation of translation	cell junction|cytoplasmic mRNA processing body|dendrite|postsynaptic density|postsynaptic membrane	nucleotide binding|RNA binding			ovary(1)|breast(1)	2			BRCA - Breast invasive adenocarcinoma(143;0.229)															---	---	---	---
PDE8A	5151	broad.mit.edu	37	15	85652203	85652203	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:85652203delA	uc002blh.2	+						PDE8A_uc002bli.2_Intron|PDE8A_uc010bnc.2_Intron|PDE8A_uc010bnd.2_Intron|PDE8A_uc002blj.2_Intron|PDE8A_uc002blk.2_Intron	NM_002605	NP_002596			phosphodiesterase 8A isoform 1						cyclic nucleotide metabolic process|regulation of transcription, DNA-dependent	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|metal ion binding|two-component response regulator activity			ovary(2)|pancreas(1)|skin(1)	4	Colorectal(223;0.227)		BRCA - Breast invasive adenocarcinoma(143;0.0608)															---	---	---	---
NTRK3	4916	broad.mit.edu	37	15	88670279	88670279	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:88670279delT	uc002bme.1	-						NTRK3_uc002bmh.2_Intron|NTRK3_uc002bmf.1_Intron|NTRK3_uc010upl.1_Intron|NTRK3_uc010bnh.1_Intron|NTRK3_uc002bmg.2_Intron	NM_001012338	NP_001012338			neurotrophic tyrosine kinase, receptor, type 3						transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|transmembrane receptor protein tyrosine kinase activity		ETV6/NTRK3(234)	soft_tissue(85)|kidney(66)|breast(56)|salivary_gland(26)|lung(22)|large_intestine(6)|ovary(6)|stomach(5)|central_nervous_system(3)|pancreas(3)|haematopoietic_and_lymphoid_tissue(2)|skin(1)	281			BRCA - Breast invasive adenocarcinoma(143;0.211)					T	ETV6	congenital fibrosarcoma|Secretory breast 					TSP Lung(13;0.10)			---	---	---	---
IQGAP1	8826	broad.mit.edu	37	15	91018049	91018049	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91018049delT	uc002bpl.1	+							NM_003870	NP_003861			IQ motif containing GTPase activating protein 1						energy reserve metabolic process|regulation of insulin secretion|small GTPase mediated signal transduction	actin filament|cytoplasm|midbody|nucleus|plasma membrane	calmodulin binding|GTPase inhibitor activity|protein phosphatase binding|Ras GTPase activator activity			ovary(2)|lung(2)|central_nervous_system(2)|pancreas(1)|skin(1)	8	Melanoma(11;0.00551)|Lung NSC(78;0.0237)|all_lung(78;0.0488)		BRCA - Breast invasive adenocarcinoma(143;0.0745)|KIRC - Kidney renal clear cell carcinoma(17;0.138)|Kidney(142;0.194)															---	---	---	---
MAN2A2	4122	broad.mit.edu	37	15	91459621	91459621	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91459621delG	uc010bnz.2	+						MAN2A2_uc002bqc.2_Intron|MAN2A2_uc010uql.1_Intron|MAN2A2_uc010uqm.1_Intron|MAN2A2_uc010uqn.1_Intron	NM_006122	NP_006113			mannosidase, alpha, class 2A, member 2						mannose metabolic process|post-translational protein modification|protein N-linked glycosylation via asparagine	Golgi membrane|integral to membrane	alpha-mannosidase activity|carbohydrate binding|mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity|zinc ion binding			large_intestine(2)|ovary(1)	3	Lung NSC(78;0.0771)|all_lung(78;0.137)		Lung(145;0.229)															---	---	---	---
CHD2	1106	broad.mit.edu	37	15	93488927	93488928	+	Intron	DEL	TT	-	-	rs113903945		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:93488927_93488928delTT	uc002bsp.2	+						CHD2_uc002bsn.2_Intron|CHD2_uc002bso.1_Intron|CHD2_uc010urb.1_Intron|CHD2_uc010bof.1_Intron	NM_001271	NP_001262			chromodomain helicase DNA binding protein 2						regulation of transcription from RNA polymerase II promoter	nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding			ovary(1)|skin(1)	2	Lung NSC(78;0.00976)|all_lung(78;0.016)		BRCA - Breast invasive adenocarcinoma(143;0.0282)|OV - Ovarian serous cystadenocarcinoma(32;0.0814)															---	---	---	---
C15orf51	196968	broad.mit.edu	37	15	100341728	100341728	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:100341728delA	uc010urx.1	-						C15orf51_uc010ury.1_Intron|uc002bvp.2_5'Flank|C15orf51_uc010urz.1_Intron|C15orf51_uc010bow.2_Intron	NR_003260				Homo sapiens cDNA FLJ43799 fis, clone TESTI4000288.												0																		---	---	---	---
LRRK1	79705	broad.mit.edu	37	15	101555474	101555474	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:101555474delA	uc002bwr.2	+						LRRK1_uc010usb.1_Intron|LRRK1_uc010usc.1_Intron	NM_024652	NP_078928			leucine-rich repeat kinase 1						small GTPase mediated signal transduction	mitochondrion	ATP binding|GTP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			ovary(4)|lung(4)|central_nervous_system(3)|large_intestine(1)	12	Melanoma(26;0.00505)|Lung NSC(78;0.00793)|all_lung(78;0.0094)		OV - Ovarian serous cystadenocarcinoma(32;0.000932)|LUSC - Lung squamous cell carcinoma(107;0.187)|Lung(145;0.23)													OREG0023522	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
LOC100134368	100134368	broad.mit.edu	37	16	437288	437288	+	Intron	DEL	A	-	-	rs137908843		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:437288delA	uc002cgw.1	+						uc002cgx.3_3'UTR	NR_024453				Homo sapiens cDNA clone IMAGE:3636396, partial cds.												0																		---	---	---	---
LMF1	64788	broad.mit.edu	37	16	920134	920134	+	Intron	DEL	G	-	-	rs111946394		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:920134delG	uc002ckj.2	-						LMF1_uc010brg.2_5'Flank|LMF1_uc010brh.2_Intron|LMF1_uc010bri.2_Intron|LMF1_uc002ckk.2_Intron	NM_022773	NP_073610			lipase maturation factor 1							endoplasmic reticulum membrane|integral to membrane					0		Hepatocellular(780;0.00308)																---	---	---	---
HN1L	90861	broad.mit.edu	37	16	1747679	1747679	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1747679delG	uc002cmg.2	+						HN1L_uc010uvi.1_Intron|HN1L_uc010brt.2_Intron|HN1L_uc010bru.2_Intron|HN1L_uc010uvj.1_Intron|HN1L_uc010uvk.1_Intron	NM_144570	NP_653171			hematological and neurological expressed 1-like							cytoplasm|nucleus				upper_aerodigestive_tract(1)	1																		---	---	---	---
TRAF7	84231	broad.mit.edu	37	16	2223873	2223873	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2223873delC	uc002cow.2	+							NM_032271	NP_115647			TNF receptor-associated factor 7						activation of MAPKKK activity|apoptosis|regulation of apoptosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic membrane-bounded vesicle|ubiquitin ligase complex	identical protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|lung(1)|breast(1)	3																		---	---	---	---
SRRM2	23524	broad.mit.edu	37	16	2809844	2809844	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2809844delT	uc002crk.2	+						SRRM2_uc002crj.1_Intron|SRRM2_uc002crl.1_Intron|SRRM2_uc010bsu.1_Intron	NM_016333	NP_057417			splicing coactivator subunit SRm300							Cajal body|catalytic step 2 spliceosome|nuclear speck	C2H2 zinc finger domain binding|protein N-terminus binding|RNA binding			ovary(1)|pancreas(1)|central_nervous_system(1)|skin(1)	4																		---	---	---	---
CREBBP	1387	broad.mit.edu	37	16	3786327	3786327	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3786327delC	uc002cvv.2	-						CREBBP_uc002cvw.2_Intron	NM_004380	NP_004371			CREB binding protein isoform a						cellular lipid metabolic process|homeostatic process|interspecies interaction between organisms|N-terminal peptidyl-lysine acetylation|protein complex assembly|response to hypoxia	cytoplasm|nuclear body	histone acetyltransferase activity|MyoD binding|p53 binding|sequence-specific DNA binding transcription factor activity|signal transducer activity|transcription coactivator activity|zinc ion binding			haematopoietic_and_lymphoid_tissue(97)|ovary(14)|lung(6)|skin(6)|breast(2)|NS(1)|pancreas(1)	127		Ovarian(90;0.0266)		OV - Ovarian serous cystadenocarcinoma(1;3.54e-05)				T|N|F|Mis|O	MLL|MORF|RUNXBP2	ALL|AML|DLBCL|B-NHL 		Rubinstein-Taybi syndrome		Rubinstein-Taybi_syndrome				---	---	---	---
CREBBP	1387	broad.mit.edu	37	16	3789629	3789629	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3789629delA	uc002cvv.2	-	25	4434	c.4230delT	c.(4228-4230)TTTfs	p.F1410fs	CREBBP_uc002cvw.2_Frame_Shift_Del_p.F1372fs	NM_004380	NP_004371	Q92793	CBP_HUMAN	CREB binding protein isoform a	1410	Cys/His-rich.				cellular lipid metabolic process|homeostatic process|interspecies interaction between organisms|N-terminal peptidyl-lysine acetylation|protein complex assembly|response to hypoxia	cytoplasm|nuclear body	histone acetyltransferase activity|MyoD binding|p53 binding|sequence-specific DNA binding transcription factor activity|signal transducer activity|transcription coactivator activity|zinc ion binding	p.F1410fs*49(1)		haematopoietic_and_lymphoid_tissue(97)|ovary(14)|lung(6)|skin(6)|breast(2)|NS(1)|pancreas(1)	127		Ovarian(90;0.0266)		OV - Ovarian serous cystadenocarcinoma(1;3.54e-05)				T|N|F|Mis|O	MLL|MORF|RUNXBP2	ALL|AML|DLBCL|B-NHL 		Rubinstein-Taybi syndrome		Rubinstein-Taybi_syndrome				---	---	---	---
USP7	7874	broad.mit.edu	37	16	8994680	8994681	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:8994680_8994681delAA	uc002czl.2	-						USP7_uc010uyk.1_Intron|USP7_uc002czj.2_Intron|USP7_uc010uyj.1_Intron|USP7_uc002czk.2_Intron	NM_003470	NP_003461			ubiquitin specific peptidase 7						interspecies interaction between organisms|multicellular organismal development|protein deubiquitination|regulation of sequence-specific DNA binding transcription factor activity|ubiquitin-dependent protein catabolic process	cytoplasm|PML body	cysteine-type endopeptidase activity|p53 binding|protein C-terminus binding|transcription factor binding|ubiquitin protein ligase binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(3)	3																		---	---	---	---
ATF7IP2	80063	broad.mit.edu	37	16	10524399	10524400	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:10524399_10524400delTT	uc002czu.2	+						ATF7IP2_uc002czv.2_Intron|ATF7IP2_uc010uyo.1_Intron|ATF7IP2_uc010uyp.1_Intron|ATF7IP2_uc002czw.2_Intron|ATF7IP2_uc010uyq.1_Intron	NM_024997	NP_079273			activating transcription factor 7 interacting						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus					0																		---	---	---	---
LITAF	9516	broad.mit.edu	37	16	11647267	11647267	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11647267delA	uc002daz.2	-						LITAF_uc002dba.2_Intron|LITAF_uc002dbb.2_Intron|LITAF_uc002dbc.2_Intron|LITAF_uc002dbd.2_Intron	NM_004862	NP_004853			lipopolysaccharide-induced TNF-alpha factor						apoptosis|positive regulation of I-kappaB kinase/NF-kappaB cascade|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	Golgi apparatus|lysosomal membrane	signal transducer activity|WW domain binding			liver(1)	1																		---	---	---	---
ZC3H7A	29066	broad.mit.edu	37	16	11859034	11859034	+	Intron	DEL	C	-	-	rs75779711	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11859034delC	uc002dbk.2	-						ZC3H7A_uc002dbj.2_Intron|ZC3H7A_uc002dbl.2_Intron|ZC3H7A_uc002dbm.1_Intron	NM_014153	NP_054872			zinc finger CCCH-type containing 7A							nucleus	nucleic acid binding|zinc ion binding			ovary(2)|pancreas(1)|skin(1)	4																		---	---	---	---
GSPT1	2935	broad.mit.edu	37	16	11990390	11990391	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11990390_11990391delTT	uc002dbr.2	-						GSPT1_uc002dbu.2_Intron|GSPT1_uc002dbt.2_Intron|GSPT1_uc010bux.2_Intron	NM_001130007	NP_001123479			G1 to S phase transition 1 isoform 3						G1/S transition of mitotic cell cycle|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|protein methylation	intracellular	GTP binding|GTPase activity|protein binding|translation release factor activity			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3																		---	---	---	---
Unknown	0	broad.mit.edu	37	16	12936326	12936326	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:12936326delT								CPPED1 (38582 upstream) : SHISA9 (59151 downstream)																																			---	---	---	---
ERCC4	2072	broad.mit.edu	37	16	14016110	14016111	+	Intron	DEL	TT	-	-	rs113434368		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:14016110_14016111delTT	uc002dce.2	+						ERCC4_uc010bva.2_Intron	NM_005236	NP_005227			excision repair cross-complementing rodent						double-strand break repair via homologous recombination|meiotic mismatch repair|negative regulation of telomere maintenance|nucleotide-excision repair, DNA damage removal|nucleotide-excision repair, DNA incision, 3'-to lesion|nucleotide-excision repair, DNA incision, 5'-to lesion|resolution of meiotic recombination intermediates|telomere maintenance via telomere shortening|transcription-coupled nucleotide-excision repair	nuclear chromosome, telomeric region|nucleoplasm|nucleotide-excision repair factor 1 complex	damaged DNA binding|protein C-terminus binding|protein N-terminus binding|single-stranded DNA binding|single-stranded DNA specific endodeoxyribonuclease activity			lung(4)|ovary(3)|skin(2)|pancreas(1)	10								Mis|N|F			skin basal cell|skin squamous cell|melanoma		Direct_reversal_of_damage|NER	Xeroderma_Pigmentosum				---	---	---	---
PARN	5073	broad.mit.edu	37	16	14693890	14693890	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:14693890delA	uc010uzd.1	-						PARN_uc010uzc.1_Intron|PARN_uc010uze.1_Intron|PARN_uc010uzf.1_Intron|PARN_uc010uzg.1_Intron	NM_002582	NP_002573			poly(A)-specific ribonuclease (deadenylation						female gamete generation|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|nuclear-transcribed mRNA poly(A) tail shortening|RNA modification	cytosol|nucleolus	metal ion binding|mRNA 3'-UTR binding|nucleotide binding|poly(A)-specific ribonuclease activity|protein binding			ovary(2)	2																		---	---	---	---
PARN	5073	broad.mit.edu	37	16	14698126	14698126	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:14698126delT	uc010uzd.1	-						PARN_uc010uzc.1_Intron|PARN_uc010uze.1_Intron|PARN_uc010uzf.1_Intron|PARN_uc010uzg.1_Intron	NM_002582	NP_002573			poly(A)-specific ribonuclease (deadenylation						female gamete generation|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|nuclear-transcribed mRNA poly(A) tail shortening|RNA modification	cytosol|nucleolus	metal ion binding|mRNA 3'-UTR binding|nucleotide binding|poly(A)-specific ribonuclease activity|protein binding			ovary(2)	2																		---	---	---	---
ABCC6	368	broad.mit.edu	37	16	16266968	16266968	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:16266968delT	uc002den.3	-						ABCC6_uc010bvo.2_Intron	NM_001171	NP_001162			ATP-binding cassette, sub-family C, member 6						response to drug|visual perception	integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			skin(2)|ovary(1)	3				UCEC - Uterine corpus endometrioid carcinoma (3;0.123)														---	---	---	---
TMC7	79905	broad.mit.edu	37	16	19020932	19020932	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19020932delA	uc002dfq.2	+						TMC7_uc010vao.1_Intron|TMC7_uc002dfp.2_Intron|TMC7_uc010vap.1_Intron	NM_024847	NP_079123			transmembrane channel-like 7 isoform a							integral to membrane				skin(2)|ovary(1)	3																		---	---	---	---
C16orf62	57020	broad.mit.edu	37	16	19627861	19627861	+	Intron	DEL	A	-	-	rs113166809		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19627861delA	uc002dgn.1	+						C16orf62_uc002dgo.1_Intron|C16orf62_uc002dgp.1_Intron|C16orf62_uc002dgm.1_Intron	NM_020314	NP_064710			hypothetical protein LOC57020							integral to membrane				ovary(1)	1																		---	---	---	---
METTL9	51108	broad.mit.edu	37	16	21653103	21653105	+	Intron	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21653103_21653105delTTT	uc002dje.2	+						uc002diq.3_Intron|METTL9_uc002djf.2_Intron|IGSF6_uc002djg.1_Intron	NM_016025	NP_057109			methyltransferase like 9 isoform 1											ovary(1)	1				GBM - Glioblastoma multiforme(48;0.0759)														---	---	---	---
Unknown	0	broad.mit.edu	37	16	21890632	21890632	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21890632delA	uc002djr.3	-						uc002djs.3_Intron|uc010vbo.1_RNA	NM_130464	NP_569731			nuclear pore complex interacting protein-like 3																														---	---	---	---
CDR2	1039	broad.mit.edu	37	16	22376144	22376145	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:22376144_22376145insT	uc002dkn.2	-							NM_001802	NP_001793			cerebellar degeneration-related protein 2							nucleus	protein binding			skin(1)	1				GBM - Glioblastoma multiforme(48;0.0188)														---	---	---	---
GGA2	23062	broad.mit.edu	37	16	23504945	23504945	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23504945delA	uc002dlq.2	-						GGA2_uc010bxo.1_Intron	NM_015044	NP_055859			ADP-ribosylation factor binding protein 2						intracellular protein transport|vesicle-mediated transport	clathrin adaptor complex|clathrin-coated vesicle|endosome membrane|trans-Golgi network	ADP-ribosylation factor binding			ovary(1)|central_nervous_system(1)	2				GBM - Glioblastoma multiforme(48;0.0386)														---	---	---	---
PALB2	79728	broad.mit.edu	37	16	23637881	23637881	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23637881delA	uc002dlx.1	-							NM_024675	NP_078951			partner and localizer of BRCA2						double-strand break repair via homologous recombination	nucleoplasm	DNA binding|protein binding			lung(3)|breast(3)|ovary(2)|skin(1)|kidney(1)|pancreas(1)	11				GBM - Glioblastoma multiforme(48;0.0167)				F|N|Mis			Wilms tumor|medulloblastoma|AML ,breast		Direct_reversal_of_damage|Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia_type_N|Fanconi_Anemia|PALB2-associated_Familial_Breast_and_Pancreatic_Cancer|Pancreatic_Cancer_Familial_Clustering_of				---	---	---	---
GTF3C1	2975	broad.mit.edu	37	16	27475036	27475036	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:27475036delA	uc002dov.1	-						GTF3C1_uc002dou.2_Intron	NM_001520	NP_001511			general transcription factor IIIC, polypeptide							transcription factor TFIIIC complex	DNA binding|protein binding			ovary(2)|pancreas(1)|breast(1)|skin(1)	5																		---	---	---	---
KCTD13	253980	broad.mit.edu	37	16	29923238	29923238	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29923238delC	uc002duv.2	-						uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|ASPHD1_uc002duu.3_Intron|ASPHD1_uc010bzi.2_Intron|KCTD13_uc010vee.1_Intron	NM_178863	NP_849194			potassium channel tetramerisation domain						cell migration|DNA replication|negative regulation of Rho protein signal transduction|proteasomal ubiquitin-dependent protein catabolic process|protein ubiquitination|stress fiber assembly	Cul3-RING ubiquitin ligase complex|nucleus|voltage-gated potassium channel complex	GTP-Rho binding|voltage-gated potassium channel activity				0																		---	---	---	---
ITFG1	81533	broad.mit.edu	37	16	47292700	47292700	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:47292700delA	uc002eet.2	-						ITFG1_uc010vgg.1_Intron|ITFG1_uc010vgh.1_Intron	NM_030790	NP_110417			integrin alpha FG-GAP repeat containing 1							extracellular region|integral to membrane				ovary(1)|central_nervous_system(1)	2		all_cancers(37;0.0613)|all_lung(18;0.0543)|Lung NSC(13;0.227)																---	---	---	---
ADCY7	113	broad.mit.edu	37	16	50340876	50340877	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:50340876_50340877insT	uc002egd.1	+						ADCY7_uc002egc.1_Intron	NM_001114	NP_001105			adenylate cyclase 7						activation of adenylate cyclase activity by G-protein signaling pathway|activation of phospholipase C activity|activation of protein kinase A activity|cellular response to ethanol|cellular response to glucagon stimulus|energy reserve metabolic process|inhibition of adenylate cyclase activity by G-protein signaling pathway|nerve growth factor receptor signaling pathway|positive regulation of cAMP biosynthetic process|synaptic transmission|transmembrane transport|water transport	integral to membrane|plasma membrane	adenylate cyclase activity|ATP binding|metal ion binding			skin(1)	1		all_cancers(37;0.0127)		GBM - Glioblastoma multiforme(240;0.195)	Bromocriptine(DB01200)													---	---	---	---
IRX3	79191	broad.mit.edu	37	16	54317531	54317531	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:54317531delT	uc002eht.1	-	4						NM_024336	NP_077312			iroquois homeobox 3						multicellular organismal development	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
MT1F	4494	broad.mit.edu	37	16	56692566	56692566	+	Intron	DEL	T	-	-	rs75978933		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:56692566delT	uc002ejt.2	+							NM_005949	NP_005940			metallothionein 1F							cytoplasm	cadmium ion binding|copper ion binding|zinc ion binding				0																		---	---	---	---
CIAPIN1	57019	broad.mit.edu	37	16	57466224	57466225	+	Intron	DEL	AA	-	-	rs67440037		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57466224_57466225delAA	uc002ell.1	-						CIAPIN1_uc002elk.1_Intron|CIAPIN1_uc002elm.1_Intron|CIAPIN1_uc002eln.1_Intron|CIAPIN1_uc010cda.1_Intron|CIAPIN1_uc002elo.1_Intron	NM_020313	NP_064709			cytokine induced apoptosis inhibitor 1						anti-apoptosis|apoptosis	cytoplasm|nucleolus					0																		---	---	---	---
CDH11	1009	broad.mit.edu	37	16	64981267	64981267	+	3'UTR	DEL	T	-	-	rs34181449		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:64981267delT	uc002eoi.2	-	13					CDH11_uc010cdn.2_RNA|CDH11_uc002eoj.2_3'UTR|CDH11_uc010vin.1_3'UTR	NM_001797	NP_001788			cadherin 11, type 2 preproprotein						adherens junction organization|cell junction assembly|homophilic cell adhesion|ossification|skeletal system development	integral to membrane|plasma membrane	calcium ion binding|protein binding			lung(10)|ovary(3)|skin(1)	14		Ovarian(137;0.0973)		OV - Ovarian serous cystadenocarcinoma(108;0.205)				T	USP6	aneurysmal bone cysts					TSP Lung(24;0.17)			---	---	---	---
CBFB	865	broad.mit.edu	37	16	67070809	67070810	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67070809_67070810delTT	uc002era.2	+						CBFB_uc002erb.2_Intron|CBFB_uc010vja.1_Intron	NM_001755	NP_001746			core-binding factor, beta subunit isoform 2						transcription from RNA polymerase II promoter	nucleus	protein binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity			breast(2)	2		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.00189)|Epithelial(162;0.00755)|all cancers(182;0.066)				T	MYH11	AML								---	---	---	---
KCTD19	146212	broad.mit.edu	37	16	67325776	67325776	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67325776delA	uc002esu.2	-						KCTD19_uc002est.2_Intron|KCTD19_uc010vjj.1_Intron	NM_001100915	NP_001094385			potassium channel tetramerisation domain							voltage-gated potassium channel complex	voltage-gated potassium channel activity			skin(1)	1		Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0311)|Epithelial(162;0.0906)														---	---	---	---
C16orf48	84080	broad.mit.edu	37	16	67699272	67699274	+	Intron	DEL	ATT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67699272_67699274delATT	uc002etw.1	-						C16orf48_uc002etv.1_5'Flank|C16orf48_uc010cem.1_Intron|C16orf86_uc002etx.1_5'Flank|C16orf86_uc002ety.2_5'Flank|C16orf86_uc002etz.2_5'Flank	NM_032140	NP_115516			hypothetical protein LOC84080							microtubule cytoskeleton	protein binding				0		Acute lymphoblastic leukemia(13;3.23e-05)|all_hematologic(13;0.00251)|Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0143)|Epithelial(162;0.047)|all cancers(182;0.228)														---	---	---	---
NFAT5	10725	broad.mit.edu	37	16	69693613	69693613	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:69693613delT	uc002exm.1	+						NFAT5_uc002exh.1_Intron|NFAT5_uc002exi.2_Intron|NFAT5_uc002exj.1_Intron|NFAT5_uc002exk.1_Intron|NFAT5_uc002exl.1_Intron|NFAT5_uc002exn.1_Intron	NM_006599	NP_006590			nuclear factor of activated T-cells 5 isoform c						excretion|signal transduction|transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
VAC14	55697	broad.mit.edu	37	16	70765775	70765775	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70765775delA	uc002ezm.2	-						VAC14_uc010cfw.2_Intron|VAC14_uc002ezn.2_Intron|VAC14_uc002ezl.2_5'Flank|VAC14_uc010cfx.1_Intron	NM_018052	NP_060522			Vac14 homolog						interspecies interaction between organisms	endoplasmic reticulum|endosome membrane|microsome	protein binding|receptor activity			pancreas(1)|skin(1)	2		Ovarian(137;0.0699)																---	---	---	---
CFDP1	10428	broad.mit.edu	37	16	75327732	75327732	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:75327732delA	uc002fdy.2	-	7					CFDP1_uc002fdz.2_3'UTR	NM_006324	NP_006315			craniofacial development protein 1						multicellular organismal development					upper_aerodigestive_tract(1)	1																		---	---	---	---
VAT1L	57687	broad.mit.edu	37	16	77850683	77850683	+	Intron	DEL	A	-	-	rs71884745		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:77850683delA	uc002ffg.1	+							NM_020927	NP_065978			vesicle amine transport protein 1 homolog (T.								oxidoreductase activity|zinc ion binding			central_nervous_system(1)	1																		---	---	---	---
C16orf46	123775	broad.mit.edu	37	16	81095915	81095915	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:81095915delA	uc002fgc.3	-						C16orf46_uc010chf.2_Intron|C16orf46_uc010vno.1_Intron	NM_152337	NP_689550			chromosome 16 open reading frame 46 isoform 2												0																		---	---	---	---
CPNE7	27132	broad.mit.edu	37	16	89655347	89655348	+	Intron	INS	-	C	C	rs114759325	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89655347_89655348insC	uc002fnp.2	+						CPNE7_uc002fnq.2_Intron	NM_014427	NP_055242			copine 7 isoform b						lipid metabolic process		transporter activity				0		all_hematologic(23;0.0748)		all cancers(4;3.63e-08)|OV - Ovarian serous cystadenocarcinoma(4;1.7e-06)|BRCA - Breast invasive adenocarcinoma(80;0.0147)														---	---	---	---
PRDM7	11105	broad.mit.edu	37	16	90124446	90124447	+	3'UTR	DEL	TG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:90124446_90124447delTG	uc010cje.2	-	10					PRDM7_uc002fqo.2_3'UTR|PRDM7_uc010cjf.2_3'UTR	NM_001098173	NP_001091643			PR domain containing 7 isoform 1							chromosome|nucleus	nucleic acid binding			ovary(1)	1		all_cancers(9;4.44e-13)|Lung NSC(15;1.56e-06)|all_lung(18;2.18e-06)|all_neural(9;0.00118)|all_hematologic(23;0.0194)		BRCA - Breast invasive adenocarcinoma(80;0.0278)														---	---	---	---
GLOD4	51031	broad.mit.edu	37	17	663610	663610	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:663610delA	uc002frv.2	-						GLOD4_uc002frt.2_Intron|GLOD4_uc002fru.2_Intron|GLOD4_uc010vqc.1_Intron	NM_016080	NP_057164			glyoxalase domain containing 4							mitochondrion					0				UCEC - Uterine corpus endometrioid carcinoma (25;0.022)														---	---	---	---
ABR	29	broad.mit.edu	37	17	1004072	1004072	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1004072delT	uc002fsd.2	-						ABR_uc002fse.2_Intron|ABR_uc002fsg.2_Intron|ABR_uc010cjq.1_Intron	NM_021962	NP_068781			active breakpoint cluster region-related						apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity|protein binding|Rho guanyl-nucleotide exchange factor activity			upper_aerodigestive_tract(1)	1				UCEC - Uterine corpus endometrioid carcinoma (25;0.0228)														---	---	---	---
MYO1C	4641	broad.mit.edu	37	17	1387335	1387335	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1387335delA	uc002fsp.2	-						MYO1C_uc002fsn.2_Intron|MYO1C_uc002fso.2_Intron|MYO1C_uc010vqj.1_Intron|MYO1C_uc010vqk.1_Intron	NM_001080779	NP_001074248			myosin IC isoform a						mRNA transport|protein transport|transmembrane transport	basal plasma membrane|cytoplasm|filamentous actin|lateral plasma membrane|nuclear pore|nucleolus|nucleoplasm|stereocilium membrane	actin binding|ATP binding|calmodulin binding|motor activity				0				UCEC - Uterine corpus endometrioid carcinoma (25;0.0822)														---	---	---	---
METT10D	79066	broad.mit.edu	37	17	2405282	2405282	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:2405282delT	uc002fut.2	-						METT10D_uc002fuu.3_Intron|METT10D_uc010cka.2_Intron|METT10D_uc002fuv.2_Intron|METT10D_uc010vqx.1_Intron|METT10D_uc010vqy.1_Intron	NM_024086	NP_076991			methyltransferase 10 domain containing								methyltransferase activity				0																		---	---	---	---
STX8	9482	broad.mit.edu	37	17	9282137	9282137	+	Intron	DEL	A	-	-	rs139246965	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:9282137delA	uc002glx.2	-							NM_004853	NP_004844			syntaxin 8						transport	endoplasmic reticulum|integral to plasma membrane				central_nervous_system(1)	1																		---	---	---	---
MYH4	4622	broad.mit.edu	37	17	10347779	10347779	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10347779delT	uc002gmn.2	-						uc002gml.1_Intron	NM_017533	NP_060003			myosin, heavy polypeptide 4, skeletal muscle						muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(10)|skin(2)|central_nervous_system(1)	13																		---	---	---	---
MYH4	4622	broad.mit.edu	37	17	10362680	10362680	+	Frame_Shift_Del	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10362680delA	uc002gmn.2	-	15	1586	c.1475delT	c.(1474-1476)TTCfs	p.F492fs	uc002gml.1_Intron	NM_017533	NP_060003	Q9Y623	MYH4_HUMAN	myosin, heavy polypeptide 4, skeletal muscle	492	Myosin head-like.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(10)|skin(2)|central_nervous_system(1)	13																		---	---	---	---
Unknown	0	broad.mit.edu	37	17	14608988	14608988	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:14608988delT								HS3ST3B1 (359496 upstream) : PMP22 (524109 downstream)																																			---	---	---	---
FLCN	201163	broad.mit.edu	37	17	17131025	17131026	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:17131025_17131026insA	uc002gra.3	-						PLD6_uc010cpn.2_Intron|FLCN_uc002grb.3_Intron|FLCN_uc002grc.2_Intron	NM_144997	NP_659434			folliculin isoform 1						regulation of protein phosphorylation	cytoplasm|nucleus|plasma membrane	protein binding			thyroid(1)|haematopoietic_and_lymphoid_tissue(1)|lung(1)	3														Birt-Hogg-Dub__syndrome|Familial_Non-VHL_Clear_Cell_Renal_Cancer				---	---	---	---
Unknown	0	broad.mit.edu	37	17	20319292	20319292	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:20319292delA	uc010vzg.1	+						uc002gwx.2_5'Flank					Homo sapiens cDNA FLJ59693 complete cds, moderately similar to Ankyrin repeat domain-containing protein 26.																														---	---	---	---
KIAA0100	9703	broad.mit.edu	37	17	26947118	26947118	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26947118delG	uc002hbu.2	-						KIAA0100_uc002hbt.2_Intron	NM_014680	NP_055495			hypothetical protein LOC9703 precursor							extracellular region				ovary(2)|breast(1)|skin(1)	4	Lung NSC(42;0.00431)																	---	---	---	---
SUPT6H	6830	broad.mit.edu	37	17	27004564	27004565	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27004564_27004565delAA	uc002hby.2	+						SUPT6H_uc010crt.2_Intron	NM_003170	NP_003161			suppressor of Ty 6 homolog						chromatin remodeling|regulation of transcription elongation, DNA-dependent|regulation of transcription from RNA polymerase II promoter	nucleus	hydrolase activity, acting on ester bonds|RNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)|skin(1)	3	Lung NSC(42;0.00431)																	---	---	---	---
TAOK1	57551	broad.mit.edu	37	17	27805189	27805189	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27805189delA	uc002hdz.1	+						TAOK1_uc010wbe.1_Intron|TAOK1_uc010wbf.1_Intron|TAOK1_uc002heb.1_5'Flank	NM_020791	NP_065842			TAO kinase 1						mitotic prometaphase	cytosol|intracellular membrane-bounded organelle	ATP binding|protein serine/threonine kinase activity			upper_aerodigestive_tract(1)|lung(1)|central_nervous_system(1)|skin(1)	4			Colorectal(6;0.198)															---	---	---	---
EFCAB5	374786	broad.mit.edu	37	17	28296060	28296061	+	Frame_Shift_Ins	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:28296060_28296061insA	uc002het.2	+	4	634_635	c.442_443insA	c.(442-444)GAAfs	p.E148fs	EFCAB5_uc010wbi.1_Intron|EFCAB5_uc010wbj.1_Frame_Shift_Ins_p.E92fs|EFCAB5_uc010wbk.1_Intron|EFCAB5_uc010csd.2_RNA|EFCAB5_uc010cse.2_Frame_Shift_Ins_p.E27fs|EFCAB5_uc010csf.2_Frame_Shift_Ins_p.E27fs	NM_198529	NP_940931	A4FU69	EFCB5_HUMAN	EF-hand calcium binding domain 5 isoform a	148							calcium ion binding			ovary(1)|skin(1)	2																		---	---	---	---
NF1	4763	broad.mit.edu	37	17	29665990	29665992	+	Intron	DEL	AGA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:29665990_29665992delAGA	uc002hgg.2	+						NF1_uc002hgh.2_Intron|NF1_uc010cso.2_Intron|NF1_uc010wbt.1_Intron|NF1_uc010wbu.1_Intron	NM_001042492	NP_001035957			neurofibromin isoform 1						actin cytoskeleton organization|adrenal gland development|artery morphogenesis|camera-type eye morphogenesis|cerebral cortex development|collagen fibril organization|forebrain astrocyte development|forebrain morphogenesis|heart development|liver development|MAPKKK cascade|metanephros development|myelination in peripheral nervous system|negative regulation of cell migration|negative regulation of endothelial cell proliferation|negative regulation of MAP kinase activity|negative regulation of MAPKKK cascade|negative regulation of neuroblast proliferation|negative regulation of oligodendrocyte differentiation|negative regulation of transcription factor import into nucleus|osteoblast differentiation|phosphatidylinositol 3-kinase cascade|pigmentation|positive regulation of adenylate cyclase activity|positive regulation of neuron apoptosis|Ras protein signal transduction|regulation of blood vessel endothelial cell migration|regulation of bone resorption|response to hypoxia|smooth muscle tissue development|spinal cord development|sympathetic nervous system development|visual learning|wound healing	axon|cytoplasm|dendrite|intrinsic to internal side of plasma membrane|nucleus	protein binding|Ras GTPase activator activity			soft_tissue(159)|central_nervous_system(56)|lung(28)|large_intestine(27)|haematopoietic_and_lymphoid_tissue(18)|ovary(18)|autonomic_ganglia(12)|breast(3)|skin(3)|stomach(2)|thyroid(1)|prostate(1)|kidney(1)|pancreas(1)	330		all_cancers(10;1.29e-12)|all_epithelial(10;0.00347)|all_hematologic(16;0.00556)|Acute lymphoblastic leukemia(14;0.00593)|Breast(31;0.014)|Myeloproliferative disorder(56;0.0255)|all_lung(9;0.0321)|Lung NSC(157;0.0659)		UCEC - Uterine corpus endometrioid carcinoma (4;4.38e-05)|all cancers(4;1.64e-26)|Epithelial(4;9.15e-23)|OV - Ovarian serous cystadenocarcinoma(4;3.58e-21)|GBM - Glioblastoma multiforme(4;0.00146)				D|Mis|N|F|S|O		neurofibroma|glioma	neurofibroma|glioma			Neurofibromatosis_type_1	TCGA GBM(6;<1E-08)|TSP Lung(7;0.0071)|TCGA Ovarian(3;0.0088)			---	---	---	---
DDX52	11056	broad.mit.edu	37	17	35974149	35974149	+	3'UTR	DEL	A	-	-	rs143300381	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:35974149delA	uc002hoi.1	-	15					DDX52_uc002hoh.1_3'UTR	NM_007010	NP_008941			ATP-dependent RNA helicase ROK1 isoform a							nucleolus	ATP binding|ATP-dependent helicase activity|RNA binding			ovary(1)|skin(1)	2		Breast(25;0.00637)|Ovarian(249;0.15)																---	---	---	---
PSMB3	5691	broad.mit.edu	37	17	36920440	36920440	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:36920440delT	uc002hqr.2	+	6						NM_002795	NP_002786			proteasome beta 3 subunit						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|interspecies interaction between organisms|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	cytoplasm|nucleus|proteasome core complex	protein binding|threonine-type endopeptidase activity				0																		---	---	---	---
CWC25	54883	broad.mit.edu	37	17	36977135	36977135	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:36977135delC	uc002hqu.2	-						CWC25_uc010wdv.1_Intron|CWC25_uc010wdx.1_Intron	NM_017748	NP_060218			coiled-coil domain containing 49												0																		---	---	---	---
IKZF3	22806	broad.mit.edu	37	17	37988576	37988576	+	Intron	DEL	A	-	-	rs74343111		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37988576delA	uc002hsu.2	-						IKZF3_uc002htd.2_Intron|IKZF3_uc010cwd.2_Intron|IKZF3_uc002hsv.2_Intron|IKZF3_uc010cwe.2_Intron|IKZF3_uc010cwf.2_Intron|IKZF3_uc010cwg.2_Intron|IKZF3_uc002hsw.2_Intron|IKZF3_uc002hsx.2_Intron|IKZF3_uc002hsy.2_Intron|IKZF3_uc002hsz.2_Intron|IKZF3_uc002hta.2_Intron|IKZF3_uc002htb.2_Intron|IKZF3_uc010cwh.2_Intron|IKZF3_uc002htc.2_Intron	NM_012481	NP_036613			aiolos isoform 1						B cell activation|mesoderm development|regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(2)|kidney(2)|skin(2)	6	Breast(7;4.5e-103)|Colorectal(19;0.000442)|Esophageal squamous(10;0.052)		UCEC - Uterine corpus endometrioid carcinoma (11;0.000126)|Colorectal(5;6.23e-08)|COAD - Colon adenocarcinoma(5;8.58e-06)|Lung(15;0.00193)|LUAD - Lung adenocarcinoma(14;0.0664)|LUSC - Lung squamous cell carcinoma(15;0.171)															---	---	---	---
CDC6	990	broad.mit.edu	37	17	38445872	38445872	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38445872delT	uc002huj.1	+							NM_001254	NP_001245			cell division cycle 6 protein						cell division|DNA replication|DNA replication checkpoint|M/G1 transition of mitotic cell cycle|mitosis|negative regulation of cell proliferation|negative regulation of DNA replication|positive regulation of cell cycle cytokinesis|positive regulation of chromosome segregation|regulation of cyclin-dependent protein kinase activity|regulation of mitotic anaphase|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle|traversing start control point of mitotic cell cycle	cytosol|nucleoplasm|spindle midzone|spindle pole	ATP binding|kinase binding|nucleoside-triphosphatase activity			ovary(2)|breast(1)	3																		---	---	---	---
KRT15	3866	broad.mit.edu	37	17	39675295	39675296	+	5'Flank	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39675295_39675296insT	uc002hwy.2	-						KRT15_uc002hwz.2_5'Flank|KRT15_uc002hxa.2_5'Flank|KRT15_uc002hxb.1_Intron	NM_002275	NP_002266			keratin 15						epidermis development	intermediate filament	protein binding|structural constituent of cytoskeleton				0		Breast(137;0.000286)																---	---	---	---
KLHL10	317719	broad.mit.edu	37	17	39994521	39994522	+	Intron	DEL	TT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39994521_39994522delTT	uc010cxr.2	+						NT5C3L_uc002hyb.3_5'Flank|NT5C3L_uc002hyc.3_5'Flank|NT5C3L_uc002hyd.3_5'Flank|NT5C3L_uc002hxy.3_5'Flank|NT5C3L_uc002hxz.3_5'Flank|NT5C3L_uc002hya.3_5'Flank|KLHL10_uc010wfv.1_Intron|KLHL10_uc010wfw.1_Intron	NM_152467	NP_689680			kelch-like 10							cytoplasm				ovary(1)|lung(1)|breast(1)|central_nervous_system(1)	4		Breast(137;0.000162)																---	---	---	---
RAB5C	5878	broad.mit.edu	37	17	40280554	40280554	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40280554delC	uc002hyz.2	-						RAB5C_uc002hza.2_Intron|RAB5C_uc010cxx.2_Intron|RAB5C_uc010cxy.2_Intron	NM_201434	NP_958842			RAB5C, member RAS oncogene family isoform a						protein transport|small GTPase mediated signal transduction	early endosome membrane|melanosome|plasma membrane	GTP binding|GTPase activity|protein binding			large_intestine(1)|skin(1)	2		all_cancers(22;1.24e-06)|all_epithelial(22;4.33e-05)|Breast(137;0.000143)		BRCA - Breast invasive adenocarcinoma(366;0.128)														---	---	---	---
Unknown	0	broad.mit.edu	37	17	43616612	43616612	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43616612delA	uc002ijh.2	-						uc010wjv.1_Intron					Homo sapiens cDNA FLJ45049 fis, clone BRAWH3022347.																														---	---	---	---
MAPT	4137	broad.mit.edu	37	17	44069148	44069150	+	Intron	DEL	TTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:44069148_44069150delTTT	uc002ijr.3	+						MAPT_uc010dau.2_Intron|MAPT_uc002ijs.3_Intron|MAPT_uc002ijx.3_Intron|MAPT_uc002ijt.3_Intron|MAPT_uc002iju.3_Intron|MAPT_uc002ijv.3_Intron	NM_016835	NP_058519			microtubule-associated protein tau isoform 1						cellular component disassembly involved in apoptosis|microtubule cytoskeleton organization|negative regulation of microtubule depolymerization|positive regulation of axon extension|positive regulation of microtubule polymerization|regulation of autophagy	axon|cytosol|growth cone|microtubule|microtubule associated complex|nuclear periphery|plasma membrane|tubulin complex	apolipoprotein E binding|enzyme binding|identical protein binding|lipoprotein particle binding|microtubule binding|protein binding|SH3 domain binding|structural constituent of cytoskeleton			pancreas(1)	1		Melanoma(429;0.216)																---	---	---	---
C17orf57	124989	broad.mit.edu	37	17	45451703	45451703	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45451703delT	uc002iln.2	+						C17orf57_uc002ilm.2_Intron|C17orf57_uc002ill.1_Intron|C17orf57_uc010daz.1_Intron	NM_152347	NP_689560			hypothetical protein LOC124989								calcium ion binding			breast(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
SP6	80320	broad.mit.edu	37	17	45925335	45925335	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45925335delC	uc002img.1	-	2	793	c.461delG	c.(460-462)GGCfs	p.G154fs	SP6_uc002imh.1_Frame_Shift_Del_p.G154fs	NM_199262	NP_954871	Q3SY56	SP6_HUMAN	Sp6 transcription factor	154					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)	1																		---	---	---	---
CACNA1G	8913	broad.mit.edu	37	17	48667993	48667993	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48667993delC	uc002irk.1	+						CACNA1G_uc002iri.1_Intron|CACNA1G_uc002irj.1_Intron|CACNA1G_uc002irl.1_Intron|CACNA1G_uc002irm.1_Intron|CACNA1G_uc002irn.1_Intron|CACNA1G_uc002iro.1_Intron|CACNA1G_uc002irp.1_Intron|CACNA1G_uc002irq.1_Intron|CACNA1G_uc002irr.1_Intron|CACNA1G_uc002irs.1_Intron|CACNA1G_uc002irt.1_Intron|CACNA1G_uc002irv.1_Intron|CACNA1G_uc002irw.1_Intron|CACNA1G_uc002iru.1_Intron|CACNA1G_uc002irx.1_Intron|CACNA1G_uc002iry.1_Intron|CACNA1G_uc002irz.1_Intron|CACNA1G_uc002isa.1_Intron|CACNA1G_uc002isb.1_Intron|CACNA1G_uc002isc.1_Intron|CACNA1G_uc002isd.1_Intron|CACNA1G_uc002ise.1_Intron|CACNA1G_uc002isf.1_Intron|CACNA1G_uc002isg.1_Intron|CACNA1G_uc002ish.1_Intron|CACNA1G_uc002isi.1_Intron	NM_018896	NP_061496			voltage-dependent calcium channel alpha 1G						axon guidance	voltage-gated calcium channel complex	low voltage-gated calcium channel activity			breast(1)	1	Breast(11;6.7e-17)		BRCA - Breast invasive adenocarcinoma(22;7.52e-09)		Ethosuximide(DB00593)|Flunarizine(DB04841)|Levetiracetam(DB01202)|Mibefradil(DB01388)|Pimozide(DB01100)|Trimethadione(DB00347)|Verapamil(DB00661)|Zonisamide(DB00909)													---	---	---	---
LUC7L3	51747	broad.mit.edu	37	17	48821044	48821044	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48821044delT	uc002isr.2	+						LUC7L3_uc002isp.1_Intron|LUC7L3_uc010wmw.1_Intron|LUC7L3_uc002isq.2_Intron|LUC7L3_uc002iss.2_Intron	NM_006107	NP_006098			LUC7-like 3						apoptosis|mRNA processing|response to stress|RNA splicing	focal adhesion|nuclear speck	DNA binding|mRNA binding|protein binding				0																		---	---	---	---
SPAG9	9043	broad.mit.edu	37	17	49098339	49098340	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:49098339_49098340insT	uc002itc.2	-						SPAG9_uc002itb.2_Intron|SPAG9_uc002itd.2_Intron|SPAG9_uc002itf.2_Intron|SPAG9_uc002ita.2_Intron|SPAG9_uc002ite.2_Intron	NM_001130528	NP_001124000			sperm associated antigen 9 isoform 1						positive regulation of cell migration|positive regulation of muscle cell differentiation|retrograde transport, endosome to Golgi|spermatogenesis	acrosomal vesicle|integral to membrane|perinuclear region of cytoplasm				lung(4)|breast(1)	5			BRCA - Breast invasive adenocarcinoma(22;4.24e-07)															---	---	---	---
STXBP4	252983	broad.mit.edu	37	17	53120723	53120723	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:53120723delA	uc002iuf.1	+						STXBP4_uc010dcc.1_Intron|STXBP4_uc010dcd.1_Intron	NM_178509	NP_848604			syntaxin binding protein 4							cytoplasm	calcium ion binding			ovary(1)	1																		---	---	---	---
DGKE	8526	broad.mit.edu	37	17	54934138	54934138	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:54934138delT	uc002iur.2	+						DGKE_uc002ius.1_Intron	NM_003647	NP_003638			diacylglycerol kinase epsilon						activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|intracellular signal transduction|phospholipid biosynthetic process|platelet activation	integral to membrane|plasma membrane	ATP binding|diacylglycerol kinase activity|metal ion binding|protein binding			breast(2)	2	Breast(9;3.59e-07)																	---	---	---	---
SKA2	348235	broad.mit.edu	37	17	57208610	57208610	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57208610delT	uc002ixd.2	-						SKA2_uc002ixc.2_Intron|SKA2_uc010dde.1_Intron|SKA2_uc002ixe.2_Intron	NM_182620	NP_872426			spindle and KT associated 2 isoform 1						cell division|chromosome segregation|mitotic anaphase|mitotic prometaphase|regulation of microtubule polymerization or depolymerization	condensed chromosome outer kinetochore|cytosol|spindle microtubule	microtubule binding				0																		---	---	---	---
SKA2	348235	broad.mit.edu	37	17	57208795	57208795	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57208795delT	uc002ixd.2	-						SKA2_uc002ixc.2_5'Flank|SKA2_uc010dde.1_Intron|SKA2_uc002ixe.2_Intron	NM_182620	NP_872426			spindle and KT associated 2 isoform 1						cell division|chromosome segregation|mitotic anaphase|mitotic prometaphase|regulation of microtubule polymerization or depolymerization	condensed chromosome outer kinetochore|cytosol|spindle microtubule	microtubule binding				0																		---	---	---	---
CLTC	1213	broad.mit.edu	37	17	57742423	57742423	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57742423delA	uc002ixq.1	+						CLTC_uc002ixp.2_Intron|CLTC_uc002ixr.1_Intron	NM_004859	NP_004850			clathrin heavy chain 1						axon guidance|epidermal growth factor receptor signaling pathway|intracellular protein transport|mitosis|negative regulation of epidermal growth factor receptor signaling pathway|nerve growth factor receptor signaling pathway|post-Golgi vesicle-mediated transport|receptor internalization|transferrin transport	clathrin coat of coated pit|clathrin coat of trans-Golgi network vesicle|cytosol|melanosome|spindle	protein binding|structural molecule activity		CLTC/ALK(44)|CLTC/TFE3(2)	haematopoietic_and_lymphoid_tissue(33)|soft_tissue(11)|kidney(2)|ovary(1)|breast(1)	48	all_neural(34;0.0878)|Medulloblastoma(34;0.0922)							T	ALK|TFE3	ALCL|renal 								---	---	---	---
CLTC	1213	broad.mit.edu	37	17	57746520	57746520	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57746520delA	uc002ixq.1	+						CLTC_uc002ixp.2_Intron|CLTC_uc002ixr.1_Intron	NM_004859	NP_004850			clathrin heavy chain 1						axon guidance|epidermal growth factor receptor signaling pathway|intracellular protein transport|mitosis|negative regulation of epidermal growth factor receptor signaling pathway|nerve growth factor receptor signaling pathway|post-Golgi vesicle-mediated transport|receptor internalization|transferrin transport	clathrin coat of coated pit|clathrin coat of trans-Golgi network vesicle|cytosol|melanosome|spindle	protein binding|structural molecule activity		CLTC/ALK(44)|CLTC/TFE3(2)	haematopoietic_and_lymphoid_tissue(33)|soft_tissue(11)|kidney(2)|ovary(1)|breast(1)	48	all_neural(34;0.0878)|Medulloblastoma(34;0.0922)							T	ALK|TFE3	ALCL|renal 								---	---	---	---
BCAS3	54828	broad.mit.edu	37	17	59465992	59465992	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59465992delA	uc002iyv.3	+						BCAS3_uc002iyu.3_Intron|BCAS3_uc002iyw.3_Frame_Shift_Del_p.G887fs|BCAS3_uc002iyy.3_Intron|BCAS3_uc002iyz.3_Intron|BCAS3_uc002iza.3_Intron|BCAS3_uc002izb.3_Intron|BCAS3_uc002izc.3_Intron|BCAS3_uc002izd.3_Intron	NM_001099432	NP_001092902			breast carcinoma amplified sequence 3 isoform 1							nucleus				ovary(2)|central_nervous_system(2)|skin(1)	5			BRCA - Breast invasive adenocarcinoma(1;3.11e-12)|Epithelial(12;8.2e-07)|all cancers(12;5.33e-06)															---	---	---	---
DDX5	1655	broad.mit.edu	37	17	62497066	62497066	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:62497066delA	uc002jek.2	-						DDX5_uc010deh.2_Intron|DDX5_uc002jej.2_Intron|DDX5_uc010wqa.1_Intron	NM_004396	NP_004387			DEAD (Asp-Glu-Ala-Asp) box polypeptide 5						cell growth|regulation of alternative nuclear mRNA splicing, via spliceosome	catalytic step 2 spliceosome|nucleolus	ATP binding|ATP-dependent helicase activity|mRNA binding|protein binding|RNA helicase activity|transcription cofactor activity			ovary(2)|lung(1)	3	Breast(5;2.15e-14)		BRCA - Breast invasive adenocarcinoma(8;8.6e-12)					T	ETV4	prostate								---	---	---	---
ABCA5	23461	broad.mit.edu	37	17	67264279	67264279	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:67264279delA	uc002jif.2	-						ABCA5_uc002jib.2_Intron|ABCA5_uc002jic.2_Intron|ABCA5_uc002jid.2_Intron|ABCA5_uc002jie.2_Intron|ABCA5_uc002jig.2_Intron	NM_018672	NP_061142			ATP-binding cassette, sub-family A , member 5						cholesterol efflux|high-density lipoprotein particle remodeling|negative regulation of macrophage derived foam cell differentiation	Golgi membrane|integral to membrane|late endosome membrane|lysosomal membrane	ATP binding|ATPase activity			ovary(2)|central_nervous_system(1)|skin(1)	4	Breast(10;3.72e-11)																	---	---	---	---
COG1	9382	broad.mit.edu	37	17	71203066	71203067	+	Intron	INS	-	A	A	rs35293364		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:71203066_71203067insA	uc002jjg.2	+						COG1_uc002jjh.2_Intron|COG1_uc002jjf.1_Intron	NM_018714	NP_061184			component of oligomeric golgi complex 1						Golgi organization|intra-Golgi vesicle-mediated transport|protein transport	Golgi membrane|Golgi transport complex	protein binding			ovary(1)	1			LUSC - Lung squamous cell carcinoma(166;0.197)															---	---	---	---
UNK	85451	broad.mit.edu	37	17	73809979	73809979	+	Intron	DEL	G	-	-	rs74319437	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73809979delG	uc002jpm.2	+							NM_001080419	NP_001073888			zinc finger CCCH-type domain containing 5								nucleic acid binding|zinc ion binding				0			all cancers(21;2.61e-06)|Epithelial(20;7.39e-06)|BRCA - Breast invasive adenocarcinoma(9;0.00194)|LUSC - Lung squamous cell carcinoma(166;0.154)															---	---	---	---
GAA	2548	broad.mit.edu	37	17	78078939	78078944	+	Intron	DEL	GGGCAG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78078939_78078944delGGGCAG	uc002jxo.2	+						GAA_uc002jxp.2_Intron|GAA_uc002jxq.2_Intron	NM_001079803	NP_001073271			acid alpha-glucosidase preproprotein						cardiac muscle contraction|diaphragm contraction|glycogen catabolic process|lysosome organization|tongue morphogenesis|vacuolar sequestering|ventricular cardiac muscle tissue morphogenesis	lysosomal membrane	carbohydrate binding|maltose alpha-glucosidase activity			ovary(1)	1	all_neural(118;0.117)		OV - Ovarian serous cystadenocarcinoma(97;0.0292)|BRCA - Breast invasive adenocarcinoma(99;0.139)		Acarbose(DB00284)													---	---	---	---
WDR45L	56270	broad.mit.edu	37	17	80574645	80574645	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80574645delT	uc002kfq.2	-						WDR45L_uc002kfr.2_Intron	NM_019613	NP_062559			WDR45-like						autophagy|response to starvation	organelle membrane	phosphatidylinositol-3,5-bisphosphate binding			ovary(1)	1	Breast(20;0.00106)|all_neural(118;0.0952)	all_cancers(8;0.101)|all_epithelial(8;0.198)	BRCA - Breast invasive adenocarcinoma(99;0.0262)|OV - Ovarian serous cystadenocarcinoma(97;0.0835)															---	---	---	---
ENOSF1	55556	broad.mit.edu	37	18	690429	690429	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:690429delA	uc002kku.3	-						ENOSF1_uc002kkt.3_Intron|ENOSF1_uc010dke.2_Intron|ENOSF1_uc010dkf.2_Intron|ENOSF1_uc002kkv.3_Intron|ENOSF1_uc002kkw.3_Intron|ENOSF1_uc002kkx.3_Intron	NM_017512	NP_059982			enolase superfamily 1 isoform rTS beta						cellular amino acid catabolic process	mitochondrion	isomerase activity|metal ion binding			ovary(1)	1																		---	---	---	---
MYOM1	8736	broad.mit.edu	37	18	3169070	3169071	+	Intron	INS	-	A	A	rs140809501	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3169070_3169071insA	uc002klp.2	-						MYOM1_uc002klq.2_Intron	NM_003803	NP_003794			myomesin 1 isoform a							striated muscle myosin thick filament	structural constituent of muscle			ovary(3)|central_nervous_system(1)|pancreas(1)	5																		---	---	---	---
PTPRM	5797	broad.mit.edu	37	18	8384458	8384458	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:8384458delA	uc002knn.3	+						PTPRM_uc010dkv.2_Intron|PTPRM_uc010wzl.1_Intron	NM_002845	NP_002836			protein tyrosine phosphatase, receptor type, M						homophilic cell adhesion|negative regulation of angiogenesis|negative regulation of endothelial cell migration|negative regulation of endothelial cell proliferation|response to drug|retina layer formation|retinal ganglion cell axon guidance	cell-cell adherens junction|integral to plasma membrane|lamellipodium|perinuclear region of cytoplasm	cadherin binding|transmembrane receptor protein tyrosine phosphatase activity			lung(3)|ovary(2)|central_nervous_system(1)	6		Colorectal(10;0.234)																---	---	---	---
CEP76	79959	broad.mit.edu	37	18	12699829	12699829	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:12699829delT	uc002kri.2	-	3	451	c.295delA	c.(295-297)ACTfs	p.T99fs	PSMG2_uc002krg.2_Intron|CEP76_uc002krh.3_5'UTR|CEP76_uc010wzz.1_Frame_Shift_Del_p.S99fs|CEP76_uc010xaa.1_5'UTR|CEP76_uc010xab.1_Frame_Shift_Del_p.S99fs	NM_024899	NP_079175	Q8TAP6	CEP76_HUMAN	centrosomal protein 76kDa	99					G2/M transition of mitotic cell cycle|regulation of centriole replication	centriole|cytosol	protein binding				0																		---	---	---	---
RNMT	8731	broad.mit.edu	37	18	13742794	13742794	+	Intron	DEL	A	-	-	rs7229786		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13742794delA	uc002ksk.1	+						RNMT_uc002ksl.1_Intron|RNMT_uc002ksm.1_Intron|RNMT_uc010dlk.2_Intron|RNMT_uc010xae.1_Intron	NM_003799	NP_003790			RNA (guanine-7-) methyltransferase						mRNA capping|transcription from RNA polymerase II promoter|viral reproduction	nucleoplasm	mRNA (guanine-N7-)-methyltransferase activity|RNA binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	18	14631709	14631709	+	IGR	DEL	A	-	-	rs28759159	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:14631709delA								POTEC (88110 upstream) : ANKRD30B (116530 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	18	14705716	14705716	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:14705716delA								POTEC (162117 upstream) : ANKRD30B (42523 downstream)																																			---	---	---	---
RBBP8	5932	broad.mit.edu	37	18	20526616	20526616	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:20526616delT	uc002ktw.2	+						RBBP8_uc002kty.2_Intron|RBBP8_uc002ktz.2_Intron|RBBP8_uc002kua.2_Intron|RBBP8_uc002ktx.1_Intron	NM_002894	NP_002885			retinoblastoma binding protein 8 isoform a						cell cycle checkpoint|DNA double-strand break processing involved in repair via single-strand annealing|meiosis|regulation of transcription from RNA polymerase II promoter	nucleus	damaged DNA binding|protein binding|single-stranded DNA specific endodeoxyribonuclease activity			ovary(1)|lung(1)|skin(1)	3	all_cancers(21;4.34e-05)|all_epithelial(16;8.3e-07)|Lung NSC(20;0.0107)|Colorectal(14;0.0202)|all_lung(20;0.0291)|Ovarian(20;0.19)		OV - Ovarian serous cystadenocarcinoma(1;0.00196)										Direct_reversal_of_damage|Homologous_recombination					---	---	---	---
CABYR	26256	broad.mit.edu	37	18	21737076	21737076	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21737076delT	uc002kux.2	+						CABYR_uc010xbb.1_Intron|CABYR_uc002kuy.2_Intron|CABYR_uc002kuz.2_Intron|CABYR_uc002kva.2_Intron|CABYR_uc002kvb.2_Intron|CABYR_uc002kvc.2_Intron|CABYR_uc010dlw.2_Intron	NM_012189	NP_036321			calcium-binding tyrosine						ciliary or flagellar motility|signal transduction|sperm capacitation	cytoplasm|cytoskeleton|flagellum|motile cilium|nucleus	calcium ion binding|cAMP-dependent protein kinase regulator activity|enzyme binding|protein heterodimerization activity|SH3 domain binding				0	all_cancers(21;9.13e-05)|all_epithelial(16;5.49e-07)|Lung NSC(20;0.00171)|all_lung(20;0.0055)|Colorectal(14;0.0305)|Ovarian(20;0.17)																	---	---	---	---
Unknown	0	broad.mit.edu	37	18	21741579	21741579	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21741579delT								CABYR (16 upstream) : OSBPL1A (434 downstream)																																			---	---	---	---
OSBPL1A	114876	broad.mit.edu	37	18	21861052	21861052	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21861052delT	uc002kve.2	-						OSBPL1A_uc010xbc.1_Intron|OSBPL1A_uc002kvf.3_Intron	NM_080597	NP_542164			oxysterol-binding protein-like 1A isoform B						cholesterol metabolic process|lipid transport|vesicle-mediated transport		phospholipid binding			ovary(4)	4	all_cancers(21;0.000396)|all_epithelial(16;4.36e-06)|Lung NSC(20;0.00171)|all_lung(20;0.0055)|Colorectal(14;0.0505)|Ovarian(20;0.17)																	---	---	---	---
PSMA8	143471	broad.mit.edu	37	18	23759261	23759264	+	Intron	DEL	TTTT	-	-	rs36120364		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:23759261_23759264delTTTT	uc002kvq.2	+						PSMA8_uc002kvo.2_Intron|PSMA8_uc002kvp.2_Intron|PSMA8_uc002kvr.2_Intron	NM_144662	NP_653263			proteasome alpha 8 subunit isoform 1						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|M/G1 transition of mitotic cell cycle|mRNA metabolic process|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	cytoplasm|nucleus|proteasome core complex, alpha-subunit complex	threonine-type endopeptidase activity			skin(1)	1	all_cancers(21;0.000585)|Lung NSC(5;0.00148)|all_lung(6;0.0038)|Ovarian(20;0.124)		OV - Ovarian serous cystadenocarcinoma(3;0.000324)|all cancers(3;0.000954)|LUSC - Lung squamous cell carcinoma(2;0.181)															---	---	---	---
KIAA1012	22878	broad.mit.edu	37	18	29432790	29432790	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29432790delA	uc002kxc.3	-						KIAA1012_uc002kxb.3_Intron|KIAA1012_uc002kxd.3_Intron	NM_014939	NP_055754			hypothetical protein LOC22878						ER to Golgi vesicle-mediated transport	cis-Golgi network					0																		---	---	---	---
Unknown	0	broad.mit.edu	37	18	29656267	29656267	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29656267delT								RNF125 (3113 upstream) : RNF138 (15570 downstream)																																			---	---	---	---
MEP1B	4225	broad.mit.edu	37	18	29770169	29770169	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29770169delT	uc002kxj.3	+							NM_005925	NP_005916			meprin A beta precursor						digestion|proteolysis	extracellular space|integral to plasma membrane	metalloendopeptidase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
MEP1B	4225	broad.mit.edu	37	18	29796832	29796833	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29796832_29796833delAA	uc002kxj.3	+							NM_005925	NP_005916			meprin A beta precursor						digestion|proteolysis	extracellular space|integral to plasma membrane	metalloendopeptidase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
FAM59A	64762	broad.mit.edu	37	18	29848873	29848873	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29848873delT	uc002kxl.2	-						FAM59A_uc002kxk.1_Intron	NM_022751	NP_073588			family with sequence similarity 59, member A											ovary(1)|skin(1)	2																		---	---	---	---
KLHL14	57565	broad.mit.edu	37	18	30349570	30349570	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:30349570delC	uc002kxm.1	-							NM_020805	NP_065856			kelch-like 14							cytosol|endoplasmic reticulum membrane				ovary(1)	1																		---	---	---	---
KLHL14	57565	broad.mit.edu	37	18	30349862	30349862	+	Frame_Shift_Del	DEL	G	-	-	rs147661052		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:30349862delG	uc002kxm.1	-	2	1081	c.693delC	c.(691-693)CCCfs	p.P231fs		NM_020805	NP_065856	Q9P2G3	KLH14_HUMAN	kelch-like 14	231	BACK.					cytosol|endoplasmic reticulum membrane				ovary(1)	1																		---	---	---	---
NOL4	8715	broad.mit.edu	37	18	31673383	31673383	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:31673383delT	uc010dmi.2	-						NOL4_uc002kxr.3_Intron|NOL4_uc010xbt.1_Intron|NOL4_uc010dmh.2_Intron|NOL4_uc010xbu.1_Intron|NOL4_uc002kxt.3_Intron|NOL4_uc010xbw.1_Intron	NM_003787	NP_003778			nucleolar protein 4							nucleolus	RNA binding			ovary(3)	3																		---	---	---	---
DTNA	1837	broad.mit.edu	37	18	32400995	32400995	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:32400995delA	uc010dmn.1	+						DTNA_uc002kxu.2_Intron|DTNA_uc010xbx.1_Intron|DTNA_uc002kxv.3_Intron|DTNA_uc002kxw.2_Intron|DTNA_uc002kxx.2_Intron|DTNA_uc010dmj.2_Intron|DTNA_uc002kxz.2_Intron|DTNA_uc002kxy.2_Intron|DTNA_uc010dmk.1_Intron|DTNA_uc010dml.2_Intron|DTNA_uc002kyb.3_Intron|DTNA_uc010dmm.2_Intron|DTNA_uc010xby.1_Intron|DTNA_uc010dmo.2_Intron|DTNA_uc002kyd.3_Intron|DTNA_uc010xbz.1_Intron|DTNA_uc010xca.1_Intron|DTNA_uc002kye.2_Intron	NM_001390	NP_001381			dystrobrevin alpha isoform 1						neuromuscular synaptic transmission|signal transduction|striated muscle contraction	cell junction|cytoplasm|synapse	calcium ion binding|protein binding|zinc ion binding				0																		---	---	---	---
DTNA	1837	broad.mit.edu	37	18	32457924	32457924	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:32457924delT	uc010dmn.1	+						DTNA_uc002kxw.2_Intron|DTNA_uc010dmj.2_Intron|DTNA_uc002kxz.2_Intron|DTNA_uc002kxy.2_Intron|DTNA_uc010xby.1_Intron|DTNA_uc010xbz.1_Intron|DTNA_uc010xca.1_Intron|DTNA_uc002kye.2_Intron	NM_001390	NP_001381			dystrobrevin alpha isoform 1						neuromuscular synaptic transmission|signal transduction|striated muscle contraction	cell junction|cytoplasm|synapse	calcium ion binding|protein binding|zinc ion binding				0																		---	---	---	---
PSTPIP2	9050	broad.mit.edu	37	18	43610328	43610328	+	Intron	DEL	A	-	-	rs78851876		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:43610328delA	uc002lbp.3	-						PSTPIP2_uc002lbq.3_Intron	NM_024430	NP_077748			proline-serine-threonine phosphatase interacting							membrane				ovary(1)	1																		---	---	---	---
HDHD2	84064	broad.mit.edu	37	18	44634940	44634940	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:44634940delA	uc002lcs.2	-	7					HDHD2_uc002lct.2_3'UTR	NM_032124	NP_115500			haloacid dehalogenase-like hydrolase domain								hydrolase activity				0																		---	---	---	---
MBD2	8932	broad.mit.edu	37	18	51750373	51750373	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:51750373delC	uc002lfg.1	-						MBD2_uc002lfh.1_Intron|SNORA37_uc002lfi.1_5'Flank	NM_003927	NP_003918			methyl-CpG binding domain protein 2 isoform 1						transcription, DNA-dependent		C2H2 zinc finger domain binding|methyl-CpG binding|satellite DNA binding				0				Colorectal(16;0.0212)|READ - Rectum adenocarcinoma(32;0.188)	Hexobarbital(DB01355)													---	---	---	---
Unknown	0	broad.mit.edu	37	18	57445696	57445696	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:57445696delA								CCBE1 (81052 upstream) : PMAIP1 (121496 downstream)																																			---	---	---	---
KIAA1468	57614	broad.mit.edu	37	18	59894503	59894503	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:59894503delT	uc002lil.2	+						KIAA1468_uc002lik.1_Intron|KIAA1468_uc010xel.1_Intron|KIAA1468_uc002lim.2_Intron	NM_020854	NP_065905			hypothetical protein LOC57614								binding			ovary(2)|breast(2)|upper_aerodigestive_tract(1)|large_intestine(1)	6		Colorectal(73;0.186)																---	---	---	---
ZCCHC2	54877	broad.mit.edu	37	18	60230100	60230100	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:60230100delT	uc002lip.3	+						ZCCHC2_uc002lio.2_Intron|ZCCHC2_uc002liq.2_Intron	NM_017742	NP_060212			zinc finger, CCHC domain containing 2						cell communication	cytoplasm	nucleic acid binding|phosphatidylinositol binding|zinc ion binding			lung(1)|prostate(1)	2																		---	---	---	---
MED16	10025	broad.mit.edu	37	19	873769	873770	+	Intron	INS	-	C	C	rs151113242	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:873769_873770insC	uc002lqd.1	-						MED16_uc010drw.1_Intron|MED16_uc002lqe.2_Intron|MED16_uc002lqf.2_Intron|MED16_uc010xfv.1_Intron|MED16_uc010xfw.1_Intron|MED16_uc010xfx.1_Intron|MED16_uc010xfy.1_Intron|MED16_uc010xfz.1_RNA	NM_005481	NP_005472			mediator complex subunit 16						androgen receptor signaling pathway|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	receptor activity|thyroid hormone receptor binding|thyroid hormone receptor coactivator activity|vitamin D receptor binding				0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;6.59e-06)|all_lung(49;9.97e-06)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
ABCA7	10347	broad.mit.edu	37	19	1048808	1048808	+	Intron	DEL	A	-	-	rs77486898		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1048808delA	uc002lqw.3	+						ABCA7_uc010dsb.1_Intron	NM_019112	NP_061985			ATP-binding cassette, sub-family A, member 7						phagocytosis|transmembrane transport	ATP-binding cassette (ABC) transporter complex|endosome membrane|Golgi membrane|integral to membrane|plasma membrane	ATP binding|ATPase activity|transporter activity			pancreas(7)|ovary(1)|central_nervous_system(1)	9		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.04e-05)|all_lung(49;1.53e-05)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
BTBD2	55643	broad.mit.edu	37	19	1997185	1997185	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1997185delA	uc002lup.1	-							NM_017797	NP_060267			BTB (POZ) domain containing 2							cytoplasmic mRNA processing body	protein binding			ovary(1)|skin(1)	2		Ovarian(11;2.11e-07)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
ZBTB7A	51341	broad.mit.edu	37	19	4047658	4047659	+	3'UTR	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4047658_4047659insT	uc002lzh.2	-	3					ZBTB7A_uc002lzi.2_3'UTR	NM_015898	NP_056982			zinc finger and BTB domain containing 7A						cell differentiation|multicellular organismal development|transcription, DNA-dependent	nucleus	DNA binding|histone acetyltransferase binding|zinc ion binding			pancreas(1)|skin(1)	2		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.014)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
FSD1	79187	broad.mit.edu	37	19	4323505	4323505	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4323505delC	uc002lzy.2	+						FSD1_uc002lzz.2_Intron|FSD1_uc002maa.2_Intron	NM_024333	NP_077309			fibronectin type III and SPRY domain containing						cell division|mitosis	cleavage furrow|microtubule|microtubule organizing center|nucleus				skin(1)	1				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.034)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
Unknown	0	broad.mit.edu	37	19	5576517	5576517	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5576517delT								PLAC2 (8512 upstream) : SAFB2 (10494 downstream)																																			---	---	---	---
NRTN	4902	broad.mit.edu	37	19	5824421	5824422	+	Intron	DEL	GT	-	-	rs141994814		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5824421_5824422delGT	uc002mde.2	+							NM_004558	NP_004549			neurturin preproprotein						axon guidance|MAPKKK cascade|neural crest cell migration|transmembrane receptor protein tyrosine kinase signaling pathway	extracellular region	growth factor activity				0																		---	---	---	---
KHSRP	8570	broad.mit.edu	37	19	6414076	6414076	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6414076delA	uc002mer.3	-	20						NM_003685	NP_003676			KH-type splicing regulatory protein						mRNA processing|mRNA transport|regulation of transcription, DNA-dependent|RNA splicing, via transesterification reactions|transcription, DNA-dependent	cytosol|nucleus	DNA binding|protein binding|RNA binding			skin(1)	1																		---	---	---	---
CRB3	92359	broad.mit.edu	37	19	6466212	6466212	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6466212delA	uc002mey.2	+						CRB3_uc002mez.2_Intron|CRB3_uc002mfa.2_Intron	NM_139161	NP_631900			crumbs 3 isoform a precursor						protein localization in plasma membrane|tight junction assembly	apical plasma membrane|integral to membrane|tight junction	SH3 domain binding				0																		---	---	---	---
TRIP10	9322	broad.mit.edu	37	19	6740868	6740868	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6740868delC	uc002mfs.2	+						TRIP10_uc010dux.1_Intron|TRIP10_uc002mfr.2_Intron|TRIP10_uc010duy.2_Intron|TRIP10_uc010duz.2_Intron	NM_004240	NP_004231			thyroid hormone receptor interactor 10						actin cytoskeleton organization|cell communication|endocytosis|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cell cortex|cell projection|cytoskeleton|cytosol|Golgi apparatus|lysosome|perinuclear region of cytoplasm|phagocytic cup	GTPase activator activity|identical protein binding|lipid binding			ovary(1)	1																		---	---	---	---
VAV1	7409	broad.mit.edu	37	19	6853742	6853744	+	Intron	DEL	AAA	-	-	rs79422784		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6853742_6853744delAAA	uc002mfu.1	+						VAV1_uc010xjh.1_Intron|VAV1_uc010dva.1_Intron|VAV1_uc002mfv.1_Intron	NM_005428	NP_005419			vav 1 guanine nucleotide exchange factor						apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|platelet activation|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|T cell costimulation	cytosol|plasma membrane	metal ion binding|protein binding|sequence-specific DNA binding transcription factor activity			lung(4)|ovary(4)|breast(3)|central_nervous_system(2)|kidney(2)|skin(1)	16																		---	---	---	---
EMR1	2015	broad.mit.edu	37	19	6906635	6906635	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6906635delA	uc002mfw.2	+						EMR1_uc010dvc.2_Intron|EMR1_uc010dvb.2_Intron|EMR1_uc010xji.1_Intron|EMR1_uc010xjj.1_Intron	NM_001974	NP_001965			egf-like module containing, mucin-like, hormone						cell adhesion|neuropeptide signaling pathway	integral to plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(3)|lung(1)|skin(1)	5	all_hematologic(4;0.166)																	---	---	---	---
INSR	3643	broad.mit.edu	37	19	7153006	7153006	+	Intron	DEL	A	-	-	rs62124500	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7153006delA	uc002mgd.1	-						INSR_uc002mge.1_Intron|INSR_uc002mgf.2_Intron	NM_000208	NP_000199			insulin receptor isoform Long precursor						activation of MAPK activity|activation of protein kinase B activity|carbohydrate metabolic process|fibroblast growth factor receptor signaling pathway|G-protein coupled receptor protein signaling pathway|glucose homeostasis|heart morphogenesis|peptidyl-tyrosine phosphorylation|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of developmental growth|positive regulation of DNA replication|positive regulation of glucose import|positive regulation of glycogen biosynthetic process|positive regulation of glycolysis|positive regulation of MAPKKK cascade|positive regulation of mitosis|positive regulation of nitric oxide biosynthetic process|positive regulation of protein kinase B signaling cascade|positive regulation of protein phosphorylation|positive regulation of respiratory burst|protein autophosphorylation|protein heterotetramerization|regulation of embryonic development|regulation of transcription, DNA-dependent|transformation of host cell by virus	caveola|endosome membrane|insulin receptor complex|microsome	ATP binding|GTP binding|insulin binding|insulin receptor activity|insulin receptor substrate binding|insulin-like growth factor I binding|insulin-like growth factor II binding|insulin-like growth factor receptor binding|metal ion binding|phosphatidylinositol 3-kinase binding|PTB domain binding|receptor signaling protein tyrosine kinase activity|SH2 domain binding			ovary(4)|lung(3)|central_nervous_system(2)|large_intestine(1)|stomach(1)|skin(1)	12					Insulin Glargine recombinant(DB00047)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)													---	---	---	---
PEX11G	92960	broad.mit.edu	37	19	7551023	7551023	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7551023delT	uc002mgk.1	-						PEX11G_uc002mgl.1_Intron	NM_080662	NP_542393			peroxisomal biogenesis factor 11 gamma							integral to membrane|peroxisomal membrane					0																		---	---	---	---
ZNF358	140467	broad.mit.edu	37	19	7583951	7583957	+	Intron	DEL	AAAAAAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7583951_7583957delAAAAAAA	uc002mgn.2	+							NM_018083	NP_060553			zinc finger protein 358						embryonic forelimb morphogenesis|neural tube development|regulation of transcription, DNA-dependent|stem cell maintenance|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			central_nervous_system(1)	1																		---	---	---	---
FBN3	84467	broad.mit.edu	37	19	8188240	8188240	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8188240delA	uc002mjf.2	-							NM_032447	NP_115823			fibrillin 3 precursor							proteinaceous extracellular matrix	calcium ion binding|extracellular matrix structural constituent			ovary(6)|skin(3)|pancreas(1)|central_nervous_system(1)	11																		---	---	---	---
ZNF561	93134	broad.mit.edu	37	19	9727575	9727575	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9727575delT	uc002mlu.2	-						ZNF561_uc010dwu.2_Intron|ZNF561_uc010xkr.1_Intron	NM_152289	NP_689502			zinc finger protein 561						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	19	9960432	9960432	+	IGR	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9960432delC								PIN1 (74 upstream) : OLFM2 (3963 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	19	10377498	10377498	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10377498delT								MRPL4 (6764 upstream) : ICAM1 (4019 downstream)																																			---	---	---	---
TMEM205	374882	broad.mit.edu	37	19	11455832	11455832	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11455832delT	uc002mrb.2	-						TMEM205_uc002mra.2_Intron|TMEM205_uc002mqz.2_Intron|TMEM205_uc002mrc.2_Intron|CCDC159_uc010xlr.1_5'Flank|CCDC159_uc010xls.1_5'Flank|CCDC159_uc010xlt.1_5'Flank|CCDC159_uc010xlu.1_5'Flank|CCDC159_uc010xlv.1_5'Flank	NM_001145416	NP_001138888			transmembrane protein 205							integral to membrane					0																		---	---	---	---
EPOR	2057	broad.mit.edu	37	19	11488473	11488473	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11488473delA	uc002mrh.2	-	2										SubName: Full=Erythropoietin receptor; Flags: Fragment;							extracellular region|integral to plasma membrane	erythropoietin receptor activity|identical protein binding			ovary(1)	1					Darbepoetin alfa(DB00012)|Epoetin alfa(DB00016)											OREG0025254	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
ZNF44	51710	broad.mit.edu	37	19	12384334	12384334	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12384334delT	uc010xmj.1	-	5	1085	c.880delA	c.(880-882)ATAfs	p.I294fs	ZNF44_uc002mtl.2_Intron|ZNF44_uc010dyr.1_Intron|ZNF44_uc010xmi.1_RNA|ZNF44_uc002mtn.3_RNA|ZNF44_uc010dys.2_Frame_Shift_Del_p.I246fs	NM_001164276	NP_001157748	P15621	ZNF44_HUMAN	zinc finger protein 44 isoform 1	294	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|microtubule cytoskeleton|nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)	1		Renal(1328;0.157)		GBM - Glioblastoma multiforme(1328;0.0164)|Lung(535;0.179)														---	---	---	---
Unknown	0	broad.mit.edu	37	19	12670276	12670276	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12670276delA								ZNF709 (7920 upstream) : ZNF490 (16644 downstream)																																			---	---	---	---
MAST1	22983	broad.mit.edu	37	19	12969335	12969335	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12969335delC	uc002mvm.2	+						MAST1_uc002mvk.2_Intron	NM_014975	NP_055790			microtubule associated serine/threonine kinase						cytoskeleton organization|intracellular protein kinase cascade	cytoplasm|cytoskeleton|plasma membrane	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			ovary(3)|lung(2)|large_intestine(1)|skin(1)	7																		---	---	---	---
NANOS3	342977	broad.mit.edu	37	19	13986003	13986007	+	5'Flank	DEL	TTTTT	-	-	rs77913995		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:13986003_13986007delTTTTT	uc002mxj.3	+							NM_001098622	NP_001092092			nanos homolog 3						anti-apoptosis|germ cell development|multicellular organismal development|oogenesis|regulation of cell cycle|regulation of translation|spermatogenesis	cytoplasmic mRNA processing body|nucleus|stress granule	RNA binding|zinc ion binding			skin(1)	1			OV - Ovarian serous cystadenocarcinoma(19;2e-21)															---	---	---	---
CD97	976	broad.mit.edu	37	19	14516481	14516481	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:14516481delG	uc002myl.2	+						CD97_uc002mym.2_Intron|CD97_uc002myn.2_Intron	NM_078481	NP_510966			CD97 antigen isoform 1 precursor						cell adhesion|cell-cell signaling|cellular component movement|immune response|inflammatory response|neuropeptide signaling pathway	extracellular space|integral to plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(3)|breast(1)	4																		---	---	---	---
TPM4	7171	broad.mit.edu	37	19	16186781	16186781	+	5'Flank	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16186781delG	uc002ndj.2	+						TPM4_uc002ndi.2_Intron	NM_003290	NP_003281			tropomyosin 4 isoform 2						cellular component movement|muscle filament sliding|response to oxidative stress	cytosol|muscle thin filament tropomyosin|stress fiber	actin binding|calcium ion binding|structural constituent of muscle		TPM4/ALK(12)	soft_tissue(10)|haematopoietic_and_lymphoid_tissue(2)|breast(1)	13								T	ALK	ALCL								---	---	---	---
MYO9B	4650	broad.mit.edu	37	19	17256146	17256146	+	Intron	DEL	A	-	-	rs67918577		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17256146delA	uc010eak.2	+						MYO9B_uc002nfi.2_Intron|MYO9B_uc002nfj.1_Intron	NM_004145	NP_004136			myosin IXB isoform 1						actin filament-based movement	cell cortex|cytosol|filamentous actin|myosin complex|perinuclear region of cytoplasm	actin binding|ADP binding|ATP binding|ATPase activity|calmodulin binding|metal ion binding|microfilament motor activity|Rho GTPase activator activity			breast(1)	1																		---	---	---	---
USHBP1	83878	broad.mit.edu	37	19	17369974	17369974	+	Intron	DEL	A	-	-	rs80351288		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17369974delA	uc002nfs.1	-						USHBP1_uc002nfr.1_5'Flank|USHBP1_uc002nft.1_Intron|USHBP1_uc010xpk.1_Intron|USHBP1_uc010eam.1_Intron	NM_031941	NP_114147			Usher syndrome 1C binding protein 1								PDZ domain binding			ovary(1)	1																		---	---	---	---
PGLS	25796	broad.mit.edu	37	19	17628819	17628822	+	Intron	DEL	AAAA	-	-	rs67260410		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17628819_17628822delAAAA	uc002ngw.2	+							NM_012088	NP_036220			6-phosphogluconolactonase							cytosol	6-phosphogluconolactonase activity				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	19	20166717	20166717	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:20166717delT								ZNF682 (16440 upstream) : ZNF90 (22086 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	19	20442507	20442507	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:20442507delT								LOC284441 (72004 upstream) : ZNF826 (8571 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	19	23317115	23317115	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:23317115delT	uc002nrb.1	+											Homo sapiens cDNA FLJ16640 fis, clone TESTI4028938, moderately similar to Zinc finger protein 85.																														---	---	---	---
C19orf2	8725	broad.mit.edu	37	19	30500424	30500424	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:30500424delA	uc002nsr.2	+						C19orf2_uc002nsq.2_Intron|C19orf2_uc002nss.2_Intron|C19orf2_uc002nst.2_Intron	NM_003796	NP_003787			RPB5-mediating protein isoform a						protein folding|regulation of transcription from RNA polymerase II promoter|response to virus	DNA-directed RNA polymerase II, core complex|prefoldin complex	transcription corepressor activity|unfolded protein binding			ovary(1)|kidney(1)	2	Ovarian(5;0.000902)|Breast(6;0.0203)|Esophageal squamous(110;0.195)	Hepatocellular(1079;0.137)|Renal(1328;0.228)	STAD - Stomach adenocarcinoma(5;5.36e-06)|Lung(7;0.0144)|LUAD - Lung adenocarcinoma(5;0.115)	STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
GPI	2821	broad.mit.edu	37	19	34868277	34868278	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:34868277_34868278insA	uc002nvg.1	+						GPI_uc002nvf.2_Intron|GPI_uc010xrv.1_Intron|GPI_uc010xrw.1_Intron|GPI_uc010edl.1_Intron	NM_000175	NP_000166			glucose phosphate isomerase						angiogenesis|gluconeogenesis|glycolysis|hemostasis|humoral immune response	cytosol|extracellular space|nucleus|plasma membrane	cytokine activity|glucose-6-phosphate isomerase activity|growth factor activity			ovary(1)|kidney(1)	2	Esophageal squamous(110;0.162)																	---	---	---	---
GRAMD1A	57655	broad.mit.edu	37	19	35516902	35516902	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35516902delC	uc010xse.1	+						GRAMD1A_uc002nxk.2_Intron|GRAMD1A_uc002nxl.2_Intron|GRAMD1A_uc010xsf.1_Intron|GRAMD1A_uc002nxm.1_Intron|GRAMD1A_uc002nxn.1_Intron	NM_020895	NP_065946			GRAM domain containing 1A isoform 1							integral to membrane					0	all_lung(56;2.66e-08)|Lung NSC(56;4.13e-08)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0849)															---	---	---	---
CD22	933	broad.mit.edu	37	19	35822750	35822750	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35822750delA	uc010edt.2	+						CD22_uc010xst.1_Intron|CD22_uc010edu.2_Intron|CD22_uc010edv.2_Intron|CD22_uc002nzb.3_5'Flank	NM_001771	NP_001762			CD22 molecule precursor						cell adhesion		protein binding|sugar binding			ovary(5)|lung(3)|breast(1)	9	all_lung(56;9.78e-09)|Lung NSC(56;1.46e-08)|Esophageal squamous(110;0.162)		Epithelial(14;5.83e-19)|OV - Ovarian serous cystadenocarcinoma(14;3.19e-18)|all cancers(14;3.41e-16)|LUSC - Lung squamous cell carcinoma(66;0.0417)		OspA lipoprotein(DB00045)													---	---	---	---
ARHGAP33	115703	broad.mit.edu	37	19	36278096	36278096	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36278096delC	uc002obs.1	+	21	2231	c.2146delC	c.(2146-2148)CCCfs	p.P716fs	ARHGAP33_uc002obt.1_Frame_Shift_Del_p.P741fs|ARHGAP33_uc010eel.2_Frame_Shift_Del_p.P465fs|ARHGAP33_uc002obv.1_Frame_Shift_Del_p.P465fs	NM_052948	NP_443180	O14559	RHG33_HUMAN	sorting nexin 26	764					cell communication|protein transport|signal transduction	intracellular	GTPase activator activity|phosphatidylinositol binding|protein binding			skin(2)|ovary(1)|pancreas(1)	4																		---	---	---	---
ZNF566	84924	broad.mit.edu	37	19	36967260	36967260	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36967260delT	uc002oea.3	-						ZNF566_uc010xte.1_Intron|ZNF566_uc010xtf.1_Intron|ZNF566_uc002oeb.3_Intron|ZNF566_uc002oec.3_Intron|ZNF566_uc010xtg.1_Intron	NM_032838	NP_116227			zinc finger protein 566 isoform 1						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	Esophageal squamous(110;0.162)																	---	---	---	---
ZFP30	22835	broad.mit.edu	37	19	38135818	38135818	+	Intron	DEL	A	-	-	rs34274239		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38135818delA	uc002ogv.1	-						ZFP30_uc002ogw.1_Intron|ZFP30_uc002ogx.1_Intron|ZFP30_uc010xtt.1_Intron	NM_014898	NP_055713			zinc finger protein 30 homolog						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0			COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)															---	---	---	---
RYR1	6261	broad.mit.edu	37	19	38995853	38995854	+	Intron	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38995853_38995854insC	uc002oit.2	+						RYR1_uc002oiu.2_Intron|RYR1_uc002oiv.1_Intron	NM_000540	NP_000531			skeletal muscle ryanodine receptor isoform 1						muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)													---	---	---	---
PLEKHG2	64857	broad.mit.edu	37	19	39907794	39907794	+	Intron	DEL	T	-	-	rs111240744		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39907794delT	uc010xuz.1	+						PLEKHG2_uc010xuy.1_Intron|PLEKHG2_uc002olj.2_Intron|PLEKHG2_uc010xva.1_Intron	NM_022835	NP_073746			common-site lymphoma/leukemia guanine nucleotide						apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	Rho guanyl-nucleotide exchange factor activity			skin(2)|pancreas(1)|breast(1)	4	all_cancers(60;3.08e-07)|all_lung(34;2.66e-08)|Lung NSC(34;3e-08)|all_epithelial(25;6.57e-07)|Ovarian(47;0.0569)		Epithelial(26;2.92e-26)|all cancers(26;2.01e-23)|Lung(45;0.000499)|LUSC - Lung squamous cell carcinoma(53;0.000657)															---	---	---	---
CLC	1178	broad.mit.edu	37	19	40226843	40226844	+	Intron	DEL	AG	-	-	rs367156	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40226843_40226844delAG	uc002omh.2	-							NM_001828	NP_001819			Charcot-Leyden crystal protein						lipid catabolic process|multicellular organismal development		carboxylesterase activity|lysophospholipase activity|sugar binding				0	all_cancers(60;2.99e-06)|all_lung(34;4.7e-08)|Lung NSC(34;5.46e-08)|Ovarian(47;0.06)	Renal(1328;0.000147)|Hepatocellular(1079;0.0202)|Myeloproliferative disorder(2;0.0255)	Epithelial(26;6.43e-25)|OV - Ovarian serous cystadenocarcinoma(5;1.07e-24)|all cancers(26;8.38e-23)	GBM - Glioblastoma multiforme(1328;4.97e-06)|STAD - Stomach adenocarcinoma(1328;0.00655)														---	---	---	---
LTBP4	8425	broad.mit.edu	37	19	41132911	41132911	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41132911delC	uc002ooh.1	+	32	4218	c.4218delC	c.(4216-4218)CGCfs	p.R1406fs	LTBP4_uc002oog.1_Frame_Shift_Del_p.R1369fs|LTBP4_uc002ooi.1_Frame_Shift_Del_p.R1339fs|LTBP4_uc002ooj.1_Frame_Shift_Del_p.R279fs|LTBP4_uc002ook.1_Frame_Shift_Del_p.R540fs|LTBP4_uc002ool.1_Frame_Shift_Del_p.R418fs|LTBP4_uc010xvp.1_Frame_Shift_Del_p.R166fs	NM_001042544	NP_001036009	Q8N2S1	LTBP4_HUMAN	latent transforming growth factor beta binding	1406					growth hormone secretion|multicellular organismal development|protein folding|regulation of cell differentiation|regulation of cell growth|regulation of proteolysis|regulation of transforming growth factor beta receptor signaling pathway	extracellular space|proteinaceous extracellular matrix	calcium ion binding|glycosaminoglycan binding|integrin binding|transforming growth factor beta binding|transforming growth factor beta receptor activity			central_nervous_system(1)	1			Lung(22;0.000158)|LUSC - Lung squamous cell carcinoma(20;0.000384)															---	---	---	---
Unknown	0	broad.mit.edu	37	19	41327441	41327442	+	IGR	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41327441_41327442insA								EGLN2 (13105 upstream) : CYP2A6 (22002 downstream)																																			---	---	---	---
TMEM91	641649	broad.mit.edu	37	19	41889102	41889103	+	Intron	DEL	GC	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41889102_41889103delGC	uc002oqk.3	+						CYP2F1_uc010xvw.1_Intron|TMEM91_uc002oqi.2_3'UTR|TMEM91_uc010ehq.2_Intron|TMEM91_uc002oql.2_3'UTR|TMEM91_uc010ehr.2_Intron|TMEM91_uc010ehs.2_Intron|TMEM91_uc010eht.2_Intron|BCKDHA_uc002oqm.3_Intron|TMEM91_uc002oqn.2_Intron	NM_001098821	NP_001092291			transmembrane protein 91 isoform a						response to biotic stimulus	integral to membrane					0																		---	---	---	---
CIC	23152	broad.mit.edu	37	19	42796883	42796883	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42796883delC	uc002otf.1	+	14	3381	c.3341delC	c.(3340-3342)GCCfs	p.A1114fs		NM_015125	NP_055940	Q96RK0	CIC_HUMAN	capicua homolog	1114	Pro-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding			ovary(4)|breast(4)|lung(1)|central_nervous_system(1)|skin(1)	11		Prostate(69;0.00682)						T	DUX4	soft tissue sarcoma								---	---	---	---
CXCL17	284340	broad.mit.edu	37	19	42946759	42946760	+	Intron	INS	-	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42946759_42946760insT	uc002otu.2	-						uc010eif.1_Intron|uc002ott.1_Intron|uc010eig.1_Intron|uc010eih.1_Intron	NM_198477	NP_940879			chemokine (C-X-C motif) ligand 17 precursor						angiogenesis|cell differentiation|chemotaxis	extracellular region					0		Prostate(69;0.00899)																---	---	---	---
CKM	1158	broad.mit.edu	37	19	45822685	45822685	+	Intron	DEL	C	-	-	rs68016783		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45822685delC	uc002pbd.2	-							NM_001824	NP_001815			muscle creatine kinase						creatine metabolic process	cytosol	ATP binding|creatine kinase activity			skin(1)	1		Ovarian(192;0.0336)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;2.29e-44)|Epithelial(262;1.05e-38)|GBM - Glioblastoma multiforme(486;3.56e-07)	Creatine(DB00148)													---	---	---	---
EML2	24139	broad.mit.edu	37	19	46125009	46125012	+	Intron	DEL	TTTT	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46125009_46125012delTTTT	uc002pcn.2	-						EML2_uc002pco.2_Intron|EML2_uc002pcp.2_Intron|EML2_uc010xxl.1_Intron|EML2_uc010xxm.1_Intron|EML2_uc010xxn.1_Intron|EML2_uc010xxo.1_Intron|EML2_uc010ekj.2_Intron	NM_012155	NP_036287			echinoderm microtubule associated protein like						sensory perception of sound|visual perception	cytoplasm|intracellular membrane-bounded organelle|microtubule|microtubule associated complex	catalytic activity|protein binding			large_intestine(1)|ovary(1)	2		Ovarian(192;0.179)|all_neural(266;0.224)		OV - Ovarian serous cystadenocarcinoma(262;0.00553)|GBM - Glioblastoma multiforme(486;0.131)|Epithelial(262;0.197)														---	---	---	---
GIPR	2696	broad.mit.edu	37	19	46177864	46177864	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46177864delA	uc002pcu.1	+						GIPR_uc002pct.1_Intron|GIPR_uc010xxp.1_Intron|GIPR_uc010xxq.1_Intron|MIR642_hsa-mir-642|MI0003657_5'Flank	NM_000164	NP_000155			gastric inhibitory polypeptide receptor						generation of precursor metabolites and energy|response to nutrient	integral to membrane|plasma membrane				skin(1)	1		Ovarian(192;0.051)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0056)|GBM - Glioblastoma multiforme(486;0.0832)|Epithelial(262;0.199)														---	---	---	---
SNRPD2	6633	broad.mit.edu	37	19	46190721	46190721	+	3'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46190721delA	uc002pcw.2	-	3					SNRPD2_uc002pcv.2_3'UTR	NM_004597	NP_004588			small nuclear ribonucleoprotein D2 isoform 1						ncRNA metabolic process|spliceosomal snRNP assembly|spliceosome assembly	catalytic step 2 spliceosome|cytosol|nucleoplasm|small nuclear ribonucleoprotein complex|U12-type spliceosomal complex	protein binding				0		Ovarian(192;0.051)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.00546)|GBM - Glioblastoma multiforme(486;0.0807)|Epithelial(262;0.194)														---	---	---	---
KLK7	5650	broad.mit.edu	37	19	51483027	51483027	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:51483027delG	uc002puo.2	-						KLK7_uc002pup.2_Intron|KLK7_uc010yco.1_Intron|KLK7_uc010eok.2_Intron	NM_139277	NP_644806			stratum corneum chymotryptic enzyme						epidermis development|proteolysis	extracellular region	serine-type endopeptidase activity				0		all_neural(266;0.026)		OV - Ovarian serous cystadenocarcinoma(262;0.00382)|GBM - Glioblastoma multiforme(134;0.00895)														---	---	---	---
ZNF534	147658	broad.mit.edu	37	19	52955324	52955324	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52955324delT	uc002pzj.1	+	5					ZNF534_uc010epo.1_3'UTR|ZNF578_uc002pzm.2_5'Flank|ZNF578_uc002pzn.2_5'Flank|ZNF578_uc002pzp.3_5'Flank|ZNF578_uc002pzo.1_5'Flank|ZNF578_uc010epp.1_5'Flank					SubName: Full=Putative uncharacterized protein;						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
ZNF808	388558	broad.mit.edu	37	19	53067677	53067677	+	RNA	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53067677delA	uc002pzq.2	+	4		c.4189delA								Homo sapiens zinc finger protein 808, mRNA (cDNA clone IMAGE:3542548), complete cds.						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				OV - Ovarian serous cystadenocarcinoma(262;0.00501)|GBM - Glioblastoma multiforme(134;0.0213)														---	---	---	---
ZNF320	162967	broad.mit.edu	37	19	53368577	53368578	+	Intron	INS	-	AT	AT			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53368577_53368578insAT	uc010eqh.1	-						ZNF320_uc010eqi.1_Intron					Homo sapiens full length insert cDNA clone ZD42C02.						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.0534)														---	---	---	---
ZNF321	399669	broad.mit.edu	37	19	53451562	53451562	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53451562delT	uc010eqj.2	-						ZNF321_uc002qak.1_Intron	NM_203307	NP_976052			zinc finger protein 321												0				GBM - Glioblastoma multiforme(134;0.0305)														---	---	---	---
Unknown	0	broad.mit.edu	37	19	53833024	53833025	+	IGR	DEL	TT	-	-	rs112929393		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53833024_53833025delTT								BIRC8 (38149 upstream) : ZNF845 (3977 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	19	55212296	55212297	+	IGR	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55212296_55212297delAA								LILRB4 (32452 upstream) : LILRP2 (7304 downstream)																																			---	---	---	---
C20orf194	25943	broad.mit.edu	37	20	3298752	3298752	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3298752delT	uc002wii.2	-						C20orf194_uc002wij.3_Intron|C20orf194_uc002wik.2_Intron	NM_001009984	NP_001009984			hypothetical protein LOC25943												0																		---	---	---	---
ATRN	8455	broad.mit.edu	37	20	3577009	3577009	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3577009delT	uc002wim.2	+						ATRN_uc002wil.2_Intron	NM_139321	NP_647537			attractin isoform 1						inflammatory response	extracellular space|integral to plasma membrane	receptor activity|sugar binding			ovary(1)|breast(1)	2																		---	---	---	---
RNF24	11237	broad.mit.edu	37	20	3915838	3915839	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3915838_3915839insA	uc002wkh.2	-						RNF24_uc002wki.2_Intron|RNF24_uc002wkj.2_Intron	NM_007219	NP_009150			ring finger protein 24 isoform 1							Golgi membrane|integral to membrane	zinc ion binding				0																		---	---	---	---
PLCB1	23236	broad.mit.edu	37	20	8352015	8352015	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:8352015delT	uc002wnb.2	+						PLCB1_uc010zrb.1_Intron|PLCB1_uc010gbv.1_Intron|PLCB1_uc002wmz.1_Intron|PLCB1_uc002wna.2_Intron	NM_015192	NP_056007			phosphoinositide-specific phospholipase C beta 1						activation of meiosis involved in egg activation|CD24 biosynthetic process|cerebral cortex development|G1 phase|G2/M transition of mitotic cell cycle|glutamate signaling pathway|insulin-like growth factor receptor signaling pathway|interleukin-1-mediated signaling pathway|interleukin-12-mediated signaling pathway|interleukin-15-mediated signaling pathway|intracellular signal transduction|lipid catabolic process|memory|muscarinic acetylcholine receptor signaling pathway|negative regulation of monocyte extravasation|negative regulation of transcription, DNA-dependent|phosphatidylinositol metabolic process|positive regulation of acrosome reaction|positive regulation of developmental growth|positive regulation of embryonic development|positive regulation of interleukin-12 production|positive regulation of JNK cascade|positive regulation of myoblast differentiation|positive regulation of transcription, DNA-dependent|regulation of fertilization|regulation of G-protein coupled receptor protein signaling pathway|synaptic transmission	cytosol|nuclear chromatin|nuclear speck	calcium ion binding|calmodulin binding|enzyme binding|GTPase activator activity|phosphatidylinositol phospholipase C activity|phosphatidylinositol-4,5-bisphosphate binding|protein homodimerization activity|signal transducer activity			ovary(4)|breast(3)|upper_aerodigestive_tract(2)|skin(2)|lung(1)	12																		---	---	---	---
PLCB1	23236	broad.mit.edu	37	20	8782772	8782772	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:8782772delC	uc002wnb.2	+						PLCB1_uc002wna.2_Frame_Shift_Del_p.P1165fs	NM_015192	NP_056007			phosphoinositide-specific phospholipase C beta 1						activation of meiosis involved in egg activation|CD24 biosynthetic process|cerebral cortex development|G1 phase|G2/M transition of mitotic cell cycle|glutamate signaling pathway|insulin-like growth factor receptor signaling pathway|interleukin-1-mediated signaling pathway|interleukin-12-mediated signaling pathway|interleukin-15-mediated signaling pathway|intracellular signal transduction|lipid catabolic process|memory|muscarinic acetylcholine receptor signaling pathway|negative regulation of monocyte extravasation|negative regulation of transcription, DNA-dependent|phosphatidylinositol metabolic process|positive regulation of acrosome reaction|positive regulation of developmental growth|positive regulation of embryonic development|positive regulation of interleukin-12 production|positive regulation of JNK cascade|positive regulation of myoblast differentiation|positive regulation of transcription, DNA-dependent|regulation of fertilization|regulation of G-protein coupled receptor protein signaling pathway|synaptic transmission	cytosol|nuclear chromatin|nuclear speck	calcium ion binding|calmodulin binding|enzyme binding|GTPase activator activity|phosphatidylinositol phospholipase C activity|phosphatidylinositol-4,5-bisphosphate binding|protein homodimerization activity|signal transducer activity			ovary(4)|breast(3)|upper_aerodigestive_tract(2)|skin(2)|lung(1)	12																		---	---	---	---
SEL1L2	80343	broad.mit.edu	37	20	13858356	13858356	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:13858356delA	uc010gcf.2	-						SEL1L2_uc002woq.3_Intron|SEL1L2_uc010zrl.1_Intron|SEL1L2_uc002wor.2_Intron	NM_025229	NP_079505			sel-1 suppressor of lin-12-like 2 precursor							integral to membrane	binding			ovary(2)	2																		---	---	---	---
PCSK2	5126	broad.mit.edu	37	20	17350044	17350045	+	Intron	DEL	CA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:17350044_17350045delCA	uc002wpm.2	+						PCSK2_uc002wpl.2_Intron|PCSK2_uc010zrm.1_Intron	NM_002594	NP_002585			proprotein convertase subtilisin/kexin type 2						enkephalin processing|insulin processing|islet amyloid polypeptide processing	extracellular space|membrane|soluble fraction|transport vesicle	serine-type endopeptidase activity			ovary(3)|central_nervous_system(2)|large_intestine(1)|pancreas(1)	7					Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)													---	---	---	---
C20orf12	55184	broad.mit.edu	37	20	18407990	18407990	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:18407990delT	uc010zsa.1	-						C20orf12_uc002wqp.3_Intron|C20orf12_uc002wqr.3_Intron|C20orf12_uc002wqs.3_Intron|C20orf12_uc002wqq.3_Intron|C20orf12_uc002wqu.1_Intron|C20orf12_uc010gct.1_Intron	NM_001099407	NP_001092877			hypothetical protein LOC55184							intracellular	zinc ion binding			ovary(1)	1		Myeloproliferative disorder(85;0.0122)																---	---	---	---
CRNKL1	51340	broad.mit.edu	37	20	20031422	20031422	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:20031422delA	uc002wrs.2	-						C20orf26_uc010gcw.1_5'Flank|C20orf26_uc010zse.1_5'Flank|C20orf26_uc002wru.2_5'Flank|CRNKL1_uc002wrt.1_Intron	NM_016652	NP_057736			crooked neck-like 1 protein						spliceosome assembly	catalytic step 2 spliceosome|cytoplasm|nuclear speck	RNA binding			ovary(2)|large_intestine(1)	3																		---	---	---	---
XRN2	22803	broad.mit.edu	37	20	21338218	21338218	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:21338218delT	uc002wsf.1	+						XRN2_uc002wsg.1_Intron|XRN2_uc010zsk.1_Intron	NM_012255	NP_036387			5'-3' exoribonuclease 2						cell growth|DNA catabolic process, exonucleolytic|mRNA processing|regulation of transcription, DNA-dependent|RNA catabolic process|spermatogenesis|transcription termination, DNA-dependent	nucleolus	5'-3' exoribonuclease activity|nucleic acid binding|protein binding|zinc ion binding			skin(1)	1																		---	---	---	---
FRG1B	284802	broad.mit.edu	37	20	29625700	29625701	+	Intron	DEL	GG	-	-	rs111688299	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:29625700_29625701delGG	uc010ztl.1	+						FRG1B_uc002wvm.1_Intron|FRG1B_uc010ztj.1_Intron|FRG1B_uc010gdr.1_Intron|FRG1B_uc010ztk.1_Intron					Homo sapiens cDNA FLJ32537 fis, clone SMINT2000400, highly similar to Homo sapiens FRG1 mRNA.												0																		---	---	---	---
ACSS2	55902	broad.mit.edu	37	20	33470426	33470426	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33470426delA	uc002xbd.2	+						ACSS2_uc002xbc.2_Intron|ACSS2_uc010zum.1_Intron|ACSS2_uc010gey.2_Intron|ACSS2_uc002xbe.2_Intron|ACSS2_uc002xbf.2_Intron	NM_018677	NP_061147			acyl-CoA synthetase short-chain family member 2						ethanol oxidation|lipid biosynthetic process|xenobiotic metabolic process	cytosol|nucleus	acetate-CoA ligase activity|ATP binding|protein binding				0					Adenosine monophosphate(DB00131)|Adenosine triphosphate(DB00171)													---	---	---	---
GDF5	8200	broad.mit.edu	37	20	33961832	33961832	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33961832delT	uc010gfc.1	-						UQCC_uc010zuy.1_Intron|UQCC_uc002xcd.2_Intron|UQCC_uc010zuz.1_Intron|UQCC_uc010zva.1_Intron|UQCC_uc002xce.2_Intron|UQCC_uc002xcg.2_Intron|UQCC_uc010gfb.2_Intron|UQCC_uc010zvb.1_Intron|UQCC_uc002xcf.2_Intron|UQCC_uc002xci.1_Intron|UQCC_uc010gfd.1_Intron	NM_000557	NP_000548			growth differentiation factor 5 preproprotein						cartilage development|cell-cell signaling|growth|transforming growth factor beta receptor signaling pathway	extracellular space	cytokine activity|growth factor activity				0	Lung NSC(9;0.00642)|all_lung(11;0.0094)		BRCA - Breast invasive adenocarcinoma(18;0.00663)															---	---	---	---
DSN1	79980	broad.mit.edu	37	20	35396636	35396636	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35396636delA	uc010gfr.2	-						DSN1_uc002xfz.2_Intron|DSN1_uc002xfy.3_Intron|DSN1_uc002xga.2_Intron|DSN1_uc010zvs.1_Intron|DSN1_uc002xgc.2_Intron|DSN1_uc002xgb.2_Intron	NM_001145316	NP_001138788			DSN1, MIND kinetochore complex component,						cell division|chromosome segregation|mitotic prometaphase	cytosol|MIS12/MIND type complex|nucleus	protein binding			ovary(2)	2		Myeloproliferative disorder(115;0.00874)																---	---	---	---
RBL1	5933	broad.mit.edu	37	20	35646555	35646556	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35646555_35646556insA	uc002xgi.2	-						RBL1_uc010zvt.1_Intron|RBL1_uc002xgj.1_Intron	NM_002895	NP_002886			retinoblastoma-like protein 1 isoform a						cell cycle|chromatin modification|interspecies interaction between organisms|regulation of cell cycle|regulation of lipid kinase activity|transcription, DNA-dependent		transcription factor binding			lung(5)|skin(3)|ovary(2)	10		Myeloproliferative disorder(115;0.00878)																---	---	---	---
RALGAPB	57148	broad.mit.edu	37	20	37169993	37169993	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:37169993delT	uc002xiw.2	+						RALGAPB_uc002xix.2_Intron|RALGAPB_uc002xiy.1_Intron|RALGAPB_uc002xiz.2_Intron|RALGAPB_uc002xja.1_Intron	NM_020336	NP_065069			Ral GTPase activating protein, beta subunit						activation of Ral GTPase activity	intracellular	protein heterodimerization activity|Ral GTPase activator activity			pancreas(1)|skin(1)	2																		---	---	---	---
CHD6	84181	broad.mit.edu	37	20	40076798	40076798	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:40076798delA	uc002xka.1	-						CHD6_uc002xkb.1_5'Flank	NM_032221	NP_115597			chromodomain helicase DNA binding protein 6						chromatin remodeling|nervous system development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ATP binding|ATP-dependent helicase activity|chromatin binding|DNA binding			ovary(6)|skin(5)|lung(2)|central_nervous_system(1)	14		Myeloproliferative disorder(115;0.00425)																---	---	---	---
C20orf111	51526	broad.mit.edu	37	20	42831436	42831436	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:42831436delA	uc002xlk.2	-							NM_016470	NP_057554			oxidative stress responsive 1												0		Myeloproliferative disorder(115;0.028)	COAD - Colon adenocarcinoma(18;0.00189)															---	---	---	---
SYCP2	10388	broad.mit.edu	37	20	58456449	58456449	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:58456449delA	uc002yaz.2	-							NM_014258	NP_055073			synaptonemal complex protein 2						cell division|meiotic prophase I|synaptonemal complex assembly		DNA binding			ovary(3)|lung(2)	5	all_lung(29;0.00344)		BRCA - Breast invasive adenocarcinoma(7;1.19e-09)															---	---	---	---
Unknown	0	broad.mit.edu	37	21	9857293	9857293	+	IGR	DEL	T	-	-	rs71251986		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:9857293delT								None (None upstream) : None (None downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	21	15436854	15436854	+	Intron	DEL	G	-	-	rs62209920	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:15436854delG	uc002yjk.2	+						uc002yjl.2_Intron					Homo sapiens, clone IMAGE:4102980, mRNA.																														---	---	---	---
RBM11	54033	broad.mit.edu	37	21	15592145	15592145	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:15592145delA	uc002yjo.3	+						RBM11_uc002yjn.3_Intron|RBM11_uc002yjp.3_Intron	NM_144770	NP_658983			RNA binding motif protein 11								nucleotide binding|RNA binding				0				Epithelial(23;0.000314)|COAD - Colon adenocarcinoma(22;0.00242)|Colorectal(24;0.0129)|Lung(58;0.141)														---	---	---	---
Unknown	0	broad.mit.edu	37	21	21797194	21797194	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:21797194delT								None (None upstream) : C21orf131 (317720 downstream)																																			---	---	---	---
NCAM2	4685	broad.mit.edu	37	21	22664219	22664220	+	Intron	DEL	AA	-	-	rs71322042		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:22664219_22664220delAA	uc002yld.1	+						NCAM2_uc011acb.1_Intron|NCAM2_uc011acc.1_Intron	NM_004540	NP_004531			neural cell adhesion molecule 2 precursor						neuron cell-cell adhesion	integral to membrane|plasma membrane				ovary(4)	4		Lung NSC(9;0.195)		all cancers(11;0.00102)|OV - Ovarian serous cystadenocarcinoma(11;0.00121)|Epithelial(23;0.00147)|Colorectal(24;0.174)														---	---	---	---
RNF160	26046	broad.mit.edu	37	21	30330970	30330970	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:30330970delA	uc002ymr.2	-							NM_015565	NP_056380			zinc finger protein 294								ligase activity|zinc ion binding				0																		---	---	---	---
GRIK1	2897	broad.mit.edu	37	21	31234044	31234044	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:31234044delT	uc002yno.1	-						GRIK1_uc002ynn.2_Intron|GRIK1_uc011acs.1_Intron|GRIK1_uc011act.1_Intron|GRIK1_uc010glq.1_Intron|GRIK1_uc002ynr.2_Intron	NM_000830	NP_000821			glutamate receptor, ionotropic, kainate 1						central nervous system development|synaptic transmission	cell junction|postsynaptic membrane	kainate selective glutamate receptor activity			large_intestine(1)|ovary(1)|skin(1)	3					L-Glutamic Acid(DB00142)|Topiramate(DB00273)													---	---	---	---
SYNJ1	8867	broad.mit.edu	37	21	34017084	34017084	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:34017084delA	uc002yqh.2	-						SYNJ1_uc011ads.1_Intron|SYNJ1_uc002yqf.2_Intron|SYNJ1_uc002yqg.2_Intron|SYNJ1_uc002yqi.2_Intron|SYNJ1_uc002yqe.3_5'Flank	NM_003895	NP_003886			synaptojanin 1 isoform a								inositol-polyphosphate 5-phosphatase activity|nucleotide binding|phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity|RNA binding			ovary(4)|skin(1)	5																		---	---	---	---
TMEM50B	757	broad.mit.edu	37	21	34839163	34839163	+	Intron	DEL	A	-	-	rs115589759	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:34839163delA	uc002yrt.1	-						TMEM50B_uc002yrs.1_Intron|TMEM50B_uc010gmb.1_Intron	NM_006134	NP_006125			transmembrane protein 50B							endoplasmic reticulum|integral to membrane|plasma membrane				ovary(1)|skin(1)	2																		---	---	---	---
DONSON	29980	broad.mit.edu	37	21	34956724	34956725	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:34956724_34956725delAA	uc002ysk.2	-						DONSON_uc002ysi.1_Intron|DONSON_uc002ysj.2_Intron|DONSON_uc002ysl.2_Intron|DONSON_uc010gme.2_Intron|DONSON_uc002ysm.2_Intron	NM_017613	NP_060083			downstream neighbor of SON						multicellular organismal development	nucleus				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
MORC3	23515	broad.mit.edu	37	21	37710947	37710947	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:37710947delA	uc002yvi.2	+							NM_015358	NP_056173			MORC family CW-type zinc finger 3						cell aging|maintenance of protein location in nucleus|negative regulation of fibroblast proliferation|peptidyl-serine phosphorylation|protein stabilization	aggresome|intermediate filament cytoskeleton|PML body	ATP binding|zinc ion binding			ovary(2)	2																		---	---	---	---
RIPK4	54101	broad.mit.edu	37	21	43166198	43166198	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:43166198delC	uc002yzn.1	-							NM_020639	NP_065690			ankyrin repeat domain 3							cytoplasm|nucleus	ATP binding|protein serine/threonine kinase activity			ovary(2)|central_nervous_system(2)|large_intestine(1)|lung(1)|skin(1)	7																		---	---	---	---
RRP1	8568	broad.mit.edu	37	21	45218007	45218009	+	Intron	DEL	CTC	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45218007_45218009delCTC	uc002zds.2	+						RRP1_uc011aez.1_Intron|RRP1_uc010gpk.1_Intron|RRP1_uc010gpl.1_Intron|RRP1_uc010gpm.1_Intron	NM_003683	NP_003674			ribosomal RNA processing 1 homolog						rRNA processing	nucleolus|preribosome, small subunit precursor					0				COAD - Colon adenocarcinoma(84;0.00753)|Colorectal(79;0.0157)|STAD - Stomach adenocarcinoma(101;0.171)														---	---	---	---
TRAPPC10	7109	broad.mit.edu	37	21	45499777	45499778	+	Intron	DEL	AA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45499777_45499778delAA	uc002zea.2	+						TRAPPC10_uc010gpo.2_Intron|TRAPPC10_uc011afa.1_5'Flank	NM_003274	NP_003265			trafficking protein particle complex 10						vesicle-mediated transport	Golgi apparatus|integral to membrane	binding|sodium ion transmembrane transporter activity			ovary(1)|skin(1)	2																		---	---	---	---
MICAL3	57553	broad.mit.edu	37	22	18502484	18502484	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:18502484delA	uc002zng.3	-						MICAL3_uc002znh.2_Intron|MICAL3_uc010grf.2_Intron|MICAL3_uc011agm.1_Intron	NM_015241	NP_056056			microtubule associated monoxygenase, calponin							cytoplasm|cytoskeleton	monooxygenase activity|zinc ion binding				0		all_epithelial(15;0.198)		Lung(27;0.0427)														---	---	---	---
PPIL2	23759	broad.mit.edu	37	22	22026515	22026516	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:22026515_22026516insA	uc010gtj.1	+						PPIL2_uc002zvh.3_Intron|PPIL2_uc002zvi.3_Intron|PPIL2_uc002zvg.3_Intron|PPIL2_uc011aij.1_Intron	NM_148175	NP_680480			peptidylprolyl isomerase-like 2 isoform a						blood coagulation|leukocyte migration|protein folding|protein polyubiquitination	Golgi lumen|nucleus|ubiquitin ligase complex	peptidyl-prolyl cis-trans isomerase activity|ubiquitin-ubiquitin ligase activity			ovary(2)	2	Colorectal(54;0.105)																	---	---	---	---
ZDHHC8P1	150244	broad.mit.edu	37	22	23742494	23742495	+	RNA	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:23742494_23742495insG	uc002zxa.3	-	3		c.641_642insC			ZDHHC8P1_uc002zxb.3_RNA|ZDHHC8P1_uc002zwz.3_RNA	NR_003950				Homo sapiens cDNA FLJ31568 fis, clone NT2RI2001595.												0																		---	---	---	---
RGL4	266747	broad.mit.edu	37	22	24034818	24034818	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:24034818delA	uc002zxn.2	+						LOC91316_uc002zxh.3_RNA|LOC91316_uc002zxi.3_RNA|LOC91316_uc002zxk.3_Intron|LOC91316_uc010gua.2_Intron|LOC91316_uc002zxl.3_Intron|LOC91316_uc011aiz.1_Intron|LOC91316_uc002zxm.3_Intron|RGL4_uc002zxo.2_Intron|RGL4_uc002zxp.1_Intron|RGL4_uc002zxq.2_Intron	NM_153615	NP_705843			ral guanine nucleotide dissociation						small GTPase mediated signal transduction	cytoplasmic membrane-bounded vesicle	guanyl-nucleotide exchange factor activity			ovary(1)	1																		---	---	---	---
ADRBK2	157	broad.mit.edu	37	22	26043916	26043916	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26043916delA	uc003abx.3	+						ADRBK2_uc010gux.2_Intron|ADRBK2_uc003abw.2_Intron|ADRBK2_uc003aby.3_Intron	NM_005160	NP_005151			beta-adrenergic receptor kinase 2								ATP binding|beta-adrenergic receptor kinase activity|signal transducer activity			lung(3)|ovary(2)|stomach(1)|central_nervous_system(1)	7					Adenosine triphosphate(DB00171)													---	---	---	---
SEZ6L	23544	broad.mit.edu	37	22	26769605	26769605	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26769605delA	uc003acb.2	+						SEZ6L_uc003acc.2_Intron|SEZ6L_uc011akc.1_Intron|SEZ6L_uc003acd.2_Intron|SEZ6L_uc011akd.1_Intron|SEZ6L_uc003ace.2_Intron|SEZ6L_uc003acf.1_Intron|SEZ6L_uc010gvc.1_Intron|SEZ6L_uc011ake.1_Intron	NM_021115	NP_066938			seizure related 6 homolog (mouse)-like							endoplasmic reticulum membrane|integral to membrane				ovary(4)|central_nervous_system(1)|pancreas(1)	6																		---	---	---	---
EWSR1	2130	broad.mit.edu	37	22	29687543	29687543	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:29687543delC	uc003aet.2	+						EWSR1_uc003aev.2_Intron|EWSR1_uc003aew.2_Intron|EWSR1_uc003aex.2_Intron|EWSR1_uc003aey.2_Intron|EWSR1_uc003aez.2_5'UTR	NM_005243	NP_005234			Ewing sarcoma breakpoint region 1 isoform 2						regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus|plasma membrane	calmodulin binding|nucleotide binding|RNA binding|zinc ion binding		EWSR1/FLI1(2266)|EWSR1/ATF1(323)|EWSR1/WT1(231)|EWSR1/ERG(162)|EWSR1/NR4A3(140)|EWSR1/DDIT3(43)|EWSR1/CREB1(42)|EWSR1/FEV(10)|EWSR1/POU5F1(10)|EWSR1/ETV1(7)|EWSR1/ETV4(6)|EWSR1/ZNF384(4)|EWSR1/PBX1(3)|EWSR1/SP3(3)|EWSR1/PATZ1(2)	bone(2526)|soft_tissue(702)|skin(8)|autonomic_ganglia(4)|haematopoietic_and_lymphoid_tissue(4)|salivary_gland(2)|central_nervous_system(2)|NS(2)|pancreas(2)|lung(1)|ovary(1)	3254								T	FLI1|ERG|ZNF278|NR4A3|FEV|ATF1|ETV1|ETV4|WT1|ZNF384|CREB1|POU5F1| PBX1	Ewing sarcoma| desmoplastic small round cell tumor |ALL|clear cell sarcoma|sarcoma|myoepithelioma								---	---	---	---
DEPDC5	9681	broad.mit.edu	37	22	32297867	32297867	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:32297867delT	uc003als.2	+						DEPDC5_uc011als.1_Intron|DEPDC5_uc011alu.1_Intron|DEPDC5_uc011alv.1_Intron|DEPDC5_uc003alt.2_Intron|DEPDC5_uc003alu.2_Intron|DEPDC5_uc003alv.2_Intron|DEPDC5_uc003alw.2_Intron|DEPDC5_uc011alx.1_Intron|DEPDC5_uc010gwk.2_Intron|DEPDC5_uc011aly.1_Intron	NM_014662	NP_055477			DEP domain containing 5 isoform 1						intracellular signal transduction					ovary(4)|central_nervous_system(3)|pancreas(1)	8																		---	---	---	---
Unknown	0	broad.mit.edu	37	22	34492090	34492090	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:34492090delT								LARGE (173506 upstream) : ISX (970039 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	22	38075860	38075861	+	IGR	INS	-	TG	TG			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38075860_38075861insTG								LGALS1 (53 upstream) : TRIOBP (6483 downstream)																																			---	---	---	---
CACNA1I	8911	broad.mit.edu	37	22	40015496	40015496	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:40015496delC	uc003ayc.2	+						CACNA1I_uc003ayd.2_Intron|CACNA1I_uc003aye.2_Intron|CACNA1I_uc003ayf.2_Intron	NM_021096	NP_066919			calcium channel, voltage-dependent, T type,						axon guidance|signal transduction	voltage-gated calcium channel complex	low voltage-gated calcium channel activity|protein binding			breast(1)|central_nervous_system(1)	2	Melanoma(58;0.0749)				Flunarizine(DB04841)|Paramethadione(DB00617)|Verapamil(DB00661)													---	---	---	---
XPNPEP3	63929	broad.mit.edu	37	22	41264850	41264850	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41264850delA	uc003azh.2	+						XPNPEP3_uc011aox.1_Intron|XPNPEP3_uc003azi.2_Intron|XPNPEP3_uc011aoy.1_Intron|XPNPEP3_uc010gyh.1_Intron	NM_022098	NP_071381			X-prolyl aminopeptidase (aminopeptidase P) 3,						cellular process	mitochondrion	aminopeptidase activity|manganese ion binding|metallopeptidase activity				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	22	41470048	41470048	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41470048delA								RBX1 (101382 upstream) : MIR1281 (18469 downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	22	41471322	41471322	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41471322delT								RBX1 (102656 upstream) : MIR1281 (17195 downstream)																																			---	---	---	---
TCF20	6942	broad.mit.edu	37	22	42611474	42611474	+	5'Flank	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:42611474delT	uc003bcj.1	-						TCF20_uc003bck.1_5'Flank|TCF20_uc003bnt.2_5'Flank	NM_005650	NP_005641			transcription factor 20 isoform 1						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|transcription coactivator activity|zinc ion binding			ovary(4)|skin(1)	5																		---	---	---	---
SCUBE1	80274	broad.mit.edu	37	22	43687013	43687014	+	Intron	INS	-	G	G	rs74600989	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43687013_43687014insG	uc003bdt.1	-						SCUBE1_uc003bdu.1_Intron	NM_173050	NP_766638			signal peptide, CUB domain, EGF-like 1						adult heart development|blood coagulation|endothelial cell differentiation|inflammatory response|post-embryonic development|protein homooligomerization	external side of plasma membrane|extracellular space|extrinsic to plasma membrane	calcium ion binding|identical protein binding|protein heterodimerization activity			central_nervous_system(2)|ovary(1)|lung(1)|skin(1)	5		all_neural(38;0.0414)|Ovarian(80;0.07)																---	---	---	---
TRABD	80305	broad.mit.edu	37	22	50635538	50635538	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50635538delG	uc003bjq.1	+						TRABD_uc003bjr.1_Intron|TRABD_uc003bjs.1_Intron|TRABD_uc003bjt.1_Intron|TRABD_uc003bju.1_Intron|TRABD_uc003bjv.2_Intron|TRABD_uc003bjw.1_Intron	NM_025204	NP_079480			TraB domain containing												0		all_cancers(38;1.07e-07)|all_epithelial(38;9.6e-07)|all_lung(38;0.00141)|Breast(42;0.00387)|Lung NSC(38;0.0199)|Ovarian(80;0.142)|Lung SC(80;0.162)		LUAD - Lung adenocarcinoma(64;0.105)														---	---	---	---
ASMTL	8623	broad.mit.edu	37	X	1547163	1547163	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1547163delA	uc004cpx.1	-						ASMTL_uc011mhe.1_Intron|ASMTL_uc004cpy.1_Intron|ASMTL_uc011mhf.1_Intron	NM_004192	NP_004183			acetylserotonin O-methyltransferase-like						melatonin biosynthetic process	cytoplasm	acetylserotonin O-methyltransferase activity				0		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)																---	---	---	---
MXRA5	25878	broad.mit.edu	37	X	3241263	3241263	+	Frame_Shift_Del	DEL	A	-	-	rs138847281		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:3241263delA	uc004crg.3	-	5	2620	c.2463delT	c.(2461-2463)TTTfs	p.F821fs		NM_015419	NP_056234	Q9NR99	MXRA5_HUMAN	adlican precursor	821						extracellular region				ovary(5)|lung(1)|central_nervous_system(1)|skin(1)	8		all_lung(23;0.00031)|Lung NSC(23;0.000946)																---	---	---	---
FAM9A	171482	broad.mit.edu	37	X	8759221	8759221	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:8759221delA	uc004csg.2	-							NM_174951	NP_777611			family with sequence similarity 9, member A							nucleolus					0		Hepatocellular(5;0.219)																---	---	---	---
TBL1X	6907	broad.mit.edu	37	X	9622195	9622195	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:9622195delA	uc010ndq.2	+						TBL1X_uc004csq.3_Intron|TBL1X_uc010ndr.2_Intron|TBL1X_uc004csr.2_Intron	NM_001139466	NP_001132938			transducin beta-like 1X isoform a						canonical Wnt receptor signaling pathway|cellular lipid metabolic process|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|proteasomal ubiquitin-dependent protein catabolic process|sensory perception of sound|transcription, DNA-dependent	spindle microtubule|transcriptional repressor complex	beta-catenin binding|histone binding|protein C-terminus binding|protein domain specific binding|transcription corepressor activity|transcription factor binding|transcription regulatory region DNA binding			ovary(1)	1		Hepatocellular(5;0.000888)																---	---	---	---
WWC3	55841	broad.mit.edu	37	X	10094410	10094410	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:10094410delT	uc004csx.3	+						WWC3_uc010nds.2_Intron|WWC3_uc010ndt.2_Intron	NM_015691	NP_056506			WWC family member 3											ovary(4)	4																		---	---	---	---
ARHGAP6	395	broad.mit.edu	37	X	11353786	11353786	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:11353786delT	uc004cup.1	-						ARHGAP6_uc004cuo.1_Intron|ARHGAP6_uc004cur.1_Intron|ARHGAP6_uc004cun.1_Intron|ARHGAP6_uc011mif.1_Intron	NM_013427	NP_038286			Rho GTPase activating protein 6 isoform 1						actin filament polymerization|activation of phospholipase C activity|negative regulation of focal adhesion assembly|negative regulation of stress fiber assembly|Rho protein signal transduction	actin filament|cytosol	phospholipase activator activity|phospholipase binding|Rho GTPase activator activity|SH3 domain binding|SH3/SH2 adaptor activity			urinary_tract(1)|lung(1)	2																		---	---	---	---
OFD1	8481	broad.mit.edu	37	X	13776301	13776301	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:13776301delT	uc004cvp.3	+						OFD1_uc004cvr.3_Intron|OFD1_uc011mil.1_Intron|OFD1_uc004cvq.3_Intron|OFD1_uc010nen.2_Intron|OFD1_uc004cvs.3_Intron|OFD1_uc004cvu.3_Intron|OFD1_uc004cvv.3_Intron	NM_003611	NP_003602			oral-facial-digital syndrome 1						cilium movement involved in determination of left/right asymmetry|G2/M transition of mitotic cell cycle	centriole|cilium|cytosol|microtubule basal body|nuclear membrane	alpha-tubulin binding|gamma-tubulin binding				0																		---	---	---	---
MOSPD2	158747	broad.mit.edu	37	X	14913296	14913296	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:14913296delT	uc004cwi.2	+						MOSPD2_uc004cwj.2_Intron	NM_152581	NP_689794			motile sperm domain containing 2							integral to membrane	structural molecule activity			lung(1)	1	Hepatocellular(33;0.183)																	---	---	---	---
BEND2	139105	broad.mit.edu	37	X	18195563	18195564	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:18195563_18195564insA	uc004cyj.3	-						BEND2_uc010nfb.2_Intron	NM_153346	NP_699177			BEN domain containing 2											ovary(3)|kidney(1)|central_nervous_system(1)	5																		---	---	---	---
CDKL5	6792	broad.mit.edu	37	X	18616437	18616437	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:18616437delT	uc004cym.2	+						CDKL5_uc004cyn.2_Intron	NM_003159	NP_003150			cyclin-dependent kinase-like 5						neuron migration|positive regulation of axon extension|positive regulation of dendrite morphogenesis|positive regulation of Rac GTPase activity|protein autophosphorylation	dendrite cytoplasm|dendritic growth cone|nucleus	ATP binding|cyclin-dependent protein kinase activity|Rac GTPase binding			ovary(2)|large_intestine(1)|stomach(1)|central_nervous_system(1)|skin(1)	6	Hepatocellular(33;0.183)																	---	---	---	---
PHKA2	5256	broad.mit.edu	37	X	18954342	18954342	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:18954342delA	uc004cyv.3	-							NM_000292	NP_000283			phosphorylase kinase, alpha 2 (liver)						glucose metabolic process|glycogen catabolic process	cytosol|phosphorylase kinase complex|plasma membrane	calmodulin binding|glucan 1,4-alpha-glucosidase activity|phosphorylase kinase activity			ovary(1)|central_nervous_system(1)	2	Hepatocellular(33;0.183)																	---	---	---	---
PHEX	5251	broad.mit.edu	37	X	22114926	22114926	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:22114926delT	uc004dah.2	+						PHEX_uc011mjr.1_Intron|PHEX_uc011mjs.1_Intron	NM_000444	NP_000435			phosphate-regulating neutral endopeptidase						biomineral tissue development|cell-cell signaling|protein modification process|proteolysis|skeletal system development	integral to plasma membrane	aminopeptidase activity|metalloendopeptidase activity|zinc ion binding			ovary(2)|lung(1)	3																		---	---	---	---
CXorf58	254158	broad.mit.edu	37	X	23934573	23934573	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:23934573delT	uc004daz.1	+						CXorf58_uc011mju.1_Intron	NM_152761	NP_689974			hypothetical protein LOC254158												0																		---	---	---	---
POLA1	5422	broad.mit.edu	37	X	24733418	24733418	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:24733418delT	uc004dbl.2	+						POLA1_uc004dbm.2_Intron|POLA1_uc004dbn.2_Intron	NM_016937	NP_058633			DNA-directed DNA polymerase alpha 1						cell proliferation|DNA replication checkpoint|DNA replication, synthesis of RNA primer|DNA-dependent DNA replication initiation|double-strand break repair via nonhomologous end joining|interspecies interaction between organisms|lagging strand elongation|leading strand elongation|M/G1 transition of mitotic cell cycle|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication	alpha DNA polymerase:primase complex|cytoplasm|nuclear envelope|nuclear matrix|nucleolus|nucleoplasm	chromatin binding|DNA-directed DNA polymerase activity|metal ion binding|nucleoside binding			ovary(2)|skin(1)	3					Clofarabine(DB00631)|Fludarabine(DB01073)													---	---	---	---
IL1RAPL1	11141	broad.mit.edu	37	X	29973069	29973069	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:29973069delA	uc004dby.2	+							NM_014271	NP_055086			interleukin 1 receptor accessory protein-like 1						innate immune response|negative regulation of calcium ion transport via voltage-gated calcium channel activity|negative regulation of exocytosis|regulation of neuron projection development	cytoplasm|integral to membrane|plasma membrane	protein binding|transmembrane receptor activity			ovary(3)|lung(1)|pancreas(1)	5																		---	---	---	---
DMD	1756	broad.mit.edu	37	X	32404308	32404309	+	Intron	INS	-	AGAG	AGAG			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:32404308_32404309insAGAG	uc004dda.1	-						DMD_uc004dcw.2_Intron|DMD_uc004dcx.2_Intron|DMD_uc004dcz.2_Intron|DMD_uc004dcy.1_Intron|DMD_uc004ddb.1_Intron|DMD_uc010ngo.1_Intron	NM_004006	NP_003997			dystrophin Dp427m isoform						muscle filament sliding|peptide biosynthetic process	cell surface|costamere|cytoskeleton|cytosol|dystrophin-associated glycoprotein complex|sarcolemma	actin binding|dystroglycan binding|nitric-oxide synthase binding|protein binding|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(3)|pancreas(2)|large_intestine(1)	6		all_cancers(2;1.22e-16)|Acute lymphoblastic leukemia(2;4.65e-06)|all_hematologic(2;0.00108)|all_epithelial(3;0.00626)|all_neural(2;0.0189)|all_lung(315;0.182)|Glioma(3;0.203)																---	---	---	---
DMD	1756	broad.mit.edu	37	X	33229458	33229458	+	5'UTR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:33229458delA	uc004dda.1	-	1					DMD_uc004ddb.1_Intron|DMD_uc010ngo.1_5'UTR|DMD_uc004ddf.2_Intron|DMD_uc010ngr.1_5'UTR	NM_004006	NP_003997			dystrophin Dp427m isoform						muscle filament sliding|peptide biosynthetic process	cell surface|costamere|cytoskeleton|cytosol|dystrophin-associated glycoprotein complex|sarcolemma	actin binding|dystroglycan binding|nitric-oxide synthase binding|protein binding|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(3)|pancreas(2)|large_intestine(1)	6		all_cancers(2;1.22e-16)|Acute lymphoblastic leukemia(2;4.65e-06)|all_hematologic(2;0.00108)|all_epithelial(3;0.00626)|all_neural(2;0.0189)|all_lung(315;0.182)|Glioma(3;0.203)																---	---	---	---
TMEM47	83604	broad.mit.edu	37	X	34648479	34648479	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:34648479delC	uc004ddh.2	-	3	756	c.497delG	c.(496-498)GGTfs	p.G166fs	TMEM47_uc010ngs.2_RNA	NM_031442	NP_113630	Q9BQJ4	TMM47_HUMAN	transmembrane protein 47	166	Helical; (Potential).					integral to membrane				lung(1)	1																		---	---	---	---
SYTL5	94122	broad.mit.edu	37	X	37913443	37913443	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:37913443delT	uc004ddu.2	+						SYTL5_uc004ddv.2_Intron|SYTL5_uc004ddx.2_Intron	NM_001163335	NP_001156807			synaptotagmin-like 5 isoform 1						intracellular protein transport	membrane	metal ion binding|Rab GTPase binding			skin(1)	1																		---	---	---	---
BCOR	54880	broad.mit.edu	37	X	39923245	39923246	+	Intron	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:39923245_39923246insG	uc004den.3	-						BCOR_uc004dep.3_Intron|BCOR_uc004deo.3_Intron|BCOR_uc010nhb.2_5'Flank|BCOR_uc004dem.3_Intron	NM_001123385	NP_001116857			BCL-6 interacting corepressor isoform c						heart development|histone H2A monoubiquitination|negative regulation of bone mineralization|negative regulation of histone H3-K36 methylation|negative regulation of histone H3-K4 methylation|negative regulation of tooth mineralization|negative regulation of transcription from RNA polymerase II promoter|odontogenesis|palate development|specification of axis polarity|transcription, DNA-dependent	nucleus	heat shock protein binding|histone deacetylase binding|transcription corepressor activity|transcription factor binding|transcription regulatory region DNA binding			ovary(2)|kidney(1)|central_nervous_system(1)	4																		---	---	---	---
MAOA	4128	broad.mit.edu	37	X	43587703	43587703	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:43587703delA	uc004dfy.2	+						MAOA_uc011mkw.1_Intron	NM_000240	NP_000231			monoamine oxidase A						behavior|neurotransmitter biosynthetic process|neurotransmitter catabolic process|neurotransmitter secretion|xenobiotic metabolic process	integral to membrane|mitochondrial outer membrane	primary amine oxidase activity|protein binding			breast(2)|ovary(1)	3					Almotriptan(DB00918)|Carbidopa(DB00190)|Clonazepam(DB01068)|Dopamine(DB00988)|Fluvoxamine(DB00176)|Ginkgo biloba(DB01381)|Imipramine(DB00458)|Isocarboxazid(DB01247)|Levodopa(DB01235)|Linezolid(DB00601)|Lorazepam(DB00186)|Moclobemide(DB01171)|Nicotine(DB00184)|Norepinephrine(DB00368)|Phenelzine(DB00780)|Phenmetrazine(DB00830)|Phentermine(DB00191)|Phenylephrine(DB00388)|Phenylpropanolamine(DB00397)|Pseudoephedrine(DB00852)|Rasagiline(DB01367)|Riboflavin(DB00140)|Rizatriptan(DB00953)|Selegiline(DB01037)|Sumatriptan(DB00669)|Testosterone(DB00624)|Tranylcypromine(DB00752)|Zolmitriptan(DB00315)													---	---	---	---
EFHC2	80258	broad.mit.edu	37	X	44101570	44101570	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:44101570delT	uc004dgb.3	-							NM_025184	NP_079460			EF-hand domain (C-terminal) containing 2								calcium ion binding			breast(3)|ovary(2)|central_nervous_system(1)	6																		---	---	---	---
KDM6A	7403	broad.mit.edu	37	X	44936205	44936205	+	Intron	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:44936205delG	uc004dge.3	+						KDM6A_uc010nhk.2_Intron|KDM6A_uc011mkz.1_Intron|KDM6A_uc011mla.1_Intron|KDM6A_uc011mlb.1_Intron|KDM6A_uc011mlc.1_Intron|KDM6A_uc011mld.1_Intron	NM_021140	NP_066963			ubiquitously transcribed tetratricopeptide						histone H3-K4 methylation		metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			kidney(24)|haematopoietic_and_lymphoid_tissue(23)|oesophagus(11)|large_intestine(7)|lung(5)|breast(4)|central_nervous_system(3)|urinary_tract(3)|endometrium(2)|pancreas(2)	84								D|N|F|S		renal|oesophageal SCC|MM								---	---	---	---
RBM10	8241	broad.mit.edu	37	X	47034512	47034512	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:47034512delC	uc004dhf.2	+						RBM10_uc004dhe.1_Intron|RBM10_uc004dhg.2_Intron|RBM10_uc004dhh.2_Intron|RBM10_uc010nhq.2_Intron|RBM10_uc004dhi.2_Intron	NM_005676	NP_005667			RNA binding motif protein 10 isoform 1						mRNA processing|RNA splicing	chromatin remodeling complex	nucleotide binding|RNA binding|zinc ion binding			ovary(1)|large_intestine(1)|prostate(1)|breast(1)|pancreas(1)	5																		---	---	---	---
XAGE5	170627	broad.mit.edu	37	X	52842128	52842129	+	Intron	DEL	CA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:52842128_52842129delCA	uc004drd.1	+							NM_130775	NP_570131			X antigen family, member 5											ovary(1)	1																		---	---	---	---
Unknown	0	broad.mit.edu	37	X	53193530	53193530	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53193530delA								TSPYL2 (75809 upstream) : KDM5C (11931 downstream)																																			---	---	---	---
HUWE1	10075	broad.mit.edu	37	X	53615505	53615505	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53615505delA	uc004dsp.2	-						HUWE1_uc004dsn.2_Intron	NM_031407	NP_113584			HECT, UBA and WWE domain containing 1						base-excision repair|cell differentiation|histone ubiquitination|protein monoubiquitination|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	DNA binding|protein binding|ubiquitin-protein ligase activity			ovary(8)|large_intestine(4)|breast(4)|kidney(1)	17																		---	---	---	---
WNK3	65267	broad.mit.edu	37	X	54265637	54265640	+	Intron	DEL	AAAA	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54265637_54265640delAAAA	uc004dtd.1	-						WNK3_uc004dtc.1_Intron	NM_001002838	NP_001002838			WNK lysine deficient protein kinase 3 isoform 2						intracellular protein kinase cascade|positive regulation of establishment of protein localization in plasma membrane|positive regulation of peptidyl-threonine phosphorylation|positive regulation of rubidium ion transmembrane transporter activity|positive regulation of rubidium ion transport|positive regulation of sodium ion transmembrane transporter activity|positive regulation of sodium ion transport|protein autophosphorylation	adherens junction|tight junction	ATP binding|protein binding|protein serine/threonine kinase activity|rubidium ion transmembrane transporter activity|sodium ion transmembrane transporter activity			lung(4)|ovary(3)|kidney(2)|central_nervous_system(2)	11																		---	---	---	---
FGD1	2245	broad.mit.edu	37	X	54482535	54482535	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54482535delT	uc004dtg.2	-						FGD1_uc011moi.1_Intron	NM_004463	NP_004454			faciogenital dysplasia protein						actin cytoskeleton organization|apoptosis|filopodium assembly|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|organ morphogenesis|regulation of Cdc42 GTPase activity|regulation of cell shape|small GTPase mediated signal transduction	cytoskeleton|cytosol|Golgi apparatus|lamellipodium|nucleus|plasma membrane|ruffle	metal ion binding|Rho guanyl-nucleotide exchange factor activity|small GTPase binding			ovary(3)|skin(2)|central_nervous_system(1)	6																		---	---	---	---
Unknown	0	broad.mit.edu	37	X	65041156	65041156	+	IGR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:65041156delT								MSN (79364 upstream) : MIR223 (197556 downstream)																																			---	---	---	---
FOXO4	4303	broad.mit.edu	37	X	70321277	70321277	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70321277delG	uc004dys.1	+	2	1550	c.1197delG	c.(1195-1197)CTGfs	p.L399fs	FOXO4_uc010nkz.2_Intron|FOXO4_uc004dyt.1_Frame_Shift_Del_p.L344fs	NM_005938	NP_005929	P98177	FOXO4_HUMAN	forkhead box O4	399					cell cycle arrest|cell differentiation|embryo development|G1 phase of mitotic cell cycle|insulin receptor signaling pathway|mitotic cell cycle G2/M transition DNA damage checkpoint|muscle organ development|negative regulation of angiogenesis|negative regulation of cell proliferation|negative regulation of smooth muscle cell differentiation|nerve growth factor receptor signaling pathway|pattern specification process|phosphatidylinositol-mediated signaling|positive regulation of transcription from RNA polymerase II promoter|regulation of sequence-specific DNA binding transcription factor activity|tissue development	cytosol|transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|protein kinase binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding			central_nervous_system(2)|prostate(1)	3	Renal(35;0.156)																	---	---	---	---
TAF1	6872	broad.mit.edu	37	X	70639925	70639925	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70639925delT	uc004dzu.3	+						BCYRN1_uc011mpt.1_Intron|TAF1_uc004dzt.3_Intron|TAF1_uc004dzv.3_Intron|TAF1_uc010nld.1_Intron|TAF1_uc010nle.1_Intron|TAF1_uc010nlf.1_Intron|TAF1_uc004dzx.2_Intron|TAF1_uc004dzy.2_Intron	NM_138923	NP_620278			TBP-associated factor 1 isoform 2						G1 phase of mitotic cell cycle|interspecies interaction between organisms|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription initiation from RNA polymerase II promoter|protein autophosphorylation|regulation of transcription involved in G2/M-phase of mitotic cell cycle|RNA polymerase II transcriptional preinitiation complex assembly|transcription elongation from RNA polymerase II promoter|viral reproduction	MLL1 complex|transcription factor TFIID complex	ATP binding|histone acetyl-lysine binding|histone acetyltransferase activity|p53 binding|protein binding|protein serine/threonine kinase activity|sequence-specific DNA binding|TBP-class protein binding|transcription coactivator activity			ovary(7)|breast(4)|large_intestine(2)|central_nervous_system(2)|lung(1)|skin(1)	17	Renal(35;0.156)	all_lung(315;0.000321)																---	---	---	---
XIST	7503	broad.mit.edu	37	X	73071846	73071846	+	RNA	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:73071846delA	uc004ebm.1	-	1		c.743delT				NR_001564				Homo sapiens cDNA: FLJ21545 fis, clone COL06195.												0																		---	---	---	---
ITM2A	9452	broad.mit.edu	37	X	78616691	78616691	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:78616691delA	uc004edh.2	-						ITM2A_uc011mqr.1_Intron	NM_004867	NP_004858			integral membrane protein 2A							integral to membrane	protein binding			lung(2)	2																		---	---	---	---
FAM46D	169966	broad.mit.edu	37	X	79699145	79699146	+	Frame_Shift_Ins	INS	-	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:79699145_79699146insC	uc004edl.1	+	5	1441_1442	c.1107_1108insC	c.(1105-1110)CCACCCfs	p.P369fs	FAM46D_uc004edm.1_Frame_Shift_Ins_p.P369fs	NM_152630	NP_689843	Q8NEK8	FA46D_HUMAN	hypothetical protein LOC169966	369_370										lung(2)	2																		---	---	---	---
HDX	139324	broad.mit.edu	37	X	83581387	83581388	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:83581387_83581388insA	uc004eek.1	-						HDX_uc011mqv.1_Intron|HDX_uc004eel.1_Intron	NM_144657	NP_653258			highly divergent homeobox							nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			upper_aerodigestive_tract(1)|ovary(1)	2																		---	---	---	---
APOOL	139322	broad.mit.edu	37	X	84309335	84309335	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:84309335delT	uc004eem.2	+						APOOL_uc010nmp.2_Intron	NM_198450	NP_940852			apolipoprotein O-like precursor							extracellular region					0																		---	---	---	---
ZNF711	7552	broad.mit.edu	37	X	84524996	84524996	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:84524996delT	uc004eeo.2	+						ZNF711_uc004eep.2_Intron|ZNF711_uc004eeq.2_Intron|ZNF711_uc011mqy.1_Intron	NM_021998	NP_068838			zinc finger protein 711						positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding|sequence-specific DNA binding|zinc ion binding			ovary(3)|skin(1)	4																		---	---	---	---
DIAPH2	1730	broad.mit.edu	37	X	96330301	96330301	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:96330301delT	uc004efu.3	+						DIAPH2_uc004eft.3_Intron	NM_006729	NP_006720			diaphanous 2 isoform 156						cell differentiation|cytokinesis|multicellular organismal development|oogenesis	cytosol|early endosome|Golgi apparatus|mitochondrion|nucleolus	receptor binding|Rho GTPase binding			ovary(3)|lung(1)	4																		---	---	---	---
TAF7L	54457	broad.mit.edu	37	X	100536709	100536709	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:100536709delT	uc004ehb.2	-	6	731	c.719delA	c.(718-720)AAGfs	p.K240fs	TAF7L_uc004eha.2_Frame_Shift_Del_p.K154fs|TAF7L_uc004ehc.1_Frame_Shift_Del_p.K154fs	NM_024885	NP_079161	Q5H9L4	TAF7L_HUMAN	TATA box binding protein-associated factor, RNA	240					cell differentiation|multicellular organismal development|regulation of transcription, DNA-dependent|spermatogenesis|transcription initiation from RNA polymerase II promoter	cytoplasm|transcription factor TFIID complex	binding			breast(1)	1																		---	---	---	---
BEX1	55859	broad.mit.edu	37	X	102318391	102318395	+	Intron	DEL	CCCGC	-	-	rs80081474		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:102318391_102318395delCCCGC	uc004ejt.1	-							NM_018476	NP_060946			brain expressed, X-linked 1						cell differentiation|nervous system development	cytoplasm|nucleus				ovary(1)	1																		---	---	---	---
NRK	203447	broad.mit.edu	37	X	105074976	105074976	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:105074976delA	uc004emd.2	+						NRK_uc010npc.1_Intron	NM_198465	NP_940867			Nik related kinase								ATP binding|protein serine/threonine kinase activity|small GTPase regulator activity			breast(7)|ovary(3)|lung(2)|large_intestine(1)|central_nervous_system(1)	14															HNSCC(51;0.14)			---	---	---	---
NRK	203447	broad.mit.edu	37	X	105183799	105183799	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:105183799delT	uc004emd.2	+						NRK_uc010npc.1_Intron	NM_198465	NP_940867			Nik related kinase								ATP binding|protein serine/threonine kinase activity|small GTPase regulator activity			breast(7)|ovary(3)|lung(2)|large_intestine(1)|central_nervous_system(1)	14															HNSCC(51;0.14)			---	---	---	---
RNF128	79589	broad.mit.edu	37	X	105937331	105937332	+	Frame_Shift_Del	DEL	TG	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:105937331_105937332delTG	uc004emk.2	+	1	264_265	c.99_100delTG	c.(97-102)ACTGTGfs	p.T33fs		NM_024539	NP_078815	Q8TEB7	RN128_HUMAN	ring finger protein 128 isoform 2	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment_49						endomembrane system|integral to membrane|perinuclear region of cytoplasm	zinc ion binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
RNF128	79589	broad.mit.edu	37	X	105970804	105970804	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:105970804delA	uc004eml.2	+						RNF128_uc004emk.2_Intron	NM_194463	NP_919445			ring finger protein 128 isoform 1							endomembrane system|integral to membrane|perinuclear region of cytoplasm	zinc ion binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
TBC1D8B	54885	broad.mit.edu	37	X	106046064	106046065	+	5'UTR	INS	-	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:106046064_106046065insG	uc004emo.2	+	1					TBC1D8B_uc004emm.2_5'UTR|TBC1D8B_uc004emn.2_5'UTR	NM_017752	NP_060222			TBC1 domain family, member 8B (with GRAM domain)							intracellular	calcium ion binding|Rab GTPase activator activity			ovary(2)|central_nervous_system(1)|skin(1)	4																		---	---	---	---
CHRDL1	91851	broad.mit.edu	37	X	109922714	109922714	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:109922714delT	uc004eou.3	-						CHRDL1_uc004eov.2_Intron|CHRDL1_uc004eow.2_Intron|CHRDL1_uc010nps.2_Intron|CHRDL1_uc004eot.2_Intron|CHRDL1_uc011mss.1_Intron	NM_001143981	NP_001137453			chordin-like 1 isoform 1 precursor						BMP signaling pathway|cell differentiation|nervous system development|ossification	extracellular region					0																		---	---	---	---
SLC6A14	11254	broad.mit.edu	37	X	115590159	115590159	+	3'UTR	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:115590159delT	uc004eqi.2	+	14						NM_007231	NP_009162			solute carrier family 6 (amino acid						cellular amino acid metabolic process|response to toxin	integral to membrane	amino acid transmembrane transporter activity|neurotransmitter:sodium symporter activity			ovary(2)|pancreas(1)	3					L-Proline(DB00172)													---	---	---	---
RHOXF2B	727940	broad.mit.edu	37	X	119293217	119293217	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:119293217delG	uc004esl.3	+	2	566	c.376delG	c.(376-378)GGGfs	p.G126fs		NM_001099685	NP_001093155	P0C7M4	RHF2B_HUMAN	Rhox homeobox family, member 2B	126						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
CUL4B	8450	broad.mit.edu	37	X	119666625	119666626	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:119666625_119666626insA	uc004esw.2	-						CUL4B_uc010nqq.2_Intron|CUL4B_uc004esv.2_Intron	NM_003588	NP_003579			cullin 4B isoform 1						cell cycle|DNA repair|ubiquitin-dependent protein catabolic process	Cul4B-RING ubiquitin ligase complex|nucleus	protein binding|ubiquitin protein ligase binding			lung(1)|central_nervous_system(1)|pancreas(1)	3																		---	---	---	---
CUL4B	8450	broad.mit.edu	37	X	119680263	119680264	+	Intron	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:119680263_119680264insA	uc004esw.2	-						CUL4B_uc010nqq.2_Intron|CUL4B_uc004esv.2_Intron	NM_003588	NP_003579			cullin 4B isoform 1						cell cycle|DNA repair|ubiquitin-dependent protein catabolic process	Cul4B-RING ubiquitin ligase complex|nucleus	protein binding|ubiquitin protein ligase binding			lung(1)|central_nervous_system(1)|pancreas(1)	3																		---	---	---	---
STAG2	10735	broad.mit.edu	37	X	123184381	123184381	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:123184381delT	uc004etz.3	+						STAG2_uc004eua.2_Intron|STAG2_uc004eub.2_Intron|STAG2_uc004euc.2_Intron|STAG2_uc004eud.2_Intron|STAG2_uc004eue.2_Intron	NM_006603	NP_006594			stromal antigen 2 isoform b						cell division|meiosis|mitotic metaphase/anaphase transition|mitotic prometaphase|negative regulation of DNA endoreduplication|sister chromatid cohesion	chromatin|chromosome, centromeric region|nucleoplasm	protein binding			ovary(4)|skin(1)	5																		---	---	---	---
FRMD7	90167	broad.mit.edu	37	X	131212732	131212733	+	Frame_Shift_Ins	INS	-	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:131212732_131212733insA	uc004ewn.2	-	12	1490_1491	c.1312_1313insT	c.(1312-1314)TCAfs	p.S438fs	FRMD7_uc011muy.1_Frame_Shift_Ins_p.S423fs	NM_194277	NP_919253	Q6ZUT3	FRMD7_HUMAN	FERM domain containing 7	438					regulation of neuron projection development	cytoskeleton|growth cone|neuronal cell body	binding			skin(1)	1	Acute lymphoblastic leukemia(192;0.000127)																	---	---	---	---
HPRT1	3251	broad.mit.edu	37	X	133620582	133620582	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:133620582delA	uc004exl.3	+						HPRT1_uc010nrs.2_Intron	NM_000194	NP_000185			hypoxanthine phosphoribosyltransferase 1						adenine salvage|central nervous system neuron development|cerebral cortex neuron differentiation|cytolysis|dendrite morphogenesis|GMP catabolic process|GMP salvage|grooming behavior|guanine salvage|hypoxanthine salvage|IMP salvage|lymphocyte proliferation|positive regulation of dopamine metabolic process|protein homotetramerization|purine ribonucleoside salvage|response to amphetamine|striatum development	cytosol	guanine phosphoribosyltransferase activity|hypoxanthine phosphoribosyltransferase activity|magnesium ion binding|nucleotide binding|protein homodimerization activity				0	Acute lymphoblastic leukemia(192;0.000127)				Mercaptopurine(DB01033)|Thioguanine(DB00352)													---	---	---	---
MTMR1	8776	broad.mit.edu	37	X	149898488	149898488	+	Intron	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:149898488delA	uc004fei.2	+						MTMR1_uc011mya.1_Intron|MTMR1_uc004feg.1_Intron|MTMR1_uc004feh.1_Intron|MTMR1_uc004fej.2_Intron|MTMR1_uc010ntf.2_Intron	NM_003828	NP_003819			myotubularin-related protein 1							plasma membrane	protein tyrosine phosphatase activity			ovary(1)	1	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
PASD1	139135	broad.mit.edu	37	X	150770186	150770186	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:150770186delT	uc004fev.3	+							NM_173493	NP_775764			PAS domain containing 1							nucleus	signal transducer activity			ovary(3)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
ZNF185	7739	broad.mit.edu	37	X	152138802	152138802	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:152138802delT	uc010ntv.1	+						ZNF185_uc011myg.1_Intron|ZNF185_uc011myh.1_Intron|ZNF185_uc011myi.1_Intron|ZNF185_uc011myj.1_Intron|ZNF185_uc011myk.1_Intron|ZNF185_uc004fgw.3_Intron|ZNF185_uc004fgu.2_Intron|ZNF185_uc004fgv.2_Intron|ZNF185_uc004fgx.2_Intron	NM_007150	NP_009081			zinc finger protein 185							cytoplasm|cytoskeleton|focal adhesion	zinc ion binding			ovary(3)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
FAM3A	60343	broad.mit.edu	37	X	153740061	153740061	+	Intron	DEL	C	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153740061delC	uc004fls.1	-						FAM3A_uc004flt.1_Intron|FAM3A_uc011mzp.1_Intron|FAM3A_uc004flu.1_Intron|FAM3A_uc011mzq.1_Intron|FAM3A_uc004flw.1_Intron	NM_021806	NP_068578			family 3, member A protein precursor							extracellular region				large_intestine(1)	1	all_cancers(53;5.05e-16)|all_epithelial(53;1.87e-10)|all_lung(58;1.84e-07)|Lung NSC(58;5.84e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)															OREG0003614	type=REGULATORY REGION|Gene=FAM3A|Dataset=Stanford ENCODE Dataset|EvidenceSubtype=Transient transfection luciferase assay	---	---	---	---
F8	2157	broad.mit.edu	37	X	154130095	154130095	+	Intron	DEL	T	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:154130095delT	uc004fmt.2	-						F8_uc010nvi.1_Intron	NM_000132	NP_000123			coagulation factor VIII isoform a precursor						acute-phase response|blood coagulation, intrinsic pathway|cell adhesion|platelet activation|platelet degranulation	extracellular space|plasma membrane|platelet alpha granule lumen	copper ion binding|oxidoreductase activity|protein binding			ovary(5)|large_intestine(2)|pancreas(2)|upper_aerodigestive_tract(1)|skin(1)	11	all_cancers(53;7.19e-17)|all_epithelial(53;9.83e-11)|all_lung(58;6.63e-07)|Lung NSC(58;2.08e-06)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)|Renal(33;0.214)				Antihemophilic Factor(DB00025)|Coagulation Factor IX(DB00100)|Drotrecogin alfa(DB00055)													---	---	---	---
Unknown	0	broad.mit.edu	37	Y	13266400	13266400	+	IGR	DEL	A	-	-			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrY:13266400delA								None (None upstream) : None (None downstream)																																			---	---	---	---
SCNN1D	6339	broad.mit.edu	37	1	1225650	1225650	+	Splice_Site	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1225650G>T	uc001adu.1	+	12	1795	c.1171_splice	c.e12-1	p.A391_splice	SCNN1D_uc001adt.1_Splice_Site_p.A555_splice|SCNN1D_uc001adw.2_Splice_Site_p.A457_splice|SCNN1D_uc001adx.2_Splice_Site_p.A180_splice|SCNN1D_uc001adv.2_Splice_Site_p.A391_splice	NM_002978	NP_002969			sodium channel, nonvoltage-gated 1, delta												0	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;8.75e-19)|all_lung(118;2.3e-08)|Lung NSC(185;2.38e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Lung SC(97;0.128)		Epithelial(90;3.01e-35)|OV - Ovarian serous cystadenocarcinoma(86;2.46e-21)|Colorectal(212;0.000157)|COAD - Colon adenocarcinoma(227;0.000193)|Kidney(185;0.00229)|BRCA - Breast invasive adenocarcinoma(365;0.00251)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.034)|Lung(427;0.199)														---	---	---	---
GLTPD1	80772	broad.mit.edu	37	1	1262694	1262694	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1262694C>T	uc001aeo.2	+	3	611	c.196C>T	c.(196-198)CGC>TGC	p.R66C	CPSF3L_uc001aee.1_5'Flank|CPSF3L_uc001aef.1_5'Flank|CPSF3L_uc009vjz.1_5'Flank|CPSF3L_uc010nyj.1_5'Flank|CPSF3L_uc001aeg.1_5'Flank|CPSF3L_uc001aeh.1_5'Flank|CPSF3L_uc001aei.1_5'Flank|CPSF3L_uc001aej.1_5'Flank|CPSF3L_uc001aek.1_5'Flank|CPSF3L_uc001aem.1_5'Flank|CPSF3L_uc001ael.1_5'Flank|CPSF3L_uc001aen.1_5'Flank	NM_001029885	NP_001025056	Q5TA50	GLTD1_HUMAN	glycolipid transfer protein domain containing 1	66						cytoplasm	glycolipid binding|glycolipid transporter activity				0	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;8.75e-19)|all_lung(118;2.3e-08)|Lung NSC(185;2.38e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Lung SC(97;0.128)		Epithelial(90;4.95e-35)|OV - Ovarian serous cystadenocarcinoma(86;3.77e-21)|Colorectal(212;0.000155)|COAD - Colon adenocarcinoma(227;0.000193)|Kidney(185;0.00227)|BRCA - Breast invasive adenocarcinoma(365;0.0025)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0339)|Lung(427;0.199)														---	---	---	---
TAS1R3	83756	broad.mit.edu	37	1	1267559	1267559	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1267559C>A	uc010nyk.1	+	3	648	c.648C>A	c.(646-648)GAC>GAA	p.D216E		NM_152228	NP_689414	Q7RTX0	TS1R3_HUMAN	taste receptor, type 1, member 3 precursor	216	Extracellular (Potential).				detection of chemical stimulus involved in sensory perception of sweet taste|sensory perception of umami taste	plasma membrane	protein heterodimerization activity|taste receptor activity				0	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;9.48e-15)|all_lung(118;9.67e-07)|Lung NSC(185;5.59e-05)|Renal(390;0.00571)|Breast(487;0.0183)|Hepatocellular(190;0.0268)|Myeloproliferative disorder(586;0.028)|Ovarian(437;0.127)|Lung SC(97;0.217)		Epithelial(90;3.01e-35)|OV - Ovarian serous cystadenocarcinoma(86;3.88e-21)|Colorectal(212;0.000157)|COAD - Colon adenocarcinoma(227;0.000193)|Kidney(185;0.00229)|BRCA - Breast invasive adenocarcinoma(365;0.00251)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.034)|Lung(427;0.146)	Aspartame(DB00168)													---	---	---	---
MIB2	142678	broad.mit.edu	37	1	1560532	1560532	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1560532G>A	uc001agg.2	+	6	989	c.862G>A	c.(862-864)GGC>AGC	p.G288S	MIB2_uc001agh.2_Missense_Mutation_p.G274S|MIB2_uc001agi.2_Missense_Mutation_p.G288S|MIB2_uc001agj.2_Missense_Mutation_p.G129S|MIB2_uc001agk.2_Intron|MIB2_uc001agl.1_Missense_Mutation_p.G244S|MIB2_uc001agm.2_Intron|MIB2_uc010nyq.1_Missense_Mutation_p.G244S|MIB2_uc009vkh.2_Missense_Mutation_p.G129S|MIB2_uc001agn.2_5'UTR	NM_080875	NP_543151	Q96AX9	MIB2_HUMAN	mindbomb homolog 2	288					Notch signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade	endosome	actin binding|signal transducer activity|ubiquitin-protein ligase activity|zinc ion binding				0	all_cancers(77;0.000708)|all_epithelial(69;0.000943)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;6.04e-15)|all_lung(118;9.67e-07)|Lung NSC(185;5.59e-05)|Renal(390;0.00571)|Breast(487;0.0183)|Hepatocellular(190;0.0268)|Myeloproliferative disorder(586;0.028)|Ovarian(437;0.127)|Lung SC(97;0.217)		Epithelial(90;5.26e-37)|OV - Ovarian serous cystadenocarcinoma(86;2.54e-23)|GBM - Glioblastoma multiforme(42;9e-08)|Colorectal(212;0.000155)|COAD - Colon adenocarcinoma(227;0.000193)|Kidney(185;0.00227)|STAD - Stomach adenocarcinoma(132;0.00644)|BRCA - Breast invasive adenocarcinoma(365;0.00786)|KIRC - Kidney renal clear cell carcinoma(229;0.0339)|Lung(427;0.199)														---	---	---	---
SKI	6497	broad.mit.edu	37	1	2234480	2234480	+	Missense_Mutation	SNP	G	A	A	rs150934009		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:2234480G>A	uc001aja.3	+	2	1105	c.1033G>A	c.(1033-1035)GCG>ACG	p.A345T		NM_003036	NP_003027	P12755	SKI_HUMAN	v-ski sarcoma viral oncogene homolog	345					anterior/posterior axis specification|BMP signaling pathway|bone morphogenesis|cell motility|cell proliferation|embryonic limb morphogenesis|face morphogenesis|lens morphogenesis in camera-type eye|myelination in peripheral nervous system|myotube differentiation|negative regulation of activin receptor signaling pathway|negative regulation of BMP signaling pathway|negative regulation of fibroblast proliferation|negative regulation of osteoblast differentiation|negative regulation of Schwann cell proliferation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transforming growth factor beta receptor signaling pathway|neural tube closure|nose morphogenesis|olfactory bulb development|palate development|positive regulation of DNA binding|positive regulation of transcription from RNA polymerase II promoter|positive regulation of Wnt receptor signaling pathway|protein homotrimerization|regulation of apoptosis|retina development in camera-type eye|skeletal muscle fiber development|SMAD protein signal transduction|somatic stem cell maintenance|transcription, DNA-dependent|transforming growth factor beta receptor signaling pathway	cytoplasm|PML body|transcription factor complex|transcriptional repressor complex	histone deacetylase inhibitor activity|nucleotide binding|protein domain specific binding|protein kinase binding|repressing transcription factor binding|SMAD binding|transcription corepressor activity|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding			lung(1)|central_nervous_system(1)	2	all_cancers(77;0.000139)|all_epithelial(69;4.45e-05)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)			Epithelial(90;2.14e-37)|OV - Ovarian serous cystadenocarcinoma(86;2.72e-29)|GBM - Glioblastoma multiforme(42;2.45e-08)|Colorectal(212;5.33e-05)|COAD - Colon adenocarcinoma(227;0.000228)|Kidney(185;0.00268)|BRCA - Breast invasive adenocarcinoma(365;0.00471)|STAD - Stomach adenocarcinoma(132;0.0147)|KIRC - Kidney renal clear cell carcinoma(229;0.0385)|Lung(427;0.207)														---	---	---	---
CCDC27	148870	broad.mit.edu	37	1	3688087	3688087	+	Nonstop_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:3688087G>T	uc001akv.2	+	12	2052	c.1971G>T	c.(1969-1971)TAG>TAT	p.*657Y	LOC388588_uc001akw.3_5'Flank	NM_152492	NP_689705	Q2M243	CCD27_HUMAN	coiled-coil domain containing 27	657										skin(1)	1	all_cancers(77;0.0385)|Ovarian(185;0.0634)|Lung NSC(156;0.21)|all_lung(157;0.218)	all_epithelial(116;5.52e-17)|all_lung(118;1.04e-06)|Lung NSC(185;0.000214)|Renal(390;0.00357)|Breast(487;0.00446)|Hepatocellular(190;0.0218)|Lung SC(97;0.0367)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.127)		Epithelial(90;1.11e-38)|OV - Ovarian serous cystadenocarcinoma(86;1.35e-22)|GBM - Glioblastoma multiforme(42;3.46e-16)|Colorectal(212;1.17e-05)|COAD - Colon adenocarcinoma(227;5.76e-05)|Kidney(185;0.00036)|BRCA - Breast invasive adenocarcinoma(365;0.000696)|KIRC - Kidney renal clear cell carcinoma(229;0.00558)|STAD - Stomach adenocarcinoma(132;0.00645)|Lung(427;0.203)														---	---	---	---
ACOT7	11332	broad.mit.edu	37	1	6393549	6393549	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6393549C>T	uc001ams.2	-	4	685	c.528G>A	c.(526-528)GTG>GTA	p.V176V	ACOT7_uc010nzq.1_Silent_p.V61V|ACOT7_uc001amt.2_Silent_p.V166V|ACOT7_uc001amu.2_RNA|ACOT7_uc001amv.2_RNA|ACOT7_uc001amq.2_Silent_p.V125V|ACOT7_uc001amr.2_Silent_p.V146V	NM_181864	NP_863654	O00154	BACH_HUMAN	acyl-CoA thioesterase 7 isoform hBACHb	176						mitochondrion|nucleus	carboxylesterase activity|fatty-acyl-CoA binding|palmitoyl-CoA hydrolase activity				0	Ovarian(185;0.0634)|all_lung(157;0.175)	all_cancers(23;1.42e-38)|all_epithelial(116;3.96e-23)|all_lung(118;3.69e-08)|Lung NSC(185;8.52e-07)|all_hematologic(16;6.92e-06)|Colorectal(325;4.53e-05)|Acute lymphoblastic leukemia(12;5e-05)|all_neural(13;0.000164)|Breast(487;0.000688)|Renal(390;0.0007)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0393)|Medulloblastoma(700;0.211)		Epithelial(90;9.16e-37)|GBM - Glioblastoma multiforme(13;5.89e-29)|OV - Ovarian serous cystadenocarcinoma(86;7.63e-19)|Colorectal(212;1.27e-07)|COAD - Colon adenocarcinoma(227;2.06e-05)|Kidney(185;7.74e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.00129)|BRCA - Breast invasive adenocarcinoma(365;0.00132)|STAD - Stomach adenocarcinoma(132;0.00195)|READ - Rectum adenocarcinoma(331;0.0481)														---	---	---	---
TAS1R1	80835	broad.mit.edu	37	1	6639380	6639380	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6639380G>A	uc001ant.2	+	6	2262	c.2262G>A	c.(2260-2262)GAG>GAA	p.E754E	TAS1R1_uc001anu.2_Silent_p.E500E|TAS1R1_uc001anv.2_Missense_Mutation_p.R286K|TAS1R1_uc001anw.2_3'UTR|ZBTB48_uc009vmc.1_5'Flank|ZBTB48_uc001anx.2_5'Flank|ZBTB48_uc009vmd.1_5'Flank	NM_138697	NP_619642	Q7RTX1	TS1R1_HUMAN	sweet taste receptor T1r isoform b	754	Cytoplasmic (Potential).				sensory perception of umami taste	plasma membrane	protein heterodimerization activity|taste receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3	Ovarian(185;0.0212)|all_lung(157;0.154)	all_cancers(23;8.73e-34)|all_epithelial(116;9.26e-22)|all_lung(118;7.57e-07)|Lung NSC(185;4.26e-06)|Breast(487;0.000353)|Renal(390;0.0007)|Colorectal(325;0.00104)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0443)		Colorectal(212;1.29e-07)|COAD - Colon adenocarcinoma(227;1.33e-05)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000896)|BRCA - Breast invasive adenocarcinoma(365;0.00108)|STAD - Stomach adenocarcinoma(132;0.0167)|READ - Rectum adenocarcinoma(331;0.0642)														---	---	---	---
SLC45A1	50651	broad.mit.edu	37	1	8390958	8390958	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:8390958G>A	uc001apb.2	+	4	1405	c.1405G>A	c.(1405-1407)GAA>AAA	p.E469K	SLC45A1_uc001apc.2_Missense_Mutation_p.E167K	NM_001080397	NP_001073866	Q9Y2W3	S45A1_HUMAN	DNB5	469					carbohydrate transport	integral to membrane	symporter activity			central_nervous_system(2)|pancreas(1)|skin(1)	4	Ovarian(185;0.0661)|all_lung(157;0.127)	all_epithelial(116;1.22e-15)|all_lung(118;0.000147)|Lung NSC(185;0.000251)|Renal(390;0.000469)|Colorectal(325;0.00578)|Breast(348;0.00686)|Hepatocellular(190;0.0228)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.11)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|all cancers(8;3.95e-66)|GBM - Glioblastoma multiforme(8;5.93e-33)|Colorectal(212;2.86e-07)|COAD - Colon adenocarcinoma(227;3.11e-05)|Kidney(185;5.33e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000513)|KIRC - Kidney renal clear cell carcinoma(229;0.000979)|STAD - Stomach adenocarcinoma(132;0.00199)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
UBE4B	10277	broad.mit.edu	37	1	10231281	10231281	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:10231281A>C	uc001aqs.3	+	25	4132	c.3419A>C	c.(3418-3420)AAC>ACC	p.N1140T	UBE4B_uc001aqr.3_Missense_Mutation_p.N1011T|UBE4B_uc010oai.1_RNA|UBE4B_uc010oaj.1_Missense_Mutation_p.N595T|UBE4B_uc001aqu.2_Missense_Mutation_p.N21T	NM_001105562	NP_001099032	O95155	UBE4B_HUMAN	ubiquitination factor E4B isoform 1	1140					apoptosis|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|response to UV	cytoplasm|ubiquitin ligase complex	enzyme binding			ovary(2)|skin(2)	4		all_lung(284;1.13e-05)|Lung NSC(185;1.74e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0268)|Colorectal(212;1.42e-07)|COAD - Colon adenocarcinoma(227;2.77e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000435)|Kidney(185;0.000482)|KIRC - Kidney renal clear cell carcinoma(229;0.00164)|STAD - Stomach adenocarcinoma(132;0.0117)|READ - Rectum adenocarcinoma(331;0.046)														---	---	---	---
PTCHD2	57540	broad.mit.edu	37	1	11596562	11596562	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:11596562C>T	uc001ash.3	+	21	4136	c.3998C>T	c.(3997-3999)ACG>ATG	p.T1333M		NM_020780	NP_065831	Q9P2K9	PTHD2_HUMAN	patched domain containing 2	1333	Helical; (Potential).				cholesterol homeostasis|regulation of lipid transport|smoothened signaling pathway	endoplasmic reticulum|integral to membrane|nuclear membrane	hedgehog receptor activity			skin(3)|ovary(2)|pancreas(1)|breast(1)	7	Ovarian(185;0.249)	Lung NSC(185;4.16e-05)|all_lung(284;4.76e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.00965)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;3.13e-07)|COAD - Colon adenocarcinoma(227;4.83e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000325)|Kidney(185;0.000877)|KIRC - Kidney renal clear cell carcinoma(229;0.00273)|STAD - Stomach adenocarcinoma(313;0.00766)|READ - Rectum adenocarcinoma(331;0.0549)														---	---	---	---
PRAMEF8	391002	broad.mit.edu	37	1	12979762	12979762	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12979762C>T	uc001aup.2	+	4	1037	c.954C>T	c.(952-954)ATC>ATT	p.I318I		NM_001012276	NP_001012276	Q5VWM4	PRAM8_HUMAN	PRAME family member 8	318	LRR 1.										0	Ovarian(185;0.249)	Renal(390;0.000469)|Lung NSC(185;0.00143)|all_lung(284;0.00181)|Colorectal(325;0.00215)|Breast(348;0.00224)|Myeloproliferative disorder(586;0.0393)|Hepatocellular(190;0.0623)|Ovarian(437;0.0731)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00812)|Colorectal(212;4.88e-06)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000194)|COAD - Colon adenocarcinoma(227;0.000241)|BRCA - Breast invasive adenocarcinoma(304;0.000293)|STAD - Stomach adenocarcinoma(313;0.0072)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
SPEN	23013	broad.mit.edu	37	1	16263839	16263839	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16263839G>A	uc001axk.1	+	12	10412	c.10208G>A	c.(10207-10209)CGC>CAC	p.R3403H	SPEN_uc010obp.1_Missense_Mutation_p.R3362H	NM_015001	NP_055816	Q96T58	MINT_HUMAN	spen homolog, transcriptional regulator	3403	Pro-rich.				interspecies interaction between organisms|negative regulation of transcription, DNA-dependent|Notch signaling pathway	nucleus	nucleotide binding|protein binding|RNA binding			ovary(6)|breast(3)|lung(2)|skin(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	15		Colorectal(325;0.000258)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.000567)|Ovarian(437;0.0129)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0185)|Colorectal(212;5.96e-07)|COAD - Colon adenocarcinoma(227;3.11e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000115)|Kidney(64;0.000212)|KIRC - Kidney renal clear cell carcinoma(64;0.003)|STAD - Stomach adenocarcinoma(313;0.013)|READ - Rectum adenocarcinoma(331;0.0681)														---	---	---	---
EPHA2	1969	broad.mit.edu	37	1	16458607	16458607	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16458607G>A	uc001aya.1	-	13	2414	c.2277C>T	c.(2275-2277)GGC>GGT	p.G759G		NM_004431	NP_004422	P29317	EPHA2_HUMAN	ephrin receptor EphA2 precursor	759	Mediates interaction with ARHGEF16 and ELMO2.|Protein kinase.|Cytoplasmic (Potential).				activation of Rac GTPase activity|angiogenesis|apoptosis|cell chemotaxis|negative regulation of protein kinase B signaling cascade|positive regulation of establishment of protein localization in plasma membrane|protein kinase B signaling cascade|regulation of blood vessel endothelial cell migration|regulation of cell adhesion mediated by integrin|regulation of lamellipodium assembly|response to growth factor stimulus	focal adhesion|integral to plasma membrane|lamellipodium membrane|ruffle membrane	ATP binding|ephrin receptor activity|protein binding			lung(3)|central_nervous_system(3)|stomach(2)|ovary(2)	10		Colorectal(325;3.46e-05)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.000567)|Ovarian(437;0.0221)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0181)|Colorectal(212;3.63e-07)|COAD - Colon adenocarcinoma(227;2.25e-05)|BRCA - Breast invasive adenocarcinoma(304;9.58e-05)|Kidney(64;0.000175)|KIRC - Kidney renal clear cell carcinoma(64;0.00261)|STAD - Stomach adenocarcinoma(313;0.00669)|READ - Rectum adenocarcinoma(331;0.0649)	Dasatinib(DB01254)													---	---	---	---
ARHGEF19	128272	broad.mit.edu	37	1	16525635	16525635	+	Intron	SNP	G	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16525635G>C	uc001ayc.1	-						ARHGEF19_uc009voo.1_Intron|ARHGEF19_uc001ayb.1_Intron	NM_153213	NP_694945			Rho guanine nucleotide exchange factor (GEF) 19						regulation of actin cytoskeleton organization	intracellular	GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			skin(2)|ovary(1)	3		Colorectal(325;0.000147)|Renal(390;0.00145)|Breast(348;0.00224)|Lung NSC(340;0.00566)|all_lung(284;0.00831)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0646)		UCEC - Uterine corpus endometrioid carcinoma (279;0.018)|Colorectal(212;3.48e-07)|COAD - Colon adenocarcinoma(227;2.19e-05)|BRCA - Breast invasive adenocarcinoma(304;9.46e-05)|Kidney(64;0.000171)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(313;0.0117)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
ATP13A2	23400	broad.mit.edu	37	1	17331307	17331307	+	Silent	SNP	C	T	T	rs141777915		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17331307C>T	uc001baa.2	-	5	547	c.357G>A	c.(355-357)CCG>CCA	p.P119P	ATP13A2_uc001bab.2_Silent_p.P119P|ATP13A2_uc001bac.2_Silent_p.P119P	NM_022089	NP_071372	Q9NQ11	AT132_HUMAN	ATPase type 13A2 isoform 1	119	Cytoplasmic (Potential).				ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			skin(2)|ovary(1)|central_nervous_system(1)	4		Colorectal(325;0.000147)|Breast(348;0.00104)|Renal(390;0.00145)|Lung NSC(340;0.00566)|all_lung(284;0.00797)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0646)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00462)|COAD - Colon adenocarcinoma(227;1.11e-05)|BRCA - Breast invasive adenocarcinoma(304;1.99e-05)|Kidney(64;0.000171)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00645)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.182)														---	---	---	---
UBR4	23352	broad.mit.edu	37	1	19431150	19431150	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:19431150C>T	uc001bbi.2	-	86	12660	c.12656G>A	c.(12655-12657)CGT>CAT	p.R4219H	UBR4_uc001bbg.2_5'UTR|UBR4_uc001bbh.2_5'UTR	NM_020765	NP_065816	Q5T4S7	UBR4_HUMAN	retinoblastoma-associated factor 600	4219					interspecies interaction between organisms	cytoplasm|cytoskeleton|integral to membrane|nucleus	calmodulin binding|ubiquitin-protein ligase activity|zinc ion binding			kidney(10)|ovary(7)|breast(4)|pancreas(2)|skin(2)	25		Colorectal(325;3.46e-05)|Renal(390;0.000147)|all_lung(284;0.000328)|Lung NSC(340;0.000406)|Breast(348;0.000814)|Ovarian(437;0.00774)|Myeloproliferative disorder(586;0.0256)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00674)|BRCA - Breast invasive adenocarcinoma(304;5.43e-05)|Kidney(64;0.000337)|KIRC - Kidney renal clear cell carcinoma(64;0.00426)|STAD - Stomach adenocarcinoma(196;0.00715)|READ - Rectum adenocarcinoma(331;0.0816)														---	---	---	---
UBR4	23352	broad.mit.edu	37	1	19481550	19481550	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:19481550G>A	uc001bbi.2	-	44	6324	c.6320C>T	c.(6319-6321)GCG>GTG	p.A2107V	UBR4_uc001bbl.1_Missense_Mutation_p.A44V|UBR4_uc001bbm.1_Missense_Mutation_p.A1319V	NM_020765	NP_065816	Q5T4S7	UBR4_HUMAN	retinoblastoma-associated factor 600	2107					interspecies interaction between organisms	cytoplasm|cytoskeleton|integral to membrane|nucleus	calmodulin binding|ubiquitin-protein ligase activity|zinc ion binding			kidney(10)|ovary(7)|breast(4)|pancreas(2)|skin(2)	25		Colorectal(325;3.46e-05)|Renal(390;0.000147)|all_lung(284;0.000328)|Lung NSC(340;0.000406)|Breast(348;0.000814)|Ovarian(437;0.00774)|Myeloproliferative disorder(586;0.0256)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00674)|BRCA - Breast invasive adenocarcinoma(304;5.43e-05)|Kidney(64;0.000337)|KIRC - Kidney renal clear cell carcinoma(64;0.00426)|STAD - Stomach adenocarcinoma(196;0.00715)|READ - Rectum adenocarcinoma(331;0.0816)														---	---	---	---
KIAA0090	23065	broad.mit.edu	37	1	19553887	19553887	+	Missense_Mutation	SNP	C	T	T	rs139714938		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:19553887C>T	uc001bbo.2	-	18	2165	c.2122G>A	c.(2122-2124)GTC>ATC	p.V708I	KIAA0090_uc001bbp.2_Missense_Mutation_p.V707I|KIAA0090_uc001bbq.2_Missense_Mutation_p.V707I|KIAA0090_uc001bbr.2_Missense_Mutation_p.V686I	NM_015047	NP_055862	Q8N766	K0090_HUMAN	hypothetical protein LOC23065 precursor	708	Extracellular (Potential).					integral to membrane	protein binding			ovary(1)	1		Colorectal(325;0.000147)|Renal(390;0.000469)|Breast(348;0.00366)|all_lung(284;0.00519)|Lung NSC(340;0.00544)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0707)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00492)|BRCA - Breast invasive adenocarcinoma(304;3.84e-05)|Kidney(64;0.000191)|KIRC - Kidney renal clear cell carcinoma(64;0.00274)|GBM - Glioblastoma multiforme(114;0.005)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0656)														---	---	---	---
DDOST	1650	broad.mit.edu	37	1	20987835	20987835	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:20987835G>A	uc001bdo.1	-	1	203	c.60C>T	c.(58-60)CCC>CCT	p.P20P	DDOST_uc009vpw.1_Silent_p.P20P|DDOST_uc010odd.1_5'UTR|DDOST_uc010ode.1_Silent_p.P20P	NM_005216	NP_005207	P39656	OST48_HUMAN	dolichyl-diphosphooligosaccharide-protein	20					innate immune response|post-translational protein modification|response to cytokine stimulus|T cell activation	integral to membrane|microsome|oligosaccharyltransferase complex	dolichyl-diphosphooligosaccharide-protein glycotransferase activity|protein binding				0		all_lung(284;2.98e-05)|Lung NSC(340;3.25e-05)|Colorectal(325;3.46e-05)|Renal(390;0.000147)|Breast(348;0.00179)|Ovarian(437;0.00327)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0181)|COAD - Colon adenocarcinoma(152;1.17e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000141)|Kidney(64;0.000177)|GBM - Glioblastoma multiforme(114;0.00046)|KIRC - Kidney renal clear cell carcinoma(64;0.00262)|STAD - Stomach adenocarcinoma(196;0.00303)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.199)												OREG0013196	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
ECE1	1889	broad.mit.edu	37	1	21554468	21554468	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:21554468C>T	uc001bek.2	-	15	1812	c.1737G>A	c.(1735-1737)CCG>CCA	p.P579P	ECE1_uc001bem.2_Silent_p.P563P|ECE1_uc001bej.2_Silent_p.P567P|ECE1_uc001bei.2_Silent_p.P576P|ECE1_uc010odl.1_Silent_p.P579P	NM_001397	NP_001388	P42892	ECE1_HUMAN	endothelin converting enzyme 1 isoform 1	579	Extracellular (Potential).				bradykinin catabolic process|calcitonin catabolic process|ear development|embryonic digit morphogenesis|endothelin maturation|heart development|positive regulation of receptor recycling|substance P catabolic process	early endosome|external side of plasma membrane|integral to membrane|intrinsic to endosome membrane|membrane fraction|perinuclear region of cytoplasm|plasma membrane|Weibel-Palade body	metal ion binding|metalloendopeptidase activity|protein homodimerization activity			ovary(2)|skin(1)	3		Lung NSC(340;1.14e-05)|all_lung(284;1.23e-05)|Colorectal(325;3.46e-05)|Renal(390;9.67e-05)|Breast(348;0.00147)|Ovarian(437;0.00432)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0183)|OV - Ovarian serous cystadenocarcinoma(117;4.83e-27)|COAD - Colon adenocarcinoma(152;1.36e-06)|GBM - Glioblastoma multiforme(114;1.47e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000162)|STAD - Stomach adenocarcinoma(196;0.00326)|KIRC - Kidney renal clear cell carcinoma(1967;0.00755)|READ - Rectum adenocarcinoma(331;0.0678)|Lung(427;0.206)														---	---	---	---
EPHB2	2048	broad.mit.edu	37	1	23111124	23111124	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:23111124G>A	uc009vqj.1	+	3	511	c.366G>A	c.(364-366)TCG>TCA	p.S122S	EPHB2_uc001bge.2_Silent_p.S122S|EPHB2_uc001bgf.2_Silent_p.S122S|EPHB2_uc010odu.1_Silent_p.S122S	NM_017449	NP_059145	P29323	EPHB2_HUMAN	ephrin receptor EphB2 isoform 1 precursor	122	Extracellular (Potential).				axon guidance	integral to plasma membrane	ATP binding|transmembrane-ephrin receptor activity			ovary(3)|lung(1)|pancreas(1)	5		Colorectal(325;3.46e-05)|Lung NSC(340;3.7e-05)|all_lung(284;5.45e-05)|Renal(390;0.000228)|Breast(348;0.0027)|Ovarian(437;0.00327)|Myeloproliferative disorder(586;0.0258)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0348)|OV - Ovarian serous cystadenocarcinoma(117;3.67e-26)|Colorectal(126;3.23e-08)|COAD - Colon adenocarcinoma(152;9.32e-07)|GBM - Glioblastoma multiforme(114;2.93e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000606)|KIRC - Kidney renal clear cell carcinoma(1967;0.00371)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.126)|Lung(427;0.153)										Hereditary_Prostate_Cancer				---	---	---	---
LUZP1	7798	broad.mit.edu	37	1	23419547	23419547	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:23419547C>T	uc001bgk.2	-	4	1592	c.1208G>A	c.(1207-1209)CGG>CAG	p.R403Q	LUZP1_uc010odv.1_Missense_Mutation_p.R403Q|LUZP1_uc001bgl.2_Missense_Mutation_p.R403Q|LUZP1_uc001bgm.1_Missense_Mutation_p.R403Q	NM_033631	NP_361013	Q86V48	LUZP1_HUMAN	leucine zipper protein 1	403						nucleus					0		Colorectal(325;3.46e-05)|Lung NSC(340;4.15e-05)|all_lung(284;6.64e-05)|Renal(390;0.000219)|Ovarian(437;0.00373)|Breast(348;0.00815)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;4.88e-27)|Colorectal(126;8.36e-08)|COAD - Colon adenocarcinoma(152;4.31e-06)|GBM - Glioblastoma multiforme(114;8.64e-05)|BRCA - Breast invasive adenocarcinoma(304;0.00112)|KIRC - Kidney renal clear cell carcinoma(1967;0.00176)|STAD - Stomach adenocarcinoma(196;0.0146)|READ - Rectum adenocarcinoma(331;0.0686)|Lung(427;0.0967)|LUSC - Lung squamous cell carcinoma(448;0.199)														---	---	---	---
LYPLA2	11313	broad.mit.edu	37	1	24120427	24120427	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24120427C>T	uc001bht.2	+						LYPLA2_uc001bhr.2_Intron|LYPLA2_uc001bhs.1_Intron|LYPLA2_uc001bhu.2_Intron	NM_007260	NP_009191			lysophospholipase II						fatty acid metabolic process	cytoplasm	hydrolase activity			ovary(1)|skin(1)	2		Colorectal(325;3.46e-05)|Renal(390;0.000219)|Lung NSC(340;0.000233)|all_lung(284;0.000321)|Breast(348;0.0044)|Ovarian(437;0.00539)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0227)|OV - Ovarian serous cystadenocarcinoma(117;1.79e-24)|Colorectal(126;4.8e-08)|COAD - Colon adenocarcinoma(152;2.83e-06)|GBM - Glioblastoma multiforme(114;4.22e-06)|BRCA - Breast invasive adenocarcinoma(304;0.000946)|KIRC - Kidney renal clear cell carcinoma(1967;0.00314)|STAD - Stomach adenocarcinoma(196;0.0123)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.0827)|LUSC - Lung squamous cell carcinoma(448;0.184)														---	---	---	---
MYOM3	127294	broad.mit.edu	37	1	24406652	24406652	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24406652G>A	uc001bin.3	-	20	2603	c.2440C>T	c.(2440-2442)CGG>TGG	p.R814W	MYOM3_uc001bim.3_Missense_Mutation_p.R471W|MYOM3_uc001bio.2_Missense_Mutation_p.R814W	NM_152372	NP_689585	Q5VTT5	MYOM3_HUMAN	myomesin family, member 3	814	Fibronectin type-III 5.									skin(2)|ovary(1)	3		Colorectal(325;3.55e-05)|Renal(390;0.000703)|Lung NSC(340;0.001)|all_lung(284;0.0014)|Ovarian(437;0.00351)|Breast(348;0.0126)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;5.31e-24)|Colorectal(126;7.52e-08)|COAD - Colon adenocarcinoma(152;4.01e-06)|GBM - Glioblastoma multiforme(114;4.36e-06)|BRCA - Breast invasive adenocarcinoma(304;0.00108)|KIRC - Kidney renal clear cell carcinoma(1967;0.00404)|STAD - Stomach adenocarcinoma(196;0.00966)|READ - Rectum adenocarcinoma(331;0.0678)|Lung(427;0.153)														---	---	---	---
GRHL3	57822	broad.mit.edu	37	1	24669404	24669404	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24669404G>A	uc001biy.2	+	11	1369	c.1323G>A	c.(1321-1323)TCG>TCA	p.S441S	GRHL3_uc001bix.2_Silent_p.S436S|GRHL3_uc001biz.2_Silent_p.S343S	NM_021180	NP_067003	Q8TE85	GRHL3_HUMAN	sister-of-mammalian grainyhead protein isoform	436					regulation of actin cytoskeleton organization|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1		Colorectal(325;3.46e-05)|Renal(390;0.0007)|Lung NSC(340;0.00171)|all_lung(284;0.00226)|Ovarian(437;0.00348)|Breast(348;0.0126)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.19)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;8.72e-25)|Colorectal(126;4.38e-08)|COAD - Colon adenocarcinoma(152;1.84e-06)|GBM - Glioblastoma multiforme(114;0.000132)|BRCA - Breast invasive adenocarcinoma(304;0.00105)|STAD - Stomach adenocarcinoma(196;0.00151)|KIRC - Kidney renal clear cell carcinoma(1967;0.00377)|READ - Rectum adenocarcinoma(331;0.0656)|Lung(427;0.143)														---	---	---	---
FGR	2268	broad.mit.edu	37	1	27943449	27943449	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:27943449G>A	uc001boj.2	-	5	747	c.601C>T	c.(601-603)CGC>TGC	p.R201C	FGR_uc001boi.2_5'Flank|FGR_uc001bok.2_Missense_Mutation_p.R201C|FGR_uc001bol.2_Missense_Mutation_p.R201C|FGR_uc001bom.2_Missense_Mutation_p.R201C	NM_005248	NP_005239	P09769	FGR_HUMAN	proto-oncogene tyrosine-protein kinase FGR	201	SH2.				platelet activation|response to virus	cytosol	ATP binding|non-membrane spanning protein tyrosine kinase activity			skin(2)	2		all_lung(284;2.05e-05)|Colorectal(325;3.46e-05)|Lung NSC(340;3.67e-05)|Renal(390;0.00121)|Breast(348;0.0021)|Ovarian(437;0.00503)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0381)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0416)|OV - Ovarian serous cystadenocarcinoma(117;1.25e-24)|Colorectal(126;1.24e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|BRCA - Breast invasive adenocarcinoma(304;0.00244)|KIRC - Kidney renal clear cell carcinoma(1967;0.0027)|STAD - Stomach adenocarcinoma(196;0.00303)|READ - Rectum adenocarcinoma(331;0.0419)														---	---	---	---
PUM1	9698	broad.mit.edu	37	1	31437642	31437642	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:31437642G>A	uc001bsi.1	-	14	2315	c.2202C>T	c.(2200-2202)GGC>GGT	p.G734G	PUM1_uc001bsf.1_Silent_p.G400G|PUM1_uc001bsg.1_Intron|PUM1_uc001bsh.1_Silent_p.G734G|PUM1_uc001bsj.1_Silent_p.G708G|PUM1_uc010oga.1_Silent_p.G590G|PUM1_uc001bsk.1_Silent_p.G770G|PUM1_uc010ogb.1_Silent_p.G675G	NM_014676	NP_055491	Q14671	PUM1_HUMAN	pumilio 1 isoform 2	734	Ser-rich.				cellular membrane organization|post-Golgi vesicle-mediated transport|regulation of translation	cytosol	RNA binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3		Colorectal(325;0.0211)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0308)|all_neural(195;0.0381)|Breast(348;0.0848)|Medulloblastoma(700;0.123)		STAD - Stomach adenocarcinoma(196;0.0232)|READ - Rectum adenocarcinoma(331;0.0681)														---	---	---	---
PEF1	553115	broad.mit.edu	37	1	32096305	32096305	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:32096305T>G	uc001bth.1	-	5	776	c.764A>C	c.(763-765)GAG>GCG	p.E255A	HCRTR1_uc010ogl.1_Intron|PEF1_uc001bte.1_3'UTR|PEF1_uc001btf.1_Missense_Mutation_p.E94A|PEF1_uc001btg.1_Missense_Mutation_p.E185A	NM_012392	NP_036524	Q9UBV8	PEF1_HUMAN	penta-EF-hand domain containing 1	255	EF-hand 5.|Required for interaction with PDCD6.				response to calcium ion	cytoplasm|membrane	calcium ion binding|protein heterodimerization activity				0		Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.104)|all_neural(195;0.186)		STAD - Stomach adenocarcinoma(196;0.0546)														---	---	---	---
BAI2	576	broad.mit.edu	37	1	32203939	32203939	+	Intron	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:32203939G>T	uc001btn.2	-						BAI2_uc001btm.2_5'Flank|BAI2_uc001btp.1_5'Flank|BAI2_uc010ogn.1_5'Flank|BAI2_uc010ogo.1_Intron|BAI2_uc010ogp.1_Intron|BAI2_uc010ogq.1_Intron|BAI2_uc001bto.2_Intron|BAI2_uc001btq.1_Intron	NM_001703	NP_001694			brain-specific angiogenesis inhibitor 2						negative regulation of angiogenesis|neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(5)|breast(4)|ovary(2)|central_nervous_system(1)|skin(1)	13		Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0606)|all_neural(195;0.0837)|Breast(348;0.174)		STAD - Stomach adenocarcinoma(196;0.0557)														---	---	---	---
PSMB2	5690	broad.mit.edu	37	1	36074928	36074928	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36074928C>T	uc001bzf.1	-	4	477	c.367G>A	c.(367-369)GCC>ACC	p.A123T	PSMB2_uc001bzd.1_Missense_Mutation_p.A123T|PSMB2_uc010ohz.1_Missense_Mutation_p.A98T|PSMB2_uc001bzg.1_Missense_Mutation_p.A123T	NM_002794	NP_002785	P49721	PSB2_HUMAN	proteasome beta 2 subunit	123					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|interspecies interaction between organisms|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	cytoplasm|nucleus|proteasome core complex	threonine-type endopeptidase activity				0		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)			Bortezomib(DB00188)													---	---	---	---
THRAP3	9967	broad.mit.edu	37	1	36769406	36769406	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36769406C>T	uc001cae.3	+	12	2880	c.2656C>T	c.(2656-2658)CGT>TGT	p.R886C	THRAP3_uc001caf.3_Missense_Mutation_p.R886C|C1orf113_uc010oia.1_5'Flank	NM_005119	NP_005110	Q9Y2W1	TR150_HUMAN	thyroid hormone receptor associated protein 3	886					androgen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	ATP binding|ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			ovary(5)|lung(3)|breast(1)	9		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.164)						T	USP6	aneurysmal bone cysts								---	---	---	---
GRIK3	2899	broad.mit.edu	37	1	37356650	37356650	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:37356650C>T	uc001caz.2	-	2	298	c.163G>A	c.(163-165)GCC>ACC	p.A55T	GRIK3_uc001cba.1_Missense_Mutation_p.A55T	NM_000831	NP_000822	Q13003	GRIK3_HUMAN	glutamate receptor, ionotropic, kainate 3	55	Extracellular (Potential).				negative regulation of synaptic transmission, glutamatergic|regulation of membrane potential|synaptic transmission	cell junction|dendrite cytoplasm|integral to plasma membrane|perikaryon|postsynaptic membrane|terminal button	adenylate cyclase inhibiting metabotropic glutamate receptor activity|extracellular-glutamate-gated ion channel activity|G-protein-coupled receptor binding|kainate selective glutamate receptor activity			ovary(3)|skin(2)|large_intestine(1)|breast(1)	7		Myeloproliferative disorder(586;0.0258)|all_neural(195;0.169)			L-Glutamic Acid(DB00142)													---	---	---	---
EPHA10	284656	broad.mit.edu	37	1	38227403	38227403	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:38227403G>A	uc009vvi.2	-	3	610	c.524C>T	c.(523-525)ACA>ATA	p.T175I	EPHA10_uc001cbw.3_Missense_Mutation_p.T175I	NM_001099439	NP_001092909	Q5JZY3	EPHAA_HUMAN	EPH receptor A10 isofom 3	175	Extracellular (Potential).					extracellular region|integral to membrane|integral to plasma membrane	ATP binding|ephrin receptor activity|protein binding|transmembrane-ephrin receptor activity			breast(4)|stomach(3)|lung(1)	8	Acute lymphoblastic leukemia(166;0.074)|all_hematologic(146;0.197)	Myeloproliferative disorder(586;0.0255)|all_neural(195;0.164)																---	---	---	---
IPO13	9670	broad.mit.edu	37	1	44432699	44432699	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44432699G>A	uc001ckx.2	+						IPO13_uc001cky.2_Intron	NM_014652	NP_055467			importin 13						protein import into nucleus	cytoplasm|nucleus	protein binding|protein transporter activity			central_nervous_system(1)	1	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0821)																---	---	---	---
SLC6A9	6536	broad.mit.edu	37	1	44463398	44463398	+	Missense_Mutation	SNP	G	A	A	rs146175246		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44463398G>A	uc001cll.2	-	14	2132	c.1940C>T	c.(1939-1941)GCC>GTC	p.A647V	SLC6A9_uc009vxe.2_Intron|SLC6A9_uc010okm.1_Intron|SLC6A9_uc001clm.2_Missense_Mutation_p.A593V|SLC6A9_uc009vxd.2_RNA|SLC6A9_uc010okn.1_Missense_Mutation_p.A578V|SLC6A9_uc001cln.2_Missense_Mutation_p.A574V|SLC6A9_uc010oko.1_Missense_Mutation_p.A463V	NM_201649	NP_964012	P48067	SC6A9_HUMAN	solute carrier family 6 member 9 isoform 2	647	Cytoplasmic (Potential).					integral to plasma membrane|membrane fraction	glycine:sodium symporter activity|neurotransmitter:sodium symporter activity				0	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0511)			Glycine(DB00145)													---	---	---	---
RNF220	55182	broad.mit.edu	37	1	45115605	45115605	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45115605C>T	uc001clv.1	+	14	1965	c.1605C>T	c.(1603-1605)TGC>TGT	p.C535C	RNF220_uc001clw.1_Silent_p.C535C|RNF220_uc010oky.1_Silent_p.C322C|RNF220_uc010okz.1_Silent_p.C277C|RNF220_uc001clx.1_Silent_p.C251C|RNF220_uc001cly.1_Silent_p.C215C|RNF220_uc001clz.1_Silent_p.C214C|RNF220_uc001cma.1_Silent_p.C214C|TMEM53_uc001cmb.1_Intron	NM_018150	NP_060620	Q5VTB9	RN220_HUMAN	ring finger protein 220	535	RING-type.				protein autoubiquitination	cytoplasm	ubiquitin-protein ligase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
TMEM53	79639	broad.mit.edu	37	1	45120473	45120473	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45120473G>T	uc001cmc.2	-	3	628	c.592C>A	c.(592-594)CAC>AAC	p.H198N	TMEM53_uc001cmb.1_Intron|TMEM53_uc001cmd.2_Missense_Mutation_p.H125N|TMEM53_uc009vxh.1_Missense_Mutation_p.H81N|TMEM53_uc010ola.1_Missense_Mutation_p.H81N	NM_024587	NP_078863	Q6P2H8	TMM53_HUMAN	transmembrane protein 53	198						integral to membrane				ovary(2)	2	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---
HPDL	84842	broad.mit.edu	37	1	45793585	45793585	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45793585C>T	uc001cne.2	+	1	1041	c.765C>T	c.(763-765)GGC>GGT	p.G255G		NM_032756	NP_116145	Q96IR7	HPDL_HUMAN	glyoxalase domain containing 1	255					aromatic amino acid family metabolic process		4-hydroxyphenylpyruvate dioxygenase activity|metal ion binding				0	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---
NASP	4678	broad.mit.edu	37	1	46074015	46074015	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:46074015C>T	uc001coi.1	+						NASP_uc010olq.1_Intron|NASP_uc001coh.1_Intron|NASP_uc001coj.1_Intron|NASP_uc010olr.1_Intron|NASP_uc001cok.1_Missense_Mutation_p.R361W	NM_002482	NP_002473			nuclear autoantigenic sperm protein isoform 2						blastocyst development|cell cycle|cell proliferation|DNA replication|histone exchange|protein transport	cytoplasm|nucleus	Hsp90 protein binding			ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)|Lung SC(450;0.211)																	---	---	---	---
POMGNT1	55624	broad.mit.edu	37	1	46685360	46685360	+	Intron	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:46685360C>A	uc001cpg.2	-						POMGNT1_uc001cpf.2_Intron|C1orf190_uc010oma.1_Intron	NR_024332				SubName: Full=Protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase;						protein N-linked glycosylation|protein O-linked glycosylation	Golgi membrane|integral to membrane|microsome	alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity|beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity			ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)																	---	---	---	---
SLC5A9	200010	broad.mit.edu	37	1	48698138	48698138	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:48698138G>A	uc001cro.2	+	8	1049	c.997G>A	c.(997-999)GTC>ATC	p.V333I	SLC5A9_uc010oms.1_RNA|SLC5A9_uc001crn.2_Missense_Mutation_p.V358I|SLC5A9_uc010omt.1_Missense_Mutation_p.V347I|SLC5A9_uc001crp.2_5'UTR|SLC5A9_uc010omu.1_5'UTR	NM_001011547	NP_001011547	Q2M3M2	SC5A9_HUMAN	solute carrier family 5 (sodium/glucose	333	Helical; (Potential).					integral to membrane|plasma membrane	low-affinity glucose:sodium symporter activity			ovary(3)	3																		---	---	---	---
ZFYVE9	9372	broad.mit.edu	37	1	52729433	52729433	+	Intron	SNP	C	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52729433C>G	uc001cto.2	+						ZFYVE9_uc001ctn.2_Intron|ZFYVE9_uc001ctp.2_Intron	NM_004799	NP_004790			zinc finger, FYVE domain containing 9 isoform 3						endocytosis|SMAD protein complex assembly|SMAD protein import into nucleus|transforming growth factor beta receptor signaling pathway	early endosome membrane	metal ion binding|protein binding|receptor activity|serine-type peptidase activity			ovary(2)|lung(2)|central_nervous_system(2)|skin(2)	8																		---	---	---	---
CC2D1B	200014	broad.mit.edu	37	1	52824825	52824825	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52824825G>A	uc001ctq.1	-	11	1269	c.1131C>T	c.(1129-1131)GCC>GCT	p.A377A	CC2D1B_uc001ctr.2_5'Flank|CC2D1B_uc001cts.2_Silent_p.A68A	NM_032449	NP_115825	Q5T0F9	C2D1B_HUMAN	coiled-coil and C2 domain containing 1B	377										ovary(2)	2																		---	---	---	---
ORC1L	4998	broad.mit.edu	37	1	52850933	52850933	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:52850933G>A	uc001ctt.2	-	10	1702	c.1483C>T	c.(1483-1485)CTG>TTG	p.L495L	ORC1L_uc010oni.1_Silent_p.L490L|ORC1L_uc001ctu.2_Silent_p.L495L|ORC1L_uc009vzd.2_Silent_p.L249L	NM_004153	NP_004144	Q13415	ORC1_HUMAN	origin recognition complex, subunit 1	495					cell cycle checkpoint|DNA-dependent DNA replication initiation|M/G1 transition of mitotic cell cycle|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle	cytosol|nuclear origin of replication recognition complex|nucleolus|nucleoplasm|plasma membrane	ATP binding|DNA binding|nucleoside-triphosphatase activity|protein binding				0																		---	---	---	---
C1orf175	374977	broad.mit.edu	37	1	55118746	55118746	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55118746G>A	uc010ooe.1	+	3	471	c.147G>A	c.(145-147)CTG>CTA	p.L49L	C1orf175_uc001cxq.2_RNA|C1orf175_uc001cxo.2_Silent_p.L49L|C1orf175_uc010ooc.1_Intron|C1orf175_uc001cxs.2_RNA|C1orf175_uc010ood.1_Intron|C1orf175_uc010oof.1_RNA|C1orf175_uc001cxr.1_RNA|C1orf175_uc010oog.1_Silent_p.L49L|C1orf175_uc010ooh.1_RNA|C1orf175_uc009vzq.1_RNA|C1orf175_uc001cxt.1_RNA	NM_001039464	NP_001034553	Q68CQ1	HEAT8_HUMAN	hypothetical protein LOC374977	49						integral to membrane	binding				0																		---	---	---	---
UBE2U	148581	broad.mit.edu	37	1	64671363	64671363	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:64671363G>T	uc001dbn.1	+	2	352	c.108G>T	c.(106-108)TGG>TGT	p.W36C		NM_152489	NP_689702	Q5VVX9	UBE2U_HUMAN	ubiquitin-conjugating enzyme E2U (putative)	36							ATP binding|protein binding|ubiquitin-protein ligase activity				0																		---	---	---	---
SGIP1	84251	broad.mit.edu	37	1	67207114	67207114	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67207114C>T	uc001dcr.2	+	24	2676	c.2459C>T	c.(2458-2460)GCT>GTT	p.A820V	SGIP1_uc010opd.1_Missense_Mutation_p.A420V|SGIP1_uc001dcs.2_Missense_Mutation_p.A420V|SGIP1_uc001dct.2_Missense_Mutation_p.A422V|SGIP1_uc009wat.2_Missense_Mutation_p.A614V|SGIP1_uc001dcu.2_Missense_Mutation_p.A325V	NM_032291	NP_115667	Q9BQI5	SGIP1_HUMAN	SH3-domain GRB2-like (endophilin) interacting	820					positive regulation of energy homeostasis|positive regulation of feeding behavior|positive regulation of receptor-mediated endocytosis|response to dietary excess	AP-2 adaptor complex	microtubule binding|phospholipid binding|SH3 domain binding			ovary(3)	3																		---	---	---	---
COL24A1	255631	broad.mit.edu	37	1	86307793	86307793	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86307793G>A	uc001dlj.2	-	41	3570	c.3528C>T	c.(3526-3528)GGC>GGT	p.G1176G	COL24A1_uc001dli.2_Silent_p.G312G|COL24A1_uc010osd.1_Silent_p.G476G|COL24A1_uc001dlk.2_RNA|COL24A1_uc010ose.1_RNA|COL24A1_uc010osf.1_RNA	NM_152890	NP_690850	Q17RW2	COOA1_HUMAN	collagen, type XXIV, alpha 1 precursor	1176	Collagen-like 12.				cell adhesion	collagen	extracellular matrix structural constituent			ovary(3)|central_nervous_system(1)|skin(1)	5				all cancers(265;0.0627)|Epithelial(280;0.0689)														---	---	---	---
SLC44A3	126969	broad.mit.edu	37	1	95290108	95290108	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:95290108T>C	uc001dqv.3	+	3	302	c.195T>C	c.(193-195)TAT>TAC	p.Y65Y	SLC44A3_uc001dqx.3_Silent_p.Y65Y|SLC44A3_uc010otq.1_Silent_p.Y29Y|SLC44A3_uc010otr.1_Silent_p.Y29Y|SLC44A3_uc001dqw.3_Silent_p.Y17Y|SLC44A3_uc010ots.1_Silent_p.Y17Y|SLC44A3_uc009wds.2_5'UTR|SLC44A3_uc010ott.1_Silent_p.Y17Y|SLC44A3_uc010otu.1_5'Flank	NM_001114106	NP_001107578	Q8N4M1	CTL3_HUMAN	solute carrier family 44, member 3 isoform 1	65						integral to membrane|plasma membrane	choline transmembrane transporter activity			kidney(1)	1		all_lung(203;0.000712)|Lung NSC(277;0.00316)		all cancers(265;0.039)|Epithelial(280;0.124)	Choline(DB00122)													---	---	---	---
TMEM56	148534	broad.mit.edu	37	1	95657379	95657379	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:95657379A>G	uc001drb.2	+	7	1038	c.747A>G	c.(745-747)AGA>AGG	p.R249R	RWDD3_uc001drd.3_Intron|uc001dre.1_Intron|TMEM56_uc001drc.2_Silent_p.R249R	NM_152487	NP_689700	Q96MV1	TMM56_HUMAN	transmembrane protein 56	249						integral to membrane					0		all_lung(203;0.0232)|Lung NSC(277;0.0739)		all cancers(265;0.133)														---	---	---	---
NTNG1	22854	broad.mit.edu	37	1	108023372	108023372	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:108023372C>T	uc001dvh.3	+	8	2248	c.1530C>T	c.(1528-1530)TCC>TCT	p.S510S	NTNG1_uc001dvf.3_Silent_p.S451S|NTNG1_uc010out.1_Silent_p.S476S|NTNG1_uc001dvc.3_Silent_p.S409S|NTNG1_uc001dvi.2_Missense_Mutation_p.P78L|NTNG1_uc001dve.2_RNA|NTNG1_uc009wek.2_RNA|NTNG1_uc001dvg.2_RNA|NTNG1_uc009wem.2_Nonsense_Mutation_p.R73*	NM_001113226	NP_001106697	Q9Y2I2	NTNG1_HUMAN	netrin G1 isoform 1	510					axonogenesis	anchored to plasma membrane	protein binding			large_intestine(2)|ovary(2)|skin(2)	6		all_epithelial(167;1.39e-05)|all_lung(203;0.000115)|Lung NSC(277;0.000238)|Breast(1374;0.243)		Lung(183;0.0946)|BRCA - Breast invasive adenocarcinoma(282;0.237)|Epithelial(280;0.245)														---	---	---	---
CELSR2	1952	broad.mit.edu	37	1	109792844	109792844	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109792844C>T	uc001dxa.3	+	1	204	c.143C>T	c.(142-144)TCG>TTG	p.S48L		NM_001408	NP_001399	Q9HCU4	CELR2_HUMAN	cadherin EGF LAG seven-pass G-type receptor 2	48	Extracellular (Potential).				dendrite morphogenesis|homophilic cell adhesion|neural plate anterior/posterior regionalization|neuropeptide signaling pathway|regulation of cell-cell adhesion|regulation of transcription, DNA-dependent|Wnt receptor signaling pathway	cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(4)|lung(3)|skin(1)	8		all_epithelial(167;0.000114)|all_lung(203;0.000321)|Lung NSC(277;0.000626)|Breast(1374;0.244)		Colorectal(144;0.0296)|Lung(183;0.067)|COAD - Colon adenocarcinoma(174;0.114)|Epithelial(280;0.193)|all cancers(265;0.219)														---	---	---	---
CELSR2	1952	broad.mit.edu	37	1	109810552	109810552	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109810552C>T	uc001dxa.3	+	17	6249	c.6188C>T	c.(6187-6189)ACG>ATG	p.T2063M		NM_001408	NP_001399	Q9HCU4	CELR2_HUMAN	cadherin EGF LAG seven-pass G-type receptor 2	2063	Extracellular (Potential).				dendrite morphogenesis|homophilic cell adhesion|neural plate anterior/posterior regionalization|neuropeptide signaling pathway|regulation of cell-cell adhesion|regulation of transcription, DNA-dependent|Wnt receptor signaling pathway	cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(4)|lung(3)|skin(1)	8		all_epithelial(167;0.000114)|all_lung(203;0.000321)|Lung NSC(277;0.000626)|Breast(1374;0.244)		Colorectal(144;0.0296)|Lung(183;0.067)|COAD - Colon adenocarcinoma(174;0.114)|Epithelial(280;0.193)|all cancers(265;0.219)														---	---	---	---
GPR61	83873	broad.mit.edu	37	1	110086921	110086921	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110086921T>C	uc001dxy.2	+	2	1960	c.1277T>C	c.(1276-1278)CTG>CCG	p.L426P		NM_031936	NP_114142	Q9BZJ8	GPR61_HUMAN	G protein-coupled receptor 61	426	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			central_nervous_system(2)	2		all_epithelial(167;2.83e-05)|all_lung(203;0.00016)|Lung NSC(277;0.000318)|Breast(1374;0.244)		Lung(183;0.0426)|Colorectal(144;0.11)|Epithelial(280;0.128)|all cancers(265;0.132)|LUSC - Lung squamous cell carcinoma(189;0.228)														---	---	---	---
GNAT2	2780	broad.mit.edu	37	1	110146144	110146144	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110146144C>T	uc001dya.2	-	8	1110	c.897G>A	c.(895-897)GCG>GCA	p.A299A		NM_005272	NP_005263	P19087	GNAT2_HUMAN	guanine nucleotide binding protein, alpha	299					detection of chemical stimulus involved in sensory perception of bitter taste|G-protein signaling, coupled to cAMP nucleotide second messenger|rhodopsin mediated phototransduction	heterotrimeric G-protein complex|photoreceptor inner segment|photoreceptor outer segment membrane	G-protein beta/gamma-subunit complex binding|G-protein coupled photoreceptor activity|G-protein-coupled receptor binding|GTP binding|GTPase activity				0		all_epithelial(167;2.5e-05)|all_lung(203;0.000135)|Lung NSC(277;0.000269)|Breast(1374;0.244)		Lung(183;0.0422)|Colorectal(144;0.108)|Epithelial(280;0.125)|all cancers(265;0.129)|LUSC - Lung squamous cell carcinoma(189;0.227)														---	---	---	---
HBXIP	10542	broad.mit.edu	37	1	110944145	110944145	+	Nonstop_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110944145T>C	uc001dzr.2	-	4	580	c.522A>G	c.(520-522)TGA>TGG	p.*174W		NM_006402	NP_006393	O43504	HBXIP_HUMAN	hepatitis B virus x-interacting protein	174					anti-apoptosis|negative regulation of caspase activity|response to virus|viral genome replication	cytosol	protein binding			large_intestine(1)|ovary(1)|pancreas(1)	3		all_cancers(81;4.08e-06)|all_epithelial(167;4.38e-06)|all_lung(203;0.000152)|Lung NSC(277;0.000301)		Lung(183;0.0237)|all cancers(265;0.0675)|Epithelial(280;0.0732)|Colorectal(144;0.102)|LUSC - Lung squamous cell carcinoma(189;0.134)														---	---	---	---
KCNA10	3744	broad.mit.edu	37	1	111061012	111061012	+	Missense_Mutation	SNP	C	T	T	rs150165049		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:111061012C>T	uc001dzt.1	-	1	786	c.398G>A	c.(397-399)CGG>CAG	p.R133Q		NM_005549	NP_005540	Q16322	KCA10_HUMAN	potassium voltage-gated channel, shaker-related	133						voltage-gated potassium channel complex	intracellular cyclic nucleotide activated cation channel activity|voltage-gated potassium channel activity			ovary(3)|large_intestine(1)	4		all_cancers(81;4.57e-06)|all_epithelial(167;1.52e-05)|all_lung(203;0.000152)|Lung NSC(277;0.000301)		Lung(183;0.0238)|all cancers(265;0.0874)|Colorectal(144;0.103)|Epithelial(280;0.116)|LUSC - Lung squamous cell carcinoma(189;0.134)														---	---	---	---
CSDE1	7812	broad.mit.edu	37	1	115263163	115263163	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:115263163A>T	uc001efk.2	-	17	2515	c.2049T>A	c.(2047-2049)GAT>GAA	p.D683E	CSDE1_uc001efi.2_Missense_Mutation_p.D729E|CSDE1_uc001efj.2_RNA|CSDE1_uc001efl.2_Missense_Mutation_p.D652E|CSDE1_uc001efm.2_Missense_Mutation_p.D698E|CSDE1_uc009wgv.2_Missense_Mutation_p.D683E|CSDE1_uc001efn.2_Missense_Mutation_p.D652E	NM_001007553	NP_001007554	O75534	CSDE1_HUMAN	upstream of NRAS isoform 1	683	CSD 9.				male gonad development|regulation of transcription, DNA-dependent	cytoplasm	DNA binding|protein binding|RNA binding			ovary(1)	1	all_epithelial(7;5.11e-05)|all_lung(7;0.000179)|Lung NSC(6;0.00195)|Lung SC(450;0.211)	all_cancers(81;2.21e-07)|all_epithelial(167;4.2e-07)|all_lung(203;9.97e-06)|Lung NSC(69;1.74e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|all cancers(265;0.112)|Epithelial(280;0.124)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
ATP1A1	476	broad.mit.edu	37	1	116926744	116926744	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:116926744A>G	uc001ege.2	+	2	460	c.121A>G	c.(121-123)ATG>GTG	p.M41V	ATP1A1_uc010owv.1_Missense_Mutation_p.M10V|ATP1A1_uc001egd.2_Missense_Mutation_p.M41V|ATP1A1_uc010oww.1_Missense_Mutation_p.M41V|ATP1A1_uc010owx.1_Missense_Mutation_p.M10V	NM_000701	NP_000692	P05023	AT1A1_HUMAN	Na+/K+ -ATPase alpha 1 subunit isoform a	41	Cytoplasmic (Potential).				ATP biosynthetic process	melanosome|sodium:potassium-exchanging ATPase complex	ATP binding|metal ion binding|protein binding|sodium:potassium-exchanging ATPase activity			ovary(1)	1	Lung SC(450;0.225)	all_cancers(81;1.28e-06)|all_epithelial(167;3.48e-07)|all_lung(203;2.64e-06)|Lung NSC(69;1.98e-05)		Lung(183;0.0164)|LUSC - Lung squamous cell carcinoma(189;0.0548)|Colorectal(144;0.0825)|COAD - Colon adenocarcinoma(174;0.127)|all cancers(265;0.24)	Acetyldigitoxin(DB00511)|Almitrine(DB01430)|Aluminium(DB01370)|Bepridil(DB01244)|Bretylium(DB01158)|Captopril(DB01197)|Deslanoside(DB01078)|Diazoxide(DB01119)|Digitoxin(DB01396)|Digoxin(DB00390)|Esomeprazole(DB00736)|Ethacrynic acid(DB00903)|Furosemide(DB00695)|Hydroflumethiazide(DB00774)|Methyclothiazide(DB00232)|Ouabain(DB01092)|Pantoprazole(DB00213)|Trichlormethiazide(DB01021)													---	---	---	---
FMO5	2330	broad.mit.edu	37	1	146680415	146680415	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:146680415T>C	uc001epi.2	-	6	1218	c.829A>G	c.(829-831)AGA>GGA	p.R277G	FMO5_uc001eph.3_Missense_Mutation_p.R277G|FMO5_uc001epj.2_Missense_Mutation_p.R277G|FMO5_uc001epk.3_Missense_Mutation_p.R277G	NM_001461	NP_001452	P49326	FMO5_HUMAN	flavin containing monooxygenase 5 isoform 1	277						integral to membrane|intrinsic to endoplasmic reticulum membrane|microsome	flavin adenine dinucleotide binding|flavin-containing monooxygenase activity|NADP binding			ovary(3)	3	all_hematologic(923;0.0487)																	---	---	---	---
ADAMTSL4	54507	broad.mit.edu	37	1	150531071	150531071	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150531071C>A	uc001eux.2	+	15	2741	c.2505C>A	c.(2503-2505)GCC>GCA	p.A835A	ADAMTSL4_uc001euw.2_Silent_p.A835A|ADAMTSL4_uc009wlw.2_Silent_p.A858A|ADAMTSL4_uc010pcg.1_Silent_p.A796A|ADAMTSL4_uc009wlx.2_Translation_Start_Site	NM_019032	NP_061905	Q6UY14	ATL4_HUMAN	thrombospondin repeat containing 1 isoform 1	835	TSP type-1 3.				apoptosis|positive regulation of apoptosis		metalloendopeptidase activity|protease binding			ovary(1)|skin(1)	2	all_cancers(9;3.13e-53)|all_epithelial(9;3.74e-43)|all_lung(15;2.43e-34)|Lung NSC(24;8.86e-31)|Breast(34;0.000326)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Melanoma(130;0.128)|Colorectal(459;0.171)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0241)|Epithelial(6;3.18e-23)|all cancers(9;1.79e-22)|OV - Ovarian serous cystadenocarcinoma(6;1.13e-14)|BRCA - Breast invasive adenocarcinoma(12;0.000503)|LUSC - Lung squamous cell carcinoma(543;0.171)|STAD - Stomach adenocarcinoma(528;0.206)															---	---	---	---
PRUNE	58497	broad.mit.edu	37	1	150990325	150990325	+	Missense_Mutation	SNP	C	T	T	rs141143258		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150990325C>T	uc001ewh.1	+	2	213	c.77C>T	c.(76-78)GCC>GTC	p.A26V	PRUNE_uc001ewi.1_5'UTR|PRUNE_uc010pco.1_5'UTR|PRUNE_uc001ewj.1_5'UTR	NM_021222	NP_067045	Q86TP1	PRUNE_HUMAN	prune	26						cytoplasm|focal adhesion|nucleus	inorganic diphosphatase activity|manganese ion binding|protein binding			ovary(1)	1	all_lung(15;1.09e-34)|Lung NSC(24;1.1e-30)|Lung SC(34;0.00202)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.0997)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0486)|LUSC - Lung squamous cell carcinoma(543;0.211)															---	---	---	---
TCHH	7062	broad.mit.edu	37	1	152082655	152082655	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152082655C>T	uc001ezp.2	-	2	3038	c.3038G>A	c.(3037-3039)CGC>CAC	p.R1013H	TCHH_uc009wne.1_Missense_Mutation_p.R1013H	NM_007113	NP_009044	Q07283	TRHY_HUMAN	trichohyalin	1013	10 X 30 AA tandem repeats.|4-4.				keratinization	cytoskeleton	calcium ion binding			ovary(3)|kidney(1)|central_nervous_system(1)	5	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)															---	---	---	---
FLG	2312	broad.mit.edu	37	1	152283237	152283237	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152283237G>A	uc001ezu.1	-	3	4161	c.4125C>T	c.(4123-4125)CAC>CAT	p.H1375H	uc001ezv.2_5'Flank	NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	1375	Ser-rich.|Filaggrin 8.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)											Ichthyosis				---	---	---	---
FLG	2312	broad.mit.edu	37	1	152286331	152286331	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152286331G>A	uc001ezu.1	-	3	1067	c.1031C>T	c.(1030-1032)GCC>GTC	p.A344V	uc001ezv.2_RNA	NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	344	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)											Ichthyosis				---	---	---	---
LCE5A	254910	broad.mit.edu	37	1	152484105	152484105	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152484105G>A	uc001ezy.2	+	2	271	c.95G>A	c.(94-96)TGT>TAT	p.C32Y	CRCT1_uc001ezz.2_5'Flank	NM_178438	NP_848525	Q5TCM9	LCE5A_HUMAN	late cornified envelope 5A	32	Cys-rich.				keratinization					ovary(1)	1	Hepatocellular(266;0.0877)|all_hematologic(923;0.127)|Melanoma(130;0.242)		LUSC - Lung squamous cell carcinoma(543;0.206)															---	---	---	---
INTS3	65123	broad.mit.edu	37	1	153732007	153732007	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153732007T>C	uc009wom.2	+	12	1376	c.1155T>C	c.(1153-1155)AAT>AAC	p.N385N	INTS3_uc001fct.2_Silent_p.N385N|INTS3_uc001fcu.2_Silent_p.N77N|INTS3_uc001fcv.2_Silent_p.N179N|INTS3_uc010peb.1_Silent_p.N179N|INTS3_uc001fcw.2_5'UTR|INTS3_uc010pec.1_Intron	NM_023015	NP_075391	Q68E01	INT3_HUMAN	integrator complex subunit 3	386					DNA repair|G2/M transition checkpoint|response to ionizing radiation|snRNA processing	integrator complex|SOSS complex	protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	all_lung(78;3.75e-32)|Lung NSC(65;1.37e-30)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.151)															---	---	---	---
DENND4B	9909	broad.mit.edu	37	1	153915482	153915482	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153915482G>A	uc001fdd.1	-	3	843	c.442C>T	c.(442-444)CGG>TGG	p.R148W		NM_014856	NP_055671	O75064	DEN4B_HUMAN	DENN/MADD domain containing 4B	148	MABP.									ovary(1)	1	all_lung(78;2.89e-32)|Lung NSC(65;2.27e-30)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.151)															---	---	---	---
IL6R	3570	broad.mit.edu	37	1	154408549	154408549	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154408549C>T	uc001fez.1	+	6	1349	c.912C>T	c.(910-912)AGC>AGT	p.S304S	IL6R_uc001ffa.1_Silent_p.S304S	NM_000565	NP_000556	P08887	IL6RA_HUMAN	interleukin 6 receptor isoform 1 precursor	304	Fibronectin type-III.|Extracellular (Potential).|WSXWS motif.				acute-phase response|ciliary neurotrophic factor-mediated signaling pathway|defense response to Gram-negative bacterium|defense response to Gram-positive bacterium|endocrine pancreas development|hepatic immune response|negative regulation of collagen biosynthetic process|negative regulation of interleukin-8 production|positive regulation of activation of Janus kinase activity|positive regulation of anti-apoptosis|positive regulation of chemokine production|positive regulation of chemokine production|positive regulation of interleukin-6 production|positive regulation of leukocyte chemotaxis|positive regulation of MAPKKK cascade|positive regulation of osteoblast differentiation|positive regulation of smooth muscle cell proliferation|positive regulation of tyrosine phosphorylation of Stat3 protein|regulation of apoptosis	apical plasma membrane|basolateral plasma membrane|extracellular space|interleukin-6 receptor complex	ciliary neurotrophic factor binding|enzyme binding|protein homodimerization activity			ovary(3)|breast(1)	4	all_lung(78;1.72e-29)|Lung NSC(65;2.96e-27)|Hepatocellular(266;0.0877)		LUSC - Lung squamous cell carcinoma(543;0.185)															---	---	---	---
FLAD1	80308	broad.mit.edu	37	1	154960591	154960591	+	Missense_Mutation	SNP	A	G	G	rs145148009		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154960591A>G	uc001fgf.1	+	2	737	c.383A>G	c.(382-384)CAG>CGG	p.Q128R	FLAD1_uc001fgc.2_Missense_Mutation_p.Q29R|FLAD1_uc001fgd.1_Missense_Mutation_p.Q128R|FLAD1_uc001fge.1_Missense_Mutation_p.Q31R|FLAD1_uc001fgg.1_Missense_Mutation_p.Q31R|FLAD1_uc001fgh.1_5'UTR	NM_025207	NP_079483	Q8NFF5	FAD1_HUMAN	flavin adenine dinucleotide synthetase isoform	128	Molybdenum cofactor biosynthesis protein- like.				FAD biosynthetic process|Mo-molybdopterin cofactor biosynthetic process|water-soluble vitamin metabolic process	cytosol	ATP binding|FMN adenylyltransferase activity			ovary(2)|skin(1)	3	all_epithelial(22;2.77e-30)|all_lung(78;4.1e-28)|all_hematologic(923;0.0359)|Hepatocellular(266;0.0877)		BRCA - Breast invasive adenocarcinoma(34;0.00034)															---	---	---	---
FDPS	2224	broad.mit.edu	37	1	155287966	155287966	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155287966G>A	uc001fkc.2	+	6	787	c.568G>A	c.(568-570)GTG>ATG	p.V190M	RAG1AP1_uc010pey.1_Intron|FDPS_uc001fkd.2_Missense_Mutation_p.V124M|FDPS_uc001fke.2_Missense_Mutation_p.V190M|FDPS_uc001fkf.2_Missense_Mutation_p.V124M|C1orf104_uc001fkh.1_Intron|RUSC1_uc001fkj.2_5'Flank|RUSC1_uc001fkk.2_5'Flank	NM_002004	NP_001995	P14324	FPPS_HUMAN	farnesyl diphosphate synthase isoform a	190					cholesterol biosynthetic process|interspecies interaction between organisms|isoprenoid biosynthetic process	cytosol|nucleus	dimethylallyltranstransferase activity|geranyltranstransferase activity|metal ion binding				0	Hepatocellular(266;0.0877)|all_hematologic(923;0.145)		Epithelial(20;2.03e-10)|all cancers(21;5.23e-10)|BRCA - Breast invasive adenocarcinoma(34;0.000549)|LUSC - Lung squamous cell carcinoma(543;0.127)		Alendronate(DB00630)|Ibandronate(DB00710)|Pamidronate(DB00282)|Risedronate(DB00884)|Zoledronate(DB00399)													---	---	---	---
UBQLN4	56893	broad.mit.edu	37	1	156020296	156020296	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156020296G>A	uc001fna.2	-	4	551	c.527C>T	c.(526-528)GCC>GTC	p.A176V	UBQLN4_uc010pgx.1_Missense_Mutation_p.A156V	NM_020131	NP_064516	Q9NRR5	UBQL4_HUMAN	ataxin-1 ubiquitin-like interacting protein	176						cytosol|endoplasmic reticulum membrane|nucleus	identical protein binding			pancreas(1)|skin(1)	2	Hepatocellular(266;0.133)|all_neural(408;0.195)																	---	---	---	---
SH2D2A	9047	broad.mit.edu	37	1	156779442	156779442	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156779442C>T	uc001fqd.2	-						SH2D2A_uc001fqc.1_Intron|SH2D2A_uc009wsh.2_Intron|SH2D2A_uc001fqe.2_Intron|SH2D2A_uc010phs.1_Intron	NM_003975	NP_003966			SH2 domain protein 2A isoform 2						angiogenesis|cell differentiation|signal transduction	cytoplasm|soluble fraction	SH3 domain binding|SH3/SH2 adaptor activity				0	all_hematologic(923;0.0839)|Hepatocellular(266;0.158)																	---	---	---	---
OR10X1	128367	broad.mit.edu	37	1	158548958	158548958	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158548958G>T	uc010pin.1	-	1	732	c.732C>A	c.(730-732)ATC>ATA	p.I244I		NM_001004477	NP_001004477	Q8NGY0	O10X1_HUMAN	olfactory receptor, family 10, subfamily X,	244	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_hematologic(112;0.0378)																	---	---	---	---
OR10J5	127385	broad.mit.edu	37	1	159505535	159505535	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:159505535T>C	uc010piw.1	-	1	263	c.263A>G	c.(262-264)CAT>CGT	p.H88R		NM_001004469	NP_001004469	Q8NHC4	O10J5_HUMAN	olfactory receptor, family 10, subfamily J,	88	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)	3	all_hematologic(112;0.0429)																	---	---	---	---
KCNJ10	3766	broad.mit.edu	37	1	160011433	160011433	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160011433C>T	uc001fuw.1	-	2	1040	c.890G>A	c.(889-891)CGC>CAC	p.R297H		NM_002241	NP_002232	P78508	IRK10_HUMAN	potassium inwardly-rectifying channel, subfamily	297	Cytoplasmic (By similarity).		R -> C (in SESAME).			integral to plasma membrane	ATP binding|ATP-activated inward rectifier potassium channel activity			ovary(1)	1	all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.111)															---	---	---	---
IGSF8	93185	broad.mit.edu	37	1	160064939	160064939	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160064939A>G	uc001fva.2	-	2	207	c.162T>C	c.(160-162)TAT>TAC	p.Y54Y	IGSF8_uc001fuz.2_Silent_p.Y54Y|IGSF8_uc009wtf.2_Silent_p.Y54Y	NM_052868	NP_443100	Q969P0	IGSF8_HUMAN	immunoglobulin superfamily, member 8	54	Ig-like C2-type 1.|Extracellular (Potential).				cell proliferation|cellular component movement|nervous system development|single fertilization|skeletal muscle tissue development	integral to membrane	protein binding				0	all_cancers(52;1.11e-16)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.111)|LUSC - Lung squamous cell carcinoma(543;0.246)															---	---	---	---
ATP1A4	480	broad.mit.edu	37	1	160146362	160146362	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160146362C>T	uc001fve.3	+	17	3039	c.2560C>T	c.(2560-2562)CGT>TGT	p.R854C	ATP1A4_uc001fvf.3_Intron|ATP1A4_uc001fvg.2_Missense_Mutation_p.R357C|ATP1A4_uc001fvh.2_5'Flank	NM_144699	NP_653300	Q13733	AT1A4_HUMAN	Na+/K+ -ATPase alpha 4 subunit isoform 1	854	Helical; (Potential).				ATP biosynthetic process|ATP hydrolysis coupled proton transport|regulation of cellular pH|sperm motility	sodium:potassium-exchanging ATPase complex	ATP binding|metal ion binding|sodium:potassium-exchanging ATPase activity			ovary(2)|skin(2)	4	all_cancers(52;2.56e-18)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.111)															---	---	---	---
SLAMF7	57823	broad.mit.edu	37	1	160722026	160722026	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160722026A>G	uc001fwq.2	+	6	939	c.924A>G	c.(922-924)GAA>GAG	p.E308E	SLAMF7_uc010pjn.1_Silent_p.E214E|SLAMF7_uc001fws.2_Silent_p.E201E|SLAMF7_uc001fwr.2_Missense_Mutation_p.N274D|SLAMF7_uc010pjo.1_Silent_p.E177E|SLAMF7_uc010pjp.1_Silent_p.E161E|SLAMF7_uc010pjq.1_Missense_Mutation_p.N143D|SLAMF7_uc010pjr.1_Missense_Mutation_p.N127D	NM_021181	NP_067004	Q9NQ25	SLAF7_HUMAN	SLAM family member 7	308	Cytoplasmic (Potential).				cell adhesion|natural killer cell activation|natural killer cell mediated cytotoxicity	integral to membrane	receptor activity			skin(2)|ovary(1)	3	all_cancers(52;2.63e-17)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.0175)															---	---	---	---
LY9	4063	broad.mit.edu	37	1	160769735	160769735	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160769735G>A	uc001fwu.2	+	2	367	c.317G>A	c.(316-318)CGA>CAA	p.R106Q	LY9_uc001fwt.2_Missense_Mutation_p.R106Q|LY9_uc010pjs.1_Missense_Mutation_p.R106Q|LY9_uc001fwv.2_Missense_Mutation_p.R106Q|LY9_uc001fww.2_Missense_Mutation_p.R106Q|LY9_uc001fwx.2_Missense_Mutation_p.R106Q|LY9_uc001fwy.1_Missense_Mutation_p.R8Q	NM_002348	NP_002339	Q9HBG7	LY9_HUMAN	lymphocyte antigen 9 isoform a	106	Extracellular (Potential).|Ig-like V-type 1.				cell adhesion|immunoglobulin mediated immune response	integral to membrane				ovary(1)	1	all_cancers(52;2.72e-17)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00737)															---	---	---	---
NDUFS2	4720	broad.mit.edu	37	1	161183934	161183934	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161183934C>T	uc001fyv.2	+						NDUFS2_uc001fyw.2_3'UTR|NDUFS2_uc010pkj.1_3'UTR|NDUFS2_uc001fyx.2_Intron|FCER1G_uc001fyz.1_5'Flank|FCER1G_uc001fza.1_5'Flank	NM_004550	NP_004541			NADH dehydrogenase (ubiquinone) Fe-S protein 2						mitochondrial electron transport, NADH to ubiquinone|response to oxidative stress|transport	mitochondrial respiratory chain complex I	4 iron, 4 sulfur cluster binding|electron carrier activity|metal ion binding|NAD binding|NADH dehydrogenase (ubiquinone) activity|protein binding|quinone binding			skin(1)	1	all_cancers(52;1.16e-17)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00376)		NADH(DB00157)													---	---	---	---
OLFML2B	25903	broad.mit.edu	37	1	161989766	161989766	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161989766G>T	uc001gbu.2	-	2	805	c.381C>A	c.(379-381)CCC>CCA	p.P127P	OLFML2B_uc010pkq.1_Silent_p.P127P	NM_015441	NP_056256	Q68BL8	OLM2B_HUMAN	olfactomedin-like 2B precursor	127										skin(1)	1	all_hematologic(112;0.156)		BRCA - Breast invasive adenocarcinoma(70;0.0172)															---	---	---	---
C1orf111	284680	broad.mit.edu	37	1	162343898	162343898	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:162343898G>T	uc001gbx.2	-	3	790	c.726C>A	c.(724-726)GCC>GCA	p.A242A		NM_182581	NP_872387	Q5T0L3	CA111_HUMAN	hypothetical protein LOC284680	242										ovary(1)	1	all_hematologic(112;0.15)		BRCA - Breast invasive adenocarcinoma(70;0.0938)															---	---	---	---
SLC19A2	10560	broad.mit.edu	37	1	169446628	169446628	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169446628T>C	uc001gge.3	-	2	776	c.572A>G	c.(571-573)AAT>AGT	p.N191S	SLC19A2_uc001ggf.3_Intron	NM_006996	NP_008927	O60779	S19A2_HUMAN	solute carrier family 19, member 2	191	Extracellular (Potential).				thiamine-containing compound metabolic process	integral to membrane|plasma membrane	folic acid binding|folic acid transporter activity|reduced folate carrier activity|thiamine uptake transmembrane transporter activity				0	all_hematologic(923;0.208)																	---	---	---	---
SELP	6403	broad.mit.edu	37	1	169560682	169560682	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169560682C>A	uc001ggi.3	-	15	2485	c.2420G>T	c.(2419-2421)TGC>TTC	p.C807F	SELP_uc001ggh.2_Missense_Mutation_p.C602F|SELP_uc009wvr.2_Missense_Mutation_p.C806F	NM_003005	NP_002996	P16109	LYAM3_HUMAN	selectin P precursor	807	Cytoplasmic (Potential).				platelet activation|platelet degranulation|positive regulation of platelet activation	external side of plasma membrane|extracellular space|integral to plasma membrane|membrane fraction|platelet alpha granule membrane|platelet dense granule membrane|soluble fraction	fucose binding|glycosphingolipid binding|heparin binding|lipopolysaccharide binding|oligosaccharide binding|sialic acid binding			ovary(2)|skin(2)	4	all_hematologic(923;0.208)				Clopidogrel(DB00758)|Heparin(DB01109)|Tirofiban(DB00775)													---	---	---	---
GORAB	92344	broad.mit.edu	37	1	170508634	170508634	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:170508634C>A	uc001gha.2	+	2	447	c.420C>A	c.(418-420)TCC>TCA	p.S140S	GORAB_uc009wvw.2_3'UTR|GORAB_uc001ggz.3_Silent_p.S140S|GORAB_uc009wvx.2_5'UTR|GORAB_uc001ghb.2_5'UTR|GORAB_uc001ghc.2_5'UTR	NM_152281	NP_689494	Q5T7V8	GORAB_HUMAN	golgin, RAB6-interacting isoform a	140						Golgi apparatus|nucleus					0																		---	---	---	---
PRRX1	5396	broad.mit.edu	37	1	170633439	170633439	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:170633439C>T	uc001ghf.2	+	1	127	c.80C>T	c.(79-81)ACC>ATC	p.T27I	PRRX1_uc001ghe.2_Missense_Mutation_p.T27I	NM_022716	NP_073207	P54821	PRRX1_HUMAN	paired mesoderm homeobox 1 isoform pmx-1b	27						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity			ovary(1)	1	all_hematologic(923;0.0922)|Acute lymphoblastic leukemia(37;0.181)																	---	---	---	---
C1orf129	80133	broad.mit.edu	37	1	170965795	170965795	+	Intron	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:170965795G>T	uc001ghg.2	+						C1orf129_uc009wvy.2_Intron|C1orf129_uc010plz.1_Intron	NM_025063	NP_079339			hypothetical protein LOC80133 isoform 2								binding			pancreas(1)	1	all_hematologic(923;0.0922)|Acute lymphoblastic leukemia(37;0.181)																	---	---	---	---
TNR	7143	broad.mit.edu	37	1	175331848	175331848	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:175331848G>A	uc001gkp.1	-	12	2886	c.2805C>T	c.(2803-2805)AGC>AGT	p.S935S	TNR_uc009wwu.1_Silent_p.S935S	NM_003285	NP_003276	Q92752	TENR_HUMAN	tenascin R precursor	935	Fibronectin type-III 7.				axon guidance|cell adhesion|signal transduction	proteinaceous extracellular matrix				pancreas(5)|ovary(4)|central_nervous_system(1)|skin(1)	11	Renal(580;0.146)																	---	---	---	---
PAPPA2	60676	broad.mit.edu	37	1	176564398	176564398	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:176564398C>T	uc001gkz.2	+	3	2822	c.1658C>T	c.(1657-1659)GCA>GTA	p.A553V	PAPPA2_uc001gky.1_Missense_Mutation_p.A553V|PAPPA2_uc009www.2_RNA	NM_020318	NP_064714	Q9BXP8	PAPP2_HUMAN	pappalysin 2 isoform 1	553	Metalloprotease.				cell differentiation|proteolysis|regulation of cell growth	extracellular region|intracellular|membrane	metalloendopeptidase activity|zinc ion binding			ovary(7)|central_nervous_system(5)|skin(2)|lung(1)|breast(1)	16																		---	---	---	---
CACNA1E	777	broad.mit.edu	37	1	181706711	181706711	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:181706711G>A	uc001gow.2	+	23	3638	c.3473G>A	c.(3472-3474)TGC>TAC	p.C1158Y	CACNA1E_uc009wxs.2_Missense_Mutation_p.C1046Y|CACNA1E_uc001gox.1_Missense_Mutation_p.C384Y|CACNA1E_uc009wxt.2_Missense_Mutation_p.C384Y	NM_000721	NP_000712	Q15878	CAC1E_HUMAN	calcium channel, voltage-dependent, R type,	1158	III.|Helical; Name=S1 of repeat III.				energy reserve metabolic process|membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	voltage-gated calcium channel activity			ovary(3)|central_nervous_system(2)|pancreas(1)	6																		---	---	---	---
C1orf14	81626	broad.mit.edu	37	1	182908622	182908622	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:182908622A>G	uc001gpu.2	-	4	1122	c.837T>C	c.(835-837)CTT>CTC	p.L279L	C1orf14_uc001gpv.2_Silent_p.L160L|C1orf14_uc010pnz.1_Silent_p.L137L|C1orf14_uc001gpw.2_5'UTR	NM_030933	NP_112195	Q9BZQ2	SHP1L_HUMAN	chromosome 1 open reading frame 14	351											0				Colorectal(1306;1.64e-07)|KIRC - Kidney renal clear cell carcinoma(1967;0.00267)														---	---	---	---
LAMC2	3918	broad.mit.edu	37	1	183190045	183190045	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183190045C>T	uc001gqa.2	+	5	903	c.589C>T	c.(589-591)CGC>TGC	p.R197C	LAMC2_uc001gpz.3_Missense_Mutation_p.R197C|LAMC2_uc010poa.1_5'UTR	NM_005562	NP_005553	Q13753	LAMC2_HUMAN	laminin, gamma 2 isoform a precursor	197					cell adhesion|epidermis development|hemidesmosome assembly		heparin binding			skin(2)|ovary(1)	3																		---	---	---	---
LAMC2	3918	broad.mit.edu	37	1	183206601	183206601	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183206601G>A	uc001gqa.2	+	18	3030	c.2716G>A	c.(2716-2718)GCA>ACA	p.A906T	LAMC2_uc001gpz.3_Missense_Mutation_p.A906T|LAMC2_uc010poa.1_Missense_Mutation_p.A606T	NM_005562	NP_005553	Q13753	LAMC2_HUMAN	laminin, gamma 2 isoform a precursor	906	Potential.|Domain II and I.				cell adhesion|epidermis development|hemidesmosome assembly		heparin binding			skin(2)|ovary(1)	3																		---	---	---	---
RGL1	23179	broad.mit.edu	37	1	183775631	183775631	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183775631T>C	uc001gqo.2	+						RGL1_uc010pof.1_Intron|RGL1_uc001gqm.2_Intron|RGL1_uc010pog.1_Intron|RGL1_uc010poh.1_Intron|RGL1_uc010poi.1_Intron	NM_015149	NP_055964			ral guanine nucleotide dissociation						cellular lipid metabolic process|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	intracellular	protein binding|Ral guanyl-nucleotide exchange factor activity			breast(5)|ovary(4)|lung(2)	11																		---	---	---	---
RGL1	23179	broad.mit.edu	37	1	183861220	183861220	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183861220G>A	uc001gqo.2	+	9	1222	c.1065G>A	c.(1063-1065)ATG>ATA	p.M355I	RGL1_uc010pof.1_Missense_Mutation_p.M160I|RGL1_uc001gqm.2_Missense_Mutation_p.M390I|RGL1_uc010pog.1_Missense_Mutation_p.M353I|RGL1_uc010poh.1_Missense_Mutation_p.M353I|RGL1_uc010poi.1_Missense_Mutation_p.M355I	NM_015149	NP_055964	Q9NZL6	RGL1_HUMAN	ral guanine nucleotide dissociation	355	Ras-GEF.				cellular lipid metabolic process|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	intracellular	protein binding|Ral guanyl-nucleotide exchange factor activity			breast(5)|ovary(4)|lung(2)	11																		---	---	---	---
HMCN1	83872	broad.mit.edu	37	1	186037087	186037087	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186037087G>A	uc001grq.1	+	50	8056	c.7827G>A	c.(7825-7827)TGG>TGA	p.W2609*		NM_031935	NP_114141	Q96RW7	HMCN1_HUMAN	hemicentin 1 precursor	2609	Ig-like C2-type 24.				response to stimulus|visual perception	basement membrane	calcium ion binding			ovary(22)|skin(1)	23																		---	---	---	---
PRG4	10216	broad.mit.edu	37	1	186277106	186277106	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186277106C>T	uc001gru.3	+	7	2306	c.2255C>T	c.(2254-2256)ACT>ATT	p.T752I	PRG4_uc001grt.3_Missense_Mutation_p.T711I|PRG4_uc009wyl.2_Missense_Mutation_p.T659I|PRG4_uc009wym.2_Missense_Mutation_p.T618I|PRG4_uc010poo.1_Intron	NM_005807	NP_005798	Q92954	PRG4_HUMAN	proteoglycan 4 isoform A	752	59 X 8 AA repeats of K-X-P-X-P-T-T-X.|47; approximate.				cell proliferation|immune response	extracellular region	polysaccharide binding|protein binding|scavenger receptor activity			skin(1)	1																		---	---	---	---
RGS1	5996	broad.mit.edu	37	1	192545020	192545020	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:192545020T>G	uc001gsi.1	+	1	164	c.98T>G	c.(97-99)CTT>CGT	p.L33R	RGS1_uc010pou.1_Missense_Mutation_p.L33R	NM_002922	NP_002913	Q08116	RGS1_HUMAN	regulator of G-protein signalling 1	33					immune response|inhibition of adenylate cyclase activity by G-protein signaling pathway|negative regulation of signal transduction	cytoplasm|plasma membrane	calmodulin binding|GTPase activator activity|signal transducer activity				0		Breast(1374;0.188)																---	---	---	---
B3GALT2	8707	broad.mit.edu	37	1	193149798	193149798	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:193149798G>A	uc001gtc.3	-	2	1610	c.895C>T	c.(895-897)CCA>TCA	p.P299S	CDC73_uc001gtb.2_Intron	NM_003783	NP_003774	O43825	B3GT2_HUMAN	UDP-Gal:betaGlcNAc beta	299	Lumenal (Potential).				protein glycosylation	Golgi membrane|integral to membrane	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity			ovary(1)	1																		---	---	---	---
C1orf106	55765	broad.mit.edu	37	1	200880697	200880697	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200880697C>T	uc001gvo.2	+	9	1361	c.1331C>T	c.(1330-1332)CCG>CTG	p.P444L	C1orf106_uc010ppm.1_Missense_Mutation_p.P359L	NM_018265	NP_060735	Q3KP66	CA106_HUMAN	hypothetical protein LOC55765 isoform 1	444										skin(2)|ovary(1)	3																		---	---	---	---
CACNA1S	779	broad.mit.edu	37	1	201039450	201039450	+	Silent	SNP	G	A	A	rs113659687	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201039450G>A	uc001gvv.2	-	17	2537	c.2310C>T	c.(2308-2310)GCC>GCT	p.A770A		NM_000069	NP_000060	Q13698	CAC1S_HUMAN	calcium channel, voltage-dependent, L type,	770	Cytoplasmic (Potential).				axon guidance	I band|T-tubule|voltage-gated calcium channel complex	high voltage-gated calcium channel activity			ovary(3)|central_nervous_system(1)|skin(1)	5					Magnesium Sulfate(DB00653)|Verapamil(DB00661)													---	---	---	---
PKP1	5317	broad.mit.edu	37	1	201291200	201291200	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201291200G>A	uc001gwd.2	+	9	1756	c.1505G>A	c.(1504-1506)CGC>CAC	p.R502H	PKP1_uc001gwe.2_Missense_Mutation_p.R481H|PKP1_uc009wzm.2_Missense_Mutation_p.R89H	NM_000299	NP_000290	Q13835	PKP1_HUMAN	plakophilin 1 isoform 1b	502					cell adhesion|cellular component disassembly involved in apoptosis|multicellular organismal development	desmosome|intermediate filament|nucleus	intermediate filament binding|signal transducer activity|structural constituent of epidermis			ovary(2)	2																		---	---	---	---
IPO9	55705	broad.mit.edu	37	1	201844361	201844361	+	Intron	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201844361G>T	uc001gwz.2	+							NM_018085	NP_060555			importin 9						protein import into nucleus	cytoplasm|nucleus	histone binding|protein transporter activity			ovary(2)	2																		---	---	---	---
ELF3	1999	broad.mit.edu	37	1	201984366	201984366	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201984366G>T	uc001gxg.3	+	8	4223	c.1031G>T	c.(1030-1032)CGG>CTG	p.R344L	ELF3_uc001gxi.3_Missense_Mutation_p.R344L|ELF3_uc001gxh.3_Missense_Mutation_p.R344L	NM_004433	NP_004424	P78545	ELF3_HUMAN	E74-like factor 3 (ets domain transcription	344	ETS.				epidermis development|epithelial cell differentiation|inflammatory response|mammary gland involution|negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	Golgi apparatus|nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity				0																		---	---	---	---
MYBPH	4608	broad.mit.edu	37	1	203138136	203138136	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:203138136G>T	uc001gzh.1	-	9	1374	c.1315C>A	c.(1315-1317)CTA>ATA	p.L439I	FMOD_uc010pqi.1_Intron	NM_004997	NP_004988	Q13203	MYBPH_HUMAN	myosin binding protein H	439	Ig-like C2-type 2.				cell adhesion|regulation of striated muscle contraction	myosin filament	structural constituent of muscle				0			BRCA - Breast invasive adenocarcinoma(75;0.153)	Colorectal(1306;0.0306)														---	---	---	---
PLEKHA6	22874	broad.mit.edu	37	1	204214839	204214839	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:204214839G>A	uc001hau.2	-	14	2253	c.1936C>T	c.(1936-1938)CGG>TGG	p.R646W	PLEKHA6_uc009xau.1_5'Flank|PLEKHA6_uc009xav.1_5'Flank	NM_014935	NP_055750	Q9Y2H5	PKHA6_HUMAN	phosphoinositol 3-phosphate-binding protein-3	646										ovary(3)|pancreas(1)	4	all_cancers(21;0.0222)|Breast(84;0.179)		KIRC - Kidney renal clear cell carcinoma(13;0.0584)|BRCA - Breast invasive adenocarcinoma(75;0.0833)|Kidney(21;0.0934)|Epithelial(59;0.229)															---	---	---	---
PIK3C2B	5287	broad.mit.edu	37	1	204438816	204438816	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:204438816G>T	uc001haw.2	-	3	594	c.115C>A	c.(115-117)CGG>AGG	p.R39R	PIK3C2B_uc010pqv.1_Silent_p.R39R|PIK3C2B_uc001hax.1_Silent_p.R39R|PIK3C2B_uc009xbd.1_RNA	NM_002646	NP_002637	O00750	P3C2B_HUMAN	phosphoinositide-3-kinase, class 2 beta	39	Interaction with GRB2.				cell communication|phosphatidylinositol-mediated signaling	endoplasmic reticulum|microsome|nucleus|phosphatidylinositol 3-kinase complex|plasma membrane	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol binding|phosphatidylinositol-4-phosphate 3-kinase activity|protein binding			lung(2)|breast(2)|stomach(1)|prostate(1)|central_nervous_system(1)	7	all_cancers(21;0.00347)|all_neural(3;0.0218)|Glioma(3;0.0382)|all_epithelial(62;0.171)|Breast(84;0.179)|Prostate(682;0.227)		GBM - Glioblastoma multiforme(2;2.69e-45)|all cancers(3;1.66e-30)|KIRC - Kidney renal clear cell carcinoma(13;0.0584)|Kidney(21;0.0934)|BRCA - Breast invasive adenocarcinoma(75;0.143)|Epithelial(59;0.193)															---	---	---	---
PIGR	5284	broad.mit.edu	37	1	207107960	207107960	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207107960G>A	uc001hez.2	-	6	1694	c.1510C>T	c.(1510-1512)CAG>TAG	p.Q504*	PIGR_uc009xbz.2_Nonsense_Mutation_p.Q504*	NM_002644	NP_002635	P01833	PIGR_HUMAN	polymeric immunoglobulin receptor precursor	504	Ig-like V-type 5.|Extracellular (Potential).					extracellular region|integral to plasma membrane	protein binding			ovary(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
PLXNA2	5362	broad.mit.edu	37	1	208218053	208218053	+	Missense_Mutation	SNP	G	A	A	rs140111660		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:208218053G>A	uc001hgz.2	-	20	4432	c.3674C>T	c.(3673-3675)TCG>TTG	p.S1225L		NM_025179	NP_079455	O75051	PLXA2_HUMAN	plexin A2 precursor	1225	IPT/TIG 4.|Extracellular (Potential).				axon guidance	integral to membrane|intracellular|plasma membrane				ovary(2)|central_nervous_system(1)	3				OV - Ovarian serous cystadenocarcinoma(81;0.199)														---	---	---	---
USH2A	7399	broad.mit.edu	37	1	216052336	216052336	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216052336T>C	uc001hku.1	-	42	8715	c.8328A>G	c.(8326-8328)TTA>TTG	p.L2776L		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	2776	Fibronectin type-III 14.|Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)											HNSCC(13;0.011)			---	---	---	---
MIA3	375056	broad.mit.edu	37	1	222828037	222828037	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222828037A>C	uc001hnl.2	+	18	4518	c.4509A>C	c.(4507-4509)CAA>CAC	p.Q1503H	MIA3_uc001hnm.2_Missense_Mutation_p.Q381H	NM_198551	NP_940953	Q5JRA6	MIA3_HUMAN	melanoma inhibitory activity family, member 3	1503	Cytoplasmic (Potential).|Potential.				exocytosis|negative regulation of cell adhesion|negative regulation of cell migration|positive regulation of leukocyte migration|protein transport|wound healing	endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(4)|central_nervous_system(1)	5				GBM - Glioblastoma multiforme(131;0.0199)														---	---	---	---
TLR5	7100	broad.mit.edu	37	1	223285360	223285360	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223285360G>A	uc001hnv.1	-	4	1460	c.1014C>T	c.(1012-1014)CTC>CTT	p.L338L	TLR5_uc001hnw.1_Silent_p.L338L	NM_003268	NP_003259	O60602	TLR5_HUMAN	toll-like receptor 5 precursor	338	Extracellular (Potential).|LRR 7.				cellular response to mechanical stimulus|inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway|positive regulation of interleukin-8 production|positive regulation of toll-like receptor signaling pathway	integral to membrane|plasma membrane	interleukin-1 receptor binding|transmembrane receptor activity			ovary(2)|lung(1)|skin(1)	4				GBM - Glioblastoma multiforme(131;0.0851)														---	---	---	---
LBR	3930	broad.mit.edu	37	1	225591105	225591105	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:225591105C>T	uc001hoy.2	-	14	1891	c.1748G>A	c.(1747-1749)CGA>CAA	p.R583Q	LBR_uc001hoz.2_Missense_Mutation_p.R583Q	NM_002296	NP_002287	Q14739	LBR_HUMAN	lamin B receptor	583					cholesterol biosynthetic process	integral to nuclear inner membrane	chromo shadow domain binding|delta14-sterol reductase activity|DNA binding|lamin binding|receptor activity			ovary(1)|skin(1)	2	Breast(184;0.165)			GBM - Glioblastoma multiforme(131;0.117)														---	---	---	---
TMEM63A	9725	broad.mit.edu	37	1	226044616	226044616	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:226044616C>T	uc001hpm.1	-	16	1729	c.1479G>A	c.(1477-1479)TGG>TGA	p.W493*		NM_014698	NP_055513	O94886	TM63A_HUMAN	transmembrane protein 63A	493						integral to membrane|lysosomal membrane	nucleotide binding			ovary(1)|breast(1)	2	Breast(184;0.197)																	---	---	---	---
OBSCN	84033	broad.mit.edu	37	1	228444500	228444500	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228444500G>A	uc009xez.1	+	15	4502	c.4458G>A	c.(4456-4458)TCG>TCA	p.S1486S	OBSCN_uc001hsn.2_Silent_p.S1486S	NM_001098623	NP_001092093	Q5VST9	OBSCN_HUMAN	obscurin, cytoskeletal calmodulin and	1486	Ig-like 15.				apoptosis|cell differentiation|induction of apoptosis by extracellular signals|multicellular organismal development|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|M band|Z disc	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity|Rho guanyl-nucleotide exchange factor activity|structural constituent of muscle|titin binding			stomach(8)|large_intestine(7)|breast(5)|ovary(4)|skin(2)|central_nervous_system(1)|pancreas(1)	28		Prostate(94;0.0405)																---	---	---	---
OBSCN	84033	broad.mit.edu	37	1	228538569	228538569	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228538569G>A	uc009xez.1	+	77	18388	c.18344G>A	c.(18343-18345)CGG>CAG	p.R6115Q	OBSCN_uc001hsn.2_Missense_Mutation_p.R6115Q|OBSCN_uc001hsr.1_Missense_Mutation_p.R744Q|OBSCN_uc009xfa.2_5'Flank	NM_001098623	NP_001092093	Q5VST9	OBSCN_HUMAN	obscurin, cytoskeletal calmodulin and	6115	Ig-like 53.			R -> L (in Ref. 1; CAC44768).	apoptosis|cell differentiation|induction of apoptosis by extracellular signals|multicellular organismal development|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|M band|Z disc	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity|Rho guanyl-nucleotide exchange factor activity|structural constituent of muscle|titin binding			stomach(8)|large_intestine(7)|breast(5)|ovary(4)|skin(2)|central_nervous_system(1)|pancreas(1)	28		Prostate(94;0.0405)																---	---	---	---
GALNT2	2590	broad.mit.edu	37	1	230372168	230372168	+	Splice_Site	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:230372168T>C	uc010pwa.1	+	5	613	c.541_splice	c.e5+2	p.P181_splice	GALNT2_uc010pvy.1_Splice_Site_p.P143_splice|GALNT2_uc010pvz.1_Splice_Site	NM_004481	NP_004472			polypeptide N-acetylgalactosaminyltransferase 2						immunoglobulin biosynthetic process|protein O-linked glycosylation via serine|protein O-linked glycosylation via threonine	extracellular region|Golgi cisterna membrane|integral to Golgi membrane|perinuclear region of cytoplasm	manganese ion binding|polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			ovary(2)	2	Breast(184;0.193)|Ovarian(103;0.249)	all_cancers(173;0.156)|Prostate(94;0.179)																---	---	---	---
HEATR1	55127	broad.mit.edu	37	1	236715409	236715409	+	Splice_Site	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236715409T>C	uc001hyd.1	-	44	6363	c.6238_splice	c.e44-1	p.V2080_splice	HEATR1_uc009xgh.1_Splice_Site_p.V1242_splice	NM_018072	NP_060542			protein BAP28						rRNA processing	nucleolus|ribonucleoprotein complex	protein binding			ovary(2)|skin(1)	3	Ovarian(103;0.0634)|Breast(184;0.133)	all_cancers(173;0.0255)|Prostate(94;0.175)	OV - Ovarian serous cystadenocarcinoma(106;0.00117)															---	---	---	---
OPN3	23596	broad.mit.edu	37	1	241767854	241767854	+	Missense_Mutation	SNP	A	G	G	rs117720055	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:241767854A>G	uc001hza.2	-	2	546	c.401T>C	c.(400-402)GTG>GCG	p.V134A	OPN3_uc001hzb.2_RNA|OPN3_uc001hzc.2_Intron	NM_014322	NP_055137	Q9H1Y3	OPN3_HUMAN	opsin 3	134	Helical; Name=3; (Potential).				phototransduction|protein-chromophore linkage|regulation of circadian rhythm|visual perception	integral to plasma membrane	G-protein coupled photoreceptor activity				0	Ovarian(103;0.103)|all_lung(81;0.23)	all_cancers(173;0.0231)	OV - Ovarian serous cystadenocarcinoma(106;0.0125)															---	---	---	---
ZNF692	55657	broad.mit.edu	37	1	249150585	249150585	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:249150585T>C	uc001ifc.1	-	6	728	c.561A>G	c.(559-561)CCA>CCG	p.P187P	ZNF692_uc001iez.1_5'Flank|ZNF692_uc001ifa.1_5'UTR|ZNF692_uc001ifb.1_5'UTR|ZNF692_uc001ifd.1_Silent_p.P187P|ZNF692_uc001ife.1_RNA|ZNF692_uc001iff.1_Intron|ZNF692_uc010pzr.1_Silent_p.P192P	NM_017865	NP_060335	Q9BU19	ZN692_HUMAN	zinc finger protein 692 isoform 2	187					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(71;3.33e-06)|all_epithelial(71;2.41e-06)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.0458)|Lung NSC(105;0.0494)|Melanoma(84;0.199)	all_cancers(173;0.19)	OV - Ovarian serous cystadenocarcinoma(106;0.00805)															---	---	---	---
TPO	7173	broad.mit.edu	37	2	1497702	1497702	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1497702G>A	uc002qww.2	+	11	1988	c.1897G>A	c.(1897-1899)GAT>AAT	p.D633N	TPO_uc010ewj.2_RNA|TPO_uc002qwu.2_Missense_Mutation_p.D576N|TPO_uc002qwr.2_Missense_Mutation_p.D633N|TPO_uc002qwx.2_Missense_Mutation_p.D576N|TPO_uc010yio.1_Missense_Mutation_p.D460N|TPO_uc010yip.1_Missense_Mutation_p.D633N|TPO_uc002qwy.1_5'UTR|TPO_uc002qwz.2_RNA	NM_000547	NP_000538	P07202	PERT_HUMAN	thyroid peroxidase isoform a	633	Extracellular (Potential).				cellular nitrogen compound metabolic process|hormone biosynthetic process|hydrogen peroxide catabolic process	cell surface|cytoplasm|integral to plasma membrane	calcium ion binding|heme binding|iodide peroxidase activity			ovary(7)|pancreas(6)|skin(5)|lung(1)|kidney(1)	20	all_hematologic(175;0.0487)|Acute lymphoblastic leukemia(172;0.0627)	all_cancers(51;0.0338)		all cancers(51;0.0356)|OV - Ovarian serous cystadenocarcinoma(76;0.0748)|Epithelial(75;0.12)	Carbimazole(DB00389)|Methimazole(DB00763)|Propylthiouracil(DB00550)													---	---	---	---
ASAP2	8853	broad.mit.edu	37	2	9463245	9463245	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:9463245C>T	uc002qzh.2	+						ASAP2_uc002qzi.2_Intron	NM_003887	NP_003878			ArfGAP with SH3 domain, ankyrin repeat and PH						regulation of ARF GTPase activity	Golgi cisterna membrane|plasma membrane	ARF GTPase activator activity|protein binding|zinc ion binding				0																		---	---	---	---
ASAP2	8853	broad.mit.edu	37	2	9531313	9531313	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:9531313G>A	uc002qzh.2	+	23	2846	c.2506G>A	c.(2506-2508)GTG>ATG	p.V836M	ASAP2_uc002qzi.2_Intron	NM_003887	NP_003878	O43150	ASAP2_HUMAN	ArfGAP with SH3 domain, ankyrin repeat and PH	836	Pro-rich.				regulation of ARF GTPase activity	Golgi cisterna membrane|plasma membrane	ARF GTPase activator activity|protein binding|zinc ion binding				0																		---	---	---	---
ITGB1BP1	9270	broad.mit.edu	37	2	9558782	9558782	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:9558782T>A	uc002qzj.2	-	2	222	c.45A>T	c.(43-45)CAA>CAT	p.Q15H	ITGB1BP1_uc002qzk.2_Missense_Mutation_p.Q15H|ITGB1BP1_uc002qzl.2_RNA|ITGB1BP1_uc002qzm.2_RNA|ITGB1BP1_uc010yiy.1_Intron|ITGB1BP1_uc002qzn.1_Missense_Mutation_p.Q15H	NM_004763	NP_004754	O14713	ITBP1_HUMAN	integrin cytoplasmic domain-associated protein 1	15	Ser/Thr-rich.				cell migration|cell-matrix adhesion|intracellular protein kinase cascade	cytosol|lamellipodium|membrane|ruffle	protein binding|protein binding				0	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.23)														---	---	---	---
NCOA1	8648	broad.mit.edu	37	2	24930579	24930579	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:24930579A>G	uc002rfk.2	+	11	2498	c.2240A>G	c.(2239-2241)CAG>CGG	p.Q747R	NCOA1_uc010eye.2_Missense_Mutation_p.Q747R|NCOA1_uc002rfi.2_Missense_Mutation_p.Q596R|NCOA1_uc002rfj.2_Missense_Mutation_p.Q747R|NCOA1_uc002rfl.2_Missense_Mutation_p.Q747R	NM_003743	NP_003734	Q15788	NCOA1_HUMAN	nuclear receptor coactivator 1 isoform 1	747									PAX3/NCOA1(8)	soft_tissue(8)|ovary(1)|lung(1)|skin(1)	11	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)							T	PAX3	alveolar rhadomyosarcoma								---	---	---	---
OTOF	9381	broad.mit.edu	37	2	26750774	26750774	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:26750774C>T	uc002rhk.2	-	3	280	c.153G>A	c.(151-153)CCG>CCA	p.P51P		NM_194248	NP_919224	Q9HC10	OTOF_HUMAN	otoferlin isoform a	51	Cytoplasmic (Potential).				cellular membrane fusion|sensory perception of sound|synaptic vesicle exocytosis	basolateral plasma membrane|cell junction|cytosol|endoplasmic reticulum membrane|integral to membrane|membrane fraction|synaptic vesicle membrane	calcium ion binding			ovary(3)|breast(2)|central_nervous_system(1)|pancreas(1)	7	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---
IFT172	26160	broad.mit.edu	37	2	27672361	27672361	+	Intron	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27672361C>A	uc002rku.2	-						IFT172_uc010ezb.2_Intron	NM_015662	NP_056477			selective LIM binding factor homolog						cilium assembly	cilium	binding			large_intestine(1)|ovary(1)	2	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
FNDC4	64838	broad.mit.edu	37	2	27716887	27716887	+	Missense_Mutation	SNP	C	T	T	rs1046558		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27716887C>T	uc002rkx.2	-	4	770	c.364G>A	c.(364-366)GGC>AGC	p.G122S	GCKR_uc002rky.2_5'Flank|GCKR_uc010ezd.2_5'Flank|GCKR_uc010ylu.1_5'Flank	NM_022823	NP_073734	Q9H6D8	FNDC4_HUMAN	fibronectin type III domain containing 4	122	Extracellular (Potential).|Fibronectin type-III.					integral to membrane					0	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
GCKR	2646	broad.mit.edu	37	2	27730607	27730607	+	Silent	SNP	G	A	A	rs149406755	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27730607G>A	uc002rky.2	+	14	1269	c.1203G>A	c.(1201-1203)ACG>ACA	p.T401T	GCKR_uc010ezd.2_Silent_p.T399T|GCKR_uc010ylu.1_Silent_p.T211T	NM_001486	NP_001477	Q14397	GCKR_HUMAN	glucokinase regulatory protein	401	SIS 2.				carbohydrate metabolic process|glucose transport|negative regulation of glucokinase activity|positive regulation of gene expression|protein import into nucleus, translocation|regulation of glucose transport|response to fructose stimulus|transmembrane transport|triglyceride homeostasis|urate metabolic process	cytosol|nucleoplasm	fructose-6-phosphate binding|protein binding			ovary(2)	2	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
EHD3	30845	broad.mit.edu	37	2	31467249	31467249	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:31467249G>A	uc002rnu.2	+	2	945	c.337G>A	c.(337-339)GCC>ACC	p.A113T	EHD3_uc010ymt.1_Missense_Mutation_p.A113T	NM_014600	NP_055415	Q9NZN3	EHD3_HUMAN	EH-domain containing 3	113					blood coagulation|endocytic recycling|protein homooligomerization	nucleus|plasma membrane|recycling endosome membrane	ATP binding|calcium ion binding|GTP binding|GTPase activity|nucleic acid binding|protein binding			skin(2)	2	Acute lymphoblastic leukemia(172;0.155)																	---	---	---	---
NLRC4	58484	broad.mit.edu	37	2	32466128	32466128	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32466128A>G	uc002roi.2	-	5	2570	c.2324T>C	c.(2323-2325)ATG>ACG	p.M775T	NLRC4_uc002roj.1_Missense_Mutation_p.M775T|NLRC4_uc010ezt.1_Missense_Mutation_p.M110T	NM_021209	NP_067032	Q9NPP4	NLRC4_HUMAN	caspase recruitment domain protein 12	775	LRR 6.				activation of caspase activity|defense response to bacterium|detection of bacterium|interleukin-1 beta secretion|positive regulation of apoptosis	cytoplasm	ATP binding|magnesium ion binding|protein homodimerization activity			ovary(3)|large_intestine(1)|lung(1)|skin(1)	6	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.208)																	---	---	---	---
SIX3	6496	broad.mit.edu	37	2	45169609	45169609	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:45169609C>T	uc002run.1	+	1	573	c.366C>T	c.(364-366)TGC>TGT	p.C122C		NM_005413	NP_005404	O95343	SIX3_HUMAN	SIX homeobox 3	122					visual perception	nucleus					0		all_hematologic(82;0.151)|Acute lymphoblastic leukemia(82;0.175)																---	---	---	---
FBXO11	80204	broad.mit.edu	37	2	48035330	48035330	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48035330T>C	uc010fbl.2	-	23	2573	c.2459A>G	c.(2458-2460)GAG>GGG	p.E820G	FBXO11_uc002rwe.2_Missense_Mutation_p.E820G|FBXO11_uc010fbk.2_Missense_Mutation_p.E328G	NM_025133	NP_079409	Q86XK2	FBX11_HUMAN	F-box only protein 11 isoform 1	904	UBR-type.				ubiquitin-dependent protein catabolic process	cytoplasm|nucleolus|ubiquitin ligase complex	protein binding|protein-arginine N-methyltransferase activity|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|lung(1)	2		Acute lymphoblastic leukemia(82;0.0299)|all_hematologic(82;0.0358)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)															---	---	---	---
NRXN1	9378	broad.mit.edu	37	2	50318473	50318473	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:50318473G>A	uc010fbp.2	-	3	1408	c.601C>T	c.(601-603)CGC>TGC	p.R201C	NRXN1_uc002rxb.3_Missense_Mutation_p.R908C|NRXN1_uc010fbq.2_Missense_Mutation_p.R1276C|NRXN1_uc002rxe.3_Missense_Mutation_p.R1236C	NM_138735	NP_620072	P58400	NRX1B_HUMAN	neurexin 1 isoform beta precursor	201	Extracellular (Potential).|Laminin G-like.				angiogenesis|neuron cell-cell adhesion|neuronal signal transduction	cell surface|endocytic vesicle|integral to membrane|presynaptic membrane	cell adhesion molecule binding|receptor binding			ovary(2)	2		all_hematologic(82;0.152)|Acute lymphoblastic leukemia(82;0.192)	Lung(47;0.0813)|LUSC - Lung squamous cell carcinoma(58;0.116)															---	---	---	---
CCT4	10575	broad.mit.edu	37	2	62099382	62099382	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:62099382T>C	uc002sbo.2	-	12	1475	c.1326A>G	c.(1324-1326)ACA>ACG	p.T442T	CCT4_uc010ypp.1_Silent_p.T386T|CCT4_uc010ypq.1_Silent_p.T292T|CCT4_uc010ypr.1_Silent_p.T386T|CCT4_uc010yps.1_Silent_p.T412T	NM_006430	NP_006421	P50991	TCPD_HUMAN	chaperonin containing TCP1, subunit 4 (delta)	442					'de novo' posttranslational protein folding	melanosome|microtubule organizing center|nucleus	ATP binding|unfolded protein binding			ovary(2)	2	Lung NSC(7;0.035)|all_lung(7;0.0691)		LUSC - Lung squamous cell carcinoma(7;6.5e-06)|Epithelial(17;0.0647)|all cancers(80;0.221)															---	---	---	---
EHBP1	23301	broad.mit.edu	37	2	63169987	63169987	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:63169987T>C	uc002sby.2	+	12	1907	c.1425T>C	c.(1423-1425)GGT>GGC	p.G475G	EHBP1_uc010fcp.2_Silent_p.G440G|EHBP1_uc002sbz.2_Silent_p.G440G|EHBP1_uc002scb.2_Silent_p.G440G	NM_015252	NP_056067	Q8NDI1	EHBP1_HUMAN	EH domain binding protein 1 isoform 1	475	CH.					cytoplasm|membrane				ovary(1)|breast(1)	2	Lung NSC(7;0.0951)|all_lung(7;0.169)		LUSC - Lung squamous cell carcinoma(7;7.74e-05)|Epithelial(17;0.189)											Hereditary_Prostate_Cancer				---	---	---	---
PNO1	56902	broad.mit.edu	37	2	68385209	68385209	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:68385209A>T	uc002seh.2	+	1	205	c.143A>T	c.(142-144)GAC>GTC	p.D48V	WDR92_uc002sed.1_5'Flank|WDR92_uc002see.1_5'Flank|WDR92_uc002sef.1_5'Flank|WDR92_uc002seg.1_5'Flank	NM_020143	NP_064528	Q9NRX1	PNO1_HUMAN	partner of NOB1	48						nucleolus	RNA binding				0																		---	---	---	---
SFXN5	94097	broad.mit.edu	37	2	73268057	73268057	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73268057G>A	uc002siq.2	-	3	306	c.175C>T	c.(175-177)CGT>TGT	p.R59C	SFXN5_uc002sio.2_Translation_Start_Site|SFXN5_uc010yrc.1_Translation_Start_Site|SFXN5_uc002sip.2_RNA|SFXN5_uc010fet.2_Missense_Mutation_p.R59C	NM_144579	NP_653180	Q8TD22	SFXN5_HUMAN	sideroflexin 5	59					iron ion homeostasis	integral to membrane	cation transmembrane transporter activity			ovary(1)	1																		---	---	---	---
SLC4A5	57835	broad.mit.edu	37	2	74475528	74475528	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74475528C>T	uc002sko.1	-	13	1741	c.1739G>A	c.(1738-1740)AGC>AAC	p.S580N	SLC4A5_uc002skl.2_RNA|SLC4A5_uc002skn.2_Missense_Mutation_p.S580N|SLC4A5_uc010ffc.1_Missense_Mutation_p.S580N|SLC4A5_uc002skp.1_Missense_Mutation_p.S516N|SLC4A5_uc002sks.1_Missense_Mutation_p.S580N	NM_021196	NP_067019	Q9BY07	S4A5_HUMAN	sodium bicarbonate transporter 4 isoform a	580	Helical; (Potential).					apical plasma membrane|integral to membrane	inorganic anion exchanger activity|sodium:bicarbonate symporter activity			ovary(5)|skin(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	9																		---	---	---	---
MOGS	7841	broad.mit.edu	37	2	74689928	74689928	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74689928T>C	uc010ffj.2	-	4	1151	c.988A>G	c.(988-990)ATT>GTT	p.I330V	MOGS_uc010ffh.2_Missense_Mutation_p.I55V|MOGS_uc010yrt.1_Missense_Mutation_p.I211V|MOGS_uc010ffi.2_Missense_Mutation_p.I224V	NM_006302	NP_006293	Q13724	MOGS_HUMAN	mannosyl-oligosaccharide glucosidase isoform 1	330	Lumenal (Potential).			I -> F (in Ref. 1; CAA60683).	oligosaccharide metabolic process|post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine	endoplasmic reticulum membrane|integral to membrane|membrane fraction	mannosyl-oligosaccharide glucosidase activity				0																		---	---	---	---
LOXL3	84695	broad.mit.edu	37	2	74779707	74779707	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74779707G>A	uc002smp.1	-	2	127	c.55C>T	c.(55-57)CTG>TTG	p.L19L	LOXL3_uc002smo.1_5'Flank|LOXL3_uc010ffm.1_Silent_p.L19L|LOXL3_uc002smq.1_Silent_p.L19L|LOXL3_uc010ffn.1_Silent_p.L19L|DOK1_uc002smr.2_Intron|DOK1_uc002sms.2_5'Flank|DOK1_uc010ffo.2_5'Flank|DOK1_uc002smt.2_5'Flank|DOK1_uc002smu.2_5'Flank|DOK1_uc010yrz.1_5'Flank|DOK1_uc002smv.2_5'Flank|DOK1_uc002smw.1_5'Flank	NM_032603	NP_115992	P58215	LOXL3_HUMAN	lysyl oxidase-like 3 precursor	19						extracellular space|membrane	copper ion binding|protein-lysine 6-oxidase activity|scavenger receptor activity				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	2	89265997	89265997	+	RNA	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:89265997G>A	uc010ytr.1	-	95		c.7569C>T			uc002stl.2_Intron					Parts of antibodies, mostly variable regions.																														---	---	---	---
Unknown	0	broad.mit.edu	37	2	89309669	89309669	+	RNA	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:89309669T>G	uc010ytr.1	-	74		c.6678A>C			uc002stl.2_Intron					Parts of antibodies, mostly variable regions.																														---	---	---	---
Unknown	0	broad.mit.edu	37	2	89309670	89309670	+	RNA	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:89309670A>C	uc010ytr.1	-	74		c.6677T>G			uc002stl.2_Intron					Parts of antibodies, mostly variable regions.																														---	---	---	---
ZNF2	7549	broad.mit.edu	37	2	95847751	95847751	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:95847751C>T	uc002suf.2	+	6	1637	c.1175C>T	c.(1174-1176)ACG>ATG	p.T392M	ZNF2_uc002sug.2_Missense_Mutation_p.T350M|ZNF2_uc010yue.1_Missense_Mutation_p.T355M|ZNF2_uc010fhs.2_Missense_Mutation_p.T313M	NM_021088	NP_066574	Q9BSG1	ZNF2_HUMAN	zinc finger protein 2 isoform a	392					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Ovarian(717;0.00768)		READ - Rectum adenocarcinoma(193;0.0222)														---	---	---	---
CNNM3	26505	broad.mit.edu	37	2	97498336	97498336	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:97498336C>T	uc002swy.2	+	8	2131	c.2107C>T	c.(2107-2109)CGG>TGG	p.R703W	CNNM3_uc002swz.2_Missense_Mutation_p.R655W	NM_017623	NP_060093	Q8NE01	CNNM3_HUMAN	cyclin M3 isoform 1	703					ion transport	integral to membrane|plasma membrane	protein binding			ovary(1)	1																		---	---	---	---
VWA3B	200403	broad.mit.edu	37	2	98844745	98844745	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:98844745G>T	uc002syo.2	+	15	2364	c.2100G>T	c.(2098-2100)GAG>GAT	p.E700D	VWA3B_uc002syj.2_RNA|VWA3B_uc002syk.1_RNA|VWA3B_uc002syl.1_Missense_Mutation_p.E219D|VWA3B_uc002sym.2_Missense_Mutation_p.E700D|VWA3B_uc002syn.1_RNA|VWA3B_uc010yvi.1_Missense_Mutation_p.E357D|VWA3B_uc002syp.1_Missense_Mutation_p.E92D|VWA3B_uc002syq.1_Intron|VWA3B_uc002syr.1_Missense_Mutation_p.E17D	NM_144992	NP_659429	Q502W6	VWA3B_HUMAN	von Willebrand factor A domain containing 3B	700										ovary(3)|large_intestine(2)|skin(1)	6																		---	---	---	---
IL18R1	8809	broad.mit.edu	37	2	102998141	102998141	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:102998141A>G	uc002tbw.3	+	6	837	c.687A>G	c.(685-687)TTA>TTG	p.L229L	IL18R1_uc010ywc.1_Silent_p.L229L|IL18R1_uc010ywd.1_Silent_p.L74L|IL18R1_uc010fiy.2_Silent_p.L229L	NM_003855	NP_003846	Q13478	IL18R_HUMAN	interleukin 18 receptor 1 precursor	229	Ig-like C2-type 3.|Extracellular (Potential).				innate immune response	integral to membrane|plasma membrane	interleukin-1 receptor activity			ovary(2)|pancreas(1)	3																		---	---	---	---
RANBP2	5903	broad.mit.edu	37	2	109367742	109367742	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:109367742T>C	uc002tem.3	+	10	1422	c.1296T>C	c.(1294-1296)GGT>GGC	p.G432G		NM_006267	NP_006258	P49792	RBP2_HUMAN	RAN binding protein 2	432					carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA transport|protein folding|protein import into nucleus|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|nuclear pore	peptidyl-prolyl cis-trans isomerase activity|Ran GTPase binding|zinc ion binding		RANBP2/ALK(16)	soft_tissue(16)|lung(1)|pancreas(1)	18																		---	---	---	---
ANAPC1	64682	broad.mit.edu	37	2	112608394	112608394	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:112608394T>C	uc002thi.2	-	14	1856	c.1609A>G	c.(1609-1611)ACT>GCT	p.T537A		NM_022662	NP_073153	Q9H1A4	APC1_HUMAN	anaphase promoting complex subunit 1	537					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell division|mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|cytosol|nucleoplasm				skin(2)	2																		---	---	---	---
ANAPC1	64682	broad.mit.edu	37	2	112608407	112608407	+	Silent	SNP	T	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:112608407T>A	uc002thi.2	-	14	1843	c.1596A>T	c.(1594-1596)CTA>CTT	p.L532L		NM_022662	NP_073153	Q9H1A4	APC1_HUMAN	anaphase promoting complex subunit 1	532					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell division|mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|cytosol|nucleoplasm				skin(2)	2																		---	---	---	---
IL1B	3553	broad.mit.edu	37	2	113591101	113591101	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:113591101G>A	uc002tii.1	-	4	238	c.151C>T	c.(151-153)CGA>TGA	p.R51*	IL1B_uc002tih.1_Nonsense_Mutation_p.R20*	NM_000576	NP_000567	P01584	IL1B_HUMAN	interleukin 1, beta proprotein	51					activation of MAPK activity|anti-apoptosis|apoptosis|cell-cell signaling|cellular response to drug|cellular response to mechanical stimulus|cytokine-mediated signaling pathway|embryo implantation|fever generation|negative regulation of adiponectin secretion|negative regulation of cell proliferation|negative regulation of glucose transport|negative regulation of insulin receptor signaling pathway|negative regulation of lipid catabolic process|negative regulation of MAP kinase activity|positive regulation of angiogenesis|positive regulation of calcidiol 1-monooxygenase activity|positive regulation of cell adhesion molecule production|positive regulation of cell division|positive regulation of fever generation|positive regulation of granulocyte macrophage colony-stimulating factor production|positive regulation of heterotypic cell-cell adhesion|positive regulation of histone acetylation|positive regulation of histone phosphorylation|positive regulation of interferon-gamma production|positive regulation of interleukin-2 biosynthetic process|positive regulation of interleukin-6 production|positive regulation of interleukin-8 production|positive regulation of lipid catabolic process|positive regulation of membrane protein ectodomain proteolysis|positive regulation of mitosis|positive regulation of monocyte chemotactic protein-1 production|positive regulation of myosin light chain kinase activity|positive regulation of NF-kappaB import into nucleus|positive regulation of NF-kappaB transcription factor activity|positive regulation of nitric oxide biosynthetic process|positive regulation of prostaglandin secretion|positive regulation of protein export from nucleus|positive regulation of T cell proliferation|positive regulation vascular endothelial growth factor production|regulation of insulin secretion|sequestering of triglyceride|smooth muscle adaptation	cytosol|extracellular space	cytokine activity|growth factor activity|interleukin-1 receptor binding|protein domain specific binding			lung(3)|breast(1)	4					Anakinra(DB00026)|Minocycline(DB01017)|Procaterol(DB01366)													---	---	---	---
MYO7B	4648	broad.mit.edu	37	2	128322852	128322852	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128322852G>A	uc002top.2	+	4	230	c.177G>A	c.(175-177)ATG>ATA	p.M59I		NM_001080527	NP_001073996	Q6PIF6	MYO7B_HUMAN	myosin VIIB	59						apical plasma membrane|myosin complex	actin binding|ATP binding|motor activity			ovary(1)|pancreas(1)	2	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.0753)														---	---	---	---
TUBA3D	113457	broad.mit.edu	37	2	132240260	132240260	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:132240260A>G	uc002tsu.3	+	5	1299	c.1192A>G	c.(1192-1194)ATG>GTG	p.M398V		NM_080386	NP_525125	Q13748	TBA3C_HUMAN	tubulin, alpha 3d	398					'de novo' posttranslational protein folding|microtubule-based movement|protein polymerization	cytoplasm|microtubule	GTP binding|GTPase activity|protein binding|structural molecule activity				0				BRCA - Breast invasive adenocarcinoma(221;0.13)														---	---	---	---
CCDC74A	90557	broad.mit.edu	37	2	132285712	132285712	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:132285712C>A	uc002tta.2	+	1	221	c.169C>A	c.(169-171)CTG>ATG	p.L57M	CCDC74A_uc010fnb.1_Missense_Mutation_p.L57M|CCDC74A_uc002ttb.2_Missense_Mutation_p.L57M	NM_138770	NP_620125	Q96AQ1	CC74A_HUMAN	coiled-coil domain containing 74A	57	Potential.									skin(1)	1																		---	---	---	---
LYPD1	116372	broad.mit.edu	37	2	133403742	133403742	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:133403742C>T	uc002ttn.2	-	3	1278	c.302G>A	c.(301-303)TGC>TAC	p.C101Y	GPR39_uc002ttl.2_3'UTR|LYPD1_uc002ttm.3_Missense_Mutation_p.C117Y|LYPD1_uc002tto.2_Missense_Mutation_p.C49Y	NM_144586	NP_653187	Q8N2G4	LYPD1_HUMAN	LY6/PLAUR domain containing 1 isoform a	101	UPAR/Ly6.					anchored to membrane|plasma membrane					0																		---	---	---	---
KIF5C	3800	broad.mit.edu	37	2	149864536	149864536	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:149864536C>A	uc010zbu.1	+	23	2873	c.2505C>A	c.(2503-2505)TCC>TCA	p.S835S	KIF5C_uc002tws.1_RNA|KIF5C_uc002twu.1_Silent_p.S117S	NM_004522	NP_004513	O60282	KIF5C_HUMAN	kinesin family member 5C	835					microtubule-based movement|organelle organization	cytoplasm|kinesin complex|microtubule	ATP binding|microtubule motor activity			skin(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.108)														---	---	---	---
NMI	9111	broad.mit.edu	37	2	152132079	152132079	+	Missense_Mutation	SNP	G	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152132079G>C	uc002txi.2	-	6	883	c.553C>G	c.(553-555)CGA>GGA	p.R185G	NMI_uc010zbx.1_3'UTR	NM_004688	NP_004679	Q13287	NMI_HUMAN	N-myc and STAT interactor	185					inflammatory response|JAK-STAT cascade|transcription from RNA polymerase II promoter	cytoplasm|nucleus	nucleotide binding|protein binding|transcription cofactor activity				0				BRCA - Breast invasive adenocarcinoma(221;0.0571)														---	---	---	---
NEB	4703	broad.mit.edu	37	2	152470851	152470851	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152470851G>A	uc010fnx.2	-	73	11002	c.10811C>T	c.(10810-10812)ACC>ATC	p.T3604I		NM_004543	NP_004534	P20929	NEBU_HUMAN	nebulin isoform 3	3604	Nebulin 99.				muscle filament sliding|muscle organ development|regulation of actin filament length|somatic muscle development	actin cytoskeleton|cytosol|Z disc	actin binding|structural constituent of muscle			ovary(8)|large_intestine(5)|breast(3)|central_nervous_system(2)|skin(1)|pancreas(1)	20				BRCA - Breast invasive adenocarcinoma(221;0.219)														---	---	---	---
NR4A2	4929	broad.mit.edu	37	2	157185013	157185013	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:157185013A>G	uc002tyz.3	-	4	1319	c.897T>C	c.(895-897)TGT>TGC	p.C299C	NR4A2_uc002tyx.3_Silent_p.C236C|NR4A2_uc010zcf.1_Silent_p.C299C|NR4A2_uc010zcg.1_5'Flank	NM_006186	NP_006177	P43354	NR4A2_HUMAN	nuclear receptor subfamily 4, group A, member 2	299	NR C4-type.|Nuclear receptor.				cellular response to extracellular stimulus|dopaminergic neuron differentiation|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|response to protein stimulus	nucleoplasm	sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(3)	3																		---	---	---	---
LY75	4065	broad.mit.edu	37	2	160697448	160697448	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160697448G>A	uc002ubc.3	-	25	3368	c.3299C>T	c.(3298-3300)ACG>ATG	p.T1100M	LY75_uc002ubb.3_Missense_Mutation_p.T1100M|LY75_uc010fos.2_Missense_Mutation_p.T1100M	NM_002349	NP_002340	O60449	LY75_HUMAN	lymphocyte antigen 75 precursor	1100	Extracellular (Potential).				endocytosis|immune response|inflammatory response	integral to plasma membrane	receptor activity|sugar binding				0				COAD - Colon adenocarcinoma(177;0.132)														---	---	---	---
COBLL1	22837	broad.mit.edu	37	2	165551508	165551508	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:165551508C>T	uc010zcw.1	-	15	2833	c.2709G>A	c.(2707-2709)CCG>CCA	p.P903P	COBLL1_uc002ucp.2_Silent_p.P836P|COBLL1_uc002ucq.2_Silent_p.P798P|COBLL1_uc010zcx.1_Silent_p.P844P|COBLL1_uc002ucn.2_Silent_p.P264P|COBLL1_uc002uco.2_Silent_p.P567P	NM_014900	NP_055715	Q53SF7	COBL1_HUMAN	COBL-like 1	874										ovary(2)|pancreas(1)	3																		---	---	---	---
SCN3A	6328	broad.mit.edu	37	2	165987821	165987821	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:165987821C>T	uc002ucx.2	-	16	2990	c.2498G>A	c.(2497-2499)AGC>AAC	p.S833N	SCN3A_uc002ucy.2_Missense_Mutation_p.S784N|SCN3A_uc002ucz.2_Missense_Mutation_p.S784N|SCN3A_uc002uda.1_Missense_Mutation_p.S653N|SCN3A_uc002udb.1_Missense_Mutation_p.S653N	NM_006922	NP_008853	Q9NY46	SCN3A_HUMAN	sodium channel, voltage-gated, type III, alpha	833	Helical; Name=S3 of repeat II; (Potential).					voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(4)|breast(3)|skin(2)|central_nervous_system(1)	10					Lamotrigine(DB00555)													---	---	---	---
LRP2	4036	broad.mit.edu	37	2	170103223	170103223	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170103223C>T	uc002ues.2	-	21	3395	c.3182G>A	c.(3181-3183)GGC>GAC	p.G1061D	LRP2_uc010zdf.1_Missense_Mutation_p.G924D	NM_004525	NP_004516	P98164	LRP2_HUMAN	low density lipoprotein-related protein 2	1061	LDL-receptor class A 8.|Extracellular (Potential).				hormone biosynthetic process|protein glycosylation|receptor-mediated endocytosis|vitamin D metabolic process	coated pit|integral to membrane|lysosome	calcium ion binding|receptor activity|SH3 domain binding			ovary(13)|skin(6)|central_nervous_system(4)|large_intestine(3)|kidney(2)|pancreas(1)	29				STAD - Stomach adenocarcinoma(1183;0.000766)|COAD - Colon adenocarcinoma(177;0.0101)	Gentamicin(DB00798)|Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Urokinase(DB00013)													---	---	---	---
OLA1	29789	broad.mit.edu	37	2	174987938	174987938	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:174987938T>C	uc002uih.2	-	7	884	c.698A>G	c.(697-699)GAA>GGA	p.E233G	OLA1_uc002uii.2_Missense_Mutation_p.E75G|OLA1_uc010fqq.2_Missense_Mutation_p.E233G|OLA1_uc002uij.2_Missense_Mutation_p.E75G|OLA1_uc002uik.2_Missense_Mutation_p.E203G|OLA1_uc010fqr.2_Missense_Mutation_p.E233G	NM_013341	NP_037473	Q9NTK5	OLA1_HUMAN	Obg-like ATPase 1 isoform 1	233				LSE->KSD: Retention of ATP-binding specificity.	ATP catabolic process	cytoplasm	ATP binding|GTP binding|hydrolase activity|protein binding			ovary(1)|breast(1)	2																		---	---	---	---
EVX2	344191	broad.mit.edu	37	2	176948225	176948225	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:176948225A>C	uc010zeu.1	-	1	466	c.280T>G	c.(280-282)TCC>GCC	p.S94A		NM_001080458	NP_001073927	Q03828	EVX2_HUMAN	even-skipped homeobox 2	94						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.0207)|Epithelial(96;0.18)	READ - Rectum adenocarcinoma(9;0.0678)|Colorectal(32;0.115)														---	---	---	---
PDE11A	50940	broad.mit.edu	37	2	178592398	178592398	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:178592398G>A	uc002ulq.2	-	12	2349	c.2031C>T	c.(2029-2031)TTC>TTT	p.F677F	PDE11A_uc002ulp.2_Silent_p.F233F|PDE11A_uc002ulr.2_Silent_p.F427F|PDE11A_uc002uls.1_Silent_p.F319F|PDE11A_uc002ult.1_Silent_p.F427F|PDE11A_uc002ulu.1_Silent_p.F319F	NM_016953	NP_058649	Q9HCR9	PDE11_HUMAN	phosphodiesterase 11A isoform 4	677	Catalytic (By similarity).				platelet activation|signal transduction	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding			ovary(3)|large_intestine(1)	4			OV - Ovarian serous cystadenocarcinoma(117;0.00121)|Epithelial(96;0.00455)|all cancers(119;0.02)											Primary_Pigmented_Nodular_Adrenocortical_Disease_Familial				---	---	---	---
TTN	7273	broad.mit.edu	37	2	179583963	179583963	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179583963T>C	uc010zfg.1	-	80	20646	c.20422A>G	c.(20422-20424)ACA>GCA	p.T6808A	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Missense_Mutation_p.T3469A	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	7735							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179594857	179594857	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179594857A>G	uc010zfg.1	-	59	14762	c.14538T>C	c.(14536-14538)GTT>GTC	p.V4846V	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Silent_p.V1507V	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	5773							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
TTN	7273	broad.mit.edu	37	2	179612275	179612275	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179612275T>C	uc002unb.2	-	46	15076	c.14852A>G	c.(14851-14853)TAC>TGC	p.Y4951C	TTN_uc010zfg.1_Intron|TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Intron	NM_133379	NP_596870	Q8WZ42	TITIN_HUMAN	titin isoform novex-3	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
SESTD1	91404	broad.mit.edu	37	2	179989230	179989230	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179989230G>A	uc002uni.3	-	11	1178	c.1028C>T	c.(1027-1029)GCT>GTT	p.A343V	SESTD1_uc002unh.3_5'UTR	NM_178123	NP_835224	Q86VW0	SESD1_HUMAN	SEC14 and spectrin domains 1	343	Spectrin 1.				regulation of calcium ion transport via voltage-gated calcium channel activity		phosphatidic acid binding|phosphatidylinositol-3,4-bisphosphate binding|phosphatidylinositol-3,5-bisphosphate binding|phosphatidylinositol-3-phosphate binding|phosphatidylinositol-4,5-bisphosphate binding|phosphatidylinositol-4-phosphate binding|phosphatidylinositol-5-phosphate binding|protein binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.0344)|Epithelial(96;0.0531)|all cancers(119;0.147)															---	---	---	---
NEUROD1	4760	broad.mit.edu	37	2	182543334	182543334	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:182543334C>T	uc002uof.2	-	2	490	c.254G>A	c.(253-255)GGC>GAC	p.G85D	CERKL_uc002uod.1_Intron	NM_002500	NP_002491	Q13562	NDF1_HUMAN	neurogenic differentiation 1	85					amacrine cell differentiation|cerebellum development|dentate gyrus development|embryonic organ morphogenesis|enteroendocrine cell differentiation|glucose homeostasis|inner ear development|insulin secretion|negative regulation of apoptosis|nitric oxide mediated signal transduction|positive regulation of apoptosis|positive regulation of neuron differentiation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|regulation of cell cycle arrest|regulation of intestinal epithelial structure maintenance|response to glucose stimulus	cytoplasm|nucleus	chromatin binding|E-box binding|protein heterodimerization activity|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription factor binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.088)															---	---	---	---
DUSP19	142679	broad.mit.edu	37	2	183951924	183951924	+	Intron	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:183951924A>C	uc002upd.2	+						DUSP19_uc010frp.2_Intron|DUSP19_uc010zfr.1_Intron|DUSP19_uc002upe.2_Intron	NM_080876	NP_543152			dual specificity phosphatase 19 isoform 1						JNK cascade|negative regulation of JNK cascade|negative regulation of JUN kinase activity|positive regulation of JNK cascade|positive regulation of JUN kinase activity	cytoplasm	JUN kinase phosphatase activity|MAP-kinase scaffold activity|mitogen-activated protein kinase kinase kinase binding|protein kinase activator activity|protein kinase inhibitor activity|protein tyrosine phosphatase activity			ovary(4)|pancreas(1)	5																		---	---	---	---
MYO1B	4430	broad.mit.edu	37	2	192265123	192265123	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:192265123C>T	uc010fsg.2	+	22	2566	c.2311C>T	c.(2311-2313)CGG>TGG	p.R771W	MYO1B_uc002usq.2_Missense_Mutation_p.R771W|MYO1B_uc002usr.2_Missense_Mutation_p.R771W|MYO1B_uc002usu.2_Missense_Mutation_p.R45W|MYO1B_uc002usv.2_5'Flank	NM_001130158	NP_001123630	O43795	MYO1B_HUMAN	myosin IB isoform 1	771	IQ 3.					myosin complex	actin binding|ATP binding|calmodulin binding|motor activity			central_nervous_system(5)|large_intestine(2)|ovary(1)	8			OV - Ovarian serous cystadenocarcinoma(117;0.0112)|Epithelial(96;0.104)|all cancers(119;0.236)															---	---	---	---
DNAH7	56171	broad.mit.edu	37	2	196723270	196723270	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196723270G>A	uc002utj.3	-	43	8096	c.7995C>T	c.(7993-7995)TGC>TGT	p.C2665C		NM_018897	NP_061720	Q8WXX0	DYH7_HUMAN	dynein, axonemal, heavy chain 7	2665	Stalk (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(10)|ovary(2)	12																		---	---	---	---
DNAH7	56171	broad.mit.edu	37	2	196729215	196729215	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196729215C>T	uc002utj.3	-	41	7265	c.7164G>A	c.(7162-7164)GCG>GCA	p.A2388A		NM_018897	NP_061720	Q8WXX0	DYH7_HUMAN	dynein, axonemal, heavy chain 7	2388	AAA 4 (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(10)|ovary(2)	12																		---	---	---	---
HECW2	57520	broad.mit.edu	37	2	197183522	197183522	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197183522G>A	uc002utm.1	-	9	2275	c.2092C>T	c.(2092-2094)CAG>TAG	p.Q698*	HECW2_uc002utl.1_Nonsense_Mutation_p.Q342*	NM_020760	NP_065811	Q9P2P5	HECW2_HUMAN	HECT, C2 and WW domain containing E3 ubiquitin	698					protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm	ubiquitin-protein ligase activity			skin(5)|ovary(5)|lung(4)|pancreas(2)|central_nervous_system(1)|kidney(1)	18																		---	---	---	---
HECW2	57520	broad.mit.edu	37	2	197183576	197183576	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197183576C>T	uc002utm.1	-	9	2221	c.2038G>A	c.(2038-2040)GAA>AAA	p.E680K	HECW2_uc002utl.1_Missense_Mutation_p.E324K	NM_020760	NP_065811	Q9P2P5	HECW2_HUMAN	HECT, C2 and WW domain containing E3 ubiquitin	680					protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm	ubiquitin-protein ligase activity			skin(5)|ovary(5)|lung(4)|pancreas(2)|central_nervous_system(1)|kidney(1)	18																		---	---	---	---
COQ10B	80219	broad.mit.edu	37	2	198334842	198334842	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:198334842C>T	uc002uuh.1	+	4	550	c.496C>T	c.(496-498)CGT>TGT	p.R166C	COQ10B_uc010fsl.1_Missense_Mutation_p.R138C	NM_025147	NP_079423	Q9H8M1	CQ10B_HUMAN	coenzyme Q10 homolog B precursor	166						mitochondrial inner membrane					0			Epithelial(96;0.231)|OV - Ovarian serous cystadenocarcinoma(117;0.246)															---	---	---	---
BOLL	66037	broad.mit.edu	37	2	198621225	198621225	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:198621225T>C	uc002uus.2	-	9	966	c.656A>G	c.(655-657)CAA>CGA	p.Q219R	uc002uup.2_Intron|BOLL_uc002uur.2_Missense_Mutation_p.Q225R|BOLL_uc002uut.2_Missense_Mutation_p.Q231R|BOLL_uc010zha.1_Missense_Mutation_p.Q110R|BOLL_uc002uuu.1_Missense_Mutation_p.Q247R	NM_033030	NP_149019	Q8N9W6	BOLL_HUMAN	boule isoform 2	219					cell differentiation|meiosis|multicellular organismal development|positive regulation of translational initiation|spermatogenesis	cytoplasm	nucleotide binding|protein binding|RNA binding|translation activator activity			ovary(2)	2																		---	---	---	---
BOLL	66037	broad.mit.edu	37	2	198622118	198622118	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:198622118T>C	uc002uus.2	-	8	869	c.559A>G	c.(559-561)ACA>GCA	p.T187A	uc002uup.2_Intron|BOLL_uc002uur.2_Missense_Mutation_p.T193A|BOLL_uc002uut.2_Missense_Mutation_p.T199A|BOLL_uc010zha.1_Missense_Mutation_p.T78A|BOLL_uc002uuu.1_Missense_Mutation_p.T215A	NM_033030	NP_149019	Q8N9W6	BOLL_HUMAN	boule isoform 2	187	DAZ-like.				cell differentiation|meiosis|multicellular organismal development|positive regulation of translational initiation|spermatogenesis	cytoplasm	nucleotide binding|protein binding|RNA binding|translation activator activity			ovary(2)	2																		---	---	---	---
C2orf69	205327	broad.mit.edu	37	2	200789807	200789807	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:200789807G>A	uc010zhb.1	+	2	539	c.356G>A	c.(355-357)CGT>CAT	p.R119H		NM_153689	NP_710156	Q8N8R5	CB069_HUMAN	hypothetical protein LOC205327 precursor	119						extracellular region				central_nervous_system(1)	1																		---	---	---	---
SGOL2	151246	broad.mit.edu	37	2	201434523	201434523	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:201434523C>T	uc002uvw.2	+	6	724	c.611C>T	c.(610-612)TCG>TTG	p.S204L	SGOL2_uc002uvv.3_Missense_Mutation_p.S204L|SGOL2_uc010zhd.1_Missense_Mutation_p.S204L|SGOL2_uc010zhe.1_Missense_Mutation_p.S204L	NM_152524	NP_689737	Q562F6	SGOL2_HUMAN	shugoshin-like 2 isoform 1	204					cell division|mitotic prometaphase	condensed chromosome kinetochore|cytosol|mitotic cohesin complex	protein binding			ovary(2)|skin(2)	4																		---	---	---	---
CLK1	1195	broad.mit.edu	37	2	201722492	201722492	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:201722492G>A	uc002uwe.2	-	7	962	c.781C>T	c.(781-783)CGA>TGA	p.R261*	CLK1_uc002uwd.2_Nonsense_Mutation_p.R84*|CLK1_uc010zhi.1_Nonsense_Mutation_p.R303*|CLK1_uc002uwf.2_Nonsense_Mutation_p.R35*|CLK1_uc002uwg.2_Nonsense_Mutation_p.R110*|CLK1_uc010fsv.2_RNA	NM_004071	NP_004062	P49759	CLK1_HUMAN	CDC-like kinase 1 isoform 1	261	Protein kinase.				cell proliferation	nucleus	ATP binding|non-membrane spanning protein tyrosine kinase activity|protein serine/threonine kinase activity			pancreas(2)	2																		---	---	---	---
PARD3B	117583	broad.mit.edu	37	2	205986445	205986445	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:205986445G>A	uc002var.1	+	8	1144	c.937G>A	c.(937-939)GTT>ATT	p.V313I	PARD3B_uc010fub.1_Missense_Mutation_p.V313I|PARD3B_uc002vao.1_Missense_Mutation_p.V313I|PARD3B_uc002vap.1_Missense_Mutation_p.V313I|PARD3B_uc002vaq.1_Missense_Mutation_p.V313I	NM_152526	NP_689739	Q8TEW8	PAR3L_HUMAN	par-3 partitioning defective 3 homolog B isoform	313					cell cycle|cell division	endomembrane system|tight junction				skin(2)|ovary(1)|breast(1)	4		all_cancers(1;2.88e-06)|all_epithelial(1;3.23e-06)		Epithelial(149;0.0739)														---	---	---	---
NDUFS1	4719	broad.mit.edu	37	2	207006783	207006783	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:207006783G>A	uc002vbe.2	-	12	1271	c.1144C>T	c.(1144-1146)CGT>TGT	p.R382C	NDUFS1_uc010ziq.1_Missense_Mutation_p.R396C|NDUFS1_uc010zir.1_Missense_Mutation_p.R346C|NDUFS1_uc010zis.1_Missense_Mutation_p.R325C|NDUFS1_uc010zit.1_Missense_Mutation_p.R271C|NDUFS1_uc010ziu.1_Missense_Mutation_p.R266C	NM_005006	NP_004997	P28331	NDUS1_HUMAN	NADH dehydrogenase (ubiquinone) Fe-S protein 1,	382					apoptosis|ATP metabolic process|mitochondrial electron transport, NADH to ubiquinone|reactive oxygen species metabolic process|regulation of mitochondrial membrane potential|transport	mitochondrial intermembrane space|mitochondrial respiratory chain complex I	2 iron, 2 sulfur cluster binding|4 iron, 4 sulfur cluster binding|electron carrier activity|metal ion binding|NADH dehydrogenase (ubiquinone) activity|protein binding			ovary(1)	1					NADH(DB00157)													---	---	---	---
CREB1	1385	broad.mit.edu	37	2	208420450	208420450	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:208420450C>T	uc002vcc.2	+	2	342	c.91C>T	c.(91-93)CCA>TCA	p.P31S	CREB1_uc010ziz.1_Missense_Mutation_p.P29S|CREB1_uc002vcd.2_Missense_Mutation_p.P31S	NM_134442	NP_604391	P16220	CREB1_HUMAN	cAMP responsive element binding protein 1	31					activation of phospholipase C activity|axon guidance|innate immune response|interspecies interaction between organisms|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of transcription from RNA polymerase II promoter|protein phosphorylation|stress-activated MAPK cascade|synaptic transmission|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway		protein dimerization activity|transcription cofactor activity		EWSR1/CREB1(42)	soft_tissue(42)|breast(1)|central_nervous_system(1)	44				LUSC - Lung squamous cell carcinoma(261;0.0768)|Epithelial(149;0.127)|Lung(261;0.145)	Adenosine monophosphate(DB00131)|Bromocriptine(DB01200)|Naloxone(DB01183)			T	EWSR1	clear cell sarcoma|angiomatoid fibrous histiocytoma								---	---	---	---
FN1	2335	broad.mit.edu	37	2	216236885	216236885	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:216236885G>T	uc002vfa.2	-	40	6727	c.6461C>A	c.(6460-6462)CCC>CAC	p.P2154H	FN1_uc002vfb.2_Missense_Mutation_p.P1973H|FN1_uc002vfc.2_Missense_Mutation_p.P1948H|FN1_uc002vfd.2_Missense_Mutation_p.P2129H|FN1_uc002vfe.2_Missense_Mutation_p.P2063H|FN1_uc002vff.2_Missense_Mutation_p.P2038H|FN1_uc002vfg.2_Missense_Mutation_p.P1973H|FN1_uc002vfh.2_Intron|FN1_uc002vfi.2_Missense_Mutation_p.P2154H|FN1_uc002vfj.2_Intron|FN1_uc002vez.2_Missense_Mutation_p.P348H|FN1_uc010zjp.1_Missense_Mutation_p.P691H|FN1_uc002vfk.1_Intron|FN1_uc010fva.1_Intron|FN1_uc010fvb.1_Intron|FN1_uc010fvc.1_Intron|FN1_uc010fvd.1_Missense_Mutation_p.P245H	NM_212482	NP_997647	P02751	FINC_HUMAN	fibronectin 1 isoform 1 preproprotein	2063	Connecting strand 3 (CS-3) (V region).				acute-phase response|angiogenesis|leukocyte migration|peptide cross-linking|platelet activation|platelet degranulation|regulation of cell shape|substrate adhesion-dependent cell spreading	ER-Golgi intermediate compartment|fibrinogen complex|platelet alpha granule lumen|proteinaceous extracellular matrix	collagen binding|extracellular matrix structural constituent|heparin binding			central_nervous_system(7)|large_intestine(2)|breast(2)|ovary(1)|pancreas(1)	13		Renal(323;0.127)		Epithelial(149;9.59e-07)|all cancers(144;0.000174)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00948)	Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---
TNS1	7145	broad.mit.edu	37	2	218762658	218762658	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:218762658A>G	uc002vgt.2	-	6	429	c.31T>C	c.(31-33)TGT>CGT	p.C11R	TNS1_uc002vgr.2_Missense_Mutation_p.C11R|TNS1_uc002vgs.2_Missense_Mutation_p.C11R|TNS1_uc010zjv.1_Missense_Mutation_p.C11R|TNS1_uc010fvj.1_Missense_Mutation_p.C79R|TNS1_uc010fvk.1_Missense_Mutation_p.C136R|TNS1_uc002vgu.3_Missense_Mutation_p.C42R|TNS1_uc002vgv.1_RNA	NM_022648	NP_072174	Q9HBL0	TENS1_HUMAN	tensin	11	Phosphatase tensin-type.					cytoplasm|cytoskeleton|focal adhesion	actin binding			ovary(3)|breast(1)	4		Renal(207;0.0483)|Lung NSC(271;0.213)		Epithelial(149;4.43e-06)|all cancers(144;0.000653)|LUSC - Lung squamous cell carcinoma(224;0.0091)|Lung(261;0.013)														---	---	---	---
ABCB6	10058	broad.mit.edu	37	2	220078361	220078361	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220078361A>G	uc002vkc.1	-	10	1883	c.1606T>C	c.(1606-1608)TAC>CAC	p.Y536H	ABCB6_uc010fwe.1_Missense_Mutation_p.Y490H	NM_005689	NP_005680	Q9NP58	ABCB6_HUMAN	ATP-binding cassette, sub-family B, member 6	536	Helical; (Potential).|ABC transmembrane type-1.				cadmium ion transmembrane transport|cellular iron ion homeostasis|detoxification of cadmium ion|porphyrin biosynthetic process	ATP-binding cassette (ABC) transporter complex|Golgi apparatus|integral to mitochondrial outer membrane|plasma membrane|vacuolar membrane	ATP binding|efflux transmembrane transporter activity|heme binding|heme-transporting ATPase activity			breast(1)|central_nervous_system(1)	2		Renal(207;0.0474)		Epithelial(149;1.22e-06)|all cancers(144;0.000201)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
SPEG	10290	broad.mit.edu	37	2	220348655	220348655	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220348655G>T	uc010fwg.2	+	30	6470	c.6470G>T	c.(6469-6471)GGG>GTG	p.G2157V		NM_005876	NP_005867	Q15772	SPEG_HUMAN	SPEG complex locus	2157					muscle organ development|negative regulation of cell proliferation	nucleus	ATP binding|protein serine/threonine kinase activity			stomach(9)|ovary(4)|central_nervous_system(1)	14		Renal(207;0.0183)		Epithelial(149;4.5e-10)|all cancers(144;7.93e-08)|Lung(261;0.00639)|LUSC - Lung squamous cell carcinoma(224;0.00829)|READ - Rectum adenocarcinoma(5;0.163)														---	---	---	---
TMEM198	130612	broad.mit.edu	37	2	220414512	220414512	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220414512C>T	uc002vme.2	+	6	1604	c.1019C>T	c.(1018-1020)GCG>GTG	p.A340V	TMEM198_uc002vmf.2_Missense_Mutation_p.A340V|hsa-mir-3132|MI0014152_5'Flank	NM_001005209	NP_001005209	Q66K66	TM198_HUMAN	transmembrane protein 198	340						integral to membrane				ovary(1)	1		Renal(207;0.0376)		Epithelial(149;6.49e-08)|all cancers(144;6.45e-06)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00802)														---	---	---	---
STK11IP	114790	broad.mit.edu	37	2	220466796	220466796	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220466796G>T	uc002vml.2	+	5	505	c.462G>T	c.(460-462)CAG>CAT	p.Q154H	STK11IP_uc010zlk.1_Missense_Mutation_p.Q143H|STK11IP_uc010zll.1_Missense_Mutation_p.Q143H|STK11IP_uc002vmm.1_Missense_Mutation_p.Q143H	NM_052902	NP_443134	Q8N1F8	S11IP_HUMAN	LKB1 interacting protein	154	LRR 2.				protein localization	cytoplasm	protein kinase binding			ovary(1)	1		Renal(207;0.0183)		Epithelial(149;2.69e-07)|all cancers(144;5.91e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
SLC4A3	6508	broad.mit.edu	37	2	220496734	220496734	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220496734A>G	uc002vmp.3	+	7	1125	c.856A>G	c.(856-858)AAA>GAA	p.K286E	SLC4A3_uc002vmn.2_Missense_Mutation_p.K313E|SLC4A3_uc002vmo.3_Missense_Mutation_p.K313E|SLC4A3_uc010fwm.2_5'UTR|SLC4A3_uc010fwn.1_5'UTR	NM_005070	NP_005061	P48751	B3A3_HUMAN	solute carrier family 4, anion exchanger, member	286	Cytoplasmic.				bicarbonate transport	integral to plasma membrane|membrane fraction	inorganic anion exchanger activity			ovary(2)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	5		Renal(207;0.0183)		Epithelial(149;2.53e-07)|all cancers(144;5.57e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
SLC19A3	80704	broad.mit.edu	37	2	228564113	228564113	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:228564113C>T	uc002vpi.2	-	3	407	c.318G>A	c.(316-318)ATG>ATA	p.M106I	SLC19A3_uc002vpj.2_RNA|SLC19A3_uc010zlv.1_Missense_Mutation_p.M102I	NM_025243	NP_079519	Q9BZV2	S19A3_HUMAN	solute carrier family 19, member 3	106	Extracellular (Potential).				thiamine-containing compound metabolic process	integral to membrane|plasma membrane	folic acid binding|reduced folate carrier activity|thiamine uptake transmembrane transporter activity			ovary(2)	2		Renal(207;0.0112)|all_lung(227;0.0335)|Lung NSC(271;0.142)|all_hematologic(139;0.21)|Esophageal squamous(248;0.236)		Epithelial(121;1.58e-10)|all cancers(144;8.55e-08)|Lung(261;0.00948)|LUSC - Lung squamous cell carcinoma(224;0.0125)	L-Cysteine(DB00151)													---	---	---	---
DNER	92737	broad.mit.edu	37	2	230312024	230312024	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:230312024G>A	uc002vpv.2	-							NM_139072	NP_620711			delta-notch-like EGF repeat-containing						central nervous system development|endocytosis|neuron migration|Notch signaling pathway|synapse assembly	dendrite|early endosome|integral to membrane|plasma membrane	calcium ion binding|clathrin binding|transmembrane receptor activity			lung(5)|ovary(2)|skin(1)	8		all_lung(227;0.00413)|Renal(207;0.0113)|Lung NSC(271;0.0211)|all_hematologic(139;0.105)|Acute lymphoblastic leukemia(138;0.175)		Epithelial(121;1.4e-11)|all cancers(144;7.7e-09)|LUSC - Lung squamous cell carcinoma(224;0.034)|Lung(119;0.0375)														---	---	---	---
ARMC9	80210	broad.mit.edu	37	2	232146857	232146857	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:232146857G>A	uc002vrq.3	+						ARMC9_uc002vrp.3_Intron|ARMC9_uc002vrr.1_Intron	NM_025139	NP_079415			armadillo repeat containing 9								binding			ovary(1)	1		Renal(207;0.0112)|all_lung(227;0.0744)|all_hematologic(139;0.0749)|Acute lymphoblastic leukemia(138;0.167)|Medulloblastoma(418;0.184)|Lung NSC(271;0.205)		Epithelial(121;1.43e-10)|LUSC - Lung squamous cell carcinoma(224;0.017)|Lung(119;0.0189)														---	---	---	---
NEU2	4759	broad.mit.edu	37	2	233899156	233899156	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233899156G>A	uc010zmn.1	+	2	532	c.532G>A	c.(532-534)GCC>ACC	p.A178T		NM_005383	NP_005374	Q9Y3R4	NEUR2_HUMAN	neuraminidase 2	178							exo-alpha-sialidase activity				0		Breast(86;0.00279)|Renal(207;0.00339)|all_hematologic(139;0.0116)|all_lung(227;0.0271)|Acute lymphoblastic leukemia(138;0.0326)|Lung NSC(271;0.0839)		Epithelial(121;7.17e-17)|BRCA - Breast invasive adenocarcinoma(100;0.000311)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(119;0.00942)|GBM - Glioblastoma multiforme(43;0.0488)														---	---	---	---
MLPH	79083	broad.mit.edu	37	2	238434402	238434402	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:238434402G>A	uc002vwt.2	+	7	1061	c.834G>A	c.(832-834)CCG>CCA	p.P278P	MLPH_uc002vws.2_Intron|MLPH_uc010fyt.1_Silent_p.P278P|MLPH_uc002vwu.2_Silent_p.P278P|MLPH_uc002vwv.2_Silent_p.P238P|MLPH_uc002vww.2_Silent_p.P254P|MLPH_uc002vwx.2_Silent_p.P162P|MLPH_uc010fyu.2_Missense_Mutation_p.R77H	NM_024101	NP_077006	Q9BV36	MELPH_HUMAN	melanophilin isoform 1	278							metal ion binding			ovary(1)	1		Breast(86;0.000381)|Renal(207;0.000966)|Ovarian(221;0.0695)|all_hematologic(139;0.095)|all_lung(227;0.17)|Melanoma(123;0.203)		Epithelial(121;1.17e-21)|OV - Ovarian serous cystadenocarcinoma(60;1.02e-10)|Kidney(56;4.23e-09)|KIRC - Kidney renal clear cell carcinoma(57;1.15e-07)|BRCA - Breast invasive adenocarcinoma(100;0.000439)|Lung(119;0.0132)|LUSC - Lung squamous cell carcinoma(224;0.0316)														---	---	---	---
HDAC4	9759	broad.mit.edu	37	2	240078398	240078398	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:240078398G>A	uc002vyk.3	-	7	1475	c.683C>T	c.(682-684)CCG>CTG	p.P228L	HDAC4_uc010fyz.1_Missense_Mutation_p.P223L|HDAC4_uc010zoa.1_Missense_Mutation_p.P223L|HDAC4_uc010fza.2_Missense_Mutation_p.P228L|HDAC4_uc010fyy.2_Missense_Mutation_p.P180L|HDAC4_uc010znz.1_Missense_Mutation_p.P111L|HDAC4_uc010fzb.1_5'Flank	NM_006037	NP_006028	P56524	HDAC4_HUMAN	histone deacetylase 4	228	Interaction with MEF2A.				B cell differentiation|cardiac muscle hypertrophy in response to stress|chromatin remodeling|histone H3 deacetylation|histone H4 deacetylation|inflammatory response|negative regulation of glycolysis|negative regulation of myotube differentiation|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of transcription from RNA polymerase II promoter|nervous system development|peptidyl-lysine deacetylation|positive regulation of cell proliferation|positive regulation of protein sumoylation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|regulation of protein binding|response to denervation involved in regulation of muscle adaptation|response to interleukin-1|transcription, DNA-dependent	histone deacetylase complex|transcriptional repressor complex	activating transcription factor binding|histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|potassium ion binding|repressing transcription factor binding|zinc ion binding			breast(3)|skin(2)|ovary(1)	6		all_epithelial(40;1.45e-17)|Breast(86;1.53e-05)|Renal(207;0.000355)|all_lung(227;0.0121)|Ovarian(221;0.0183)|Lung NSC(271;0.0413)|Melanoma(123;0.0749)|all_hematologic(139;0.159)		Epithelial(121;6.38e-25)|OV - Ovarian serous cystadenocarcinoma(60;2.48e-12)|Kidney(56;6.04e-08)|KIRC - Kidney renal clear cell carcinoma(57;1.18e-06)|BRCA - Breast invasive adenocarcinoma(100;3.99e-05)|Lung(119;0.00942)|LUSC - Lung squamous cell carcinoma(224;0.04)														---	---	---	---
THAP4	51078	broad.mit.edu	37	2	242572334	242572334	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242572334C>T	uc002wbt.2	-	2	1461	c.1238G>A	c.(1237-1239)CGC>CAC	p.R413H		NM_015963	NP_057047	Q8WY91	THAP4_HUMAN	THAP domain containing 4 isoform 1	413							DNA binding|metal ion binding				0		all_cancers(19;2.09e-34)|all_epithelial(40;2.09e-14)|Breast(86;0.000141)|Renal(207;0.0143)|all_lung(227;0.0344)|Ovarian(221;0.069)|Lung NSC(271;0.0886)|Esophageal squamous(248;0.131)|all_hematologic(139;0.182)|Melanoma(123;0.2)		Epithelial(32;2.3e-33)|all cancers(36;8.99e-31)|OV - Ovarian serous cystadenocarcinoma(60;3.68e-15)|Kidney(56;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;1.65e-06)|Lung(119;0.000152)|LUSC - Lung squamous cell carcinoma(224;0.00154)|Colorectal(34;0.0129)|COAD - Colon adenocarcinoma(134;0.0844)														---	---	---	---
CNTN4	152330	broad.mit.edu	37	3	3085297	3085297	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:3085297A>C	uc003bpc.2	+	22	2941	c.2720A>C	c.(2719-2721)AAC>ACC	p.N907T	CNTN4_uc003bpe.2_Missense_Mutation_p.N579T|CNTN4_uc003bpf.2_Missense_Mutation_p.N578T|CNTN4_uc003bpg.2_Missense_Mutation_p.N163T	NM_175607	NP_783200	Q8IWV2	CNTN4_HUMAN	contactin 4 isoform a precursor	907	Fibronectin type-III 4.				axon guidance|axonal fasciculation|brain development|negative regulation of neuron differentiation|neuron cell-cell adhesion|regulation of synaptic plasticity	anchored to membrane|axon|extracellular region|plasma membrane	protein binding			large_intestine(2)|ovary(2)|lung(1)|central_nervous_system(1)|pancreas(1)	7		Ovarian(110;0.156)		Epithelial(13;0.000695)|all cancers(10;0.0047)|OV - Ovarian serous cystadenocarcinoma(96;0.01)														---	---	---	---
ATP2B2	491	broad.mit.edu	37	3	10401789	10401789	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10401789C>T	uc003bvt.2	-	13	2117	c.1678G>A	c.(1678-1680)GCC>ACC	p.A560T	ATP2B2_uc003bvv.2_Missense_Mutation_p.A515T|ATP2B2_uc003bvw.2_Missense_Mutation_p.A515T|ATP2B2_uc010hdo.2_Missense_Mutation_p.A265T	NM_001001331	NP_001001331	Q01814	AT2B2_HUMAN	plasma membrane calcium ATPase 2 isoform 1	560	Cytoplasmic (Potential).				ATP biosynthetic process|cytosolic calcium ion homeostasis|platelet activation	cytosol|integral to membrane|plasma membrane	ATP binding|ATP binding|calcium ion binding|calcium-transporting ATPase activity|calcium-transporting ATPase activity|calmodulin binding|calmodulin binding|metal ion binding|PDZ domain binding|protein C-terminus binding			ovary(3)|skin(2)|central_nervous_system(1)	6																		---	---	---	---
SLC6A11	6538	broad.mit.edu	37	3	10979960	10979960	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10979960A>G	uc003bvz.2	+	14	1805	c.1771A>G	c.(1771-1773)AGC>GGC	p.S591G		NM_014229	NP_055044	P48066	S6A11_HUMAN	solute carrier family 6 (neurotransmitter	591	Cytoplasmic (Potential).				neurotransmitter secretion	integral to plasma membrane	gamma-aminobutyric acid:sodium symporter activity|neurotransmitter:sodium symporter activity			skin(3)|ovary(1)	4				OV - Ovarian serous cystadenocarcinoma(96;0.229)														---	---	---	---
FBLN2	2199	broad.mit.edu	37	3	13655590	13655590	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:13655590G>T	uc011avb.1	+	5	1780	c.1655G>T	c.(1654-1656)TGC>TTC	p.C552F	FBLN2_uc011auz.1_Missense_Mutation_p.C578F|FBLN2_uc011ava.1_Missense_Mutation_p.C552F|FBLN2_uc011avc.1_Missense_Mutation_p.C552F|uc003byc.1_5'Flank	NM_001998	NP_001989	P98095	FBLN2_HUMAN	fibulin 2 isoform b precursor	552	Anaphylatoxin-like 3.					proteinaceous extracellular matrix	calcium ion binding|extracellular matrix structural constituent			ovary(1)	1			UCEC - Uterine corpus endometrioid carcinoma (1;0.00416)															---	---	---	---
SLC6A6	6533	broad.mit.edu	37	3	14513830	14513830	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:14513830G>A	uc010heg.2	+						SLC6A6_uc003byq.2_Intron|SLC6A6_uc003byr.2_Intron	NM_001134367	NP_001127839			solute carrier family 6 (neurotransmitter						cellular amino acid metabolic process	integral to plasma membrane	amino acid transmembrane transporter activity|neurotransmitter:sodium symporter activity|taurine:sodium symporter activity			ovary(1)	1																		---	---	---	---
RBMS3	27303	broad.mit.edu	37	3	29910399	29910399	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:29910399C>T	uc003cel.2	+	7	918	c.688C>T	c.(688-690)CGA>TGA	p.R230*	RBMS3_uc003cek.2_Nonsense_Mutation_p.R230*|RBMS3_uc010hfq.2_Nonsense_Mutation_p.R230*|RBMS3_uc003cem.2_Nonsense_Mutation_p.R229*|RBMS3_uc010hfr.2_Nonsense_Mutation_p.R230*	NM_001003793	NP_001003793	Q6XE24	RBMS3_HUMAN	RNA binding motif, single stranded interacting	230						cytoplasm	nucleotide binding|RNA binding			central_nervous_system(1)	1		Ovarian(412;0.0956)																---	---	---	---
GADL1	339896	broad.mit.edu	37	3	30880509	30880509	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:30880509T>C	uc003cep.2	-	9	930	c.883A>G	c.(883-885)AGC>GGC	p.S295G	GADL1_uc003ceq.1_Missense_Mutation_p.S295G	NM_207359	NP_997242	Q6ZQY3	GADL1_HUMAN	glutamate decarboxylase-like 1	295					carboxylic acid metabolic process		carboxy-lyase activity|pyridoxal phosphate binding				0					Pyridoxal Phosphate(DB00114)													---	---	---	---
SUSD5	26032	broad.mit.edu	37	3	33249394	33249394	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:33249394A>G	uc003cfo.1	-	3	733	c.315T>C	c.(313-315)AGT>AGC	p.S105S		NM_015551	NP_056366	O60279	SUSD5_HUMAN	sushi domain containing 5 precursor	105	Extracellular (Potential).|Link.				cell adhesion	integral to membrane	hyaluronic acid binding			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
SLC22A13	9390	broad.mit.edu	37	3	38317132	38317132	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38317132C>T	uc003chz.3	+	6	1045	c.991C>T	c.(991-993)CGG>TGG	p.R331W	SLC22A13_uc011aym.1_RNA|SLC22A13_uc011ayn.1_Missense_Mutation_p.R331W	NM_004256	NP_004247	Q9Y226	S22AD_HUMAN	solute carrier family 22 (organic anion	331	Cytoplasmic (Potential).					integral to plasma membrane	organic cation transmembrane transporter activity			skin(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.0533)|Kidney(284;0.067)														---	---	---	---
GORASP1	64689	broad.mit.edu	37	3	39141917	39141917	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:39141917C>T	uc003ciw.1	-	6	742	c.644G>A	c.(643-645)GGC>GAC	p.G215D	GORASP1_uc003civ.1_RNA|GORASP1_uc003cix.1_RNA|GORASP1_uc003ciy.1_RNA|GORASP1_uc011ayw.1_Missense_Mutation_p.G120D|GORASP1_uc003ciz.1_Missense_Mutation_p.G60D	NM_031899	NP_114105	Q9BQQ3	GORS1_HUMAN	Golgi reassembly stacking protein 1	215	Pro-rich.				mitotic prophase|protein transport	cytosol|Golgi apparatus|membrane				ovary(2)|central_nervous_system(1)	3				KIRC - Kidney renal clear cell carcinoma(284;0.0519)|Kidney(284;0.0653)														---	---	---	---
VIPR1	7433	broad.mit.edu	37	3	42576492	42576492	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:42576492C>T	uc003clf.2	+	11	1160	c.1036C>T	c.(1036-1038)CTG>TTG	p.L346L	VIPR1_uc011azl.1_Silent_p.L298L|VIPR1_uc011azm.1_Silent_p.L136L|VIPR1_uc011azn.1_Silent_p.L319L|VIPR1_uc003clg.2_5'UTR	NM_004624	NP_004615	P32241	VIPR1_HUMAN	vasoactive intestinal peptide receptor 1	346	Helical; Name=6; (Potential).				digestion|G-protein signaling, coupled to cyclic nucleotide second messenger|immune response|muscle contraction|positive regulation of cell proliferation|synaptic transmission	integral to plasma membrane	vasoactive intestinal polypeptide receptor activity			skin(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.241)														---	---	---	---
ZNF167	55888	broad.mit.edu	37	3	44598791	44598791	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:44598791G>A	uc010hin.2	+	2	640	c.252G>A	c.(250-252)ATG>ATA	p.M84I	ZNF167_uc003cnh.2_RNA|ZNF167_uc003cni.2_Missense_Mutation_p.M84I|ZNF167_uc010hio.2_Intron|ZNF167_uc003cnj.2_Missense_Mutation_p.M84I|ZNF167_uc003cnk.2_Missense_Mutation_p.M84I	NM_018651	NP_061121	Q9P0L1	ZN167_HUMAN	zinc finger protein 167 isoform 1	84	SCAN box.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2				KIRC - Kidney renal clear cell carcinoma(197;0.0486)|Kidney(197;0.0609)														---	---	---	---
LARS2	23395	broad.mit.edu	37	3	45435951	45435951	+	Silent	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:45435951T>G	uc003cop.1	+	3	191	c.6T>G	c.(4-6)GCT>GCG	p.A2A	LARS2_uc010hit.1_Silent_p.A2A	NM_015340	NP_056155	Q15031	SYLM_HUMAN	leucyl-tRNA synthetase 2, mitochondrial	2					leucyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|leucine-tRNA ligase activity			upper_aerodigestive_tract(1)|ovary(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.0122)|KIRC - Kidney renal clear cell carcinoma(197;0.0313)|Kidney(197;0.0372)	L-Leucine(DB00149)													---	---	---	---
LRRC2	79442	broad.mit.edu	37	3	46571410	46571410	+	Missense_Mutation	SNP	G	A	A	rs142961281		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:46571410G>A	uc010hji.2	-	6	1122	c.758C>T	c.(757-759)CCG>CTG	p.P253L	LRRC2_uc003cpu.3_Missense_Mutation_p.P253L	NM_024512	NP_078788	Q9BYS8	LRRC2_HUMAN	leucine rich repeat containing 2	253	LRR 6.									ovary(1)	1		Ovarian(412;0.0563)		OV - Ovarian serous cystadenocarcinoma(275;6.37e-05)|BRCA - Breast invasive adenocarcinoma(193;0.00133)|KIRC - Kidney renal clear cell carcinoma(197;0.0214)|Kidney(197;0.0254)														---	---	---	---
DHX30	22907	broad.mit.edu	37	3	47891514	47891514	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:47891514C>T	uc003cru.2	+	22	3915	c.3489C>T	c.(3487-3489)AGC>AGT	p.S1163S	DHX30_uc003crt.2_Silent_p.S1124S	NM_138615	NP_619520	Q7L2E3	DHX30_HUMAN	DEAH (Asp-Glu-Ala-His) box polypeptide 30	1163						mitochondrial nucleoid	ATP binding|ATP-dependent helicase activity|protein binding|RNA binding			ovary(2)|skin(2)	4				BRCA - Breast invasive adenocarcinoma(193;0.000696)|KIRC - Kidney renal clear cell carcinoma(197;0.00609)|Kidney(197;0.007)												OREG0015550	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
QARS	5859	broad.mit.edu	37	3	49140833	49140833	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49140833C>T	uc003cvx.2	-	5	466	c.461G>A	c.(460-462)CGG>CAG	p.R154Q	QARS_uc011bcd.1_Missense_Mutation_p.R9Q|QARS_uc003cvy.2_Missense_Mutation_p.R9Q|QARS_uc011bce.1_Missense_Mutation_p.R143Q|QARS_uc011bcf.1_Missense_Mutation_p.R154Q	NM_005051	NP_005042	P47897	SYQ_HUMAN	glutaminyl-tRNA synthetase	154					glutaminyl-tRNA aminoacylation	cytosol|mitochondrial matrix	ATP binding|glutamine-tRNA ligase activity|protein binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.00219)|KIRC - Kidney renal clear cell carcinoma(197;0.00245)	L-Glutamine(DB00130)													---	---	---	---
BSN	8927	broad.mit.edu	37	3	49694830	49694830	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49694830C>T	uc003cxe.3	+	5	7955	c.7841C>T	c.(7840-7842)ACG>ATG	p.T2614M		NM_003458	NP_003449	Q9UPA5	BSN_HUMAN	bassoon protein	2614					synaptic transmission	cell junction|cytoplasm|cytoskeleton|nucleus|synaptosome	metal ion binding			ovary(5)|pancreas(1)|central_nervous_system(1)|skin(1)	8				BRCA - Breast invasive adenocarcinoma(193;6.66e-05)|KIRC - Kidney renal clear cell carcinoma(197;0.0032)|Kidney(197;0.00336)														---	---	---	---
RPL29	6159	broad.mit.edu	37	3	52027966	52027966	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52027966G>A	uc003dcs.2	-	4	373	c.279C>T	c.(277-279)CTC>CTT	p.L93L		NM_000992	NP_000983	P47914	RL29_HUMAN	ribosomal protein L29	93					embryo implantation|endocrine pancreas development|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit	heparin binding|protein binding|RNA binding|structural constituent of ribosome				0				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.000537)|KIRC - Kidney renal clear cell carcinoma(197;0.000716)														---	---	---	---
SEMA3G	56920	broad.mit.edu	37	3	52475387	52475387	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52475387A>G	uc003dea.1	-	7	706	c.706T>C	c.(706-708)TCT>CCT	p.S236P		NM_020163	NP_064548	Q9NS98	SEM3G_HUMAN	semaphorin sem2 precursor	236	Sema.				multicellular organismal development	extracellular region|membrane	receptor activity			ovary(2)	2				BRCA - Breast invasive adenocarcinoma(193;1.69e-05)|Kidney(197;0.00173)|KIRC - Kidney renal clear cell carcinoma(197;0.00196)|OV - Ovarian serous cystadenocarcinoma(275;0.0333)														---	---	---	---
STAB1	23166	broad.mit.edu	37	3	52539927	52539927	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52539927G>A	uc003dej.2	+	16	1798	c.1724G>A	c.(1723-1725)CGG>CAG	p.R575Q	STAB1_uc003dei.1_Missense_Mutation_p.R575Q	NM_015136	NP_055951	Q9NY15	STAB1_HUMAN	stabilin 1 precursor	575	Extracellular (Potential).|FAS1 2.				cell adhesion|cell-cell signaling|defense response to bacterium|inflammatory response|negative regulation of angiogenesis|receptor-mediated endocytosis	integral to plasma membrane	bacterial cell surface binding|hyaluronic acid binding|low-density lipoprotein receptor activity|protein disulfide oxidoreductase activity|scavenger receptor activity			large_intestine(3)|upper_aerodigestive_tract(2)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	9				BRCA - Breast invasive adenocarcinoma(193;1.73e-05)|Kidney(197;0.00182)|KIRC - Kidney renal clear cell carcinoma(197;0.00205)|OV - Ovarian serous cystadenocarcinoma(275;0.0482)														---	---	---	---
PBRM1	55193	broad.mit.edu	37	3	52712570	52712570	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52712570T>G	uc003des.2	-	2	194	c.182A>C	c.(181-183)AAG>ACG	p.K61T	PBRM1_uc003dex.2_RNA|PBRM1_uc003deq.2_Missense_Mutation_p.K61T|PBRM1_uc003der.2_Missense_Mutation_p.K61T|PBRM1_uc003det.2_Missense_Mutation_p.K61T|PBRM1_uc003deu.2_Missense_Mutation_p.K61T|PBRM1_uc003dev.2_RNA|PBRM1_uc003dew.2_Missense_Mutation_p.K61T|PBRM1_uc010hmk.1_Missense_Mutation_p.K61T|PBRM1_uc003dey.2_Missense_Mutation_p.K61T|PBRM1_uc003dez.1_Missense_Mutation_p.K61T|PBRM1_uc003dfb.1_5'UTR	NM_181042	NP_060635	Q86U86	PB1_HUMAN	polybromo 1 isoform 4	61					chromatin remodeling|mitosis|negative regulation of cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear chromosome	chromatin binding|DNA binding|protein binding			kidney(136)|breast(4)	140				BRCA - Breast invasive adenocarcinoma(193;1.8e-05)|Kidney(197;0.00105)|KIRC - Kidney renal clear cell carcinoma(197;0.00122)|OV - Ovarian serous cystadenocarcinoma(275;0.0613)				Mis|N|F|S|D|O		clear cell renal carcinoma|breast								---	---	---	---
FAM3D	131177	broad.mit.edu	37	3	58629428	58629428	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:58629428T>C	uc003dkq.2	-	6	580	c.283A>G	c.(283-285)AAC>GAC	p.N95D		NM_138805	NP_620160	Q96BQ1	FAM3D_HUMAN	family with sequence similarity 3, member D	95					negative regulation of insulin secretion	extracellular region	cytokine activity				0				BRCA - Breast invasive adenocarcinoma(55;0.000225)|Kidney(10;0.000667)|KIRC - Kidney renal clear cell carcinoma(10;0.000802)|OV - Ovarian serous cystadenocarcinoma(275;0.169)														---	---	---	---
C3orf67	200844	broad.mit.edu	37	3	58817562	58817562	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:58817562C>A	uc003dkt.1	-	13	1681	c.1272G>T	c.(1270-1272)CAG>CAT	p.Q424H	C3orf67_uc003dkr.1_RNA|C3orf67_uc003dks.1_Missense_Mutation_p.Q365H|uc003dku.1_Intron	NM_198463	NP_940865	Q6ZVT6	CC067_HUMAN	hypothetical protein LOC200844	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment											0		all_cancers(2;0.000156)|all_epithelial(2;0.000493)|Breast(2;0.00446)|all_lung(2;0.074)|Lung NSC(2;0.248)		BRCA - Breast invasive adenocarcinoma(55;5.93e-06)|Kidney(10;0.00155)|KIRC - Kidney renal clear cell carcinoma(10;0.00172)|OV - Ovarian serous cystadenocarcinoma(275;0.23)														---	---	---	---
THOC7	80145	broad.mit.edu	37	3	63825343	63825343	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:63825343G>A	uc003dlt.3	-	2	257	c.126C>T	c.(124-126)TCC>TCT	p.S42S	C3orf49_uc003dls.3_Intron|THOC7_uc003dlu.3_Intron	NM_025075	NP_079351	Q6I9Y2	THOC7_HUMAN	Ngg1 interacting factor 3 like 1 binding protein	42					intronless viral mRNA export from host nucleus|mRNA processing|RNA splicing	cytoplasm|THO complex part of transcription export complex	protein binding|RNA binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3				BRCA - Breast invasive adenocarcinoma(55;0.000439)|Kidney(15;0.00194)|KIRC - Kidney renal clear cell carcinoma(15;0.00218)														---	---	---	---
LRIG1	26018	broad.mit.edu	37	3	66434452	66434452	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:66434452G>A	uc003dmx.2	-	14	2048	c.2034C>T	c.(2032-2034)GCC>GCT	p.A678A	SLC25A26_uc011bft.1_Intron|LRIG1_uc011bfu.1_Silent_p.A298A|LRIG1_uc003dmw.2_Silent_p.A344A|LRIG1_uc010hnz.2_Silent_p.A394A|LRIG1_uc010hoa.2_Intron	NM_015541	NP_056356	Q96JA1	LRIG1_HUMAN	leucine-rich repeats and immunoglobulin-like	678	Extracellular (Potential).|Ig-like C2-type 2.					integral to membrane				skin(3)|ovary(2)	5		Lung NSC(201;0.0101)		BRCA - Breast invasive adenocarcinoma(55;0.00047)														---	---	---	---
ROBO2	6092	broad.mit.edu	37	3	77666706	77666706	+	Silent	SNP	T	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:77666706T>A	uc003dpy.3	+	22	3979	c.3336T>A	c.(3334-3336)ACT>ACA	p.T1112T	ROBO2_uc003dpz.2_Silent_p.T1116T|ROBO2_uc011bgj.1_RNA|ROBO2_uc011bgk.1_Silent_p.T1116T|ROBO2_uc003dqa.2_Silent_p.T239T	NM_002942	NP_002933	Q9HCK4	ROBO2_HUMAN	roundabout, axon guidance receptor, homolog 2	1112	Cytoplasmic (Potential).				apoptosis involved in luteolysis|axon midline choice point recognition|cellular response to hormone stimulus|homophilic cell adhesion|metanephros development|negative regulation of negative chemotaxis|negative regulation of synaptogenesis|olfactory bulb interneuron development|positive regulation of axonogenesis|retinal ganglion cell axon guidance|ureteric bud development	axolemma|cell surface|integral to membrane	axon guidance receptor activity|identical protein binding			lung(5)|skin(3)|ovary(1)|large_intestine(1)|liver(1)	11				Epithelial(33;0.00199)|LUSC - Lung squamous cell carcinoma(21;0.008)|BRCA - Breast invasive adenocarcinoma(55;0.00884)|Lung(72;0.0183)|KIRC - Kidney renal clear cell carcinoma(39;0.0832)|Kidney(39;0.103)														---	---	---	---
MINA	84864	broad.mit.edu	37	3	97677936	97677936	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97677936C>T	uc003drz.1	-	4	1146	c.640G>A	c.(640-642)GAG>AAG	p.E214K	MINA_uc003dsa.1_Missense_Mutation_p.E214K|MINA_uc003dsb.1_Missense_Mutation_p.E214K|MINA_uc003dsc.1_Missense_Mutation_p.E214K|MINA_uc010hpa.1_RNA|MINA_uc010hpb.1_RNA	NM_001042533	NP_001035998	Q8IUF8	MINA_HUMAN	MYC induced nuclear antigen isoform a	214	JmjC.				ribosome biogenesis	cytoplasm|nucleolus				ovary(1)	1																		---	---	---	---
C3orf17	25871	broad.mit.edu	37	3	112724442	112724442	+	Missense_Mutation	SNP	A	G	G	rs150027810		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:112724442A>G	uc003dzr.2	-	9	1706	c.1645T>C	c.(1645-1647)TCA>CCA	p.S549P	GTPBP8_uc011bhy.1_Intron|C3orf17_uc003dzq.2_Missense_Mutation_p.S174P|C3orf17_uc011bhz.1_Missense_Mutation_p.S174P|C3orf17_uc010hqh.2_Missense_Mutation_p.S174P|C3orf17_uc003dzt.2_Missense_Mutation_p.S452P|C3orf17_uc003dzs.2_Missense_Mutation_p.S413P|C3orf17_uc010hqg.2_Missense_Mutation_p.S374P|C3orf17_uc011bia.1_Missense_Mutation_p.S346P|C3orf17_uc003dzu.2_Missense_Mutation_p.S478P|C3orf17_uc011bib.1_Missense_Mutation_p.S438P|C3orf17_uc011bic.1_Missense_Mutation_p.S382P|C3orf17_uc011bid.1_RNA	NM_015412	NP_056227	Q6NW34	CC017_HUMAN	hypothetical protein LOC25871	549						integral to membrane					0																		---	---	---	---
C3orf15	89876	broad.mit.edu	37	3	119434506	119434506	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:119434506G>A	uc003ede.3	+	6	675	c.598G>A	c.(598-600)GTT>ATT	p.V200I	C3orf15_uc003edc.2_Missense_Mutation_p.V200I|C3orf15_uc010hqy.1_Missense_Mutation_p.V200I|C3orf15_uc010hqz.2_Missense_Mutation_p.V138I|C3orf15_uc011bjd.1_Missense_Mutation_p.V74I|C3orf15_uc011bje.1_Missense_Mutation_p.V180I|C3orf15_uc010hra.1_5'UTR	NM_033364	NP_203528	Q7Z4T9	AAT1_HUMAN	AAT1-alpha	200						mitochondrion	protein binding			ovary(2)|pancreas(1)	3				GBM - Glioblastoma multiforme(114;0.186)														---	---	---	---
POLQ	10721	broad.mit.edu	37	3	121206287	121206287	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121206287C>T	uc003eee.3	-	16	5620	c.5491G>A	c.(5491-5493)GCA>ACA	p.A1831T	POLQ_uc003eed.2_Missense_Mutation_p.A1003T	NM_199420	NP_955452	O75417	DPOLQ_HUMAN	DNA polymerase theta	1831					DNA repair|DNA replication	nucleoplasm	ATP binding|ATP-dependent helicase activity|damaged DNA binding|DNA-directed DNA polymerase activity|single-stranded DNA-dependent ATPase activity			ovary(4)|breast(3)|lung(2)|upper_aerodigestive_tract(1)|skin(1)	11				GBM - Glioblastoma multiforme(114;0.0915)									DNA_polymerases_(catalytic_subunits)					---	---	---	---
SLC15A2	6565	broad.mit.edu	37	3	121647836	121647836	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121647836C>T	uc003eep.2	+	16	1502	c.1349C>T	c.(1348-1350)CCA>CTA	p.P450L	SLC15A2_uc011bjn.1_Missense_Mutation_p.P419L	NM_021082	NP_066568	Q16348	S15A2_HUMAN	peptide transporter 2 isoform a	450					protein transport	integral to plasma membrane	peptide:hydrogen symporter activity|protein binding			skin(1)	1				GBM - Glioblastoma multiforme(114;0.0967)	Cefadroxil(DB01140)													---	---	---	---
CD86	942	broad.mit.edu	37	3	121838326	121838326	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121838326G>A	uc003eet.2	+	7	1051	c.935G>A	c.(934-936)CGT>CAT	p.R312H	CD86_uc011bjo.1_Missense_Mutation_p.R230H|CD86_uc011bjp.1_Missense_Mutation_p.R200H|CD86_uc003eeu.2_Missense_Mutation_p.R306H	NM_175862	NP_787058	P42081	CD86_HUMAN	CD86 antigen isoform 1	312	Cytoplasmic (Potential).				interspecies interaction between organisms|positive regulation of cell proliferation|positive regulation of interleukin-2 biosynthetic process|positive regulation of interleukin-4 biosynthetic process|positive regulation of lymphotoxin A biosynthetic process|positive regulation of T-helper 2 cell differentiation|positive regulation of transcription, DNA-dependent|T cell costimulation		coreceptor activity|protein binding			pancreas(1)|skin(1)	2				GBM - Glioblastoma multiforme(114;0.156)	Abatacept(DB01281)													---	---	---	---
KALRN	8997	broad.mit.edu	37	3	124437898	124437898	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124437898G>A	uc003ehg.2	+	60	8669	c.8542G>A	c.(8542-8544)GCC>ACC	p.A2848T	KALRN_uc003ehk.2_Missense_Mutation_p.A1151T	NM_001024660	NP_001019831	O60229	KALRN_HUMAN	kalirin, RhoGEF kinase isoform 1	2847	Protein kinase.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|nervous system development|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|vesicle-mediated transport	actin cytoskeleton|cytosol	ATP binding|GTPase activator activity|metal ion binding|protein binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(2)|ovary(2)|central_nervous_system(1)|skin(1)	6																		---	---	---	---
PLXND1	23129	broad.mit.edu	37	3	129289882	129289882	+	Splice_Site	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:129289882C>T	uc003emx.2	-	18	3700	c.3600_splice	c.e18+1	p.H1200_splice		NM_015103	NP_055918			plexin D1 precursor						axon guidance	integral to membrane|intracellular|plasma membrane				large_intestine(1)	1																		---	---	---	---
TRH	7200	broad.mit.edu	37	3	129694799	129694799	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:129694799G>A	uc003enc.2	+	2	701	c.140G>A	c.(139-141)CGC>CAC	p.R47H		NM_007117	NP_009048	P20396	TRH_HUMAN	thyrotropin-releasing hormone	47					cell-cell signaling|hormone-mediated signaling pathway	extracellular region|soluble fraction	neuropeptide hormone activity|thyrotropin-releasing hormone activity			ovary(1)	1																		---	---	---	---
COL6A6	131873	broad.mit.edu	37	3	130289947	130289947	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130289947A>G	uc010htl.2	+	6	2718	c.2687A>G	c.(2686-2688)GAC>GGC	p.D896G		NM_001102608	NP_001096078	A6NMZ7	CO6A6_HUMAN	collagen type VI alpha 6 precursor	896	VWFA 5.|Nonhelical region.				axon guidance|cell adhesion	collagen				ovary(6)|central_nervous_system(1)|pancreas(1)	8																		---	---	---	---
PIK3R4	30849	broad.mit.edu	37	3	130398201	130398201	+	Silent	SNP	G	A	A	rs140271304		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130398201G>A	uc003enj.2	-	20	4616	c.4035C>T	c.(4033-4035)ATC>ATT	p.I1345I		NM_014602	NP_055417	Q99570	PI3R4_HUMAN	phosphoinositide-3-kinase, regulatory subunit 4	1345	WD 7.				fibroblast growth factor receptor signaling pathway|innate immune response|insulin receptor signaling pathway	cytosol	ATP binding|protein binding|protein serine/threonine kinase activity			ovary(3)|lung(2)|breast(2)|skin(2)|stomach(1)|central_nervous_system(1)|kidney(1)	12																		---	---	---	---
MRPL3	11222	broad.mit.edu	37	3	131197993	131197993	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:131197993T>C	uc003eoh.2	-						MRPL3_uc011blo.1_Intron|MRPL3_uc011blp.1_Intron|SNORA58_uc003eoi.1_RNA	NM_007208	NP_009139			mitochondrial ribosomal protein L3						translation	mitochondrial large ribosomal subunit	RNA binding|structural constituent of ribosome				0																		---	---	---	---
C3orf36	80111	broad.mit.edu	37	3	133647384	133647384	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133647384C>T	uc003epz.1	-	1	1273	c.264G>A	c.(262-264)GCG>GCA	p.A88A		NM_025041	NP_079317	Q3SXR2	CC036_HUMAN	hypothetical protein LOC80111	88										ovary(1)	1																		---	---	---	---
EPHB1	2047	broad.mit.edu	37	3	134880926	134880926	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:134880926C>T	uc003eqt.2	+	7	1709	c.1489C>T	c.(1489-1491)CGG>TGG	p.R497W	EPHB1_uc003equ.2_Missense_Mutation_p.R58W	NM_004441	NP_004432	P54762	EPHB1_HUMAN	ephrin receptor EphB1 precursor	497	Fibronectin type-III 2.|Extracellular (Potential).					integral to plasma membrane	ATP binding|ephrin receptor activity|protein binding			lung(11)|ovary(6)|stomach(4)|breast(3)|central_nervous_system(2)|skin(2)|large_intestine(1)|pancreas(1)	30																		---	---	---	---
EPHB1	2047	broad.mit.edu	37	3	134968296	134968296	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:134968296T>C	uc003eqt.2	+	15	3029	c.2809T>C	c.(2809-2811)TTC>CTC	p.F937L	EPHB1_uc003equ.2_Missense_Mutation_p.F498L	NM_004441	NP_004432	P54762	EPHB1_HUMAN	ephrin receptor EphB1 precursor	937	Cytoplasmic (Potential).|SAM.					integral to plasma membrane	ATP binding|ephrin receptor activity|protein binding			lung(11)|ovary(6)|stomach(4)|breast(3)|central_nervous_system(2)|skin(2)|large_intestine(1)|pancreas(1)	30																		---	---	---	---
MSL2	55167	broad.mit.edu	37	3	135870677	135870677	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:135870677C>T	uc003eqx.1	-	2	1779	c.1046G>A	c.(1045-1047)AGT>AAT	p.S349N	MSL2_uc011bmb.1_Missense_Mutation_p.S275N	NM_018133	NP_060603	Q9HCI7	MSL2_HUMAN	ring finger protein 184 isoform 1	349					histone H4-K16 acetylation	MSL complex	zinc ion binding			central_nervous_system(1)	1																		---	---	---	---
CEP70	80321	broad.mit.edu	37	3	138224312	138224312	+	Intron	SNP	A	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:138224312A>T	uc003esl.2	-						CEP70_uc011bmk.1_Intron|CEP70_uc011bml.1_Intron|CEP70_uc011bmm.1_Intron|CEP70_uc003esm.2_Intron	NM_024491	NP_077817			centrosomal protein 70 kDa						G2/M transition of mitotic cell cycle	centrosome|cytosol	protein binding			skin(1)	1																		---	---	---	---
FOXL2	668	broad.mit.edu	37	3	138665150	138665150	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:138665150C>T	uc003esw.2	-	1	833	c.415G>A	c.(415-417)GAG>AAG	p.E139K	uc003esv.1_5'Flank|C3orf72_uc003esx.1_5'Flank|C3orf72_uc011bmr.1_5'Flank	NM_023067	NP_075555	P58012	FOXL2_HUMAN	forkhead box L2	139	Fork-head.				convergent extension|DNA fragmentation involved in apoptotic nuclear change|embryonic eye morphogenesis|extraocular skeletal muscle development|female somatic sex determination|induction of apoptosis|menstruation|negative regulation of transcription, DNA-dependent|ovarian follicle development|pattern specification process|positive regulation of caspase activity|positive regulation of transcription from RNA polymerase II promoter|regulation of sequence-specific DNA binding transcription factor activity	transcription factor complex	caspase regulator activity|DNA bending activity|double-stranded DNA binding|estrogen receptor binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding|ubiquitin conjugating enzyme binding			ovary(266)|large_intestine(1)|skin(1)	268								Mis		granulosa-cell tumour of the ovary		Blepharophimosis|ptosis and epicanthus inversus Types I|II; Premature ovarian failure type III						---	---	---	---
RBP2	5948	broad.mit.edu	37	3	139173610	139173610	+	Silent	SNP	G	A	A	rs141722744		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:139173610G>A	uc003eth.2	-	3	366	c.315C>T	c.(313-315)CGC>CGT	p.R105R		NM_004164	NP_004155	P50120	RET2_HUMAN	retinol binding protein 2, cellular	105					epidermis development|retinoid metabolic process|steroid metabolic process|vitamin A metabolic process	cytosol	retinal binding|retinol binding|transporter activity			skin(1)	1					Vitamin A(DB00162)													---	---	---	---
GRK7	131890	broad.mit.edu	37	3	141499527	141499527	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:141499527T>C	uc011bnd.1	+	2	1008	c.924T>C	c.(922-924)CAT>CAC	p.H308H		NM_139209	NP_631948	Q8WTQ7	GRK7_HUMAN	G-protein-coupled receptor kinase 7 precursor	308	Protein kinase.				visual perception	membrane	ATP binding|G-protein coupled receptor kinase activity|signal transducer activity			lung(2)|stomach(1)|ovary(1)|skin(1)	5																		---	---	---	---
CHST2	9435	broad.mit.edu	37	3	142840569	142840569	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:142840569A>G	uc003evm.2	+	2	1800	c.911A>G	c.(910-912)AAG>AGG	p.K304R		NM_004267	NP_004258	Q9Y4C5	CHST2_HUMAN	carbohydrate (N-acetylglucosamine-6-O)	304	Lumenal (Potential).			K->A: Loss of function.	inflammatory response|multicellular organismal development|N-acetylglucosamine metabolic process|sulfur compound metabolic process	integral to membrane|intrinsic to Golgi membrane|trans-Golgi network	N-acetylglucosamine 6-O-sulfotransferase activity			ovary(3)	3																		---	---	---	---
RNF13	11342	broad.mit.edu	37	3	149678725	149678725	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:149678725C>T	uc003exn.3	+	11	1764	c.980C>T	c.(979-981)TCG>TTG	p.S327L	RNF13_uc003exp.3_Missense_Mutation_p.S327L|RNF13_uc010hvh.2_Missense_Mutation_p.S208L	NM_007282	NP_009213	O43567	RNF13_HUMAN	ring finger protein 13	327	Cytoplasmic (Potential).				protein autoubiquitination	endoplasmic reticulum membrane|Golgi membrane|integral to membrane|late endosome membrane|lysosomal membrane|nuclear inner membrane	ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1		all_neural(597;0.0138)|Myeloproliferative disorder(1037;0.0255)	LUSC - Lung squamous cell carcinoma(72;0.0538)|Lung(72;0.066)															---	---	---	---
P2RY12	64805	broad.mit.edu	37	3	151056359	151056359	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:151056359A>G	uc003eyw.1	-	2	491	c.275T>C	c.(274-276)CTG>CCG	p.L92P	MED12L_uc011bnz.1_Intron|MED12L_uc003eyp.2_Intron|P2RY12_uc011boa.1_Missense_Mutation_p.L92P|P2RY12_uc003eyx.1_Missense_Mutation_p.L92P	NM_176876	NP_795345	Q9H244	P2Y12_HUMAN	purinergic receptor P2Y12	92	Extracellular (Potential).				platelet activation	integral to membrane|plasma membrane	guanyl-nucleotide exchange factor activity			skin(1)	1			LUSC - Lung squamous cell carcinoma(72;0.0394)|Lung(72;0.0517)		Clopidogrel(DB00758)|Epoprostenol(DB01240)|Ticlopidine(DB00208)|Treprostinil(DB00374)													---	---	---	---
MED12L	116931	broad.mit.edu	37	3	151072930	151072930	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:151072930C>T	uc003eyp.2	+	16	2353	c.2315C>T	c.(2314-2316)GCC>GTC	p.A772V	MED12L_uc011bnz.1_Missense_Mutation_p.A632V|P2RY12_uc011boa.1_Intron|P2RY12_uc003eyx.1_Intron|MED12L_uc003eyy.1_5'Flank	NM_053002	NP_443728	Q86YW9	MD12L_HUMAN	mediator of RNA polymerase II transcription,	772					regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	mediator complex				ovary(4)|large_intestine(1)|central_nervous_system(1)|skin(1)	7			LUSC - Lung squamous cell carcinoma(72;0.0394)|Lung(72;0.0517)															---	---	---	---
AADAC	13	broad.mit.edu	37	3	151531947	151531947	+	5'UTR	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:151531947C>A	uc003eze.2	+	1						NM_001086	NP_001077			arylacetamide deacetylase						positive regulation of triglyceride catabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	carboxylesterase activity|deacetylase activity|serine hydrolase activity|triglyceride lipase activity			skin(2)	2		Myeloproliferative disorder(1037;0.0255)|all_neural(597;0.112)	LUSC - Lung squamous cell carcinoma(72;0.0394)|Lung(72;0.0813)															---	---	---	---
P2RY1	5028	broad.mit.edu	37	3	152553984	152553984	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:152553984G>A	uc003ezq.2	+	1	1249	c.413G>A	c.(412-414)AGC>AAC	p.S138N		NM_002563	NP_002554	P47900	P2RY1_HUMAN	purinergic receptor P2Y1	138	Helical; Name=3; (Potential).			Missing (in Ref. 1; CAA89066).	activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|platelet activation	integral to plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			lung(1)	1			LUSC - Lung squamous cell carcinoma(72;0.0628)|Lung(72;0.11)															---	---	---	---
CCNL1	57018	broad.mit.edu	37	3	156867298	156867298	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:156867298T>C	uc003fbf.2	-	9	1708	c.1109A>G	c.(1108-1110)CAG>CGG	p.Q370R	CCNL1_uc003fbd.1_Missense_Mutation_p.Q370R|CCNL1_uc003fbe.2_Missense_Mutation_p.Q164R|CCNL1_uc003fbg.2_RNA|CCNL1_uc011bor.1_RNA|CCNL1_uc003fbi.1_Missense_Mutation_p.Q215R	NM_020307	NP_064703	Q9UK58	CCNL1_HUMAN	cyclin L1	370					regulation of cyclin-dependent protein kinase activity|regulation of transcription, DNA-dependent|RNA processing|transcription, DNA-dependent	nuclear speck	protein kinase binding			lung(3)|breast(1)|skin(1)	5			LUSC - Lung squamous cell carcinoma(72;0.0295)|Lung(72;0.0308)															---	---	---	---
SMC4	10051	broad.mit.edu	37	3	160119879	160119879	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160119879A>G	uc003fdh.2	+	3	429	c.316A>G	c.(316-318)AAG>GAG	p.K106E	IFT80_uc003fda.2_Intron|IFT80_uc011boy.1_5'Flank|IFT80_uc003fdd.1_5'Flank|IFT80_uc003fde.1_5'Flank|SMC4_uc003fdf.1_RNA|SMC4_uc003fdg.1_Missense_Mutation_p.K106E|SMC4_uc010hwc.1_Intron|SMC4_uc003fdi.2_Missense_Mutation_p.K81E|SMC4_uc003fdj.2_Missense_Mutation_p.K106E|SMC4_uc010hwd.2_Missense_Mutation_p.K106E|uc011boz.1_5'Flank|MIR15B_hsa-mir-15b|MI0000438_5'Flank|uc003fdk.2_5'Flank|MIR16-2_hsa-mir-16-2|MI0000115_5'Flank	NM_001002800	NP_001002800	Q9NTJ3	SMC4_HUMAN	SMC4 structural maintenance of chromosomes	106					cell division|mitotic chromosome condensation	condensin complex|cytoplasm|nucleus	ATP binding|protein heterodimerization activity			ovary(1)|breast(1)	2			Lung(72;0.00334)|LUSC - Lung squamous cell carcinoma(72;0.00523)															---	---	---	---
SMC4	10051	broad.mit.edu	37	3	160142781	160142781	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160142781C>T	uc003fdh.2	+	16	2565	c.2452C>T	c.(2452-2454)CTA>TTA	p.L818L	IFT80_uc003fda.2_Intron|SMC4_uc010hwc.1_Silent_p.L582L|SMC4_uc003fdi.2_Silent_p.L793L|SMC4_uc003fdj.2_Silent_p.L818L|SMC4_uc010hwd.2_Silent_p.L818L|SMC4_uc003fdl.2_Silent_p.L521L	NM_001002800	NP_001002800	Q9NTJ3	SMC4_HUMAN	SMC4 structural maintenance of chromosomes	818	Potential.				cell division|mitotic chromosome condensation	condensin complex|cytoplasm|nucleus	ATP binding|protein heterodimerization activity			ovary(1)|breast(1)	2			Lung(72;0.00334)|LUSC - Lung squamous cell carcinoma(72;0.00523)															---	---	---	---
ARL14	80117	broad.mit.edu	37	3	160395131	160395131	+	5'UTR	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160395131T>C	uc003fdq.2	+	1						NM_025047	NP_079323			ADP-ribosylation factor-like 14						small GTPase mediated signal transduction	intracellular	GTP binding				0			Lung(72;7.02e-05)|LUSC - Lung squamous cell carcinoma(72;7.23e-05)															---	---	---	---
SI	6476	broad.mit.edu	37	3	164739180	164739180	+	Intron	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164739180G>T	uc003fei.2	-							NM_001041	NP_001032			sucrase-isomaltase						carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---
SI	6476	broad.mit.edu	37	3	164754250	164754250	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164754250T>C	uc003fei.2	-	22	2504	c.2442A>G	c.(2440-2442)CTA>CTG	p.L814L		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	814	Lumenal.|Isomaltase.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---
SI	6476	broad.mit.edu	37	3	164786978	164786978	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164786978A>G	uc003fei.2	-	4	323	c.261T>C	c.(259-261)ATT>ATC	p.I87I		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	87	Lumenal.|P-type 1.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---
BCHE	590	broad.mit.edu	37	3	165548072	165548072	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:165548072C>A	uc003fem.3	-	2	910	c.750G>T	c.(748-750)CTG>CTT	p.L250L	BCHE_uc003fen.3_Intron	NM_000055	NP_000046	P06276	CHLE_HUMAN	butyrylcholinesterase precursor	250					choline metabolic process|cocaine metabolic process|synaptic transmission, cholinergic	endoplasmic reticulum lumen|extracellular space|membrane	acetylcholinesterase activity|beta-amyloid binding|carboxylesterase activity|cholinesterase activity|enzyme binding			ovary(3)|pancreas(1)	4					Ambenonium(DB01122)|Atropine(DB00572)|Bambuterol(DB01408)|Chlorpromazine(DB00477)|Choline(DB00122)|Cinnarizine(DB00568)|Demecarium bromide(DB00944)|Dibucaine(DB00527)|Donepezil(DB00843)|Echothiophate Iodide(DB01057)|Edrophonium(DB01010)|Ethopropazine(DB00392)|Etomidate(DB00292)|Galantamine(DB00674)|Hexafluronium bromide(DB00941)|Isoflurophate(DB00677)|Mefloquine(DB00358)|Mivacurium(DB01226)|Neostigmine(DB01400)|Pancuronium(DB01337)|Pralidoxime(DB00733)|Procainamide(DB01035)|Pyridostigmine(DB00545)|Rivastigmine(DB00989)|Succinylcholine(DB00202)|Terbutaline(DB00871)|Trimethaphan(DB01116)													---	---	---	---
SLC7A14	57709	broad.mit.edu	37	3	170218995	170218995	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:170218995C>T	uc003fgz.2	-	3	760	c.444G>A	c.(442-444)GCG>GCA	p.A148A	CLDN11_uc011bpt.1_Intron|uc003fha.1_Intron	NM_020949	NP_066000	Q8TBB6	S7A14_HUMAN	solute carrier family 7 (cationic amino acid	148						integral to membrane	amino acid transmembrane transporter activity			ovary(2)|upper_aerodigestive_tract(1)|liver(1)|central_nervous_system(1)	5	all_cancers(22;2.41e-22)|all_epithelial(15;4.2e-27)|all_lung(20;1.17e-16)|Lung NSC(18;4.91e-16)|Ovarian(172;0.000902)|Breast(254;0.137)		Lung(28;6.23e-13)|LUSC - Lung squamous cell carcinoma(14;1.48e-12)															---	---	---	---
FNDC3B	64778	broad.mit.edu	37	3	172013305	172013305	+	Splice_Site	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:172013305G>A	uc003fhy.2	+	8	1173	c.1001_splice	c.e8+1	p.S334_splice	FNDC3B_uc003fhz.3_Splice_Site_p.S334_splice|FNDC3B_uc003fia.2_Splice_Site_p.S265_splice	NM_022763	NP_073600			fibronectin type III domain containing 3B							endoplasmic reticulum|integral to membrane				ovary(2)|breast(1)	3	all_cancers(22;1.01e-18)|Ovarian(172;0.00167)|Breast(254;0.165)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)	GBM - Glioblastoma multiforme(1;0.0494)														---	---	---	---
PIK3CA	5290	broad.mit.edu	37	3	178927980	178927980	+	Missense_Mutation	SNP	T	C	C	rs121913272		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:178927980T>C	uc003fjk.2	+	8	1415	c.1258T>C	c.(1258-1260)TGT>CGT	p.C420R		NM_006218	NP_006209	P42336	PK3CA_HUMAN	phosphoinositide-3-kinase, catalytic, alpha	420	C2 PI3K-type.		C -> R (in cancer; shows an increase in lipid kinase activity; may increase the affinity for lipid membranes).		epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|platelet activation|T cell costimulation|T cell receptor signaling pathway		1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity	p.C420R(26)		breast(1564)|large_intestine(776)|endometrium(246)|urinary_tract(195)|ovary(141)|skin(112)|stomach(98)|thyroid(77)|central_nervous_system(69)|lung(65)|upper_aerodigestive_tract(58)|haematopoietic_and_lymphoid_tissue(27)|cervix(25)|biliary_tract(22)|liver(20)|oesophagus(17)|pancreas(11)|penis(8)|pituitary(8)|autonomic_ganglia(4)|prostate(3)|kidney(2)|meninges(1)|eye(1)|NS(1)|soft_tissue(1)|bone(1)	3553	all_cancers(143;1.19e-17)|Ovarian(172;0.00769)|Breast(254;0.155)		OV - Ovarian serous cystadenocarcinoma(80;9.59e-28)|GBM - Glioblastoma multiforme(14;0.003)|BRCA - Breast invasive adenocarcinoma(182;0.0282)			C420R(EFM192A_BREAST)|C420R(OVISE_OVARY)|C420R(HEC151_ENDOMETRIUM)|C420R(CCK81_LARGE_INTESTINE)	57	Mis		colorectal|gastric|gliobastoma|breast					HNSCC(19;0.045)|TSP Lung(28;0.18)			---	---	---	---
MCF2L2	23101	broad.mit.edu	37	3	183097179	183097179	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183097179C>T	uc003fli.1	-	3	271	c.181G>A	c.(181-183)GCC>ACC	p.A61T	MCF2L2_uc003flj.1_Missense_Mutation_p.A61T|MCF2L2_uc003flp.1_Missense_Mutation_p.A96T	NM_015078	NP_055893	Q86YR7	MF2L2_HUMAN	Rho family guanine-nucleotide exchange factor	61	CRAL-TRIO.				regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			ovary(2)|large_intestine(2)|breast(1)	5	all_cancers(143;1.26e-12)|Ovarian(172;0.0355)		all cancers(12;3.35e-44)|Epithelial(37;6.48e-38)|LUSC - Lung squamous cell carcinoma(7;7.12e-25)|Lung(8;6.39e-23)|OV - Ovarian serous cystadenocarcinoma(80;6.75e-21)															---	---	---	---
DVL3	1857	broad.mit.edu	37	3	183882993	183882993	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183882993G>A	uc003fms.2	+	6	832	c.692G>A	c.(691-693)CGG>CAG	p.R231Q	DVL3_uc011bqw.1_Missense_Mutation_p.R231Q|DVL3_uc003fmt.2_5'UTR|DVL3_uc003fmu.2_Missense_Mutation_p.R63Q	NM_004423	NP_004414	Q92997	DVL3_HUMAN	dishevelled 3	231					canonical Wnt receptor signaling pathway|intracellular signal transduction|positive regulation of JUN kinase activity|positive regulation of protein phosphorylation|positive regulation of transcription, DNA-dependent	cytoplasm	beta-catenin binding|frizzled binding|protease binding|protein heterodimerization activity|signal transducer activity			ovary(1)|lung(1)|breast(1)	3	all_cancers(143;1.12e-10)|Ovarian(172;0.0339)		Epithelial(37;2.08e-34)|OV - Ovarian serous cystadenocarcinoma(80;1.31e-22)															---	---	---	---
VPS8	23355	broad.mit.edu	37	3	184570321	184570321	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184570321G>A	uc003fpb.1	+	10	952	c.781G>A	c.(781-783)GAC>AAC	p.D261N	VPS8_uc010hyd.1_Missense_Mutation_p.D261N	NM_015303	NP_056118	Q8N3P4	VPS8_HUMAN	vacuolar protein sorting 8 homolog isoform b	263							zinc ion binding			ovary(1)	1	all_cancers(143;2.51e-11)|Ovarian(172;0.0339)|Breast(254;0.247)		Epithelial(37;1.02e-33)|OV - Ovarian serous cystadenocarcinoma(80;4.81e-22)															---	---	---	---
MASP1	5648	broad.mit.edu	37	3	186954047	186954047	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186954047G>A	uc003frh.1	-						MASP1_uc003fri.2_Nonsense_Mutation_p.R538*|MASP1_uc003frj.2_Nonsense_Mutation_p.R507*	NM_001879	NP_001870			mannan-binding lectin serine protease 1 isoform						complement activation, lectin pathway|negative regulation of complement activation|proteolysis	extracellular space	calcium ion binding|calcium-dependent protein binding|protein binding|protein homodimerization activity|serine-type endopeptidase activity			ovary(2)|breast(1)|liver(1)	4	all_cancers(143;5.33e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;3.49e-18)	GBM - Glioblastoma multiforme(93;0.0366)														---	---	---	---
ATP13A4	84239	broad.mit.edu	37	3	193153486	193153486	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:193153486A>G	uc003ftd.2	-	24	2828	c.2720T>C	c.(2719-2721)ATG>ACG	p.M907T	ATP13A4_uc010hzi.2_RNA	NM_032279	NP_115655	Q4VNC1	AT134_HUMAN	ATPase type 13A4	907	Helical; (Potential).				ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			ovary(2)	2	all_cancers(143;1.76e-08)|Ovarian(172;0.0386)		OV - Ovarian serous cystadenocarcinoma(49;2.72e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;0.000109)														---	---	---	---
LRRC15	131578	broad.mit.edu	37	3	194080146	194080146	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194080146C>T	uc003ftu.2	-	2	1713	c.1627G>A	c.(1627-1629)GCC>ACC	p.A543T	LRRC15_uc003ftt.2_Missense_Mutation_p.A549T	NM_130830	NP_570843	Q8TF66	LRC15_HUMAN	leucine rich repeat containing 15 isoform b	543	Helical; (Potential).					integral to membrane				ovary(3)	3	all_cancers(143;5.31e-09)|Ovarian(172;0.0634)		OV - Ovarian serous cystadenocarcinoma(49;2.2e-17)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;4.94e-05)														---	---	---	---
ATP13A3	79572	broad.mit.edu	37	3	194147932	194147932	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194147932C>T	uc003fty.3	-	28	3399	c.2997G>A	c.(2995-2997)TCG>TCA	p.S999S	ATP13A3_uc003ftx.3_5'Flank	NM_024524	NP_078800	Q9H7F0	AT133_HUMAN	ATPase type 13A3	999					ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			ovary(1)	1	all_cancers(143;6.01e-09)|Ovarian(172;0.0634)	Melanoma(1037;0.211)	OV - Ovarian serous cystadenocarcinoma(49;3.83e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;5.98e-05)														---	---	---	---
C3orf21	152002	broad.mit.edu	37	3	194947467	194947467	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194947467G>A	uc003fum.3	-	2	731	c.623C>T	c.(622-624)TCG>TTG	p.S208L	C3orf21_uc011bsw.1_Missense_Mutation_p.S62L	NM_152531	NP_689744	Q8NBI6	CC021_HUMAN	hypothetical protein LOC152002	208						integral to membrane	transferase activity, transferring glycosyl groups				0	all_cancers(143;9.33e-09)|Ovarian(172;0.0634)		Epithelial(36;1.73e-20)|all cancers(36;1.42e-18)|OV - Ovarian serous cystadenocarcinoma(49;1.56e-17)|Lung(62;0.000117)|LUSC - Lung squamous cell carcinoma(58;0.000146)	GBM - Glioblastoma multiforme(46;1.36e-05)														---	---	---	---
MFI2	4241	broad.mit.edu	37	3	196748318	196748318	+	Silent	SNP	G	A	A	rs148913417	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196748318G>A	uc003fxk.3	-	6	782	c.669C>T	c.(667-669)GAC>GAT	p.D223D	MFI2_uc003fxl.3_Silent_p.D223D|MFI2_uc011bua.1_Missense_Mutation_p.T196M	NM_005929	NP_005920	P08582	TRFM_HUMAN	melanoma-associated antigen p97 isoform 1	223	Transferrin-like 1.				cellular iron ion homeostasis|iron ion transport	anchored to membrane|extracellular region|integral to plasma membrane	ferric iron binding|protein binding				0	all_cancers(143;3.95e-09)|Ovarian(172;0.0634)|Breast(254;0.0838)		Epithelial(36;4.55e-24)|all cancers(36;2.87e-22)|OV - Ovarian serous cystadenocarcinoma(49;1.76e-18)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.00536)														---	---	---	---
TMEM175	84286	broad.mit.edu	37	4	941568	941568	+	Missense_Mutation	SNP	C	A	A	rs148512239	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:941568C>A	uc003gbq.2	+	2	139	c.41C>A	c.(40-42)CCG>CAG	p.P14Q	TMEM175_uc010ibl.1_Missense_Mutation_p.P14Q|TMEM175_uc003gbp.1_5'UTR|TMEM175_uc003gbr.2_5'UTR|TMEM175_uc003gbu.2_Intron|TMEM175_uc003gbs.2_5'UTR|TMEM175_uc003gbt.2_5'UTR|TMEM175_uc003gbv.2_Intron	NM_032326	NP_115702	Q9BSA9	TM175_HUMAN	transmembrane protein 175	14						integral to membrane					0			OV - Ovarian serous cystadenocarcinoma(23;0.0158)															---	---	---	---
FAM53A	152877	broad.mit.edu	37	4	1656776	1656776	+	Silent	SNP	G	T	T	rs142856177	byFrequency;by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:1656776G>T	uc011bve.1	-	4	1009	c.811C>A	c.(811-813)CGG>AGG	p.R271R	FAM53A_uc010ibw.2_Silent_p.R271R	NM_001013622	NP_001013644	Q6NSI3	FA53A_HUMAN	dorsal neural-tube nuclear protein	271	Nuclear localization signal (Potential).					nucleus					0		all_epithelial(65;0.206)|Breast(71;0.212)	OV - Ovarian serous cystadenocarcinoma(23;0.0145)															---	---	---	---
WHSC1	7468	broad.mit.edu	37	4	1906092	1906092	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:1906092T>C	uc003gdz.3	+	3	923	c.747T>C	c.(745-747)TAT>TAC	p.Y249Y	WHSC1_uc003geb.3_Silent_p.Y249Y|WHSC1_uc003gec.3_Silent_p.Y249Y|WHSC1_uc003ged.3_Silent_p.Y249Y|WHSC1_uc003gee.3_RNA|WHSC1_uc003gef.3_RNA|WHSC1_uc003gdx.2_Silent_p.Y249Y|WHSC1_uc003gdy.1_Silent_p.Y249Y|WHSC1_uc010icd.1_Silent_p.Y249Y|WHSC1_uc003gea.1_Silent_p.Y249Y|WHSC1_uc010ice.1_Silent_p.Y249Y|WHSC1_uc003geg.1_Silent_p.Y249Y|WHSC1_uc003geh.1_Silent_p.Y249Y	NM_001042424	NP_001035889	O96028	NSD2_HUMAN	Wolf-Hirschhorn syndrome candidate 1 protein	249	PWWP 1.				anatomical structure morphogenesis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|cytoplasm|nuclear membrane|nucleolus	DNA binding|histone-lysine N-methyltransferase activity|zinc ion binding			ovary(3)|lung(3)|skin(2)|pancreas(1)	9		all_epithelial(65;1.34e-05)	OV - Ovarian serous cystadenocarcinoma(23;0.00606)	STAD - Stomach adenocarcinoma(129;0.232)				T	IGH@	MM								---	---	---	---
ZFYVE28	57732	broad.mit.edu	37	4	2306773	2306773	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:2306773C>T	uc003gex.1	-	8	1613	c.1294G>A	c.(1294-1296)GAC>AAC	p.D432N	ZFYVE28_uc011bvk.1_Missense_Mutation_p.D362N|ZFYVE28_uc011bvl.1_Missense_Mutation_p.D402N|ZFYVE28_uc003gew.1_Missense_Mutation_p.D318N	NM_020972	NP_066023	Q9HCC9	LST2_HUMAN	zinc finger, FYVE domain containing 28	432					negative regulation of epidermal growth factor receptor activity	cytosol|early endosome membrane	metal ion binding|phosphatidylinositol-3-phosphate binding|protein binding			skin(2)|ovary(1)	3																		---	---	---	---
STK32B	55351	broad.mit.edu	37	4	5399935	5399935	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:5399935G>A	uc003gih.1	+	5	500	c.436G>A	c.(436-438)GAC>AAC	p.D146N	STK32B_uc010ida.1_Missense_Mutation_p.D99N	NM_018401	NP_060871	Q9NY57	ST32B_HUMAN	serine/threonine kinase 32B	146	Protein kinase.	Proton acceptor (By similarity).					ATP binding|metal ion binding|protein serine/threonine kinase activity			breast(2)|large_intestine(1)|central_nervous_system(1)|skin(1)	5																		---	---	---	---
WFS1	7466	broad.mit.edu	37	4	6302928	6302928	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:6302928C>T	uc003giy.2	+	8	1572	c.1406C>T	c.(1405-1407)TCG>TTG	p.S469L	WFS1_uc003gix.2_Missense_Mutation_p.S469L|WFS1_uc003giz.2_Missense_Mutation_p.S287L	NM_001145853	NP_001139325	O76024	WFS1_HUMAN	wolframin	469	Helical; (Potential).				endoplasmic reticulum calcium ion homeostasis|endoplasmic reticulum unfolded protein response|ER overload response|ER-associated protein catabolic process|glucose homeostasis|kidney development|negative regulation of neuron apoptosis|negative regulation of sequence-specific DNA binding transcription factor activity|polyubiquitinated misfolded protein transport|positive regulation of calcium ion transport|positive regulation of growth|positive regulation of protein ubiquitination|positive regulation of proteolysis|protein stabilization|renal water homeostasis|sensory perception of sound|visual perception	dendrite|integral to endoplasmic reticulum membrane	activating transcription factor binding|ATPase binding|transporter activity|ubiquitin protein ligase binding			central_nervous_system(2)	2				Colorectal(103;0.0512)														---	---	---	---
CCDC96	257236	broad.mit.edu	37	4	7043252	7043252	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:7043252C>T	uc003gjv.2	-	1	1477	c.1414G>A	c.(1414-1416)GCC>ACC	p.A472T	TADA2B_uc003gjw.3_5'Flank|TADA2B_uc010idi.2_5'Flank	NM_153376	NP_699207	Q2M329	CCD96_HUMAN	coiled-coil domain containing 96	472											0																		---	---	---	---
SLC2A9	56606	broad.mit.edu	37	4	9943581	9943581	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:9943581C>T	uc003gmc.2	-	6	831	c.770G>A	c.(769-771)CGC>CAC	p.R257H	SLC2A9_uc003gmd.2_Missense_Mutation_p.R228H	NM_020041	NP_064425	Q9NRM0	GTR9_HUMAN	solute carrier family 2, member 9 protein	257	Cytoplasmic (Potential).				glucose transport|urate metabolic process	integral to membrane|plasma membrane	sugar:hydrogen symporter activity			ovary(3)	3																		---	---	---	---
PROM1	8842	broad.mit.edu	37	4	16026930	16026930	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:16026930C>T	uc003goo.2	-	5	727	c.515G>A	c.(514-516)GGC>GAC	p.G172D	PROM1_uc003gor.2_Missense_Mutation_p.G172D|PROM1_uc003gos.2_Missense_Mutation_p.G163D|PROM1_uc003got.2_Missense_Mutation_p.G172D|PROM1_uc003gou.2_Missense_Mutation_p.G163D|PROM1_uc003gop.2_Missense_Mutation_p.G163D|PROM1_uc003goq.3_Missense_Mutation_p.G163D|PROM1_uc010iec.1_Missense_Mutation_p.G50D	NM_006017	NP_006008	O43490	PROM1_HUMAN	prominin 1 isoform 1	172	Helical; (Potential).				camera-type eye photoreceptor cell differentiation|photoreceptor cell maintenance|retina layer formation	apical plasma membrane|cell surface|integral to plasma membrane|microvillus membrane|photoreceptor outer segment membrane|plasma membrane	beta-actinin binding|cadherin binding			ovary(3)|upper_aerodigestive_tract(1)|lung(1)|kidney(1)|central_nervous_system(1)	7																		---	---	---	---
NCAPG	64151	broad.mit.edu	37	4	17838932	17838932	+	Missense_Mutation	SNP	G	A	A	rs111401034		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:17838932G>A	uc003gpp.2	+	15	2436	c.2260G>A	c.(2260-2262)GTG>ATG	p.V754M	NCAPG_uc011bxj.1_Missense_Mutation_p.V263M	NM_022346	NP_071741	Q9BPX3	CND3_HUMAN	chromosome condensation protein G	754					cell division|mitotic chromosome condensation	condensin complex|cytoplasm|nucleus	protein binding			large_intestine(1)	1				STAD - Stomach adenocarcinoma(129;0.18)														---	---	---	---
PACRGL	133015	broad.mit.edu	37	4	20715115	20715115	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:20715115G>A	uc010iek.2	+	7	953	c.562G>A	c.(562-564)GTT>ATT	p.V188I	PACRGL_uc003gpu.2_RNA|PACRGL_uc010iei.1_Missense_Mutation_p.V236I|PACRGL_uc003gpz.2_Missense_Mutation_p.V188I|PACRGL_uc011bxm.1_Missense_Mutation_p.V135I|PACRGL_uc003gqa.2_Missense_Mutation_p.V90I|PACRGL_uc003gpx.3_RNA|PACRGL_uc003gpv.2_Missense_Mutation_p.V188I|PACRGL_uc003gpw.2_RNA|PACRGL_uc010iej.1_RNA|PACRGL_uc011bxn.1_Missense_Mutation_p.V90I|PACRGL_uc003gpy.2_Missense_Mutation_p.V135I	NM_145048	NP_659485	Q8N7B6	PACRL_HUMAN	PARK2 co-regulated-like isoform 1	188							binding				0																		---	---	---	---
ARAP2	116984	broad.mit.edu	37	4	36231038	36231038	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:36231038A>C	uc003gsq.1	-	2	409	c.71T>G	c.(70-72)CTC>CGC	p.L24R	ARAP2_uc003gsr.1_Missense_Mutation_p.L24R	NM_015230	NP_056045	Q8WZ64	ARAP2_HUMAN	ArfGAP with RhoGAP domain, ankyrin repeat and PH	24	SAM.				regulation of ARF GTPase activity|small GTPase mediated signal transduction	cytosol	ARF GTPase activator activity|phosphatidylinositol-3,4,5-trisphosphate binding|zinc ion binding			ovary(1)|pancreas(1)|skin(1)	3																		---	---	---	---
TLR10	81793	broad.mit.edu	37	4	38775306	38775306	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:38775306C>T	uc003gti.2	-	2	2285	c.1906G>A	c.(1906-1908)GCA>ACA	p.A636T	TLR10_uc003gtj.2_Missense_Mutation_p.A636T|TLR10_uc003gtk.2_Missense_Mutation_p.A636T	NM_030956	NP_112218	Q9BXR5	TLR10_HUMAN	toll-like receptor 10 precursor	636	TIR.|Cytoplasmic (Potential).				inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway	integral to membrane|plasma membrane	transmembrane receptor activity			lung(1)|breast(1)	2																		---	---	---	---
KLHL5	51088	broad.mit.edu	37	4	39109197	39109197	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:39109197G>A	uc003gts.2	+	8	1747	c.1672G>A	c.(1672-1674)GTA>ATA	p.V558I	KLHL5_uc003gtp.2_Missense_Mutation_p.V512I|KLHL5_uc003gtq.2_Missense_Mutation_p.V371I|KLHL5_uc003gtr.1_Missense_Mutation_p.V558I|KLHL5_uc003gtt.2_Missense_Mutation_p.V497I	NM_015990	NP_057074	Q96PQ7	KLHL5_HUMAN	kelch-like 5 isoform 1	558	Kelch 2.					cytoplasm|cytoskeleton	actin binding			ovary(1)	1																		---	---	---	---
KCTD8	386617	broad.mit.edu	37	4	44450036	44450036	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:44450036C>T	uc003gwu.2	-	1	789	c.505G>A	c.(505-507)GTC>ATC	p.V169I		NM_198353	NP_938167	Q6ZWB6	KCTD8_HUMAN	potassium channel tetramerisation domain	169						cell junction|postsynaptic membrane|presynaptic membrane|voltage-gated potassium channel complex	voltage-gated potassium channel activity			central_nervous_system(2)|ovary(1)	3															HNSCC(17;0.042)			---	---	---	---
COMMD8	54951	broad.mit.edu	37	4	47455198	47455198	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47455198G>A	uc003gxi.2	-	4	417	c.409C>T	c.(409-411)CGA>TGA	p.R137*		NM_017845	NP_060315	Q9NX08	COMD8_HUMAN	COMM domain containing 8	137	COMM.						protein binding				0																		---	---	---	---
CNGA1	1259	broad.mit.edu	37	4	47942795	47942795	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47942795C>T	uc003gxt.3	-	10	915	c.649G>A	c.(649-651)GTA>ATA	p.V217I	uc003gxr.1_Intron|CNGA1_uc003gxu.2_Missense_Mutation_p.V286I	NM_000087	NP_000078	P29973	CNGA1_HUMAN	cyclic nucleotide gated channel alpha 1 isoform	217	Helical; Name=H2; (Potential).				response to stimulus|visual perception	integral to plasma membrane	cGMP binding|ion channel activity			ovary(2)	2																		---	---	---	---
FRYL	285527	broad.mit.edu	37	4	48595988	48595988	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:48595988T>C	uc003gyh.1	-	16	1899	c.1294A>G	c.(1294-1296)AGT>GGT	p.S432G	FRYL_uc003gyk.2_Missense_Mutation_p.S432G	NM_015030	NP_055845	O94915	FRYL_HUMAN	furry-like	432					regulation of transcription, DNA-dependent|transcription, DNA-dependent		protein binding			skin(1)	1																		---	---	---	---
FRYL	285527	broad.mit.edu	37	4	48621329	48621329	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:48621329A>G	uc003gyh.1	-	7	978	c.373T>C	c.(373-375)TTC>CTC	p.F125L	FRYL_uc003gyk.2_Missense_Mutation_p.F125L|FRYL_uc003gyl.1_Missense_Mutation_p.F176L	NM_015030	NP_055845	O94915	FRYL_HUMAN	furry-like	125					regulation of transcription, DNA-dependent|transcription, DNA-dependent		protein binding			skin(1)	1																		---	---	---	---
KIT	3815	broad.mit.edu	37	4	55573423	55573423	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:55573423A>G	uc010igr.2	+	6	1172	c.1085A>G	c.(1084-1086)TAT>TGT	p.Y362C	KIT_uc010igs.2_Missense_Mutation_p.Y362C	NM_000222	NP_000213	P10721	KIT_HUMAN	v-kit Hardy-Zuckerman 4 feline sarcoma viral	362	Ig-like C2-type 4.|Extracellular (Potential).				male gonad development|transmembrane receptor protein tyrosine kinase signaling pathway	extracellular space|integral to membrane	ATP binding|protein binding|receptor signaling protein tyrosine kinase activity			soft_tissue(3273)|haematopoietic_and_lymphoid_tissue(1572)|skin(99)|testis(49)|bone(21)|genital_tract(18)|kidney(17)|ovary(16)|salivary_gland(15)|large_intestine(11)|thymus(6)|lung(6)|central_nervous_system(4)|NS(3)|eye(2)|endometrium(2)|breast(1)|stomach(1)|autonomic_ganglia(1)|pancreas(1)	5118	all_cancers(7;0.00453)|all_lung(4;0.000565)|Lung NSC(11;0.00129)|all_epithelial(27;0.0104)|Glioma(25;0.08)|all_neural(26;0.101)		LUSC - Lung squamous cell carcinoma(32;0.000276)|Epithelial(7;0.209)	Colorectal(1;0.0276)|COAD - Colon adenocarcinoma(1;0.171)	Dasatinib(DB01254)|Imatinib(DB00619)|Sorafenib(DB00398)|Sunitinib(DB01268)		1	Mis|O		GIST|AML|TGCT|mastocytosis|mucosal melanoma	GIST|epithelioma	Piebald trait		Mast_Cell_disease_Familial_Clustering_of|Piebaldism|Gastrointestinal_Stromal_Tumors_Sporadic_Multiple_Primary|Familial_Gastrointestinal_Stromal_Tumors				---	---	---	---
CEP135	9662	broad.mit.edu	37	4	56883935	56883935	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:56883935C>T	uc003hbi.2	+	22	3158	c.2924C>T	c.(2923-2925)TCA>TTA	p.S975L	CEP135_uc003hbj.2_Missense_Mutation_p.S681L	NM_025009	NP_079285	Q66GS9	CP135_HUMAN	centrosome protein 4	975	Potential.				centriole replication|centriole-centriole cohesion|G2/M transition of mitotic cell cycle	centriole|cytosol	protein C-terminus binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5	Glioma(25;0.08)|all_neural(26;0.101)																	---	---	---	---
LPHN3	23284	broad.mit.edu	37	4	62862015	62862015	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:62862015G>A	uc010ihh.2	+	17	3212	c.3039G>A	c.(3037-3039)TGG>TGA	p.W1013*	LPHN3_uc003hcq.3_Nonsense_Mutation_p.W1013*|LPHN3_uc003hct.2_Nonsense_Mutation_p.W406*	NM_015236	NP_056051	Q9HAR2	LPHN3_HUMAN	latrophilin 3 precursor	1000	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity|sugar binding			lung(15)|ovary(1)|central_nervous_system(1)|pancreas(1)	18																		---	---	---	---
STAP1	26228	broad.mit.edu	37	4	68442967	68442967	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:68442967C>T	uc003hde.3	+	4	435	c.353C>T	c.(352-354)ACA>ATA	p.T118I	STAP1_uc003hdf.2_Missense_Mutation_p.T118I	NM_012108	NP_036240	Q9ULZ2	STAP1_HUMAN	signal transducing adaptor family member 1	118	PH.				cellular membrane fusion|intracellular protein transport	cytoplasm					0																		---	---	---	---
UGT2B7	7364	broad.mit.edu	37	4	69973972	69973972	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:69973972A>G	uc003heg.3	+	5	1288	c.1242A>G	c.(1240-1242)AGA>AGG	p.R414R	UGT2B7_uc010ihq.2_Intron	NM_001074	NP_001065	P16662	UD2B7_HUMAN	UDP glucuronosyltransferase 2B7 precursor	414					lipid metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glucuronosyltransferase activity			ovary(1)|skin(1)	2																		---	---	---	---
FRAS1	80144	broad.mit.edu	37	4	79308595	79308595	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79308595C>A	uc003hlb.2	+	29	4155	c.3715C>A	c.(3715-3717)CAG>AAG	p.Q1239K	FRAS1_uc003hkw.2_Missense_Mutation_p.Q1239K	NM_025074	NP_079350	Q86XX4	FRAS1_HUMAN	Fraser syndrome 1	1238	CSPG 2.|Extracellular (Potential).				cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5																		---	---	---	---
ANXA3	306	broad.mit.edu	37	4	79518578	79518578	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79518578C>T	uc003hld.2	+						ANXA3_uc003hle.2_Intron|ANXA3_uc010ijk.2_Intron	NM_005139	NP_005130			annexin A3						defense response to bacterium|neutrophil degranulation|phagocytosis|positive regulation of angiogenesis|positive regulation of endothelial cell migration|positive regulation of sequence-specific DNA binding transcription factor activity	phagocytic vesicle membrane|plasma membrane|specific granule	calcium ion binding|calcium-dependent phospholipid binding|phospholipase A2 inhibitor activity				0																		---	---	---	---
BMP2K	55589	broad.mit.edu	37	4	79791998	79791998	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79791998G>A	uc003hlk.2	+	11	1459	c.1293G>A	c.(1291-1293)CCG>CCA	p.P431P	BMP2K_uc010ijl.1_RNA|BMP2K_uc003hlj.2_Silent_p.P431P|BMP2K_uc003hll.2_5'Flank	NM_198892	NP_942595	Q9NSY1	BMP2K_HUMAN	BMP-2 inducible kinase isoform a	431	Gln/His-rich.					nucleus	ATP binding|protein serine/threonine kinase activity			lung(1)	1																		---	---	---	---
FGF5	2250	broad.mit.edu	37	4	81196160	81196160	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:81196160T>C	uc003hmd.2	+	2	690	c.453T>C	c.(451-453)CAT>CAC	p.H151H	FGF5_uc003hme.2_Intron	NM_004464	NP_004455	P12034	FGF5_HUMAN	fibroblast growth factor 5 isoform 1 precursor	151					cell proliferation|cell-cell signaling|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|positive regulation of cell division|positive regulation of cell proliferation	extracellular space	fibroblast growth factor receptor binding|growth factor activity			ovary(1)|breast(1)	2																		---	---	---	---
PRKG2	5593	broad.mit.edu	37	4	82090857	82090857	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:82090857C>A	uc003hmh.2	-	4	822	c.808G>T	c.(808-810)GCC>TCC	p.A270S	PRKG2_uc011cch.1_Missense_Mutation_p.A270S	NM_006259	NP_006250	Q13237	KGP2_HUMAN	protein kinase, cGMP-dependent, type II	270	cGMP 1.				platelet activation|signal transduction	cytosol	ATP binding|cGMP binding|cGMP-dependent protein kinase activity			breast(3)|central_nervous_system(2)|ovary(1)|large_intestine(1)	7																		---	---	---	---
SPARCL1	8404	broad.mit.edu	37	4	88416218	88416218	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:88416218T>C	uc010ikm.2	-	4	688	c.116A>G	c.(115-117)AAC>AGC	p.N39S	SPARCL1_uc011cdc.1_Intron|SPARCL1_uc003hqs.3_Missense_Mutation_p.N39S|SPARCL1_uc011cdd.1_5'UTR|SPARCL1_uc003hqt.2_Missense_Mutation_p.N39S	NM_001128310	NP_001121782	Q14515	SPRL1_HUMAN	SPARC-like 1 precursor	39	O-glycosylated at two sites.				signal transduction	extracellular space|proteinaceous extracellular matrix	calcium ion binding			ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(123;0.00118)														---	---	---	---
HERC5	51191	broad.mit.edu	37	4	89425506	89425506	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:89425506C>T	uc003hrt.2	+	21	2859	c.2706C>T	c.(2704-2706)CCC>CCT	p.P902P	HERC5_uc011cdm.1_Silent_p.P540P	NM_016323	NP_057407	Q9UII4	HERC5_HUMAN	hect domain and RLD 5	902	HECT.				innate immune response|ISG15-protein conjugation|negative regulation of type I interferon production|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|regulation of cyclin-dependent protein kinase activity|regulation of defense response to virus|response to virus	cytosol|perinuclear region of cytoplasm	ISG15 ligase activity|protein binding|ubiquitin-protein ligase activity			ovary(4)|lung(3)|skin(2)	9		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;0.000209)														---	---	---	---
C4orf37	285555	broad.mit.edu	37	4	99064238	99064238	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:99064238C>A	uc003htt.1	-	1	154	c.64G>T	c.(64-66)GGT>TGT	p.G22C		NM_174952	NP_777612	Q8N412	CD037_HUMAN	hypothetical protein LOC285555	22											0				OV - Ovarian serous cystadenocarcinoma(123;2.27e-08)												OREG0016268	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
MTTP	4547	broad.mit.edu	37	4	100534305	100534305	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:100534305A>G	uc003hvc.3	+						MTTP_uc011cej.1_Intron	NM_000253	NP_000244			microsomal triglyceride transfer protein large						lipid metabolic process|lipoprotein metabolic process	endoplasmic reticulum lumen	lipid binding|lipid transporter activity			ovary(3)|central_nervous_system(1)	4				OV - Ovarian serous cystadenocarcinoma(123;6.04e-09)	Hesperetin(DB01094)													---	---	---	---
CYP2U1	113612	broad.mit.edu	37	4	108871407	108871407	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:108871407G>A	uc003hyp.2	+	5	1546	c.1463G>A	c.(1462-1464)CGG>CAG	p.R488Q	CYP2U1_uc011cfi.1_Missense_Mutation_p.R279Q	NM_183075	NP_898898	Q7Z449	CP2U1_HUMAN	cytochrome P450, family 2, subfamily U,	488					xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	aromatase activity|electron carrier activity|heme binding|oxygen binding				0		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;0.000128)														---	---	---	---
NDST3	9348	broad.mit.edu	37	4	119163208	119163208	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:119163208A>G	uc003ibx.2	+	12	2706	c.2303A>G	c.(2302-2304)GAT>GGT	p.D768G		NM_004784	NP_004775	O95803	NDST3_HUMAN	N-deacetylase/N-sulfotransferase (heparan	768	Lumenal (Potential).|Heparan sulfate N-sulfotransferase 3.					Golgi membrane|integral to membrane	[heparan sulfate]-glucosamine N-sulfotransferase activity|hydrolase activity			large_intestine(1)	1																		---	---	---	---
SLC25A31	83447	broad.mit.edu	37	4	128651810	128651810	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:128651810C>T	uc003ifl.2	+	1	256	c.110C>T	c.(109-111)GCG>GTG	p.A37V		NM_031291	NP_112581	Q9H0C2	ADT4_HUMAN	solute carrier family 25 (mitochondrial carrier;	37	Solcar 1.|Helical; Name=1; (Potential).				transmembrane transport	cilium|flagellum|integral to membrane|mitochondrial inner membrane	binding|transporter activity				0																		---	---	---	---
HSPA4L	22824	broad.mit.edu	37	4	128751951	128751951	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:128751951A>G	uc003ifm.2	+	18	2578	c.2325A>G	c.(2323-2325)TCA>TCG	p.S775S	HSPA4L_uc011cgr.1_Silent_p.S742S	NM_014278	NP_055093	O95757	HS74L_HUMAN	heat shock 70kDa protein 4-like	775					protein folding|response to unfolded protein	cytoplasm|nucleus	ATP binding|protein binding			ovary(2)|central_nervous_system(1)|skin(1)	4																		---	---	---	---
LARP1B	55132	broad.mit.edu	37	4	129121797	129121797	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:129121797G>T	uc003iga.2	+	17	2417	c.2286G>T	c.(2284-2286)TGG>TGT	p.W762C	LARP1B_uc003igc.2_Missense_Mutation_p.W181C|LARP1B_uc010ioa.1_RNA|LARP1B_uc003ige.2_RNA|LARP1B_uc003igd.2_RNA|LARP1B_uc003igf.2_5'UTR	NM_018078	NP_060548	Q659C4	LAR1B_HUMAN	La ribonucleoprotein domain family member 2	762							RNA binding				0																		---	---	---	---
PCDH10	57575	broad.mit.edu	37	4	134076066	134076066	+	Intron	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:134076066T>G	uc003iha.2	+							NM_032961	NP_116586			protocadherin 10 isoform 1 precursor						homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2				LUSC - Lung squamous cell carcinoma(193;0.227)														---	---	---	---
TBC1D9	23158	broad.mit.edu	37	4	141545263	141545263	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:141545263C>T	uc010ioj.2	-							NM_015130	NP_055945			TBC1 domain family, member 9 (with GRAM domain)							intracellular	calcium ion binding|Rab GTPase activator activity			ovary(1)	1	all_hematologic(180;0.162)	Medulloblastoma(177;0.00498)																---	---	---	---
SMAD1	4086	broad.mit.edu	37	4	146436032	146436032	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:146436032C>T	uc003ikc.2	+	2	683	c.267C>T	c.(265-267)TGC>TGT	p.C89C	SMAD1_uc003ikd.2_Silent_p.C89C|SMAD1_uc010iov.2_Silent_p.C89C|SMAD1_uc011cic.1_Silent_p.C89C	NM_005900	NP_005891	Q15797	SMAD1_HUMAN	Sma- and Mad-related protein 1	89	MH1.				BMP signaling pathway|embryonic pattern specification|primary miRNA processing|SMAD protein complex assembly|transforming growth factor beta receptor signaling pathway	cytosol|integral to membrane|nuclear inner membrane	co-SMAD binding|I-SMAD binding|identical protein binding|protein kinase binding|sequence-specific DNA binding transcription factor activity|transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity			ovary(1)	1	all_hematologic(180;0.151)																	---	---	---	---
POU4F2	5458	broad.mit.edu	37	4	147561827	147561827	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:147561827T>G	uc003ikv.2	+	2	1345	c.1097T>G	c.(1096-1098)ATT>AGT	p.I366S		NM_004575	NP_004566	Q12837	PO4F2_HUMAN	Brn3b POU domain transcription factor	366	Homeobox.				estrogen receptor signaling pathway|MAPKKK cascade|negative regulation of transcription from RNA polymerase II promoter	nuclear speck	RNA polymerase II core promoter proximal region sequence-specific DNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription			breast(1)	1	all_hematologic(180;0.151)																	---	---	---	---
FBXW7	55294	broad.mit.edu	37	4	153249385	153249385	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:153249385G>A	uc003ims.2	-	9	1542	c.1393C>T	c.(1393-1395)CGT>TGT	p.R465C	FBXW7_uc011cii.1_Missense_Mutation_p.R465C|FBXW7_uc003imt.2_Missense_Mutation_p.R465C|FBXW7_uc011cih.1_Missense_Mutation_p.R289C|FBXW7_uc003imq.2_Missense_Mutation_p.R385C|FBXW7_uc003imr.2_Missense_Mutation_p.R347C	NM_033632	NP_361014	Q969H0	FBXW7_HUMAN	F-box and WD repeat domain containing 7 isoform	465	WD 3.		R -> H (in a colorectal cancer sample; somatic mutation).|R -> C (in a acute lymphoblastic leukemia cell line).		interspecies interaction between organisms|lipid homeostasis|negative regulation of DNA endoreduplication|negative regulation of hepatocyte proliferation|negative regulation of Notch signaling pathway|negative regulation of triglyceride biosynthetic process|positive regulation of epidermal growth factor receptor activity|positive regulation of ERK1 and ERK2 cascade|positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process|protein stabilization|protein ubiquitination|regulation of lipid storage|regulation of protein localization|SCF-dependent proteasomal ubiquitin-dependent protein catabolic process|sister chromatid cohesion|vasculature development	nucleolus|nucleolus|nucleoplasm|nucleoplasm|SCF ubiquitin ligase complex	protein binding|protein binding	p.R465C(52)|p.R465H(36)|p.R465L(2)		haematopoietic_and_lymphoid_tissue(125)|large_intestine(99)|stomach(16)|lung(14)|endometrium(13)|ovary(9)|biliary_tract(8)|upper_aerodigestive_tract(5)|central_nervous_system(3)|kidney(3)|skin(3)|pancreas(3)|breast(2)|prostate(2)|cervix(1)|NS(1)|bone(1)	308	all_hematologic(180;0.093)	Acute lymphoblastic leukemia(8;0.000629)|all_hematologic(8;0.067)						Mis|N|D|F		colorectal|endometrial|T-ALL								---	---	---	---
DCHS2	54798	broad.mit.edu	37	4	155254496	155254496	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:155254496C>T	uc003inw.2	-	9	1367	c.1367G>A	c.(1366-1368)GGC>GAC	p.G456D	DCHS2_uc003inx.2_Missense_Mutation_p.G955D	NM_017639	NP_060109	Q6V1P9	PCD23_HUMAN	dachsous 2 isoform 1	456	Cadherin 3.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|pancreas(1)	4	all_hematologic(180;0.208)	Renal(120;0.0854)		LUSC - Lung squamous cell carcinoma(193;0.107)														---	---	---	---
TLL1	7092	broad.mit.edu	37	4	166795140	166795140	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:166795140C>T	uc003irh.1	+	1	731	c.84C>T	c.(82-84)TGC>TGT	p.C28C	TLL1_uc011cjn.1_Silent_p.C28C|TLL1_uc011cjo.1_5'UTR	NM_012464	NP_036596	O43897	TLL1_HUMAN	tolloid-like 1 precursor	28					cell differentiation|proteolysis|skeletal system development	extracellular region	calcium ion binding|metalloendopeptidase activity|zinc ion binding			skin(3)|ovary(2)|breast(1)|central_nervous_system(1)	7	all_hematologic(180;0.221)	Melanoma(52;0.0315)|Prostate(90;0.0405)		GBM - Glioblastoma multiforme(119;0.103)														---	---	---	---
KIAA1430	57587	broad.mit.edu	37	4	186112159	186112159	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:186112159A>G	uc003ixf.3	-	2	339	c.192T>C	c.(190-192)CTT>CTC	p.L64L	KIAA1430_uc003ixg.2_Silent_p.L64L	NM_020827	NP_065878	Q9P2B7	K1430_HUMAN	hypothetical protein LOC57587	64											0		all_lung(41;1.19e-13)|Lung NSC(41;3.16e-13)|Hepatocellular(41;0.00826)|Colorectal(36;0.00872)|Renal(120;0.00988)|Prostate(90;0.0235)|all_hematologic(60;0.0592)|all_neural(102;0.243)		all cancers(43;9.44e-26)|Epithelial(43;2.64e-23)|OV - Ovarian serous cystadenocarcinoma(60;1.66e-11)|Colorectal(24;6.03e-05)|BRCA - Breast invasive adenocarcinoma(30;8.01e-05)|GBM - Glioblastoma multiforme(59;0.000331)|COAD - Colon adenocarcinoma(29;0.000427)|STAD - Stomach adenocarcinoma(60;0.000777)|LUSC - Lung squamous cell carcinoma(40;0.00924)|READ - Rectum adenocarcinoma(43;0.165)														---	---	---	---
SDHA	6389	broad.mit.edu	37	5	251215	251215	+	Missense_Mutation	SNP	C	T	T	rs9809219		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:251215C>T	uc003jao.3	+	12	1775	c.1660C>T	c.(1660-1662)CGG>TGG	p.R554W	SDHA_uc011clv.1_Missense_Mutation_p.R554W|SDHA_uc011clw.1_Missense_Mutation_p.R506W|SDHA_uc003jap.3_Intron|SDHA_uc003jaq.3_Missense_Mutation_p.R329W|SDHA_uc003jar.3_Missense_Mutation_p.R148W	NM_004168	NP_004159	P31040	DHSA_HUMAN	succinate dehydrogenase complex, subunit A,	554			R -> W (in LS).		nervous system development|respiratory electron transport chain|succinate metabolic process|transport|tricarboxylic acid cycle	mitochondrial respiratory chain complex II	electron carrier activity|flavin adenine dinucleotide binding|protein binding|succinate dehydrogenase (ubiquinone) activity				0			Epithelial(17;0.0159)|all cancers(22;0.0236)|OV - Ovarian serous cystadenocarcinoma(19;0.0674)|Lung(60;0.113)		Succinic acid(DB00139)									Familial_Paragangliomas				---	---	---	---
AHRR	57491	broad.mit.edu	37	5	353927	353927	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:353927A>G	uc003jav.2	+	3	201	c.157A>G	c.(157-159)AGC>GGC	p.S53G	AHRR_uc003jaw.2_Missense_Mutation_p.S49G|AHRR_uc010isy.2_Intron|AHRR_uc010isz.2_Missense_Mutation_p.S49G	NM_020731	NP_065782	A9YTQ3	AHRR_HUMAN	arylhydrocarbon receptor repressor	53	Helix-loop-helix motif.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|signal transducer activity			breast(2)	2			Epithelial(17;0.0011)|OV - Ovarian serous cystadenocarcinoma(19;0.00353)|all cancers(22;0.00354)|Lung(60;0.0863)															---	---	---	---
ADAMTS16	170690	broad.mit.edu	37	5	5303565	5303565	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:5303565G>A	uc003jdl.2	+	19	3112	c.2974G>A	c.(2974-2976)GCC>ACC	p.A992T	ADAMTS16_uc003jdk.1_Missense_Mutation_p.A992T	NM_139056	NP_620687	Q8TE57	ATS16_HUMAN	ADAM metallopeptidase with thrombospondin type 1	992	TSP type-1 4.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(3)|lung(2)|large_intestine(1)|breast(1)|pancreas(1)	8																		---	---	---	---
SRD5A1	6715	broad.mit.edu	37	5	6652020	6652020	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:6652020C>T	uc003jdw.2	+	2	549	c.359C>T	c.(358-360)GCG>GTG	p.A120V	SRD5A1_uc011cml.1_RNA|SRD5A1_uc011cmm.1_Intron	NM_001047	NP_001038	P18405	S5A1_HUMAN	steroid-5-alpha-reductase 1	120	Helical; (Potential).				androgen biosynthetic process|cell differentiation|sex determination|sex differentiation	endoplasmic reticulum membrane|integral to membrane|microsome	3-oxo-5-alpha-steroid 4-dehydrogenase activity|electron carrier activity				0					Dutasteride(DB01126)|Finasteride(DB01216)													---	---	---	---
FAM173B	134145	broad.mit.edu	37	5	10227606	10227606	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:10227606G>T	uc003jeo.2	-	5	678	c.649C>A	c.(649-651)CGT>AGT	p.R217S	FAM173B_uc003jep.2_RNA|FAM173B_uc010itr.2_Missense_Mutation_p.R200S	NM_199133	NP_954584	Q6P4H8	F173B_HUMAN	hypothetical protein LOC134145	217						integral to membrane				kidney(1)|central_nervous_system(1)	2																		---	---	---	---
DNAH5	1767	broad.mit.edu	37	5	13913929	13913929	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:13913929A>C	uc003jfd.2	-	11	1501	c.1459T>G	c.(1459-1461)TTT>GTT	p.F487V	DNAH5_uc003jfe.1_RNA	NM_001369	NP_001360	Q8TE73	DYH5_HUMAN	dynein, axonemal, heavy chain 5	487	Stem (By similarity).				microtubule-based movement	cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(14)|skin(13)|upper_aerodigestive_tract(1)|central_nervous_system(1)|breast(1)|pancreas(1)	31	Lung NSC(4;0.00476)													Kartagener_syndrome				---	---	---	---
CDH9	1007	broad.mit.edu	37	5	26906221	26906221	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:26906221C>T	uc003jgs.1	-	5	827	c.658G>A	c.(658-660)GCA>ACA	p.A220T	CDH9_uc010iug.2_Missense_Mutation_p.A220T	NM_016279	NP_057363	Q9ULB4	CADH9_HUMAN	cadherin 9, type 2 preproprotein	220	Extracellular (Potential).|Cadherin 2.				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(5)|skin(2)|upper_aerodigestive_tract(1)|haematopoietic_and_lymphoid_tissue(1)	9																		---	---	---	---
PDZD2	23037	broad.mit.edu	37	5	31983467	31983467	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31983467A>G	uc003jhl.2	+	3	1071	c.683A>G	c.(682-684)AAC>AGC	p.N228S	PDZD2_uc003jhm.2_Missense_Mutation_p.N228S|PDZD2_uc011cnx.1_Missense_Mutation_p.N54S	NM_178140	NP_835260	O15018	PDZD2_HUMAN	PDZ domain containing 2	228					cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9																		---	---	---	---
PDZD2	23037	broad.mit.edu	37	5	31995817	31995817	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31995817G>A	uc003jhl.2	+	4	1502	c.1114G>A	c.(1114-1116)GCT>ACT	p.A372T	PDZD2_uc003jhm.2_Missense_Mutation_p.A372T|PDZD2_uc011cnx.1_Missense_Mutation_p.A198T	NM_178140	NP_835260	O15018	PDZD2_HUMAN	PDZ domain containing 2	372	PDZ 2.				cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9																		---	---	---	---
RXFP3	51289	broad.mit.edu	37	5	33937053	33937053	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:33937053G>A	uc003jic.1	+	1	565	c.208G>A	c.(208-210)GGG>AGG	p.G70R		NM_016568	NP_057652	Q9NSD7	RL3R1_HUMAN	relaxin/insulin-like family peptide receptor 3	70	Extracellular (Potential).					integral to plasma membrane	N-formyl peptide receptor activity			upper_aerodigestive_tract(1)	1																		---	---	---	---
NIPBL	25836	broad.mit.edu	37	5	37002815	37002815	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37002815A>C	uc003jkl.3	+	15	4215	c.3716A>C	c.(3715-3717)AAT>ACT	p.N1239T	NIPBL_uc003jkk.3_Missense_Mutation_p.N1239T	NM_133433	NP_597677	Q6KC79	NIPBL_HUMAN	delangin isoform A	1239					brain development|cellular protein localization|cellular response to X-ray|cognition|developmental growth|ear morphogenesis|embryonic arm morphogenesis|embryonic digestive tract morphogenesis|external genitalia morphogenesis|eye morphogenesis|face morphogenesis|gall bladder development|maintenance of mitotic sister chromatid cohesion|metanephros development|negative regulation of transcription from RNA polymerase II promoter|outflow tract morphogenesis|positive regulation of histone deacetylation|regulation of developmental growth|regulation of embryonic development|regulation of hair cycle|response to DNA damage stimulus|sensory perception of sound|uterus morphogenesis	SMC loading complex	chromo shadow domain binding|histone deacetylase binding|protein C-terminus binding|protein N-terminus binding			ovary(4)|lung(2)|large_intestine(1)|breast(1)|kidney(1)	9	all_lung(31;0.000447)|Hepatocellular(1;0.108)		Epithelial(62;0.072)|COAD - Colon adenocarcinoma(61;0.14)|all cancers(62;0.191)|Colorectal(62;0.202)															---	---	---	---
HEATR7B2	133558	broad.mit.edu	37	5	41018876	41018876	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41018876G>A	uc003jmj.3	-	26	3080	c.2590C>T	c.(2590-2592)CGA>TGA	p.R864*	HEATR7B2_uc003jmi.3_Nonsense_Mutation_p.R419*	NM_173489	NP_775760	Q7Z745	HTRB2_HUMAN	HEAT repeat family member 7B2	864							binding			ovary(6)|central_nervous_system(2)	8																		---	---	---	---
PLCXD3	345557	broad.mit.edu	37	5	41382280	41382280	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:41382280G>A	uc003jmm.1	-	2	562	c.460C>T	c.(460-462)CAC>TAC	p.H154Y		NM_001005473	NP_001005473	Q63HM9	PLCX3_HUMAN	phosphatidylinositol-specific phospholipase C, X	154	PI-PLC X-box.				intracellular signal transduction|lipid catabolic process		phospholipase C activity|signal transducer activity			skin(2)|urinary_tract(1)|ovary(1)|lung(1)|central_nervous_system(1)	6																		---	---	---	---
HSPB3	8988	broad.mit.edu	37	5	53751959	53751959	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:53751959T>C	uc003jph.1	+	1	515	c.340T>C	c.(340-342)TTC>CTC	p.F114L		NM_006308	NP_006299	Q12988	HSPB3_HUMAN	heat shock 27kDa protein 3	114					cell death|response to heat|response to unfolded protein	cytoplasm|nucleus					0		Lung NSC(810;0.00104)																---	---	---	---
MAP3K1	4214	broad.mit.edu	37	5	56178223	56178223	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:56178223A>G	uc003jqw.3	+	14	3697	c.3196A>G	c.(3196-3198)ACC>GCC	p.T1066A		NM_005921	NP_005912	Q13233	M3K1_HUMAN	mitogen-activated protein kinase kinase kinase	1066					cellular response to mechanical stimulus|innate immune response|MyD88-dependent toll-like receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 4 signaling pathway	cytosol	ATP binding|zinc ion binding			ovary(1)|skin(1)	2		Lung NSC(810;4.65e-05)|Prostate(74;0.0132)|Breast(144;0.0321)|Ovarian(174;0.223)		OV - Ovarian serous cystadenocarcinoma(10;6.08e-40)														---	---	---	---
CENPH	64946	broad.mit.edu	37	5	68490522	68490522	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:68490522C>T	uc003jvp.2	+	3	326	c.239C>T	c.(238-240)GCT>GTT	p.A80V	CENPH_uc010ixc.2_Missense_Mutation_p.A80V	NM_022909	NP_075060	Q9H3R5	CENPH_HUMAN	centromere protein H	80	Potential.				cell division|CenH3-containing nucleosome assembly at centromere|chromosome segregation|kinetochore organization|mitotic prometaphase	condensed chromosome kinetochore|cytosol|nucleoplasm	kinetochore binding|protein binding			large_intestine(1)	1		Lung NSC(167;5.51e-05)|Prostate(74;0.00634)|Ovarian(174;0.0448)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;1.41e-56)|Epithelial(20;1.29e-52)|all cancers(19;3.15e-48)|Lung(70;0.0178)														---	---	---	---
ZNF366	167465	broad.mit.edu	37	5	71757157	71757157	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:71757157C>T	uc003kce.1	-	2	353	c.167G>A	c.(166-168)CGG>CAG	p.R56Q		NM_152625	NP_689838	Q8N895	ZN366_HUMAN	zinc finger protein 366	56					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			central_nervous_system(1)|skin(1)	2		Lung NSC(167;0.0247)|Ovarian(174;0.0908)|Prostate(461;0.155)		OV - Ovarian serous cystadenocarcinoma(47;2.51e-53)														---	---	---	---
GFM2	84340	broad.mit.edu	37	5	74026203	74026203	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:74026203C>A	uc003kdh.1	-	17	1912	c.1608G>T	c.(1606-1608)GGG>GGT	p.G536G	GFM2_uc003kdi.1_Silent_p.G489G|GFM2_uc010izj.1_Silent_p.G568G|GFM2_uc010izk.1_Intron	NM_032380	NP_115756	Q969S9	RRF2M_HUMAN	mitochondrial elongation factor G2 isoform 1	536					mitochondrial translation|ribosome disassembly	mitochondrion	GTP binding|GTPase activity				0		all_lung(232;0.00101)|Lung NSC(167;0.00278)|Ovarian(174;0.0129)|Breast(144;0.231)		OV - Ovarian serous cystadenocarcinoma(47;1.86e-56)														---	---	---	---
RASGRF2	5924	broad.mit.edu	37	5	80382721	80382721	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:80382721G>A	uc003kha.1	+	9	1339	c.1339G>A	c.(1339-1341)GTG>ATG	p.V447M	RASGRF2_uc011ctn.1_RNA|RASGRF2_uc003khb.1_Missense_Mutation_p.V275M	NM_006909	NP_008840	O14827	RGRF2_HUMAN	Ras protein-specific guanine	447					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|synaptic transmission	cytosol|endoplasmic reticulum membrane|plasma membrane	protein binding|Rho guanyl-nucleotide exchange factor activity			breast(5)|ovary(3)|large_intestine(2)|central_nervous_system(1)|skin(1)	12		Lung NSC(167;0.00498)|all_lung(232;0.00531)|Ovarian(174;0.0357)		OV - Ovarian serous cystadenocarcinoma(54;4.22e-42)|Epithelial(54;4.04e-35)|all cancers(79;2.52e-29)														---	---	---	---
VCAN	1462	broad.mit.edu	37	5	82817797	82817797	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:82817797G>T	uc003kii.3	+	7	4028	c.3672G>T	c.(3670-3672)AAG>AAT	p.K1224N	VCAN_uc003kij.3_Intron|VCAN_uc010jau.2_Missense_Mutation_p.K1224N|VCAN_uc003kik.3_Intron	NM_004385	NP_004376	P13611	CSPG2_HUMAN	versican isoform 1 precursor	1224	GAG-alpha (glucosaminoglycan attachment domain).				cell adhesion|cell recognition|glial cell migration	extracellular space|proteinaceous extracellular matrix	calcium ion binding|hyaluronic acid binding|sugar binding			ovary(7)|skin(6)|lung(2)|central_nervous_system(1)	16		Lung NSC(167;0.0216)|all_lung(232;0.0251)|Ovarian(174;0.142)		OV - Ovarian serous cystadenocarcinoma(54;2.47e-41)|Epithelial(54;2.51e-34)|all cancers(79;5.19e-29)														---	---	---	---
SLCO4C1	353189	broad.mit.edu	37	5	101631731	101631731	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:101631731G>A	uc003knm.2	-	1	523	c.236C>T	c.(235-237)TCG>TTG	p.S79L		NM_180991	NP_851322	Q6ZQN7	SO4C1_HUMAN	solute carrier organic anion transporter family,	79	Cytoplasmic (Potential).				cell differentiation|multicellular organismal development|sodium-independent organic anion transport|spermatogenesis	basolateral plasma membrane|integral to membrane	sodium-independent organic anion transmembrane transporter activity			upper_aerodigestive_tract(1)|ovary(1)|central_nervous_system(1)|pancreas(1)	4		all_cancers(142;1.86e-08)|all_epithelial(76;5.24e-12)|Prostate(80;0.00124)|Colorectal(57;0.00332)|Ovarian(225;0.024)|Lung NSC(167;0.0402)|all_lung(232;0.0486)		Epithelial(69;4.07e-14)|COAD - Colon adenocarcinoma(37;0.00986)														---	---	---	---
APC	324	broad.mit.edu	37	5	112103087	112103087	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112103087G>T	uc010jby.2	+	4	802	c.422G>T	c.(421-423)AGG>ATG	p.R141M	APC_uc011cvt.1_Missense_Mutation_p.R151M|APC_uc003kpz.3_Missense_Mutation_p.R141M|APC_uc003kpy.3_Missense_Mutation_p.R141M|APC_uc010jbz.2_Translation_Start_Site	NM_001127511	NP_001120983	P25054	APC_HUMAN	adenomatous polyposis coli	141	Leu-rich.|Potential.				canonical Wnt receptor signaling pathway|cell adhesion|cell cycle arrest|cell migration|cellular component disassembly involved in apoptosis|cytokinesis after mitosis|mitotic cell cycle spindle assembly checkpoint|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cyclin-dependent protein kinase activity|negative regulation of microtubule depolymerization|positive regulation of apoptosis|positive regulation of cell migration|positive regulation of pseudopodium assembly|protein complex assembly|regulation of attachment of spindle microtubules to kinetochore|response to DNA damage stimulus|tight junction assembly	adherens junction|APC-Axin-1-beta-catenin complex|Axin-APC-beta-catenin-GSK3B complex|beta-catenin destruction complex|centrosome|cytosol|kinetochore|lamellipodium|lateral plasma membrane|nucleus|ruffle membrane|tight junction	beta-catenin binding|gamma-catenin binding|microtubule plus-end binding|protein kinase binding|protein kinase regulator activity	p.R141fs*6(2)|p.R141S(1)		large_intestine(2123)|stomach(123)|soft_tissue(55)|small_intestine(34)|breast(26)|pancreas(25)|urinary_tract(20)|lung(19)|thyroid(18)|liver(13)|central_nervous_system(10)|ovary(9)|skin(7)|upper_aerodigestive_tract(6)|adrenal_gland(6)|bone(6)|NS(5)|prostate(4)|endometrium(3)|kidney(1)|oesophagus(1)|biliary_tract(1)	2515		all_cancers(142;3.01e-27)|all_epithelial(76;2.3e-18)|all_hematologic(541;4.32e-09)|Ovarian(225;1.78e-06)|Lung NSC(167;0.000195)|Breast(839;0.000231)|all_lung(232;0.000247)|Colorectal(10;0.000355)|Prostate(80;0.00133)		OV - Ovarian serous cystadenocarcinoma(64;1.09e-113)|Epithelial(69;3.79e-112)|all cancers(49;1.67e-104)|BRCA - Breast invasive adenocarcinoma(61;0.00136)|COAD - Colon adenocarcinoma(37;0.00155)|Colorectal(14;0.00191)			12	D|Mis|N|F|S		colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS	colorectal|pancreatic|desmoid|hepatoblastoma|glioma|other CNS			Hereditary_Desmoid_Disease|Familial_Adenomatous_Polyposis|Turcot_syndrome	TSP Lung(16;0.13)			---	---	---	---
YTHDC2	64848	broad.mit.edu	37	5	112860771	112860771	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112860771A>G	uc003kqn.2	+	3	555	c.372A>G	c.(370-372)AAA>AAG	p.K124K	YTHDC2_uc010jce.1_Silent_p.K124K|YTHDC2_uc010jcf.1_Intron	NM_022828	NP_073739	Q9H6S0	YTDC2_HUMAN	YTH domain containing 2	124							ATP binding|ATP-dependent helicase activity|nucleic acid binding			skin(2)|central_nervous_system(1)	3		all_cancers(142;7.69e-05)|all_epithelial(76;6.42e-07)|Colorectal(10;0.00278)|Prostate(80;0.00955)|Ovarian(225;0.0444)|Lung NSC(810;0.143)|all_lung(232;0.163)|Breast(839;0.244)		OV - Ovarian serous cystadenocarcinoma(64;7.2e-08)|Epithelial(69;8.83e-08)|all cancers(49;6.9e-06)|COAD - Colon adenocarcinoma(37;0.0458)|Colorectal(14;0.0594)														---	---	---	---
SEMA6A	57556	broad.mit.edu	37	5	115814423	115814423	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:115814423A>G	uc010jck.2	-						SEMA6A_uc003krx.3_Intron|SEMA6A_uc003krw.3_5'Flank|SEMA6A_uc010jcj.2_Intron	NM_020796	NP_065847			sema domain, transmembrane domain (TM), and						apoptosis|axon guidance|cell surface receptor linked signaling pathway|cytoskeleton organization|organ morphogenesis	axon|integral to membrane|plasma membrane	receptor activity			ovary(2)	2		all_cancers(142;0.00316)|all_epithelial(76;5.71e-05)|Prostate(80;0.00845)|Ovarian(225;0.0796)|Lung NSC(810;0.171)|all_lung(232;0.203)		OV - Ovarian serous cystadenocarcinoma(64;1.59e-08)|Epithelial(69;2e-08)|all cancers(49;5.7e-08)|COAD - Colon adenocarcinoma(49;0.151)														---	---	---	---
IL3	3562	broad.mit.edu	37	5	131398085	131398085	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:131398085C>T	uc003kwe.1	+	3	338	c.285C>T	c.(283-285)AGC>AGT	p.S95S		NM_000588	NP_000579	P08700	IL3_HUMAN	interleukin 3 precursor	95					cell-cell signaling|immune response|nervous system development|positive regulation of cell proliferation|positive regulation of DNA replication|positive regulation of survival gene product expression|positive regulation of tyrosine phosphorylation of Stat5 protein	extracellular space	cytokine activity|growth factor activity|interleukin-3 receptor binding			ovary(2)|central_nervous_system(1)	3		all_cancers(142;7.42e-12)|Lung NSC(810;4.25e-07)|all_lung(232;1.93e-06)|Prostate(281;0.00741)|Breast(839;0.0544)|Lung SC(612;0.122)|Ovarian(839;0.223)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)	GBM - Glioblastoma multiforme(465;0.0161)|Lung(113;0.105)	Amlexanox(DB01025)													---	---	---	---
VDAC1	7416	broad.mit.edu	37	5	133328691	133328691	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:133328691G>A	uc003kyp.1	-	2	112	c.13C>T	c.(13-15)CCC>TCC	p.P5S	VDAC1_uc003kyq.1_Missense_Mutation_p.P5S|VDAC1_uc003kyr.1_Missense_Mutation_p.P5S	NM_003374	NP_003365	P21796	VDAC1_HUMAN	voltage-dependent anion channel 1	5					apoptosis|interspecies interaction between organisms	mitochondrial nucleoid|mitochondrial outer membrane|plasma membrane|pore complex	porin activity|protein binding|voltage-gated anion channel activity				0			KIRC - Kidney renal clear cell carcinoma(527;0.00806)|Kidney(363;0.02)		Dihydroxyaluminium(DB01375)													---	---	---	---
TCF7	6932	broad.mit.edu	37	5	133473836	133473836	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:133473836G>A	uc003kyt.2	+	4	724	c.528G>A	c.(526-528)GCG>GCA	p.A176A	TCF7_uc003kyu.1_Silent_p.A61A|TCF7_uc003kyv.2_Silent_p.A61A|TCF7_uc003kyw.2_Silent_p.A61A|TCF7_uc003kyx.2_5'UTR|TCF7_uc003kyy.2_Silent_p.A61A|TCF7_uc003kyz.2_Silent_p.A61A|TCF7_uc003kza.2_Silent_p.A61A	NM_003202	NP_003193	P36402	TCF7_HUMAN	transcription factor 7 (T-cell specific,	176					cellular response to interleukin-4|immune response|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent|Wnt receptor signaling pathway	nucleus	protein binding|transcription regulatory region DNA binding				0		Breast(839;0.058)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---
SAR1B	51128	broad.mit.edu	37	5	133948427	133948427	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:133948427A>G	uc003kzq.2	-	5	445	c.198T>C	c.(196-198)ATT>ATC	p.I66I	SAR1B_uc003kzr.2_Silent_p.I66I	NM_001033503	NP_001028675	Q9Y6B6	SAR1B_HUMAN	SAR1a gene homolog 2	66					COPII vesicle coating|intracellular protein transport|post-translational protein modification|protein N-linked glycosylation via asparagine	cytosol|endoplasmic reticulum membrane|ER to Golgi transport vesicle membrane|Golgi cisterna membrane	GTP binding|GTPase activity|metal ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---
BRD8	10902	broad.mit.edu	37	5	137480854	137480854	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137480854T>C	uc003lcf.1	-						BRD8_uc003lcc.1_Intron	NM_139199	NP_631938			bromodomain containing 8 isoform 2						cell surface receptor linked signaling pathway|histone H2A acetylation|histone H4 acetylation|regulation of growth|regulation of transcription from RNA polymerase II promoter	mitochondrion|NuA4 histone acetyltransferase complex	sequence-specific DNA binding transcription factor activity|thyroid hormone receptor activity			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0109)															---	---	---	---
BRD8	10902	broad.mit.edu	37	5	137501568	137501568	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137501568T>G	uc003lcf.1	-	11	1282	c.1227A>C	c.(1225-1227)GAA>GAC	p.E409D	BRD8_uc003lcc.1_RNA|BRD8_uc011cyl.1_Missense_Mutation_p.E188D|BRD8_uc003lcg.2_Missense_Mutation_p.E482D|BRD8_uc003lci.2_Missense_Mutation_p.E412D|BRD8_uc003lch.2_Missense_Mutation_p.E303D|BRD8_uc011cym.1_Missense_Mutation_p.E393D|BRD8_uc010jer.1_Missense_Mutation_p.E378D|BRD8_uc011cyn.1_Missense_Mutation_p.E368D	NM_139199	NP_631938	Q9H0E9	BRD8_HUMAN	bromodomain containing 8 isoform 2	409					cell surface receptor linked signaling pathway|histone H2A acetylation|histone H4 acetylation|regulation of growth|regulation of transcription from RNA polymerase II promoter	mitochondrion|NuA4 histone acetyltransferase complex	sequence-specific DNA binding transcription factor activity|thyroid hormone receptor activity			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0109)															---	---	---	---
CTNNA1	1495	broad.mit.edu	37	5	138268591	138268591	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:138268591C>T	uc003ldh.2	+						CTNNA1_uc011cyx.1_Intron|CTNNA1_uc011cyy.1_Intron|CTNNA1_uc003ldi.2_Intron|CTNNA1_uc003ldj.2_Silent_p.C816C|CTNNA1_uc003ldl.2_Intron	NM_001903	NP_001894			catenin, alpha 1						adherens junction organization|apical junction assembly|cell adhesion|cellular response to indole-3-methanol|muscle cell differentiation|positive regulation of muscle cell differentiation	actin cytoskeleton|catenin complex|cytosol	beta-catenin binding|cadherin binding|gamma-catenin binding|structural molecule activity|vinculin binding			breast(6)|ovary(2)|large_intestine(2)|kidney(1)	11			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00325)															---	---	---	---
PCDHA1	56147	broad.mit.edu	37	5	140168055	140168055	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140168055C>A	uc003lhb.2	+	1	2180	c.2180C>A	c.(2179-2181)CCC>CAC	p.P727H	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lgz.2_Missense_Mutation_p.P727H	NM_018900	NP_061723	Q9Y5I3	PCDA1_HUMAN	protocadherin alpha 1 isoform 1 precursor	727	Cytoplasmic (Potential).				homophilic cell adhesion|nervous system development	extracellular region|integral to plasma membrane	calcium ion binding|protein binding			skin(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHA3	56145	broad.mit.edu	37	5	140180869	140180869	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140180869C>T	uc003lhf.2	+	1	87	c.87C>T	c.(85-87)GGC>GGT	p.G29G	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA2_uc011czy.1_Intron|PCDHA3_uc011czz.1_Silent_p.G29G	NM_018906	NP_061729	Q9Y5H8	PCDA3_HUMAN	protocadherin alpha 3 isoform 1 precursor	29					homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(6)|skin(2)	8			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHA3	56145	broad.mit.edu	37	5	140182434	140182434	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140182434T>G	uc003lhf.2	+	1	1652	c.1652T>G	c.(1651-1653)CTG>CGG	p.L551R	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA2_uc011czy.1_Intron|PCDHA3_uc011czz.1_Missense_Mutation_p.L551R	NM_018906	NP_061729	Q9Y5H8	PCDA3_HUMAN	protocadherin alpha 3 isoform 1 precursor	551	Cadherin 5.|Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(6)|skin(2)	8			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHA7	56141	broad.mit.edu	37	5	140215070	140215070	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140215070G>A	uc003lhq.2	+	1	1102	c.1102G>A	c.(1102-1104)GTC>ATC	p.V368I	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc011dac.1_Missense_Mutation_p.V368I	NM_018910	NP_061733	Q9UN72	PCDA7_HUMAN	protocadherin alpha 7 isoform 1 precursor	368	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(2)|skin(2)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHA9	9752	broad.mit.edu	37	5	140230119	140230119	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140230119C>T	uc003lhu.2	+	1	2763	c.2039C>T	c.(2038-2040)TCG>TTG	p.S680L	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc003lhq.2_Intron|PCDHA8_uc003lhs.2_Intron|PCDHA9_uc003lht.1_Missense_Mutation_p.S680L	NM_031857	NP_114063	Q9Y5H5	PCDA9_HUMAN	protocadherin alpha 9 isoform 1 precursor	680	Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding|protein binding			large_intestine(2)|ovary(2)|skin(1)	5			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHA12	56137	broad.mit.edu	37	5	140256419	140256419	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140256419G>A	uc003lic.2	+	1	1489	c.1362G>A	c.(1360-1362)GCG>GCA	p.A454A	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc003lhq.2_Intron|PCDHA8_uc003lhs.2_Intron|PCDHA9_uc003lhu.2_Intron|PCDHA10_uc003lhw.2_Intron|PCDHA10_uc003lhx.2_Intron|PCDHA11_uc003lia.2_Intron|PCDHA12_uc011daf.1_Silent_p.A454A	NM_018903	NP_061726	Q9UN75	PCDAC_HUMAN	protocadherin alpha 12 isoform 1 precursor	454	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding|protein binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHB6	56130	broad.mit.edu	37	5	140531448	140531448	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140531448C>G	uc003lir.2	+	1	1610	c.1610C>G	c.(1609-1611)CCG>CGG	p.P537R	PCDHB6_uc011dah.1_Missense_Mutation_p.P401R	NM_018939	NP_061762	Q9Y5E3	PCDB6_HUMAN	protocadherin beta 6 precursor	537	Cadherin 5.|Extracellular (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to plasma membrane	calcium ion binding			skin(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---
PCDHB16	57717	broad.mit.edu	37	5	140563826	140563826	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140563826G>A	uc003liv.2	+	1	2847	c.1692G>A	c.(1690-1692)CCG>CCA	p.P564P		NM_020957	NP_066008	Q9NRJ7	PCDBG_HUMAN	protocadherin beta 16 precursor	564	Extracellular (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to membrane|plasma membrane	calcium ion binding			ovary(1)|pancreas(1)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---
PCDHB9	56127	broad.mit.edu	37	5	140568792	140568792	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140568792A>G	uc003liw.1	+	3	1901	c.1901A>G	c.(1900-1902)GAC>GGC	p.D634G		NM_019119	NP_061992	Q9Y5E1	PCDB9_HUMAN	protocadherin beta 9 precursor	634	Extracellular (Potential).|Cadherin 6.				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)															---	---	---	---
PCDHGA7	56108	broad.mit.edu	37	5	140762928	140762928	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140762928A>G	uc003lka.1	+	1	462	c.462A>G	c.(460-462)TTA>TTG	p.L154L	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003ljz.1_Silent_p.L154L	NM_018920	NP_061743	Q9Y5G6	PCDG7_HUMAN	protocadherin gamma subfamily A, 7 isoform 1	154	Extracellular (Potential).|Cadherin 2.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHGB6	56100	broad.mit.edu	37	5	140789521	140789521	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140789521C>T	uc003lkj.1	+	1	1752	c.1752C>T	c.(1750-1752)CCC>CCT	p.P584P	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc003lkf.1_Intron|PCDHGA9_uc003lkh.1_Intron|PCDHGB6_uc003lki.1_Silent_p.P584P	NM_018926	NP_061749	Q9Y5F9	PCDGI_HUMAN	protocadherin gamma subfamily B, 6 isoform 1	584	Extracellular (Potential).|Cadherin 6.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHGB7	56099	broad.mit.edu	37	5	140798879	140798879	+	Missense_Mutation	SNP	G	A	A	rs35892780		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140798879G>A	uc003lkn.1	+	1	1598	c.1453G>A	c.(1453-1455)GGC>AGC	p.G485S	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc003lkf.1_Intron|PCDHGA9_uc003lkh.1_Intron|PCDHGB6_uc003lkj.1_Intron|PCDHGA10_uc003lkl.1_Intron|PCDHGB7_uc003lkm.2_Missense_Mutation_p.G485S|PCDHGA11_uc003lko.1_5'Flank|PCDHGA11_uc003lkp.1_5'Flank|PCDHGA11_uc003lkq.1_5'Flank	NM_018927	NP_061750	Q9Y5F8	PCDGJ_HUMAN	protocadherin gamma subfamily B, 7 isoform 1	485	Extracellular (Potential).|Cadherin 5.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHGA12	26025	broad.mit.edu	37	5	140811594	140811594	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140811594C>T	uc003lkt.1	+	1	1437	c.1268C>T	c.(1267-1269)ACC>ATC	p.T423I	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc003lkc.1_Intron|PCDHGA8_uc003lkd.1_Intron|PCDHGB5_uc003lkf.1_Intron|PCDHGA9_uc003lkh.1_Intron|PCDHGB6_uc003lkj.1_Intron|PCDHGA10_uc003lkl.1_Intron|PCDHGB7_uc003lkn.1_Intron|PCDHGA11_uc003lkp.1_Intron|PCDHGA11_uc003lkq.1_Intron|PCDHGA12_uc011dba.1_Missense_Mutation_p.T423I	NM_003735	NP_003726	O60330	PCDGC_HUMAN	protocadherin gamma subfamily A, 12 isoform 1	423	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)|pancreas(1)|skin(1)	4			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
STK32A	202374	broad.mit.edu	37	5	146619223	146619223	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:146619223C>G	uc010jgn.1	+	2	306	c.26C>G	c.(25-27)CCA>CGA	p.P9R	STK32A_uc003lol.3_Missense_Mutation_p.P9R|STK32A_uc003lom.2_Missense_Mutation_p.P9R|STK32A_uc011dbw.1_Missense_Mutation_p.P9R	NM_001112724	NP_001106195	Q8WU08	ST32A_HUMAN	serine/threonine kinase 32A isoform 1	9							ATP binding|metal ion binding|protein serine/threonine kinase activity			lung(2)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
CD74	972	broad.mit.edu	37	5	149782828	149782828	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:149782828G>T	uc003lsc.2	-	7	684	c.673C>A	c.(673-675)CCG>ACG	p.P225T	CD74_uc003lsb.2_Intron|CD74_uc003lse.2_Intron|CD74_uc003lsd.2_Intron|CD74_uc003lsf.1_Missense_Mutation_p.P225T	NM_001025159	NP_001020330	P04233	HG2A_HUMAN	CD74 antigen isoform a	225	Thyroglobulin type-1.|Extracellular (Potential).				antigen processing and presentation of endogenous antigen|cell proliferation|immunoglobulin mediated immune response|intracellular protein transport|negative regulation of apoptosis|negative regulation of DNA damage response, signal transduction by p53 class mediator|negative regulation of peptide secretion|positive regulation of B cell proliferation|positive regulation of chemokine (C-X-C motif) ligand 2 production|positive regulation of cytokine-mediated signaling pathway|positive regulation of ERK1 and ERK2 cascade|positive regulation of fibroblast proliferation|positive regulation of macrophage cytokine production|positive regulation of neutrophil chemotaxis|positive regulation of peptidyl-tyrosine phosphorylation|prostaglandin biosynthetic process|protein complex assembly|regulation of macrophage activation	endoplasmic reticulum membrane|Golgi apparatus|integral to membrane|lysosome|receptor complex	beta-amyloid binding|cytokine receptor activity|identical protein binding|MHC class II protein binding			breast(1)	1		all_hematologic(541;0.224)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)					T	ROS1	NSCLC								---	---	---	---
SYNPO	11346	broad.mit.edu	37	5	150029083	150029083	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:150029083G>A	uc003lsn.2	+	3	2352	c.1978G>A	c.(1978-1980)GTG>ATG	p.V660M	SYNPO_uc003lso.3_Missense_Mutation_p.V416M|SYNPO_uc003lsp.2_Missense_Mutation_p.V416M	NM_001109974	NP_001103444	Q8N3V7	SYNPO_HUMAN	synaptopodin isoform B	660					positive regulation of actin filament bundle assembly|regulation of stress fiber assembly	actin cytoskeleton|cytoplasm|dendritic spine|perikaryon|postsynaptic density|postsynaptic membrane|tight junction	actin binding|protein binding			large_intestine(1)	1		Medulloblastoma(196;0.134)|all_hematologic(541;0.224)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)															---	---	---	---
SLC36A2	153201	broad.mit.edu	37	5	150723790	150723790	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:150723790A>C	uc003lty.2	-	2	333	c.203T>G	c.(202-204)ATG>AGG	p.M68R	GM2A_uc011dcs.1_Intron|SLC36A2_uc003ltz.2_RNA|SLC36A2_uc003lua.2_5'UTR|SLC36A2_uc010jhv.2_Missense_Mutation_p.M68R|SLC36A2_uc011dct.1_Missense_Mutation_p.M68R	NM_181776	NP_861441	Q495M3	S36A2_HUMAN	solute carrier family 36, member 2	68	Helical; (Potential).				cellular nitrogen compound metabolic process	cytoplasm|integral to membrane|plasma membrane	glycine transmembrane transporter activity			ovary(1)|central_nervous_system(1)	2		Medulloblastoma(196;0.109)|all_hematologic(541;0.243)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)															---	---	---	---
FAT2	2196	broad.mit.edu	37	5	150885663	150885663	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:150885663A>G	uc003lue.3	-						GM2A_uc011dcs.1_Intron|FAT2_uc003lud.3_Intron	NM_001447	NP_001438			FAT tumor suppressor 2 precursor						epithelial cell migration|homophilic cell adhesion	cell-cell adherens junction|integral to membrane|nucleus	calcium ion binding			ovary(4)|upper_aerodigestive_tract(1)|skin(1)	6		Medulloblastoma(196;0.0912)|all_hematologic(541;0.104)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)															---	---	---	---
FGF18	8817	broad.mit.edu	37	5	170863205	170863205	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:170863205C>T	uc003mbk.2	+	3	715	c.178C>T	c.(178-180)CGG>TGG	p.R60W		NM_003862	NP_003853	O76093	FGF18_HUMAN	fibroblast growth factor 18 precursor	60					cell-cell signaling|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|positive regulation of cell proliferation	extracellular space|nucleolus	growth factor activity|type 1 fibroblast growth factor receptor binding|type 2 fibroblast growth factor receptor binding				0	Renal(175;0.000159)|Lung NSC(126;0.011)|all_lung(126;0.0175)	Medulloblastoma(196;0.0208)|all_neural(177;0.0416)	Kidney(164;7.24e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000516)															---	---	---	---
CPEB4	80315	broad.mit.edu	37	5	173380104	173380104	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:173380104G>A	uc003mcs.3	+	9	3197	c.1791G>A	c.(1789-1791)GCG>GCA	p.A597A	CPEB4_uc010jju.1_Silent_p.A572A|CPEB4_uc010jjv.2_Silent_p.A580A|CPEB4_uc011dfg.1_Silent_p.A572A|CPEB4_uc003mct.3_Silent_p.A207A|CPEB4_uc003mcu.3_Silent_p.A190A	NM_030627	NP_085130	Q17RY0	CPEB4_HUMAN	cytoplasmic polyadenylation element binding	597	RRM 2.						nucleotide binding|RNA binding				0	Renal(175;0.000159)|Lung NSC(126;0.0128)|all_lung(126;0.0202)	Medulloblastoma(196;0.0399)|all_neural(177;0.0966)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000183)															---	---	---	---
EIF4E1B	253314	broad.mit.edu	37	5	176070250	176070250	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176070250G>A	uc010jkf.1	+	4	767	c.183G>A	c.(181-183)CTG>CTA	p.L61L		NM_001099408	NP_001092878	A6NMX2	I4E1B_HUMAN	eukaryotic translation initiation factor 4E	61					regulation of translation	cytoplasm|mRNA cap binding complex	translation initiation factor activity				0	all_cancers(89;0.00185)|Renal(175;0.000269)|Lung NSC(126;0.00902)|all_lung(126;0.0142)	Medulloblastoma(196;0.00498)|all_neural(177;0.0212)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
MAML1	9794	broad.mit.edu	37	5	179193438	179193438	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:179193438G>A	uc003mkm.2	+	2	1690	c.1427G>A	c.(1426-1428)CGG>CAG	p.R476Q	MAML1_uc003mkn.1_Missense_Mutation_p.R476Q	NM_014757	NP_055572	Q92585	MAML1_HUMAN	mastermind-like 1	476					Notch signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nuclear speck	peptide antigen binding|protein kinase binding|transcription coactivator activity			lung(4)|ovary(2)	6	all_cancers(89;0.000197)|all_epithelial(37;6.7e-05)|Renal(175;0.000159)|Lung NSC(126;0.00121)|all_lung(126;0.00218)	all_cancers(40;0.0308)|Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)															---	---	---	---
FARS2	10667	broad.mit.edu	37	6	5404836	5404836	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:5404836C>T	uc010jnv.1	+	3	1010	c.674C>T	c.(673-675)GCG>GTG	p.A225V	FARS2_uc003mwr.2_Missense_Mutation_p.A225V|FARS2_uc003mws.1_Missense_Mutation_p.A225V	NM_006567	NP_006558	O95363	SYFM_HUMAN	phenylalanyl-tRNA synthetase 2 precursor	225					phenylalanyl-tRNA aminoacylation|tRNA processing	mitochondrial matrix|soluble fraction	ATP binding|magnesium ion binding|phenylalanine-tRNA ligase activity|tRNA binding				0	Ovarian(93;0.11)	all_hematologic(90;0.0104)			L-Phenylalanine(DB00120)													---	---	---	---
ERVFRDE1	405754	broad.mit.edu	37	6	11105335	11105335	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:11105335G>A	uc003mzt.2	-	2	579	c.209C>T	c.(208-210)GCG>GTG	p.A70V	LOC221710_uc003mzr.2_Intron|LOC221710_uc011dio.1_Intron	NM_207582	NP_997465	P60508	EFRD1_HUMAN	syncytin 2	70	Extracellular (Potential).					integral to membrane|plasma membrane|virion					0																		---	---	---	---
DCDC2	51473	broad.mit.edu	37	6	24357791	24357791	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:24357791C>T	uc003ndx.2	-	1	490	c.188G>A	c.(187-189)AGG>AAG	p.R63K	DCDC2_uc003ndy.2_Missense_Mutation_p.R63K|KAAG1_uc003ndz.1_5'UTR	NM_016356	NP_057440	Q9UHG0	DCDC2_HUMAN	doublecortin domain containing 2	63	Doublecortin 1.				cellular defense response|intracellular signal transduction|neuron migration					ovary(1)	1		Ovarian(999;0.101)																---	---	---	---
HIST1H1D	3007	broad.mit.edu	37	6	26234786	26234786	+	Missense_Mutation	SNP	C	G	G	rs115924520	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26234786C>G	uc003nhd.2	-	1	431	c.376G>C	c.(376-378)GCA>CCA	p.A126P		NM_005320	NP_005311	P16402	H13_HUMAN	histone cluster 1, H1d	126					nucleosome assembly	nucleosome|nucleus	DNA binding			skin(1)	1		all_hematologic(11;0.0945)|Acute lymphoblastic leukemia(11;0.167)																---	---	---	---
BTN1A1	696	broad.mit.edu	37	6	26502055	26502055	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26502055G>A	uc003nif.3	+	2	337	c.317G>A	c.(316-318)CGC>CAC	p.R106H		NM_001732	NP_001723	Q13410	BT1A1_HUMAN	butyrophilin, subfamily 1, member A1 precursor	106	Extracellular (Potential).|Ig-like V-type 1.					extracellular region|integral to plasma membrane	receptor activity	p.R106S(1)		ovary(1)|skin(1)	2																		---	---	---	---
HIST1H2BN	8341	broad.mit.edu	37	6	27806590	27806590	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27806590C>T	uc003njv.2	+	1	151	c.151C>T	c.(151-153)CCC>TCC	p.P51S	HIST1H2AK_uc003njs.2_5'Flank|HIST1H2BN_uc003njt.1_RNA|HIST1H2BN_uc003nju.1_Missense_Mutation_p.P51S	NM_003520	NP_003511	Q99877	H2B1N_HUMAN	histone cluster 1, H2bn	51					nucleosome assembly	nucleosome|nucleus	DNA binding				0																		---	---	---	---
ZSCAN16	80345	broad.mit.edu	37	6	28094637	28094637	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28094637C>T	uc003nkm.2	+	3	564	c.464C>T	c.(463-465)ACT>ATT	p.T155I	uc010jqw.1_Intron|uc003nkk.1_Intron|uc003nkl.1_Intron|ZSCAN16_uc011dky.1_Missense_Mutation_p.T155I	NM_025231	NP_079507	Q9H4T2	ZSC16_HUMAN	zinc finger and SCAN domain containing 16	155					viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			large_intestine(1)	1																		---	---	---	---
ZKSCAN4	387032	broad.mit.edu	37	6	28213420	28213420	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28213420G>A	uc003nks.1	-	5	1356	c.1112C>T	c.(1111-1113)ACT>ATT	p.T371I	ZKSCAN4_uc011dlb.1_Missense_Mutation_p.T216I	NM_019110	NP_061983	Q969J2	ZKSC4_HUMAN	zinc finger with KRAB and SCAN domains 4	371					viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1																		---	---	---	---
SCAND3	114821	broad.mit.edu	37	6	28554244	28554244	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28554244T>C	uc003nlo.2	-	1	869	c.251A>G	c.(250-252)GAG>GGG	p.E84G	uc003nlp.1_5'Flank	NM_052923	NP_443155	Q6R2W3	SCND3_HUMAN	SCAN domain containing 3	84	SCAN box.				DNA integration|viral reproduction	nucleus	DNA binding|protein dimerization activity|sequence-specific DNA binding transcription factor activity			ovary(1)	1																		---	---	---	---
GABBR1	2550	broad.mit.edu	37	6	29599375	29599375	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29599375A>G	uc003nmt.3	-	3	423	c.87T>C	c.(85-87)GGT>GGC	p.G29G	GABBR1_uc003nmu.3_Silent_p.G29G|GABBR1_uc011dlr.1_5'UTR|GABBR1_uc011dls.1_Silent_p.G29G	NM_001470	NP_001461	Q9UBS5	GABR1_HUMAN	gamma-aminobutyric acid (GABA) B receptor 1	29	Extracellular (Potential).				gamma-aminobutyric acid signaling pathway|negative regulation of adenylate cyclase activity|synaptic transmission	cell junction|extracellular region|integral to plasma membrane|postsynaptic membrane	G-protein coupled receptor activity|GABA-B receptor activity			ovary(5)|liver(1)|skin(1)	7					Baclofen(DB00181)|Progabide(DB00837)													---	---	---	---
VARS2	57176	broad.mit.edu	37	6	30889738	30889738	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30889738T>C	uc003nsc.1	+	18	2404	c.1772T>C	c.(1771-1773)CTG>CCG	p.L591P	VARS2_uc011dmx.1_Missense_Mutation_p.L591P|VARS2_uc011dmy.1_Missense_Mutation_p.L451P|VARS2_uc011dmz.1_Missense_Mutation_p.L621P|VARS2_uc011dna.1_Missense_Mutation_p.L589P|VARS2_uc011dnb.1_RNA|VARS2_uc011dnc.1_Intron|VARS2_uc011dnd.1_Silent_p.P6P|VARS2_uc010jsg.1_Intron|VARS2_uc010jsh.1_5'Flank	NM_020442	NP_065175	Q5ST30	SYVM_HUMAN	valyl-tRNA synthetase 2, mitochondrial	591					valyl-tRNA aminoacylation	mitochondrion	ATP binding|valine-tRNA ligase activity			ovary(3)|central_nervous_system(1)	4																		---	---	---	---
VARS2	57176	broad.mit.edu	37	6	30890692	30890692	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30890692C>T	uc003nsc.1	+	22	2756	c.2124C>T	c.(2122-2124)CAC>CAT	p.H708H	VARS2_uc011dmx.1_Silent_p.H708H|VARS2_uc011dmy.1_Silent_p.H568H|VARS2_uc011dmz.1_Silent_p.H738H|VARS2_uc011dna.1_Silent_p.H706H|VARS2_uc011dnb.1_RNA|VARS2_uc011dnc.1_RNA|VARS2_uc011dnd.1_Silent_p.H146H|VARS2_uc010jsg.1_Silent_p.H80H|VARS2_uc010jsh.1_5'Flank	NM_020442	NP_065175	Q5ST30	SYVM_HUMAN	valyl-tRNA synthetase 2, mitochondrial	708					valyl-tRNA aminoacylation	mitochondrion	ATP binding|valine-tRNA ligase activity			ovary(3)|central_nervous_system(1)	4																		---	---	---	---
VARS	7407	broad.mit.edu	37	6	31750063	31750063	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31750063G>A	uc003nxe.2	-	17	2572	c.2149C>T	c.(2149-2151)CGG>TGG	p.R717W	VARS_uc003nxf.1_5'Flank|VARS_uc011doi.1_RNA	NM_006295	NP_006286	P26640	SYVC_HUMAN	valyl-tRNA synthetase	717					translational elongation|valyl-tRNA aminoacylation	cytosol	ATP binding|protein binding|valine-tRNA ligase activity			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3					L-Valine(DB00161)													---	---	---	---
RNF5	6048	broad.mit.edu	37	6	32147867	32147867	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32147867G>A	uc003oaj.3	+	5	536	c.409G>A	c.(409-411)GTC>ATC	p.V137I	AGPAT1_uc003oaf.2_5'Flank|AGPAT1_uc003oag.2_5'Flank|AGPAT1_uc003oah.2_5'Flank	NM_006913	NP_008844	Q99942	RNF5_HUMAN	ring finger protein 5	137	Helical; (Potential).				ER-associated misfolded protein catabolic process|protein K48-linked ubiquitination|protein K63-linked ubiquitination	endoplasmic reticulum membrane|integral to membrane|mitochondrial membrane	protein binding|ubiquitin-protein ligase activity|zinc ion binding				0																		---	---	---	---
HLA-DMB	3109	broad.mit.edu	37	6	32908589	32908589	+	5'UTR	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32908589T>C	uc003ocl.1	-	1					HLA-DMB_uc003ocj.1_5'UTR|HLA-DMB_uc011dql.1_5'UTR	NM_002118	NP_002109			major histocompatibility complex, class II, DM						antigen processing and presentation of peptide or polysaccharide antigen via MHC class II|interferon-gamma-mediated signaling pathway|T cell costimulation|T cell receptor signaling pathway	integral to membrane|late endosome membrane|lysosomal membrane|MHC class II protein complex					0																		---	---	---	---
ITPR3	3710	broad.mit.edu	37	6	33641973	33641973	+	Intron	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33641973C>A	uc011drk.1	+							NM_002224	NP_002215			inositol 1,4,5-triphosphate receptor, type 3						activation of phospholipase C activity|calcium ion transport into cytosol|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|nerve growth factor receptor signaling pathway|platelet activation|protein heterooligomerization|protein homooligomerization|regulation of insulin secretion|response to calcium ion	apical part of cell|brush border|endoplasmic reticulum membrane|integral to plasma membrane|myelin sheath|neuronal cell body|nuclear outer membrane|platelet dense tubular network membrane	inositol 1,3,4,5 tetrakisphosphate binding|inositol 1,4,5 trisphosphate binding|inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity|inositol hexakisphosphate binding|intracellular ligand-gated calcium channel activity|protein binding			ovary(6)|lung(5)|central_nervous_system(5)|breast(2)|kidney(1)	19																		---	---	---	---
ITPR3	3710	broad.mit.edu	37	6	33652652	33652652	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33652652G>A	uc011drk.1	+	39	5458	c.5239G>A	c.(5239-5241)GAG>AAG	p.E1747K	ITPR3_uc003oey.2_5'Flank	NM_002224	NP_002215	Q14573	ITPR3_HUMAN	inositol 1,4,5-triphosphate receptor, type 3	1747	Cytoplasmic (Potential).				activation of phospholipase C activity|calcium ion transport into cytosol|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|nerve growth factor receptor signaling pathway|platelet activation|protein heterooligomerization|protein homooligomerization|regulation of insulin secretion|response to calcium ion	apical part of cell|brush border|endoplasmic reticulum membrane|integral to plasma membrane|myelin sheath|neuronal cell body|nuclear outer membrane|platelet dense tubular network membrane	inositol 1,3,4,5 tetrakisphosphate binding|inositol 1,4,5 trisphosphate binding|inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity|inositol hexakisphosphate binding|intracellular ligand-gated calcium channel activity|protein binding			ovary(6)|lung(5)|central_nervous_system(5)|breast(2)|kidney(1)	19																		---	---	---	---
UHRF1BP1	54887	broad.mit.edu	37	6	34825148	34825148	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34825148C>T	uc003oju.3	+	12	1708	c.1474C>T	c.(1474-1476)CTT>TTT	p.L492F	UHRF1BP1_uc010jvm.1_RNA|UHRF1BP1_uc010jvn.2_RNA|UHRF1BP1_uc010jvo.2_5'Flank	NM_017754	NP_060224	Q6BDS2	URFB1_HUMAN	ICBP90 binding protein 1	492										ovary(3)	3																		---	---	---	---
MAPK13	5603	broad.mit.edu	37	6	36106213	36106213	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:36106213G>A	uc003ols.2	+	9	852	c.754G>A	c.(754-756)GAC>AAC	p.D252N	MAPK13_uc003olt.2_Intron	NM_002754	NP_002745	O15264	MK13_HUMAN	mitogen-activated protein kinase 13	252	Protein kinase.				cell cycle|intracellular protein kinase cascade|nerve growth factor receptor signaling pathway|positive regulation of interleukin-6 production|Ras protein signal transduction|response to stress		ATP binding|MAP kinase activity|protein binding			breast(2)|central_nervous_system(1)	3																		---	---	---	---
C6orf222	389384	broad.mit.edu	37	6	36298038	36298038	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:36298038G>T	uc003oly.2	-	2	608	c.430C>A	c.(430-432)CTC>ATC	p.L144I		NM_001010903	NP_001010903	P0C671	CF222_HUMAN	hypothetical protein LOC389384	144										skin(2)|ovary(1)|breast(1)	4																		---	---	---	---
DNAH8	1769	broad.mit.edu	37	6	38903419	38903419	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38903419C>T	uc003ooe.1	+	75	11458	c.10858C>T	c.(10858-10860)CGG>TGG	p.R3620W	DNAH8_uc003oog.1_Missense_Mutation_p.R69W|uc003oof.1_Intron	NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21																		---	---	---	---
TFEB	7942	broad.mit.edu	37	6	41657475	41657475	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41657475G>T	uc003oqs.1	-	5	845	c.543C>A	c.(541-543)CCC>CCA	p.P181P	TFEB_uc003oqt.1_Silent_p.P181P|TFEB_uc003oqu.1_Silent_p.P195P|TFEB_uc003oqv.1_Silent_p.P181P|TFEB_uc010jxo.1_Silent_p.P181P|TFEB_uc003oqr.1_Silent_p.P96P	NM_007162	NP_009093	P19484	TFEB_HUMAN	transcription factor EB	181					embryonic placenta development|humoral immune response|positive regulation of transcription from RNA polymerase II promoter	cytoplasm	sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			ovary(1)	1	Ovarian(28;0.0355)|Colorectal(47;0.121)		Epithelial(12;7.61e-05)|STAD - Stomach adenocarcinoma(11;0.000204)|Colorectal(64;0.00245)|COAD - Colon adenocarcinoma(64;0.00507)					T	ALPHA	renal (childhood epithelioid)								---	---	---	---
TRERF1	55809	broad.mit.edu	37	6	42231171	42231171	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42231171T>C	uc003osd.2	-	8	2334	c.1771A>G	c.(1771-1773)AAG>GAG	p.K591E	TRERF1_uc011duq.1_Intron|TRERF1_uc003osb.2_Intron|TRERF1_uc003osc.2_Intron|TRERF1_uc003ose.2_Missense_Mutation_p.K591E	NM_033502	NP_277037	Q96PN7	TREF1_HUMAN	transcriptional regulating factor 1	591	Pro-rich.|Interacts with CREBBP.				cholesterol catabolic process|homeostatic process|multicellular organismal development|positive regulation of transcription, DNA-dependent|regulation of hormone biosynthetic process|steroid biosynthetic process	nucleus	DNA bending activity|ligand-dependent nuclear receptor transcription coactivator activity|RNA polymerase II transcription cofactor activity|sequence-specific DNA binding transcription factor activity|transcription factor binding|zinc ion binding			ovary(3)|pancreas(1)|skin(1)	5	Colorectal(47;0.196)		Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)															---	---	---	---
CUL9	23113	broad.mit.edu	37	6	43155673	43155673	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43155673G>A	uc003ouk.2	+	7	1879	c.1804G>A	c.(1804-1806)GCC>ACC	p.A602T	CUL9_uc003ouj.1_Missense_Mutation_p.A492T|CUL9_uc003oul.2_Missense_Mutation_p.A602T|CUL9_uc010jyk.2_5'UTR|CUL9_uc003oum.1_Missense_Mutation_p.A60T	NM_015089	NP_055904	Q8IWT3	CUL9_HUMAN	p53-associated parkin-like cytoplasmic protein	602					ubiquitin-dependent protein catabolic process	cullin-RING ubiquitin ligase complex|cytoplasm	ATP binding|ubiquitin protein ligase binding|zinc ion binding			ovary(5)|lung(3)|skin(2)|breast(1)|central_nervous_system(1)	12																		---	---	---	---
CUL9	23113	broad.mit.edu	37	6	43181594	43181594	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43181594C>T	uc003ouk.2	+	29	5707	c.5632C>T	c.(5632-5634)CGT>TGT	p.R1878C	CUL9_uc003oul.2_Missense_Mutation_p.R1850C|CUL9_uc010jyk.2_Missense_Mutation_p.R1030C|CUL9_uc003oun.2_5'UTR	NM_015089	NP_055904	Q8IWT3	CUL9_HUMAN	p53-associated parkin-like cytoplasmic protein	1878					ubiquitin-dependent protein catabolic process	cullin-RING ubiquitin ligase complex|cytoplasm	ATP binding|ubiquitin protein ligase binding|zinc ion binding			ovary(5)|lung(3)|skin(2)|breast(1)|central_nervous_system(1)	12																		---	---	---	---
SLC22A7	10864	broad.mit.edu	37	6	43267525	43267525	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43267525G>A	uc003out.2	+						SLC22A7_uc010jyl.1_Missense_Mutation_p.A220T|SLC22A7_uc003ous.2_Intron	NM_153320	NP_696961			solute carrier family 22 member 7 isoform b							basolateral plasma membrane|integral to plasma membrane|membrane fraction	anion:anion antiporter activity|sodium-independent organic anion transmembrane transporter activity				0			Colorectal(64;0.00245)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.00998)|OV - Ovarian serous cystadenocarcinoma(102;0.0305)															---	---	---	---
ABCC10	89845	broad.mit.edu	37	6	43415559	43415559	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43415559C>T	uc003ouy.1	+	18	4058	c.3843C>T	c.(3841-3843)CGC>CGT	p.R1281R	ABCC10_uc003ouz.1_Silent_p.R1253R|ABCC10_uc010jyo.1_Silent_p.R387R	NM_033450	NP_258261	Q5T3U5	MRP7_HUMAN	ATP-binding cassette, sub-family C, member 10	1281	ABC transporter 2.|ATP 2 (Potential).					integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(6)|central_nervous_system(1)	7	all_lung(25;0.00536)		Colorectal(64;0.00245)|COAD - Colon adenocarcinoma(64;0.00536)|all cancers(41;0.0152)|OV - Ovarian serous cystadenocarcinoma(102;0.0804)															---	---	---	---
GPR111	222611	broad.mit.edu	37	6	47650252	47650252	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47650252G>A	uc010jzj.1	+	6	1958	c.1957G>A	c.(1957-1959)GCC>ACC	p.A653T	GPR111_uc010jzk.1_Missense_Mutation_p.A585T|GPR111_uc003oyy.2_RNA	NM_153839	NP_722581	Q8IZF7	GP111_HUMAN	G-protein coupled receptor 111	653	Helical; Name=6; (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			skin(1)	1																		---	---	---	---
PKHD1	5314	broad.mit.edu	37	6	51897950	51897950	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51897950C>T	uc003pah.1	-	29	3518	c.3242G>A	c.(3241-3243)CGC>CAC	p.R1081H	PKHD1_uc003pai.2_Missense_Mutation_p.R1081H	NM_138694	NP_619639	P08F94	PKHD1_HUMAN	fibrocystin isoform 1	1081	IPT/TIG 5.|Extracellular (Potential).		R -> C (in a colorectal cancer sample; somatic mutation).		cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity	p.R1081C(1)		lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)																	---	---	---	---
PKHD1	5314	broad.mit.edu	37	6	51913367	51913367	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51913367G>A	uc003pah.1	-	23	2606	c.2330C>T	c.(2329-2331)ACG>ATG	p.T777M	PKHD1_uc003pai.2_Missense_Mutation_p.T777M	NM_138694	NP_619639	P08F94	PKHD1_HUMAN	fibrocystin isoform 1	777	Extracellular (Potential).				cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity			lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)																	---	---	---	---
GCM1	8521	broad.mit.edu	37	6	52999038	52999038	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:52999038G>A	uc003pbp.2	-	3	369	c.160C>T	c.(160-162)CGG>TGG	p.R54W	GCM1_uc010jzr.2_Missense_Mutation_p.R54W	NM_003643	NP_003634	Q9NP62	GCM1_HUMAN	glial cells missing homolog a	54	GCM.					transcription factor complex	DNA binding|sequence-specific DNA binding transcription factor activity|transcription factor binding			central_nervous_system(1)	1	Lung NSC(77;0.0755)																	---	---	---	---
PHF3	23469	broad.mit.edu	37	6	64423103	64423103	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:64423103A>G	uc003pep.1	+	15	5645	c.5619A>G	c.(5617-5619)TCA>TCG	p.S1873S	PHF3_uc003pen.2_Silent_p.S1785S|PHF3_uc011dxs.1_Silent_p.S1142S	NM_015153	NP_055968	Q92576	PHF3_HUMAN	PHD finger protein 3	1873					multicellular organismal development|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(3)|lung(1)|skin(1)	5	all_cancers(3;0.0241)|all_epithelial(2;0.00306)|Lung NSC(77;0.121)		LUSC - Lung squamous cell carcinoma(74;0.0644)|Lung(124;0.148)															---	---	---	---
COL9A1	1297	broad.mit.edu	37	6	70942332	70942332	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70942332C>T	uc003pfg.3	-	36	2616	c.2457G>A	c.(2455-2457)CCG>CCA	p.P819P	COL9A1_uc003pfe.3_Silent_p.P368P|COL9A1_uc003pff.3_Silent_p.P576P	NM_001851	NP_001842	P20849	CO9A1_HUMAN	alpha 1 type IX collagen isoform 1 precursor	819	Triple-helical region (COL1).				axon guidance|cell adhesion|organ morphogenesis	collagen type IX	metal ion binding			ovary(4)	4																		---	---	---	---
COL12A1	1303	broad.mit.edu	37	6	75843658	75843658	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:75843658C>A	uc003phs.2	-	33	5746	c.5580G>T	c.(5578-5580)TTG>TTT	p.L1860F	COL12A1_uc003pht.2_Missense_Mutation_p.L696F	NM_004370	NP_004361	Q99715	COCA1_HUMAN	collagen, type XII, alpha 1 long isoform	1860	Fibronectin type-III 14.				cell adhesion|collagen fibril organization|skeletal system development	collagen type XII|extracellular space	extracellular matrix structural constituent conferring tensile strength			ovary(6)|large_intestine(1)|breast(1)|skin(1)	9																		---	---	---	---
PHIP	55023	broad.mit.edu	37	6	79655834	79655834	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:79655834C>T	uc003pir.2	-	38	4740	c.4514G>A	c.(4513-4515)CGA>CAA	p.R1505Q	PHIP_uc003piq.2_Missense_Mutation_p.R529Q|PHIP_uc011dyp.1_Missense_Mutation_p.R1504Q|IRAK1BP1_uc010kbg.1_RNA|PHIP_uc003pio.3_Missense_Mutation_p.R391Q	NM_017934	NP_060404	Q8WWQ0	PHIP_HUMAN	pleckstrin homology domain interacting protein	1505					insulin receptor signaling pathway|negative regulation of apoptosis|positive regulation of cell proliferation|positive regulation of insulin-like growth factor receptor signaling pathway|positive regulation of mitosis	nucleus	insulin receptor binding			large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)|ovary(1)	6		all_cancers(76;0.00125)|Acute lymphoblastic leukemia(125;1.1e-05)|all_hematologic(105;0.00117)|all_epithelial(107;0.219)		BRCA - Breast invasive adenocarcinoma(397;0.231)														---	---	---	---
PHIP	55023	broad.mit.edu	37	6	79770253	79770253	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:79770253C>T	uc003pir.2	-	6	607	c.381G>A	c.(379-381)GCG>GCA	p.A127A	PHIP_uc011dyp.1_Silent_p.A127A	NM_017934	NP_060404	Q8WWQ0	PHIP_HUMAN	pleckstrin homology domain interacting protein	127					insulin receptor signaling pathway|negative regulation of apoptosis|positive regulation of cell proliferation|positive regulation of insulin-like growth factor receptor signaling pathway|positive regulation of mitosis	nucleus	insulin receptor binding			large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)|ovary(1)	6		all_cancers(76;0.00125)|Acute lymphoblastic leukemia(125;1.1e-05)|all_hematologic(105;0.00117)|all_epithelial(107;0.219)		BRCA - Breast invasive adenocarcinoma(397;0.231)														---	---	---	---
IBTK	25998	broad.mit.edu	37	6	82950191	82950191	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:82950191T>C	uc003pjl.1	-	2	540	c.13A>G	c.(13-15)ATG>GTG	p.M5V	IBTK_uc011dyv.1_Missense_Mutation_p.M5V|IBTK_uc011dyw.1_Missense_Mutation_p.M5V|IBTK_uc010kbi.1_5'UTR|IBTK_uc003pjm.2_Missense_Mutation_p.M5V	NM_015525	NP_056340	Q9P2D0	IBTK_HUMAN	inhibitor of Bruton's tyrosine kinase	5					negative regulation of protein phosphorylation|release of sequestered calcium ion into cytosol	cytoplasm|membrane|nucleus	protein kinase binding|protein tyrosine kinase inhibitor activity			ovary(2)|central_nervous_system(2)	4		all_cancers(76;3.38e-06)|Acute lymphoblastic leukemia(125;3.41e-06)|all_hematologic(105;0.000865)|all_epithelial(107;0.0037)		BRCA - Breast invasive adenocarcinoma(397;0.0901)														---	---	---	---
PGM3	5238	broad.mit.edu	37	6	83884156	83884156	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:83884156T>A	uc003pjv.2	-	10	1219	c.1179A>T	c.(1177-1179)CAA>CAT	p.Q393H	PGM3_uc003pjw.2_Missense_Mutation_p.Q312H|PGM3_uc011dyz.1_Missense_Mutation_p.Q421H	NM_015599	NP_056414	O95394	AGM1_HUMAN	phosphoglucomutase 3	393					dolichol-linked oligosaccharide biosynthetic process|embryo development ending in birth or egg hatching|glucose 1-phosphate metabolic process|hemopoiesis|post-translational protein modification|protein N-linked glycosylation via asparagine|UDP-N-acetylglucosamine biosynthetic process	cytosol	magnesium ion binding|phosphoacetylglucosamine mutase activity|phosphoglucomutase activity				0		all_cancers(76;0.000504)|Acute lymphoblastic leukemia(125;3.85e-06)|all_hematologic(105;0.0017)|all_epithelial(107;0.068)		BRCA - Breast invasive adenocarcinoma(397;0.0478)														---	---	---	---
TBX18	9096	broad.mit.edu	37	6	85472393	85472393	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:85472393C>T	uc003pkl.1	-	2	366	c.366G>A	c.(364-366)CCG>CCA	p.P122P	TBX18_uc010kbq.1_5'UTR	NM_001080508	NP_001073977	O95935	TBX18_HUMAN	T-box 18	122					multicellular organismal development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity	p.P122L(1)		ovary(2)|pancreas(2)|lung(1)	5		all_cancers(76;0.000283)|Acute lymphoblastic leukemia(125;3.66e-08)|all_hematologic(105;8.61e-05)|all_epithelial(107;0.0858)		BRCA - Breast invasive adenocarcinoma(108;0.0267)														---	---	---	---
RARS2	57038	broad.mit.edu	37	6	88239291	88239291	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:88239291G>A	uc003pme.2	-	10	907	c.847C>T	c.(847-849)CTG>TTG	p.L283L	RARS2_uc003pmb.2_Silent_p.L108L|RARS2_uc003pmc.2_Silent_p.L108L|RARS2_uc003pmd.2_5'UTR|RARS2_uc003pmf.2_RNA	NM_020320	NP_064716	Q5T160	SYRM_HUMAN	arginyl-tRNA synthetase 2, mitochondrial	283					arginyl-tRNA aminoacylation	mitochondrial matrix	arginine-tRNA ligase activity|ATP binding|protein binding			ovary(2)|central_nervous_system(1)	3		all_cancers(76;3.93e-06)|Acute lymphoblastic leukemia(125;3.55e-10)|Prostate(29;3.51e-09)|all_hematologic(105;3.29e-06)|all_epithelial(107;0.00575)		BRCA - Breast invasive adenocarcinoma(108;0.0456)														---	---	---	---
GABRR1	2569	broad.mit.edu	37	6	89890064	89890064	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:89890064C>T	uc003pna.2	-	9	1548	c.1093G>A	c.(1093-1095)GTC>ATC	p.V365I	GABRR1_uc011dzv.1_Missense_Mutation_p.V342I	NM_002042	NP_002033	P24046	GBRR1_HUMAN	gamma-aminobutyric acid (GABA) receptor, rho 1	365	Helical; (Probable).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			pancreas(1)	1		all_cancers(76;9.49e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.46e-10)|all_hematologic(105;7.74e-07)|all_epithelial(107;0.000114)		BRCA - Breast invasive adenocarcinoma(108;0.00917)	Picrotoxin(DB00466)													---	---	---	---
MDN1	23195	broad.mit.edu	37	6	90411617	90411617	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90411617T>C	uc003pnn.1	-							NM_014611	NP_055426			MDN1, midasin homolog						protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)														---	---	---	---
EPHA7	2045	broad.mit.edu	37	6	94068094	94068094	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:94068094C>A	uc003poe.2	-	4	1109	c.868G>T	c.(868-870)GAT>TAT	p.D290Y	EPHA7_uc003pof.2_Missense_Mutation_p.D290Y|EPHA7_uc011eac.1_Missense_Mutation_p.D290Y	NM_004440	NP_004431	Q15375	EPHA7_HUMAN	ephrin receptor EphA7 precursor	290	Extracellular (Potential).|Cys-rich.					integral to plasma membrane	ATP binding|ephrin receptor activity			lung(8)|ovary(7)|upper_aerodigestive_tract(3)|central_nervous_system(3)|skin(3)|large_intestine(2)|stomach(1)|pancreas(1)	28		all_cancers(76;7.47e-10)|Acute lymphoblastic leukemia(125;1.88e-09)|all_hematologic(75;1.75e-07)|all_epithelial(107;3.6e-05)|Lung NSC(302;0.0368)|all_lung(197;0.0509)|Colorectal(196;0.142)		BRCA - Breast invasive adenocarcinoma(108;0.0847)														---	---	---	---
POPDC3	64208	broad.mit.edu	37	6	105609533	105609533	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:105609533C>T	uc003prb.2	-	2	654	c.252G>A	c.(250-252)CTG>CTA	p.L84L	uc003pqz.2_Intron|POPDC3_uc003pra.2_Intron	NM_022361	NP_071756	Q9HBV1	POPD3_HUMAN	popeye protein 3	84	Helical; (Potential).					integral to membrane				skin(3)|ovary(2)	5		all_cancers(87;4.87e-05)|Acute lymphoblastic leukemia(125;1.9e-08)|all_hematologic(75;9.25e-07)|all_epithelial(87;0.0157)|Colorectal(196;0.202)|Lung NSC(302;0.238)																---	---	---	---
AIM1	202	broad.mit.edu	37	6	106967902	106967902	+	Missense_Mutation	SNP	G	A	A	rs139571922	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:106967902G>A	uc003prh.2	+	2	2082	c.1595G>A	c.(1594-1596)CGT>CAT	p.R532H		NM_001624	NP_001615	Q9Y4K1	AIM1_HUMAN	absent in melanoma 1	532							sugar binding			breast(4)|ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|skin(1)	9	Breast(9;0.0138)|all_epithelial(6;0.169)	all_cancers(87;4.67e-25)|all_epithelial(87;5.46e-21)|Acute lymphoblastic leukemia(125;2.15e-07)|all_hematologic(75;5.28e-06)|Colorectal(196;3.46e-05)|all_lung(197;5.94e-05)|Lung NSC(302;7.26e-05)|Ovarian(999;0.00473)	Epithelial(6;0.00114)|all cancers(7;0.00726)|BRCA - Breast invasive adenocarcinoma(8;0.0114)|OV - Ovarian serous cystadenocarcinoma(5;0.0305)	all cancers(137;1.73e-50)|Epithelial(106;2.42e-48)|OV - Ovarian serous cystadenocarcinoma(136;1.51e-27)|BRCA - Breast invasive adenocarcinoma(108;0.00104)|GBM - Glioblastoma multiforme(226;0.00858)														---	---	---	---
BEND3	57673	broad.mit.edu	37	6	107390480	107390480	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:107390480G>A	uc003prs.2	-	5	2565	c.1915C>T	c.(1915-1917)CTG>TTG	p.L639L		NM_001080450	NP_001073919	Q5T5X7	BEND3_HUMAN	BEN domain containing 3	639	BEN 3.									ovary(3)	3																		---	---	---	---
BEND3	57673	broad.mit.edu	37	6	107390687	107390687	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:107390687T>C	uc003prs.2	-	5	2358	c.1708A>G	c.(1708-1710)ATC>GTC	p.I570V		NM_001080450	NP_001073919	Q5T5X7	BEND3_HUMAN	BEN domain containing 3	570	BEN 3.									ovary(3)	3																		---	---	---	---
SLC16A10	117247	broad.mit.edu	37	6	111527861	111527861	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:111527861G>A	uc003pus.2	+	4	1184	c.1009G>A	c.(1009-1011)GTC>ATC	p.V337I	SLC16A10_uc003put.2_Missense_Mutation_p.V23I	NM_018593	NP_061063	Q8TF71	MOT10_HUMAN	solute carrier family 16, member 10	337	Helical; (Potential).				aromatic amino acid transport|cellular nitrogen compound metabolic process|ion transport	basolateral plasma membrane|integral to membrane	amino acid transmembrane transporter activity				0		all_cancers(87;0.00172)|Acute lymphoblastic leukemia(125;2.27e-07)|all_hematologic(75;1.38e-05)|all_epithelial(87;0.0313)|Colorectal(196;0.0466)		OV - Ovarian serous cystadenocarcinoma(136;0.0703)|Epithelial(106;0.12)|all cancers(137;0.132)														---	---	---	---
REV3L	5980	broad.mit.edu	37	6	111695520	111695520	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:111695520A>G	uc003puy.3	-	13	4361	c.4038T>C	c.(4036-4038)TTT>TTC	p.F1346F	REV3L_uc003pux.3_Silent_p.F1268F|REV3L_uc003puz.3_Silent_p.F1268F	NM_002912	NP_002903	O60673	DPOLZ_HUMAN	DNA polymerase zeta	1346					DNA-dependent DNA replication|translesion synthesis	nucleus|zeta DNA polymerase complex	DNA binding|DNA-directed DNA polymerase activity|metal ion binding|nucleotide binding			large_intestine(2)|ovary(2)|skin(2)	6		all_cancers(87;7.57e-06)|Acute lymphoblastic leukemia(125;2.46e-08)|all_hematologic(75;1.08e-06)|all_epithelial(87;0.00138)|Colorectal(196;0.021)		OV - Ovarian serous cystadenocarcinoma(136;0.0314)|Epithelial(106;0.057)|all cancers(137;0.0663)									DNA_polymerases_(catalytic_subunits)|Direct_reversal_of_damage					---	---	---	---
TUBE1	51175	broad.mit.edu	37	6	112405384	112405384	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112405384T>C	uc003pvq.2	-						TUBE1_uc003pvr.2_Intron	NM_016262	NP_057346			tubulin, epsilon 1						centrosome cycle|microtubule-based movement|protein polymerization	microtubule|pericentriolar material	GTP binding|GTPase activity|structural constituent of cytoskeleton			ovary(1)	1		all_cancers(87;0.0101)|all_hematologic(75;0.000258)|Colorectal(196;0.0466)|all_epithelial(87;0.1)		all cancers(137;0.0217)|OV - Ovarian serous cystadenocarcinoma(136;0.0613)|Epithelial(106;0.0636)|GBM - Glioblastoma multiforme(226;0.0972)|BRCA - Breast invasive adenocarcinoma(108;0.246)														---	---	---	---
DSE	29940	broad.mit.edu	37	6	116758028	116758028	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:116758028A>G	uc003pws.2	+	6	2591	c.2397A>G	c.(2395-2397)CAA>CAG	p.Q799Q	DSE_uc011ebg.1_Silent_p.Q818Q|DSE_uc003pwt.2_Silent_p.Q799Q|DSE_uc003pwu.2_Silent_p.Q466Q	NM_001080976	NP_001074445	Q9UL01	DSE_HUMAN	dermatan sulfate epimerase precursor	799					dermatan sulfate biosynthetic process	endoplasmic reticulum|Golgi apparatus|integral to membrane	chondroitin-glucuronate 5-epimerase activity			ovary(1)	1		all_cancers(87;0.00019)|all_epithelial(87;0.000416)|Ovarian(999;0.133)|Colorectal(196;0.234)		Epithelial(106;0.00915)|OV - Ovarian serous cystadenocarcinoma(136;0.0149)|GBM - Glioblastoma multiforme(226;0.0189)|all cancers(137;0.0262)														---	---	---	---
TRDN	10345	broad.mit.edu	37	6	123673709	123673709	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:123673709C>A	uc003pzj.1	-	21	1366	c.1344G>T	c.(1342-1344)GAG>GAT	p.E448D	TRDN_uc003pzk.1_Missense_Mutation_p.E449D|TRDN_uc003pzl.1_Missense_Mutation_p.E449D|TRDN_uc010kem.1_5'UTR	NM_006073	NP_006064	Q13061	TRDN_HUMAN	triadin	448	Lumenal.				muscle contraction	integral to membrane|plasma membrane|sarcoplasmic reticulum membrane	receptor binding			ovary(1)	1				GBM - Glioblastoma multiforme(226;0.184)														---	---	---	---
HEY2	23493	broad.mit.edu	37	6	126080753	126080753	+	Silent	SNP	G	A	A	rs34745209	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:126080753G>A	uc003qad.2	+	5	1010	c.819G>A	c.(817-819)GCG>GCA	p.A273A	HEY2_uc011ebr.1_Silent_p.A227A	NM_012259	NP_036391	Q9UBP5	HEY2_HUMAN	hairy/enhancer-of-split related with YRPW motif	273	Ala-rich.				negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription initiation from RNA polymerase II promoter|negative regulation of transcription regulatory region DNA binding|Notch signaling pathway|smooth muscle cell differentiation|transcription, DNA-dependent	transcriptional repressor complex	histone deacetylase binding|RNA polymerase II activating transcription factor binding|sequence-specific DNA binding			breast(1)	1				UCEC - Uterine corpus endometrioid carcinoma (4;0.0608)|GBM - Glioblastoma multiforme(226;0.0361)|all cancers(137;0.193)														---	---	---	---
C6orf174	387104	broad.mit.edu	37	6	127796641	127796641	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:127796641G>A	uc003qbd.2	-	6	3395	c.2530C>T	c.(2530-2532)CGC>TGC	p.R844C	C6orf174_uc003qbc.2_5'UTR	NM_001012279	NP_001012279	Q5TF21	CF174_HUMAN	hypothetical protein LOC387104 precursor	844						integral to membrane				breast(3)|ovary(2)|skin(1)	6				GBM - Glioblastoma multiforme(226;0.026)|all cancers(137;0.161)														---	---	---	---
AKAP7	9465	broad.mit.edu	37	6	131486329	131486329	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:131486329C>T	uc003qck.2	+	4	433	c.400C>T	c.(400-402)CAA>TAA	p.Q134*	AKAP7_uc011ebz.1_Nonsense_Mutation_p.Q112*|AKAP7_uc003qcl.1_Nonsense_Mutation_p.Q15*	NM_016377	NP_057461	O43687	AKA7A_HUMAN	A-kinase anchor protein 7 isoform gamma	Error:Variant_position_missing_in_O43687_after_alignment					intracellular signal transduction|ion transport	apical plasma membrane|intracellular|lateral plasma membrane	protein kinase A binding			ovary(2)	2	Breast(56;0.152)			GBM - Glioblastoma multiforme(226;0.0184)|OV - Ovarian serous cystadenocarcinoma(155;0.0345)														---	---	---	---
TAAR6	319100	broad.mit.edu	37	6	132891923	132891923	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132891923G>A	uc011eck.1	+	1	463	c.463G>A	c.(463-465)GTG>ATG	p.V155M		NM_175067	NP_778237	Q96RI8	TAAR6_HUMAN	trace amine associated receptor 6	155	Helical; Name=4; (Potential).					plasma membrane	G-protein coupled receptor activity			ovary(2)|skin(1)	3	Breast(56;0.112)			OV - Ovarian serous cystadenocarcinoma(155;0.006)|GBM - Glioblastoma multiforme(226;0.00792)														---	---	---	---
SLC2A12	154091	broad.mit.edu	37	6	134349987	134349987	+	Missense_Mutation	SNP	C	T	T	rs151202816		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:134349987C>T	uc003qem.1	-	2	1147	c.976G>A	c.(976-978)GTC>ATC	p.V326I		NM_145176	NP_660159	Q8TD20	GTR12_HUMAN	solute carrier family 2 (facilitated glucose	326	Helical; (Potential).					endomembrane system|integral to membrane|perinuclear region of cytoplasm|plasma membrane	D-glucose transmembrane transporter activity			ovary(1)	1	Breast(56;0.214)|Colorectal(23;0.221)			OV - Ovarian serous cystadenocarcinoma(155;0.0101)|GBM - Glioblastoma multiforme(68;0.0123)														---	---	---	---
AHI1	54806	broad.mit.edu	37	6	135787084	135787084	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:135787084C>A	uc003qgi.2	-	7	1001	c.617G>T	c.(616-618)AGG>ATG	p.R206M	AHI1_uc003qgh.2_Missense_Mutation_p.R206M|AHI1_uc003qgj.2_Missense_Mutation_p.R206M|AHI1_uc003qgk.3_RNA|AHI1_uc003qgl.3_Missense_Mutation_p.R206M	NM_001134831	NP_001128303	Q8N157	AHI1_HUMAN	Abelson helper integration site 1 isoform a	206						adherens junction|cilium|microtubule basal body				ovary(1)|kidney(1)|central_nervous_system(1)	3	Breast(56;0.239)|Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00904)|OV - Ovarian serous cystadenocarcinoma(155;0.00991)														---	---	---	---
BCLAF1	9774	broad.mit.edu	37	6	136600998	136600998	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:136600998G>A	uc003qgx.1	-	3	260	c.7C>T	c.(7-9)CGC>TGC	p.R3C	BCLAF1_uc003qgw.1_Missense_Mutation_p.R3C|BCLAF1_uc003qgy.1_Missense_Mutation_p.R3C|BCLAF1_uc011edc.1_RNA|BCLAF1_uc011edd.1_RNA|BCLAF1_uc011ede.1_Missense_Mutation_p.R3C	NM_014739	NP_055554	Q9NYF8	BCLF1_HUMAN	BCL2-associated transcription factor 1 isoform	3					induction of apoptosis|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleolus	DNA binding|protein binding			ovary(1)	1	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00226)|OV - Ovarian serous cystadenocarcinoma(155;0.00331)														---	---	---	---
GPR126	57211	broad.mit.edu	37	6	142691311	142691311	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:142691311C>T	uc010khc.2	+	4	861	c.450C>T	c.(448-450)GCC>GCT	p.A150A	GPR126_uc010khd.2_Silent_p.A150A|GPR126_uc010khe.2_Silent_p.A150A|GPR126_uc010khf.2_Silent_p.A150A|GPR126_uc003qix.2_Silent_p.A150A	NM_020455	NP_065188	Q86SQ4	GP126_HUMAN	G protein-coupled receptor 126 alpha 1	150	Pentaxin.|Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(1)	1	Breast(32;0.176)			OV - Ovarian serous cystadenocarcinoma(155;9.33e-06)|GBM - Glioblastoma multiforme(68;0.00121)														---	---	---	---
PHACTR2	9749	broad.mit.edu	37	6	144093509	144093509	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144093509C>T	uc003qjq.3	+	7	1444	c.1314C>T	c.(1312-1314)TAC>TAT	p.Y438Y	PHACTR2_uc010khh.2_Silent_p.Y358Y|PHACTR2_uc010khi.2_Silent_p.Y449Y|PHACTR2_uc003qjr.3_Silent_p.Y369Y	NM_014721	NP_055536	O75167	PHAR2_HUMAN	phosphatase and actin regulator 2 isoform 3	438							actin binding|protein phosphatase inhibitor activity			ovary(2)	2				OV - Ovarian serous cystadenocarcinoma(155;1.58e-05)|GBM - Glioblastoma multiforme(68;0.0386)														---	---	---	---
LTV1	84946	broad.mit.edu	37	6	144183260	144183260	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:144183260C>A	uc003qjs.2	+	8	1050	c.943C>A	c.(943-945)CTT>ATT	p.L315I	LTV1_uc003qju.1_Missense_Mutation_p.L100I|C6orf94_uc010khj.2_Intron|C6orf94_uc010khk.2_5'Flank|C6orf94_uc011edy.1_5'Flank	NM_032860	NP_116249	Q96GA3	LTV1_HUMAN	LTV1 homolog	315										ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(155;2.72e-06)|GBM - Glioblastoma multiforme(68;0.0372)														---	---	---	---
LATS1	9113	broad.mit.edu	37	6	150004580	150004580	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:150004580C>A	uc003qmu.1	-	4	2193	c.1645G>T	c.(1645-1647)GCT>TCT	p.A549S	LATS1_uc010kif.1_Missense_Mutation_p.A444S|LATS1_uc003qmv.1_Missense_Mutation_p.A549S|LATS1_uc003qmw.2_Missense_Mutation_p.A549S|LATS1_uc010kig.1_Missense_Mutation_p.A444S	NM_004690	NP_004681	O95835	LATS1_HUMAN	LATS homolog 1	549	Interaction with YAP1.				cell division|cytoplasmic sequestering of protein|G2/M transition of mitotic cell cycle|hippo signaling cascade|hormone-mediated signaling pathway|mitosis|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cyclin-dependent protein kinase activity|positive regulation of peptidyl-serine phosphorylation|regulation of actin filament polymerization|sister chromatid segregation	microtubule organizing center|spindle pole	ATP binding|magnesium ion binding|protein kinase binding|protein serine/threonine kinase activity			lung(5)|central_nervous_system(1)	6		Ovarian(120;0.0164)		OV - Ovarian serous cystadenocarcinoma(155;6.93e-13)|GBM - Glioblastoma multiforme(68;0.116)														---	---	---	---
PLEKHG1	57480	broad.mit.edu	37	6	151151939	151151939	+	Silent	SNP	G	A	A	rs141197193	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151151939G>A	uc003qny.1	+	16	2004	c.1692G>A	c.(1690-1692)CCG>CCA	p.P564P	PLEKHG1_uc011eel.1_Silent_p.P604P|PLEKHG1_uc011eem.1_Silent_p.P623P|PLEKHG1_uc003qnz.2_Silent_p.P564P	NM_001029884	NP_001025055	Q9ULL1	PKHG1_HUMAN	pleckstrin homology domain containing, family G	564					regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			ovary(2)	2			BRCA - Breast invasive adenocarcinoma(37;0.0923)	OV - Ovarian serous cystadenocarcinoma(155;6.69e-13)														---	---	---	---
ZBTB2	57621	broad.mit.edu	37	6	151687420	151687420	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151687420G>A	uc003qoh.2	-	3	916	c.781C>T	c.(781-783)CGG>TGG	p.R261W		NM_020861	NP_065912	Q8N680	ZBTB2_HUMAN	zinc finger and BTB domain containing 2	261	C2H2-type 1.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)	1			BRCA - Breast invasive adenocarcinoma(37;0.175)	OV - Ovarian serous cystadenocarcinoma(155;2.63e-11)														---	---	---	---
SYNE1	23345	broad.mit.edu	37	6	152453304	152453304	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152453304A>G	uc010kiw.2	-	144	26649	c.26047T>C	c.(26047-26049)TCT>CCT	p.S8683P	SYNE1_uc010kiv.2_Missense_Mutation_p.S3207P|SYNE1_uc003qos.3_Missense_Mutation_p.S3207P|SYNE1_uc003qot.3_Missense_Mutation_p.S8635P|SYNE1_uc003qou.3_Missense_Mutation_p.S8683P|SYNE1_uc003qop.3_Missense_Mutation_p.S868P|SYNE1_uc011eez.1_Missense_Mutation_p.S885P|SYNE1_uc003qoq.3_Missense_Mutation_p.S885P|SYNE1_uc003qor.3_Missense_Mutation_p.S1606P	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	8683	Ser-rich.|Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)											HNSCC(10;0.0054)			---	---	---	---
SYNE1	23345	broad.mit.edu	37	6	152737700	152737700	+	Nonsense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152737700C>A	uc010kiw.2	-	41	6474	c.5872G>T	c.(5872-5874)GAG>TAG	p.E1958*	SYNE1_uc003qot.3_Nonsense_Mutation_p.E1965*|SYNE1_uc003qou.3_Nonsense_Mutation_p.E1958*|SYNE1_uc010kjb.1_Nonsense_Mutation_p.E1941*	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	1958	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)											HNSCC(10;0.0054)			---	---	---	---
SYNE1	23345	broad.mit.edu	37	6	152783944	152783944	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152783944C>T	uc010kiw.2	-	20	2781	c.2179G>A	c.(2179-2181)GCC>ACC	p.A727T	SYNE1_uc003qot.3_Missense_Mutation_p.A734T|SYNE1_uc003qou.3_Missense_Mutation_p.A727T|SYNE1_uc010kjb.1_Missense_Mutation_p.A710T|SYNE1_uc003qpa.1_Missense_Mutation_p.A727T|SYNE1_uc003qow.2_Missense_Mutation_p.A22T|SYNE1_uc003qox.1_Missense_Mutation_p.A243T|SYNE1_uc003qoz.2_Missense_Mutation_p.A159T|SYNE1_uc003qoy.2_Missense_Mutation_p.A294T	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	727	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)											HNSCC(10;0.0054)			---	---	---	---
TIAM2	26230	broad.mit.edu	37	6	155574159	155574159	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:155574159G>A	uc003qqb.2	+	26	5470	c.4197G>A	c.(4195-4197)GCG>GCA	p.A1399A	TIAM2_uc003qqe.2_Silent_p.A1399A|TIAM2_uc010kjj.2_Silent_p.A961A|TIAM2_uc003qqf.2_Silent_p.A775A|TIAM2_uc011efl.1_Silent_p.A735A|TIAM2_uc003qqg.2_Silent_p.A711A|TIAM2_uc003qqh.2_Silent_p.A324A	NM_012454	NP_036586	Q8IVF5	TIAM2_HUMAN	T-cell lymphoma invasion and metastasis 2	1399	PH 2.				apoptosis|cellular lipid metabolic process|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|filopodium|growth cone|lamellipodium	receptor signaling protein activity|Rho guanyl-nucleotide exchange factor activity			ovary(3)|breast(1)	4		Ovarian(120;0.196)		OV - Ovarian serous cystadenocarcinoma(155;8.1e-13)|BRCA - Breast invasive adenocarcinoma(81;0.0053)														---	---	---	---
SYNJ2	8871	broad.mit.edu	37	6	158492692	158492692	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:158492692G>A	uc003qqx.1	+	15	2074	c.1999G>A	c.(1999-2001)GCC>ACC	p.A667T	SYNJ2_uc003qqw.1_Missense_Mutation_p.A667T|SYNJ2_uc003qqy.1_Missense_Mutation_p.A380T|SYNJ2_uc003qqz.1_Missense_Mutation_p.A284T|SYNJ2_uc003qra.1_Missense_Mutation_p.A10T	NM_003898	NP_003889	O15056	SYNJ2_HUMAN	synaptojanin 2	667	Catalytic (By similarity).						nucleotide binding|phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity|RNA binding			skin(1)	1				OV - Ovarian serous cystadenocarcinoma(65;4.42e-18)|BRCA - Breast invasive adenocarcinoma(81;4.23e-05)														---	---	---	---
PACRG	135138	broad.mit.edu	37	6	163510322	163510322	+	Silent	SNP	C	T	T	rs150756193	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:163510322C>T	uc003qua.2	+	5	719	c.495C>T	c.(493-495)ATC>ATT	p.I165I	PACRG_uc003qub.2_Silent_p.I165I|PACRG_uc003quc.2_Silent_p.I165I	NM_152410	NP_689623	Q96M98	PACRG_HUMAN	parkin co-regulated gene protein isoform 1	165											0		Breast(66;2.41e-05)|Ovarian(120;0.0245)|Prostate(117;0.0273)|all_neural(5;0.0416)|Glioma(2;0.203)		OV - Ovarian serous cystadenocarcinoma(33;4.31e-19)|GBM - Glioblastoma multiforme(2;7.42e-11)|BRCA - Breast invasive adenocarcinoma(81;3.19e-05)|KIRC - Kidney renal clear cell carcinoma(3;0.205)|Kidney(3;0.242)														---	---	---	---
C6orf118	168090	broad.mit.edu	37	6	165693544	165693544	+	3'UTR	SNP	C	T	T	rs146452979	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:165693544C>T	uc003qum.3	-	9						NM_144980	NP_659417			hypothetical protein LOC168090												0		Breast(66;6.27e-05)|Ovarian(120;0.0228)|Prostate(117;0.0906)|all_neural(5;0.157)		OV - Ovarian serous cystadenocarcinoma(33;3.23e-18)|BRCA - Breast invasive adenocarcinoma(81;3.11e-06)|GBM - Glioblastoma multiforme(31;0.000313)														---	---	---	---
DLL1	28514	broad.mit.edu	37	6	170592537	170592537	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170592537C>T	uc003qxm.2	-	9	2300	c.1830G>A	c.(1828-1830)ACG>ACA	p.T610T		NM_005618	NP_005609	O00548	DLL1_HUMAN	delta-like 1 precursor	610	Cytoplasmic (Potential).				cell communication|cell fate determination|hemopoiesis|Notch receptor processing|Notch signaling pathway|regulation of cell adhesion	extracellular region|integral to plasma membrane	calcium ion binding|Notch binding			lung(4)|ovary(1)	5		Breast(66;5.08e-05)|Ovarian(120;0.125)|Esophageal squamous(34;0.246)		OV - Ovarian serous cystadenocarcinoma(33;6.71e-23)|BRCA - Breast invasive adenocarcinoma(81;4.81e-06)|GBM - Glioblastoma multiforme(31;0.0584)														---	---	---	---
INTS1	26173	broad.mit.edu	37	7	1539187	1539187	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:1539187C>T	uc003skn.2	-	6	867	c.766G>A	c.(766-768)GCC>ACC	p.A256T	INTS1_uc003skq.2_Missense_Mutation_p.A256T	NM_001080453	NP_001073922	Q8N201	INT1_HUMAN	integrator complex subunit 1	256					snRNA processing	integral to membrane|integrator complex|nuclear membrane					0		Ovarian(82;0.0253)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0181)|OV - Ovarian serous cystadenocarcinoma(56;6.99e-15)														---	---	---	---
FBXL18	80028	broad.mit.edu	37	7	5545127	5545127	+	Silent	SNP	G	A	A	rs145119070	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:5545127G>A	uc003soo.2	-	2	247	c.153C>T	c.(151-153)AAC>AAT	p.N51N	FBXL18_uc003son.3_Silent_p.N51N	NM_024963	NP_079239	Q96ME1	FXL18_HUMAN	F-box and leucine-rich repeat protein 18	51	F-box.									central_nervous_system(2)|ovary(1)	3		Ovarian(82;0.0607)		UCEC - Uterine corpus endometrioid carcinoma (126;0.181)|OV - Ovarian serous cystadenocarcinoma(56;3.64e-13)														---	---	---	---
RAC1	5879	broad.mit.edu	37	7	6442041	6442041	+	Silent	SNP	C	T	T	rs144238799	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6442041C>T	uc003spx.2	+	6	784	c.543C>T	c.(541-543)CCC>CCT	p.P181P	RAC1_uc003spw.2_Silent_p.P200P	NM_006908	NP_008839	P63000	RAC1_HUMAN	ras-related C3 botulinum toxin substrate 1	181					actin filament polymerization|apoptosis|axon guidance|cell motility|cell-matrix adhesion|induction of apoptosis by extracellular signals|inflammatory response|lamellipodium assembly|localization within membrane|negative regulation of interleukin-23 production|negative regulation of receptor-mediated endocytosis|nerve growth factor receptor signaling pathway|platelet activation|positive regulation of lamellipodium assembly|positive regulation of Rho protein signal transduction|regulation of cell migration|regulation of defense response to virus by virus|regulation of hydrogen peroxide metabolic process|regulation of respiratory burst|ruffle organization|small GTPase mediated signal transduction|T cell costimulation|viral reproduction	cytosol|melanosome|plasma membrane	GTP binding|GTP-dependent protein binding|GTPase activity|thioesterase binding			lung(2)	2		Ovarian(82;0.0776)		UCEC - Uterine corpus endometrioid carcinoma (126;0.104)	Pravastatin(DB00175)|Simvastatin(DB00641)													---	---	---	---
HOXA6	3203	broad.mit.edu	37	7	27185513	27185513	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27185513G>A	uc003syo.1	-	2	466	c.466C>T	c.(466-468)CGC>TGC	p.R156C	HOXA5_uc003syn.1_5'Flank|uc003syp.1_5'Flank	NM_024014	NP_076919	P31267	HXA6_HUMAN	homeobox A6	156	Homeobox.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
ZNRF2	223082	broad.mit.edu	37	7	30363339	30363339	+	Missense_Mutation	SNP	G	A	A	rs142290977		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30363339G>A	uc003tat.2	+	2	1602	c.551G>A	c.(550-552)CGA>CAA	p.R184Q		NM_147128	NP_667339	Q8NHG8	ZNRF2_HUMAN	zinc finger/RING finger 2	184						cell junction|endosome membrane|lysosomal membrane|presynaptic membrane	ligase activity|zinc ion binding				0																		---	---	---	---
AOAH	313	broad.mit.edu	37	7	36763673	36763673	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:36763673G>A	uc003tfh.3	-	1	482	c.81C>T	c.(79-81)AAC>AAT	p.N27N	AOAH_uc010kxf.2_Silent_p.N27N|AOAH_uc011kba.1_Silent_p.N27N	NM_001637	NP_001628	P28039	AOAH_HUMAN	acyloxyacyl hydrolase precursor	27					inflammatory response|lipid metabolic process	extracellular region	acyloxyacyl hydrolase activity|lipoprotein lipase activity			skin(1)	1																		---	---	---	---
TXNDC3	51314	broad.mit.edu	37	7	37896881	37896881	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:37896881A>G	uc003tfn.2	+	6	576	c.204A>G	c.(202-204)GAA>GAG	p.E68E		NM_016616	NP_057700	Q8N427	TXND3_HUMAN	thioredoxin domain containing 3	68	Thioredoxin.				cell differentiation|cell redox homeostasis|CTP biosynthetic process|GTP biosynthetic process|multicellular organismal development|spermatogenesis|UTP biosynthetic process	cytoplasm|microtubule cytoskeleton	ATP binding|nucleoside diphosphate kinase activity			ovary(1)|breast(1)|central_nervous_system(1)	3														Kartagener_syndrome				---	---	---	---
HECW1	23072	broad.mit.edu	37	7	43484813	43484813	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:43484813C>T	uc003tid.1	+	11	2647	c.2042C>T	c.(2041-2043)TCG>TTG	p.S681L	HECW1_uc011kbi.1_Missense_Mutation_p.S681L	NM_015052	NP_055867	Q76N89	HECW1_HUMAN	NEDD4-like ubiquitin-protein ligase 1	681	Cys-rich.				protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	ubiquitin-protein ligase activity			ovary(8)|lung(6)|breast(4)|skin(4)|pancreas(1)	23																		---	---	---	---
TNS3	64759	broad.mit.edu	37	7	47408471	47408471	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:47408471C>A	uc003tnv.2	-	17	2139	c.1772G>T	c.(1771-1773)CGC>CTC	p.R591L	TNS3_uc003tnw.2_Missense_Mutation_p.R591L	NM_022748	NP_073585	Q68CZ2	TENS3_HUMAN	tensin 3	591						focal adhesion	protein binding			ovary(4)	4																		---	---	---	---
VWC2	375567	broad.mit.edu	37	7	49842417	49842417	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:49842417C>T	uc003tot.1	+	3	1363	c.807C>T	c.(805-807)TGC>TGT	p.C269C		NM_198570	NP_940972	Q2TAL6	VWC2_HUMAN	von Willebrand factor C domain containing 2	269	VWFC 2.				negative regulation of BMP signaling pathway|positive regulation of neuron differentiation	basement membrane|extracellular space					0																		---	---	---	---
AUTS2	26053	broad.mit.edu	37	7	70254989	70254989	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:70254989G>A	uc003tvw.3	+	19	3530	c.2787G>A	c.(2785-2787)GCG>GCA	p.A929A	AUTS2_uc003tvx.3_Silent_p.A905A|AUTS2_uc011keg.1_Silent_p.A381A	NM_015570	NP_056385	Q8WXX7	AUTS2_HUMAN	autism susceptibility candidate 2 isoform 1	929										ovary(2)|central_nervous_system(1)	3		all_cancers(73;0.0264)|all_epithelial(88;0.0198)|Lung NSC(55;0.0599)|all_lung(88;0.093)		LUSC - Lung squamous cell carcinoma(90;0.082)|Lung(90;0.186)														---	---	---	---
WBSCR17	64409	broad.mit.edu	37	7	70597984	70597984	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:70597984C>T	uc003tvy.2	+	1	196	c.196C>T	c.(196-198)CGC>TGC	p.R66C		NM_022479	NP_071924	Q6IS24	GLTL3_HUMAN	UDP-GalNAc:polypeptide	66	Lumenal (Potential).					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			skin(3)|upper_aerodigestive_tract(1)|ovary(1)|pancreas(1)|central_nervous_system(1)	7		all_cancers(73;0.2)|Lung NSC(55;0.094)|all_lung(88;0.125)																---	---	---	---
POM121	9883	broad.mit.edu	37	7	72412620	72412620	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72412620G>A	uc003twk.2	+	11	2088	c.2088G>A	c.(2086-2088)CCG>CCA	p.P696P	POM121_uc003twj.2_Silent_p.P431P|POM121_uc010lam.1_Silent_p.P431P	NM_172020	NP_742017	Q96HA1	P121A_HUMAN	nuclear pore membrane protein 121	696	Pore side (Potential).				carbohydrate metabolic process|glucose transport|mRNA transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	endoplasmic reticulum membrane|nuclear membrane|nuclear pore					0		Lung NSC(55;0.163)																---	---	---	---
NSUN5P2	260294	broad.mit.edu	37	7	72419905	72419905	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72419905G>A	uc003twn.2	-	8	1041	c.329C>T	c.(328-330)CCG>CTG	p.P110L	POM121_uc010lam.1_3'UTR|NSUN5P2_uc003twl.2_RNA|NSUN5P2_uc003twm.2_Missense_Mutation_p.P110L|NSUN5P2_uc003two.2_Missense_Mutation_p.P110L|NSUN5P2_uc003twq.2_Missense_Mutation_p.P110L|NSUN5P2_uc010lan.1_Intron|NSUN5P2_uc003twp.2_Missense_Mutation_p.P110L	NM_032158	NP_115534			NOL1/NOP2/Sun domain family, member 5C isoform												0																		---	---	---	---
FKBP6	8468	broad.mit.edu	37	7	72756821	72756821	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72756821A>G	uc003tya.2	+	8	1040	c.908A>G	c.(907-909)TAT>TGT	p.Y303C	FKBP6_uc003twz.2_Missense_Mutation_p.Y273C|FKBP6_uc011kew.1_Missense_Mutation_p.Y298C	NM_003602	NP_003593	O75344	FKBP6_HUMAN	FK506 binding protein 6 isoform a	303					protein folding	membrane	FK506 binding|peptidyl-prolyl cis-trans isomerase activity				0		Lung NSC(55;0.0908)|all_lung(88;0.198)														OREG0018106	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
WBSCR27	155368	broad.mit.edu	37	7	73254783	73254783	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:73254783G>T	uc003tzj.2	-	4	389	c.349C>A	c.(349-351)CTC>ATC	p.L117I	RFC2_uc011kfa.1_Intron|WBSCR27_uc011kfd.1_Intron	NM_152559	NP_689772	Q8N6F8	WBS27_HUMAN	Williams-Beuren syndrome chromosome region 27	117										central_nervous_system(1)	1		Lung NSC(55;0.159)																---	---	---	---
CLIP2	7461	broad.mit.edu	37	7	73770775	73770775	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:73770775C>T	uc003uam.2	+	5	1166	c.839C>T	c.(838-840)GCG>GTG	p.A280V	CLIP2_uc003uan.2_Missense_Mutation_p.A280V	NM_003388	NP_003379	Q9UDT6	CLIP2_HUMAN	CAP-GLY domain containing linker protein 2	280	CAP-Gly 2.					microtubule associated complex				skin(3)	3																		---	---	---	---
GTF2I	2969	broad.mit.edu	37	7	74148279	74148279	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:74148279A>G	uc003uau.2	+	16	1689	c.1319A>G	c.(1318-1320)AAT>AGT	p.N440S	GTF2I_uc003uav.2_Missense_Mutation_p.N419S|GTF2I_uc003uaw.2_Missense_Mutation_p.N420S|GTF2I_uc003uay.2_Missense_Mutation_p.N418S|GTF2I_uc003uax.2_Missense_Mutation_p.N399S	NM_032999	NP_127492	P78347	GTF2I_HUMAN	general transcription factor IIi isoform 1	440	GTF2I-like 2.				negative regulation of angiogenesis|signal transduction|transcription initiation from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
ABCB1	5243	broad.mit.edu	37	7	87183124	87183124	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87183124T>C	uc003uiz.1	-	10	1370	c.952A>G	c.(952-954)ACC>GCC	p.T318A	ABCB1_uc011khc.1_Missense_Mutation_p.T254A	NM_000927	NP_000918	P08183	MDR1_HUMAN	ATP-binding cassette, subfamily B, member 1	318	ABC transmembrane type-1 1.				G2/M transition of mitotic cell cycle|stem cell proliferation	apical plasma membrane|cell surface|Golgi membrane|integral to membrane|intercellular canaliculus|membrane fraction	ATP binding|protein binding|xenobiotic-transporting ATPase activity			ovary(4)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	7	Esophageal squamous(14;0.00164)				Adenosine triphosphate(DB00171)|Alfentanil(DB00802)|Arsenic trioxide(DB01169)|Atazanavir(DB01072)|Carvedilol(DB01136)|Colchicine(DB01394)|Cyclosporine(DB00091)|Daunorubicin(DB00694)|Dipyridamole(DB00975)|Estramustine(DB01196)|Flupenthixol(DB00875)|Imatinib(DB00619)|Itraconazole(DB01167)|Nicardipine(DB00622)|Propafenone(DB01182)|Quinacrine(DB01103)|Quinidine(DB00908)|Ranolazine(DB00243)|Rifampin(DB01045)|Roxithromycin(DB00778)|Saquinavir(DB01232)|Tamoxifen(DB00675)|Vinblastine(DB00570)													---	---	---	---
ADAM22	53616	broad.mit.edu	37	7	87737537	87737537	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87737537A>G	uc003ujn.2	+	5	516	c.437A>G	c.(436-438)GAC>GGC	p.D146G	ADAM22_uc003uji.1_Missense_Mutation_p.D145G|ADAM22_uc003ujj.1_Missense_Mutation_p.D146G|ADAM22_uc003ujk.1_Missense_Mutation_p.D146G|ADAM22_uc003ujl.1_Missense_Mutation_p.D146G|ADAM22_uc003ujm.2_Missense_Mutation_p.D146G|ADAM22_uc003ujo.2_Missense_Mutation_p.D146G|ADAM22_uc003ujp.1_Missense_Mutation_p.D198G	NM_021723	NP_068369	Q9P0K1	ADA22_HUMAN	ADAM metallopeptidase domain 22 isoform 1	146					cell adhesion|central nervous system development|negative regulation of cell adhesion|proteolysis	integral to membrane	integrin binding|metalloendopeptidase activity|protein binding|receptor activity|zinc ion binding			ovary(4)|skin(2)|lung(1)|kidney(1)	8	Esophageal squamous(14;0.00202)		STAD - Stomach adenocarcinoma(171;0.215)															---	---	---	---
COL1A2	1278	broad.mit.edu	37	7	94055071	94055071	+	Missense_Mutation	SNP	G	A	A	rs72659312		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:94055071G>A	uc003ung.1	+	44	3316	c.2845G>A	c.(2845-2847)GGT>AGT	p.G949S	COL1A2_uc011kib.1_Intron	NM_000089	NP_000080	P08123	CO1A2_HUMAN	alpha 2 type I collagen precursor	949			G -> S (in OI3; moderate).		axon guidance|blood vessel development|collagen fibril organization|leukocyte migration|odontogenesis|platelet activation|regulation of blood pressure|Rho protein signal transduction|skeletal system development|skin morphogenesis|transforming growth factor beta receptor signaling pathway	collagen type I|extracellular space|plasma membrane	extracellular matrix structural constituent|identical protein binding|platelet-derived growth factor binding|protein binding, bridging		COL1A2/PLAG1(3)	soft_tissue(3)|central_nervous_system(3)|ovary(2)|skin(1)	9	all_cancers(62;2.46e-09)|all_epithelial(64;2.7e-08)		STAD - Stomach adenocarcinoma(171;0.0031)		Collagenase(DB00048)										HNSCC(75;0.22)			---	---	---	---
PEG10	23089	broad.mit.edu	37	7	94293701	94293701	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:94293701G>A	uc011kie.1	+	2	1278	c.1061G>A	c.(1060-1062)CGC>CAC	p.R354H		NM_001040152	NP_001035242	Q86TG7	PEG10_HUMAN	paternally expressed 10 isoform RF1	278					apoptosis|cell differentiation|negative regulation of transforming growth factor beta receptor signaling pathway	cytoplasm|nucleus	DNA binding|protein binding|zinc ion binding	p.R278H(1)		central_nervous_system(1)	1	all_cancers(62;8.26e-10)|all_epithelial(64;5.59e-09)|Lung NSC(181;0.188)|all_lung(186;0.215)		STAD - Stomach adenocarcinoma(171;0.0031)															---	---	---	---
MCM7	4176	broad.mit.edu	37	7	99695360	99695360	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99695360A>C	uc003usw.1	-	9	1504	c.994T>G	c.(994-996)TTC>GTC	p.F332V	MCM7_uc003usv.1_Missense_Mutation_p.F156V|MCM7_uc003usx.1_Missense_Mutation_p.F156V	NM_005916	NP_005907	P33993	MCM7_HUMAN	minichromosome maintenance complex component 7	332	MCM.				cell cycle checkpoint|DNA strand elongation involved in DNA replication|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|regulation of phosphorylation|response to DNA damage stimulus|S phase of mitotic cell cycle	chromatin|MCM complex	ATP binding|protein binding				0	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)				Atorvastatin(DB01076)													---	---	---	---
FBXO24	26261	broad.mit.edu	37	7	100192820	100192820	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100192820C>T	uc003uvm.1	+	7	1341	c.1048C>T	c.(1048-1050)CCG>TCG	p.P350S	FBXO24_uc003uvl.1_Intron|FBXO24_uc003uvn.1_Missense_Mutation_p.P45S|uc011kjy.1_Intron|FBXO24_uc011kjz.1_Missense_Mutation_p.P388S|FBXO24_uc011kka.1_Missense_Mutation_p.P338S	NM_033506	NP_277041	O75426	FBX24_HUMAN	F-box only protein 24 isoform 1	350						ubiquitin ligase complex	ubiquitin-protein ligase activity			ovary(3)|skin(1)	4	Lung NSC(181;0.0261)|all_lung(186;0.0392)|Esophageal squamous(72;0.0439)																	---	---	---	---
MUC17	140453	broad.mit.edu	37	7	100680596	100680596	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100680596C>T	uc003uxp.1	+	3	5952	c.5899C>T	c.(5899-5901)CCT>TCT	p.P1967S	MUC17_uc010lho.1_RNA	NM_001040105	NP_001035194	Q685J3	MUC17_HUMAN	mucin 17 precursor	1967	Extracellular (Potential).|Ser-rich.|59 X approximate tandem repeats.|31.					extracellular region|integral to membrane|plasma membrane	extracellular matrix constituent, lubricant activity			ovary(14)|skin(8)|breast(3)|lung(2)	27	Lung NSC(181;0.136)|all_lung(186;0.182)																	---	---	---	---
ALKBH4	54784	broad.mit.edu	37	7	102098296	102098296	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:102098296C>T	uc003uzl.2	-	3	459	c.454G>A	c.(454-456)GAG>AAG	p.E152K	ALKBH4_uc003uzm.2_Missense_Mutation_p.E79K	NM_017621	NP_060091	Q9NXW9	ALKB4_HUMAN	alkB, alkylation repair homolog 4	152						cytoplasm|nucleus	metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen				0																		---	---	---	---
LRRC17	10234	broad.mit.edu	37	7	102584826	102584826	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:102584826G>A	uc003vau.2	+	4	1487	c.1098G>A	c.(1096-1098)AAG>AAA	p.K366K	FBXL13_uc010liq.1_Intron|FBXL13_uc003vaq.2_Intron|FBXL13_uc010lir.1_Intron|FBXL13_uc003var.2_Intron|FBXL13_uc003vas.2_Intron|LRRC17_uc003vat.2_3'UTR	NM_001031692	NP_001026862	Q8N6Y2	LRC17_HUMAN	leucine rich repeat containing 17 isoform 1	366	LRRCT 2.				bone marrow development|negative regulation of osteoclast differentiation|ossification	extracellular space				ovary(1)	1																		---	---	---	---
SRPK2	6733	broad.mit.edu	37	7	104787044	104787044	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:104787044G>A	uc003vct.2	-	7	837	c.650C>T	c.(649-651)CCG>CTG	p.P217L	SRPK2_uc003vcu.2_Missense_Mutation_p.P217L|SRPK2_uc003vcv.2_Missense_Mutation_p.P228L|SRPK2_uc003vcw.1_Missense_Mutation_p.P217L	NM_182691	NP_872633	P78362	SRPK2_HUMAN	serine/arginine-rich protein-specific kinase 2	217	Protein kinase.				angiogenesis|cell differentiation|intracellular protein kinase cascade|negative regulation of viral genome replication|nuclear speck organization|positive regulation of cell cycle|positive regulation of cell proliferation|positive regulation of gene expression|positive regulation of neuron apoptosis|positive regulation of viral genome replication|spliceosome assembly	cytoplasm|nucleolus	14-3-3 protein binding|ATP binding|magnesium ion binding|protein serine/threonine kinase activity			central_nervous_system(3)|ovary(2)|upper_aerodigestive_tract(1)	6																		---	---	---	---
PRKAR2B	5577	broad.mit.edu	37	7	106797745	106797745	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:106797745G>A	uc003vdx.2	+	10	1274	c.1099G>A	c.(1099-1101)GCC>ACC	p.A367T		NM_002736	NP_002727	P31323	KAP3_HUMAN	cAMP-dependent protein kinase, regulatory	367	cAMP 2.				activation of phospholipase C activity|activation of protein kinase A activity|blood coagulation|cellular response to glucagon stimulus|energy reserve metabolic process|G2/M transition of mitotic cell cycle|intracellular signal transduction|nerve growth factor receptor signaling pathway|regulation of insulin secretion|transmembrane transport|water transport	centrosome|cytosol|plasma membrane	cAMP binding|cAMP-dependent protein kinase regulator activity			ovary(1)	1																		---	---	---	---
DLD	1738	broad.mit.edu	37	7	107542201	107542201	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:107542201T>G	uc003vet.2	+	3	247	c.137T>G	c.(136-138)GTT>GGT	p.V46G	DLD_uc010ljm.1_RNA|DLD_uc011kmg.1_Missense_Mutation_p.V46G|DLD_uc011kmh.1_Missense_Mutation_p.V46G|DLD_uc011kmi.1_Intron	NM_000108	NP_000099	P09622	DLDH_HUMAN	dihydrolipoamide dehydrogenase precursor	46					branched chain family amino acid catabolic process|cell redox homeostasis|lysine catabolic process|regulation of acetyl-CoA biosynthetic process from pyruvate|tricarboxylic acid cycle	mitochondrial matrix	dihydrolipoyl dehydrogenase activity			central_nervous_system(1)	1					NADH(DB00157)													---	---	---	---
LAMB1	3912	broad.mit.edu	37	7	107599833	107599833	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:107599833A>G	uc003vew.2	-	20	2886	c.2551T>C	c.(2551-2553)TGT>CGT	p.C851R	LAMB1_uc003vev.2_Missense_Mutation_p.C875R	NM_002291	NP_002282	P07942	LAMB1_HUMAN	laminin, beta 1 precursor	851	Laminin EGF-like 7.				axon guidance|odontogenesis|positive regulation of cell migration|positive regulation of epithelial cell proliferation|substrate adhesion-dependent cell spreading	extracellular space|laminin-1 complex|laminin-10 complex|laminin-2 complex|laminin-8 complex|perinuclear region of cytoplasm	extracellular matrix structural constituent			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	8					Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---
DOCK4	9732	broad.mit.edu	37	7	111409728	111409728	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:111409728C>T	uc003vfx.2	-	36	3927	c.3658G>A	c.(3658-3660)GCA>ACA	p.A1220T	DOCK4_uc011kml.1_Missense_Mutation_p.A101T|DOCK4_uc011kmm.1_Missense_Mutation_p.A127T|DOCK4_uc003vfw.2_Missense_Mutation_p.A670T|DOCK4_uc003vfy.2_Missense_Mutation_p.A1265T	NM_014705	NP_055520	Q8N1I0	DOCK4_HUMAN	dedicator of cytokinesis 4	1220	DHR-2.				cell chemotaxis	cytosol|endomembrane system|membrane|stereocilium	GTP binding|guanyl-nucleotide exchange factor activity|PDZ domain binding|Rac GTPase activator activity|Rac GTPase binding|receptor tyrosine kinase binding|SH3 domain binding			ovary(2)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)	4		Acute lymphoblastic leukemia(1;0.0441)																---	---	---	---
WNT2	7472	broad.mit.edu	37	7	116955140	116955140	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:116955140G>T	uc003viz.2	-	3	873	c.573C>A	c.(571-573)AAC>AAA	p.N191K	WNT2_uc003vja.2_Missense_Mutation_p.N95K	NM_003391	NP_003382	P09544	WNT2_HUMAN	wingless-type MMTV integration site family	191					atrial cardiac muscle tissue morphogenesis|canonical Wnt receptor signaling pathway|cardiac epithelial to mesenchymal transition|cellular response to retinoic acid|cellular response to transforming growth factor beta stimulus|dorsal/ventral axis specification|iris morphogenesis|labyrinthine layer blood vessel development|lens development in camera-type eye|lung induction|mammary gland epithelium development|neuron differentiation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of cardiac muscle cell proliferation|positive regulation of epithelial cell proliferation involved in lung morphogenesis|positive regulation of fibroblast proliferation|positive regulation of mesenchymal cell proliferation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|Wnt receptor signaling pathway, calcium modulating pathway	cytoplasm|extracellular space|proteinaceous extracellular matrix	cytokine activity|frizzled binding|frizzled-2 binding|signal transducer activity			breast(2)|central_nervous_system(2)|ovary(1)|lung(1)|skin(1)	7	all_epithelial(6;2.24e-06)|Lung NSC(10;0.000936)|all_lung(10;0.00109)		STAD - Stomach adenocarcinoma(10;0.000512)	LUSC - Lung squamous cell carcinoma(290;0.133)														---	---	---	---
WNT2	7472	broad.mit.edu	37	7	116962949	116962949	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:116962949G>A	uc003viz.2	-						WNT2_uc003vja.2_Intron	NM_003391	NP_003382			wingless-type MMTV integration site family						atrial cardiac muscle tissue morphogenesis|canonical Wnt receptor signaling pathway|cardiac epithelial to mesenchymal transition|cellular response to retinoic acid|cellular response to transforming growth factor beta stimulus|dorsal/ventral axis specification|iris morphogenesis|labyrinthine layer blood vessel development|lens development in camera-type eye|lung induction|mammary gland epithelium development|neuron differentiation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of cardiac muscle cell proliferation|positive regulation of epithelial cell proliferation involved in lung morphogenesis|positive regulation of fibroblast proliferation|positive regulation of mesenchymal cell proliferation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|Wnt receptor signaling pathway, calcium modulating pathway	cytoplasm|extracellular space|proteinaceous extracellular matrix	cytokine activity|frizzled binding|frizzled-2 binding|signal transducer activity			breast(2)|central_nervous_system(2)|ovary(1)|lung(1)|skin(1)	7	all_epithelial(6;2.24e-06)|Lung NSC(10;0.000936)|all_lung(10;0.00109)		STAD - Stomach adenocarcinoma(10;0.000512)	LUSC - Lung squamous cell carcinoma(290;0.133)														---	---	---	---
HYAL4	23553	broad.mit.edu	37	7	123508376	123508376	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:123508376G>A	uc003vlc.2	+	3	687	c.49G>A	c.(49-51)GTA>ATA	p.V17I	HYAL4_uc011knz.1_Missense_Mutation_p.V17I	NM_012269	NP_036401	Q2M3T9	HYAL4_HUMAN	hyaluronoglucosaminidase 4	17	Helical; (Potential).				fusion of sperm to egg plasma membrane|glycosaminoglycan catabolic process	integral to membrane	hyalurononglucosaminidase activity			skin(1)	1																		---	---	---	---
SND1	27044	broad.mit.edu	37	7	127637804	127637804	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:127637804T>C	uc003vmi.2	+						SND1_uc010lle.2_Intron|C7orf54_uc003vmj.1_RNA	NM_014390	NP_055205			staphylococcal nuclease domain containing 1						gene silencing by RNA|interspecies interaction between organisms|regulation of transcription, DNA-dependent|transcription, DNA-dependent	melanosome|nucleus|RNA-induced silencing complex	nuclease activity|nucleic acid binding|protein binding|transcription cofactor activity			ovary(2)|central_nervous_system(1)	3																		---	---	---	---
PLXNA4	91584	broad.mit.edu	37	7	131825463	131825463	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:131825463A>G	uc003vra.3	-	30	5562	c.5333T>C	c.(5332-5334)TTC>TCC	p.F1778S	PLXNA4_uc003vqz.3_Missense_Mutation_p.F63S	NM_020911	NP_065962	Q9HCM2	PLXA4_HUMAN	plexin A4 isoform 1	1778	Cytoplasmic (Potential).					integral to membrane|intracellular|plasma membrane				ovary(1)	1																		---	---	---	---
CNOT4	4850	broad.mit.edu	37	7	135047689	135047689	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:135047689G>T	uc011kpy.1	-	11	2182	c.2090C>A	c.(2089-2091)CCC>CAC	p.P697H	CNOT4_uc003vss.2_Missense_Mutation_p.P623H|CNOT4_uc011kpz.1_Missense_Mutation_p.P694H|CNOT4_uc003vst.2_Missense_Mutation_p.P626H	NM_001008225	NP_001008226	O95628	CNOT4_HUMAN	CCR4-NOT transcription complex, subunit 4	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					nuclear-transcribed mRNA poly(A) tail shortening|protein autoubiquitination|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|nucleus	nucleotide binding|protein binding|RNA binding|ubiquitin-protein ligase activity|zinc ion binding				0																		---	---	---	---
SVOPL	136306	broad.mit.edu	37	7	138329450	138329450	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138329450G>A	uc011kqh.1	-						SVOPL_uc003vue.2_Intron	NM_001139456	NP_001132928			SVOP-like isoform 1							integral to membrane	transmembrane transporter activity				0																		---	---	---	---
KIAA1549	57670	broad.mit.edu	37	7	138603298	138603298	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138603298A>G	uc011kql.1	-	2	1123	c.1074T>C	c.(1072-1074)CAT>CAC	p.H358H	KIAA1549_uc003vuk.3_Silent_p.H308H|KIAA1549_uc011kqj.1_Silent_p.H358H	NM_020910	NP_065961	Q9HCM3	K1549_HUMAN	hypothetical protein LOC57670 isoform 1	358						integral to membrane			KIAA1549/BRAF(229)	central_nervous_system(229)|pancreas(1)	230								O	BRAF	pilocytic astrocytoma								---	---	---	---
UBN2	254048	broad.mit.edu	37	7	138969242	138969242	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138969242G>T	uc011kqr.1	+	15	3591	c.3591G>T	c.(3589-3591)CAG>CAT	p.Q1197H		NM_173569	NP_775840	Q6ZU65	UBN2_HUMAN	ubinuclein 2	1197	Ser-rich.									ovary(1)|skin(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	7	142176325	142176325	+	Intron	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142176325T>G	uc011kro.1	+						uc011krp.1_Intron|uc011krr.1_Intron|uc011krx.1_Intron					SubName: Full=V_segment translation product; Flags: Fragment;																														---	---	---	---
CLCN1	1180	broad.mit.edu	37	7	143036388	143036388	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143036388G>A	uc003wcr.1	+	13	1531	c.1444G>A	c.(1444-1446)GGA>AGA	p.G482R	CLCN1_uc011ktc.1_Missense_Mutation_p.G94R	NM_000083	NP_000074	P35523	CLCN1_HUMAN	chloride channel 1, skeletal muscle	482	Helical; (By similarity).|Selectivity filter part_3 (By similarity).		G -> R (in MCR).		muscle contraction	chloride channel complex|integral to plasma membrane	voltage-gated chloride channel activity			ovary(2)|breast(1)|central_nervous_system(1)|skin(1)	5	Melanoma(164;0.205)																	---	---	---	---
CUL1	8454	broad.mit.edu	37	7	148484193	148484193	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:148484193G>A	uc010lpg.2	+	13	1986	c.1460G>A	c.(1459-1461)AGC>AAC	p.S487N	CUL1_uc003wey.2_Missense_Mutation_p.S487N|CUL1_uc003wez.2_Missense_Mutation_p.S377N|CUL1_uc003wfa.2_Missense_Mutation_p.S148N	NM_003592	NP_003583	Q13616	CUL1_HUMAN	cullin 1	487					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell cycle arrest|G1/S transition of mitotic cell cycle|induction of apoptosis by intracellular signals|interspecies interaction between organisms|negative regulation of cell proliferation|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein ubiquitination|S phase of mitotic cell cycle|SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	cytosol|nucleoplasm|SCF ubiquitin ligase complex	ubiquitin protein ligase binding			lung(1)	1	Melanoma(164;0.15)		OV - Ovarian serous cystadenocarcinoma(82;0.00291)															---	---	---	---
ZNF786	136051	broad.mit.edu	37	7	148767724	148767724	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:148767724G>A	uc003wfh.2	-	4	2277	c.2140C>T	c.(2140-2142)CGG>TGG	p.R714W	ZNF786_uc011kuk.1_Missense_Mutation_p.R677W|ZNF786_uc003wfi.2_Missense_Mutation_p.R628W	NM_152411	NP_689624	Q8N393	ZN786_HUMAN	zinc finger protein 786	714	C2H2-type 15.			R -> W (in Ref. 1; CAD39166).	regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			breast(3)|skin(1)	4	Melanoma(164;0.15)		OV - Ovarian serous cystadenocarcinoma(82;0.00463)															---	---	---	---
ZNF746	155061	broad.mit.edu	37	7	149171807	149171807	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149171807C>T	uc003wfw.2	-	7	1874	c.1603G>A	c.(1603-1605)GAG>AAG	p.E535K	ZNF746_uc010lpi.2_Missense_Mutation_p.E536K	NM_152557	NP_689770	Q6NUN9	ZN746_HUMAN	zinc finger protein 746 isoform 2	535					negative regulation of transcription, DNA-dependent|neuron death|regulation of cell death|transcription, DNA-dependent	cytoplasm|nucleus	transcription regulatory region DNA binding|ubiquitin protein ligase binding|zinc ion binding			ovary(2)|breast(1)	3	Melanoma(164;0.165)		OV - Ovarian serous cystadenocarcinoma(82;0.00358)															---	---	---	---
GIMAP8	155038	broad.mit.edu	37	7	150174379	150174379	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150174379C>T	uc003whj.2	+	5	1839	c.1509C>T	c.(1507-1509)GTC>GTT	p.V503V		NM_175571	NP_783161	Q8ND71	GIMA8_HUMAN	GTPase, IMAP family member 8	503						endoplasmic reticulum|Golgi apparatus|mitochondrion	GTP binding			skin(3)|ovary(2)|breast(1)|central_nervous_system(1)	7			OV - Ovarian serous cystadenocarcinoma(82;0.0218)	UCEC - Uterine corpus endometrioid carcinoma (81;0.17)														---	---	---	---
ABCF2	10061	broad.mit.edu	37	7	150915664	150915664	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150915664T>C	uc003wjp.2	-	10	1321	c.1210A>G	c.(1210-1212)AAG>GAG	p.K404E	ABCF2_uc003wjo.1_Missense_Mutation_p.K404E	NM_007189	NP_009120	Q9UG63	ABCF2_HUMAN	ATP-binding cassette, sub-family F, member 2	404	ABC transporter 2.					ATP-binding cassette (ABC) transporter complex|mitochondrial envelope	ATP binding|ATPase activity|transporter activity			central_nervous_system(1)	1			OV - Ovarian serous cystadenocarcinoma(82;0.00448)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)														---	---	---	---
DPP6	1804	broad.mit.edu	37	7	154684199	154684199	+	3'UTR	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:154684199C>T	uc003wlk.2	+	26					DPP6_uc003wli.2_3'UTR|DPP6_uc003wlm.2_3'UTR|DPP6_uc011kvq.1_3'UTR	NM_130797	NP_570629			dipeptidyl-peptidase 6 isoform 1						cell death|proteolysis	integral to membrane	dipeptidyl-peptidase activity|serine-type peptidase activity			pancreas(3)|breast(1)	4	all_neural(206;0.181)	all_hematologic(28;0.0044)|all_lung(21;0.0176)|Lung NSC(21;0.0204)	OV - Ovarian serous cystadenocarcinoma(82;0.0562)															---	---	---	---
ERICH1	157697	broad.mit.edu	37	8	623803	623803	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:623803A>G	uc003wph.2	-	4	614	c.549T>C	c.(547-549)GCT>GCC	p.A183A	ERICH1_uc011kwh.1_Silent_p.A183A|ERICH1_uc003wpe.1_Silent_p.A89A|ERICH1_uc003wpi.2_5'UTR	NM_207332	NP_997215	Q86X53	ERIC1_HUMAN	glutamate-rich 1	183										large_intestine(2)	2		Colorectal(14;0.158)|Ovarian(12;0.17)|Myeloproliferative disorder(644;0.185)|Hepatocellular(245;0.236)		Epithelial(5;3.29e-14)|BRCA - Breast invasive adenocarcinoma(11;1.49e-06)|OV - Ovarian serous cystadenocarcinoma(5;3.65e-06)|READ - Rectum adenocarcinoma(1;0.0325)														---	---	---	---
CSMD1	64478	broad.mit.edu	37	8	2855694	2855694	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:2855694C>T	uc011kwk.1	-	54	8609	c.8219G>A	c.(8218-8220)GGT>GAT	p.G2740D	CSMD1_uc011kwj.1_Missense_Mutation_p.G2069D|CSMD1_uc010lrg.2_Missense_Mutation_p.G750D	NM_033225	NP_150094	Q96PZ7	CSMD1_HUMAN	CUB and Sushi multiple domains 1 precursor	2740	Extracellular (Potential).|Sushi 19.					integral to membrane				breast(20)|large_intestine(5)	25		all_cancers(1;5.7e-41)|all_epithelial(1;2.54e-36)|Lung NSC(1;7.54e-11)|all_lung(1;3.2e-10)|Hepatocellular(1;3.78e-05)|Breast(1;0.000196)|Myeloproliferative disorder(4;0.000374)|Esophageal squamous(1;0.0157)|Ovarian(12;0.091)|Renal(68;0.144)|Colorectal(14;0.234)		all cancers(1;5.03e-41)|Epithelial(1;4.78e-31)|Lung(1;1.14e-14)|LUSC - Lung squamous cell carcinoma(1;2.34e-14)|GBM - Glioblastoma multiforme(1;4.49e-10)|Colorectal(4;1.18e-07)|OV - Ovarian serous cystadenocarcinoma(1;3.2e-07)|BRCA - Breast invasive adenocarcinoma(1;6.17e-07)|COAD - Colon adenocarcinoma(4;0.000539)|READ - Rectum adenocarcinoma(4;0.00896)|Kidney(5;0.00957)|KIRC - Kidney renal clear cell carcinoma(5;0.0689)														---	---	---	---
MCPH1	79648	broad.mit.edu	37	8	6338339	6338339	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:6338339G>A	uc003wqi.2	+	11	2146	c.2078G>A	c.(2077-2079)CGC>CAC	p.R693H		NM_024596	NP_078872	Q8NEM0	MCPH1_HUMAN	microcephalin	693	BRCT 2.					microtubule organizing center				central_nervous_system(1)|skin(1)	2		Hepatocellular(245;0.0663)		Colorectal(4;0.0505)														---	---	---	---
MSRA	4482	broad.mit.edu	37	8	10177409	10177409	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:10177409C>T	uc003wsx.2	+	5	650	c.453C>T	c.(451-453)AAC>AAT	p.N151N	MSRA_uc011kwx.1_Silent_p.N111N|MSRA_uc011kwy.1_Silent_p.N108N|MSRA_uc003wsz.2_Silent_p.N108N|MSRA_uc003wsy.2_Silent_p.N85N	NM_012331	NP_036463	Q9UJ68	MSRA_HUMAN	methionine sulfoxide reductase A isoform a	151					methionine metabolic process|protein modification process|response to oxidative stress	mitochondrion|nucleus	peptide-methionine-(S)-S-oxide reductase activity				0		Myeloproliferative disorder(644;0.178)			L-Methionine(DB00134)													---	---	---	---
RP1L1	94137	broad.mit.edu	37	8	10464633	10464633	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:10464633G>A	uc003wtc.2	-	4	7204	c.6975C>T	c.(6973-6975)AGC>AGT	p.S2325S		NM_178857	NP_849188	Q8IWN7	RP1L1_HUMAN	retinitis pigmentosa 1-like 1	2325					intracellular signal transduction					ovary(4)|breast(3)|central_nervous_system(1)	8				COAD - Colon adenocarcinoma(149;0.0811)														---	---	---	---
ASAH1	427	broad.mit.edu	37	8	17927303	17927303	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:17927303A>T	uc003wyl.2	-	4	613	c.301T>A	c.(301-303)TTG>ATG	p.L101M	ASAH1_uc010ltb.1_RNA|ASAH1_uc003wym.2_Missense_Mutation_p.L101M|ASAH1_uc003wyn.2_Missense_Mutation_p.L117M|ASAH1_uc003wyo.2_Intron	NM_177924	NP_808592	Q13510	ASAH1_HUMAN	N-acylsphingosine amidohydrolase 1 isoform a	101					ceramide metabolic process	lysosome	ceramidase activity				0				Colorectal(111;0.0646)|COAD - Colon adenocarcinoma(73;0.228)														---	---	---	---
LZTS1	11178	broad.mit.edu	37	8	20112440	20112440	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:20112440G>A	uc003wzr.2	-	1	364	c.253C>T	c.(253-255)CTG>TTG	p.L85L	LZTS1_uc010ltg.1_Silent_p.L85L	NM_021020	NP_066300	Q9Y250	LZTS1_HUMAN	leucine zipper, putative tumor suppressor 1	85					cell cycle|termination of RNA polymerase III transcription|transcription elongation from RNA polymerase III promoter	cell junction|dendritic spine|Golgi apparatus|nucleolus|nucleoplasm|postsynaptic density|postsynaptic membrane	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1				Colorectal(74;0.0511)|COAD - Colon adenocarcinoma(73;0.207)														---	---	---	---
FAM160B2	64760	broad.mit.edu	37	8	21956068	21956068	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:21956068C>T	uc011kyx.1	+	7	954	c.903C>T	c.(901-903)TAC>TAT	p.Y301Y	FAM160B2_uc011kyy.1_RNA	NM_022749	NP_073586	Q86V87	F16B2_HUMAN	retinoic acid induced 16	301											0																		---	---	---	---
KIAA1967	57805	broad.mit.edu	37	8	22473623	22473623	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22473623C>T	uc003xch.2	+	14	1844	c.1707C>T	c.(1705-1707)TCC>TCT	p.S569S	KIAA1967_uc003xci.2_Silent_p.S569S|KIAA1967_uc003xcj.1_Silent_p.S238S	NM_199205	NP_954675	Q8N163	K1967_HUMAN	p30 DBC protein	569					apoptosis|positive regulation of apoptosis	mitochondrial matrix|nucleus	enzyme binding|enzyme inhibitor activity			ovary(1)|central_nervous_system(1)|skin(1)	3		Prostate(55;0.0421)|Breast(100;0.102)|all_epithelial(46;0.142)		BRCA - Breast invasive adenocarcinoma(99;0.00593)|Colorectal(74;0.0157)|COAD - Colon adenocarcinoma(73;0.064)														---	---	---	---
EGR3	1960	broad.mit.edu	37	8	22548028	22548028	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22548028C>T	uc003xcm.1	-	2	1480	c.1122G>A	c.(1120-1122)GCG>GCA	p.A374A	EGR3_uc011kzn.1_Silent_p.A336A|EGR3_uc011kzo.1_Silent_p.A320A	NM_004430	NP_004421	Q06889	EGR3_HUMAN	early growth response 3	374					circadian rhythm|muscle organ development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Prostate(55;0.0421)|Breast(100;0.102)		Colorectal(74;0.0145)|BRCA - Breast invasive adenocarcinoma(99;0.053)|COAD - Colon adenocarcinoma(73;0.0608)														---	---	---	---
RHOBTB2	23221	broad.mit.edu	37	8	22862901	22862901	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22862901G>A	uc003xcq.2	+	3	746	c.209G>A	c.(208-210)CGA>CAA	p.R70Q	RHOBTB2_uc003xcp.2_Missense_Mutation_p.R92Q|RHOBTB2_uc011kzp.1_Missense_Mutation_p.R77Q	NM_015178	NP_055993	Q9BYZ6	RHBT2_HUMAN	Rho-related BTB domain containing 2 isoform 3	70	Rho-like.				regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|plasma membrane	GTP binding			ovary(1)|lung(1)	2		Prostate(55;0.0513)|Breast(100;0.214)		Colorectal(74;0.0157)|COAD - Colon adenocarcinoma(73;0.064)														---	---	---	---
STC1	6781	broad.mit.edu	37	8	23709800	23709800	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:23709800G>A	uc003xdw.1	-	2	500	c.216C>T	c.(214-216)GAC>GAT	p.D72D		NM_003155	NP_003146	P52823	STC1_HUMAN	stanniocalcin 1 precursor	72					cell surface receptor linked signaling pathway|cell-cell signaling|cellular calcium ion homeostasis		hormone activity			skin(3)|upper_aerodigestive_tract(1)	4		Prostate(55;0.055)|Breast(100;0.116)		Colorectal(74;0.0155)|COAD - Colon adenocarcinoma(73;0.0632)														---	---	---	---
TRIM35	23087	broad.mit.edu	37	8	27145136	27145136	+	Silent	SNP	G	A	A	rs148537365		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27145136G>A	uc003xfl.1	-	6	1495	c.1413C>T	c.(1411-1413)GGC>GGT	p.G471G	TRIM35_uc010lup.1_3'UTR	NM_171982	NP_741983	Q9UPQ4	TRI35_HUMAN	tripartite motif-containing 35 isoform 2	471	B30.2/SPRY.				apoptosis|induction of apoptosis|negative regulation of mitotic cell cycle	cytoplasm|nucleus	zinc ion binding				0		Ovarian(32;2.61e-05)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0213)|Epithelial(17;9.34e-10)|Colorectal(74;0.141)														---	---	---	---
WRN	7486	broad.mit.edu	37	8	30982073	30982073	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:30982073G>A	uc003xio.3	+	22	3454	c.2666G>A	c.(2665-2667)CGA>CAA	p.R889Q	WRN_uc010lvk.2_Missense_Mutation_p.R356Q	NM_000553	NP_000544	Q14191	WRN_HUMAN	Werner syndrome protein	889	Helicase C-terminal.				base-excision repair|cellular response to starvation|DNA recombination|DNA synthesis involved in DNA repair|multicellular organismal aging|nucleolus to nucleoplasm transport|positive regulation of hydrolase activity|regulation of apoptosis|replication fork processing|response to oxidative stress|response to UV-C|telomere maintenance	centrosome|nucleolus|nucleoplasm	3'-5' exonuclease activity|ATP binding|ATP-dependent 3'-5' DNA helicase activity|bubble DNA binding|four-way junction helicase activity|G-quadruplex DNA binding|magnesium ion binding|manganese ion binding|protein complex binding|protein homodimerization activity|Y-form DNA binding			ovary(2)|kidney(2)|large_intestine(1)|lung(1)|skin(1)	7		Breast(100;0.195)		KIRC - Kidney renal clear cell carcinoma(542;0.147)|Kidney(114;0.176)|Colorectal(111;0.192)				Mis|N|F|S			osteosarcoma|meningioma|others		Genes_defective_in_diseases_associated_with_sensitivity_to_DNA_damaging_agents	Werner_syndrome				---	---	---	---
UNC5D	137970	broad.mit.edu	37	8	35402061	35402061	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:35402061A>G	uc003xjr.1	+						UNC5D_uc003xjs.1_Intron	NM_080872	NP_543148			unc-5 homolog D precursor						apoptosis|axon guidance	integral to membrane	receptor activity			upper_aerodigestive_tract(2)|ovary(2)|pancreas(1)|skin(1)	6				READ - Rectum adenocarcinoma(1;1.31e-05)|Colorectal(1;0.000723)														---	---	---	---
ERLIN2	11160	broad.mit.edu	37	8	37611432	37611432	+	Splice_Site	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:37611432G>A	uc003xke.3	+	12	935	c.820_splice	c.e12-1	p.L274_splice		NM_007175	NP_009106			ER lipid raft associated 2 isoform 1						ER-associated protein catabolic process	endoplasmic reticulum membrane|integral to membrane|plasma membrane	protein binding				0		Lung NSC(58;0.174)	BRCA - Breast invasive adenocarcinoma(5;6.14e-24)|LUSC - Lung squamous cell carcinoma(8;3.5e-10)															---	---	---	---
PPAPDC1B	84513	broad.mit.edu	37	8	38126393	38126393	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:38126393C>T	uc003xlf.3	-						PPAPDC1B_uc003xle.3_Intron|PPAPDC1B_uc003xlg.3_Intron|PPAPDC1B_uc010lwd.2_Intron	NM_001102559	NP_001096029			phosphatidic acid phosphatase type 2 domain						phospholipid dephosphorylation	cytoplasm|integral to membrane|plasma membrane	phosphatidate phosphatase activity				0	Colorectal(12;0.000442)|Esophageal squamous(3;0.0725)	all_lung(54;0.00787)|Lung NSC(58;0.0295)|Hepatocellular(245;0.121)	BRCA - Breast invasive adenocarcinoma(5;3.04e-26)|COAD - Colon adenocarcinoma(9;0.188)															---	---	---	---
GINS4	84296	broad.mit.edu	37	8	41399427	41399427	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:41399427C>T	uc003xnx.2	+						GINS4_uc003xny.2_Intron	NM_032336	NP_115712			GINS complex subunit 4						DNA strand elongation involved in DNA replication|S phase of mitotic cell cycle	cytoplasm|nucleoplasm				skin(1)	1	Ovarian(28;0.014)|Colorectal(14;0.0202)|Lung SC(25;0.211)	all_lung(54;0.00732)|Lung NSC(58;0.0207)|Hepatocellular(245;0.0462)|Esophageal squamous(32;0.0844)	Colorectal(10;0.0014)|OV - Ovarian serous cystadenocarcinoma(14;0.00329)|LUSC - Lung squamous cell carcinoma(45;0.0137)|COAD - Colon adenocarcinoma(11;0.0147)															---	---	---	---
AGPAT6	137964	broad.mit.edu	37	8	41467268	41467268	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:41467268C>T	uc003xnz.2	+	4	1269	c.330C>T	c.(328-330)TTC>TTT	p.F110F		NM_178819	NP_848934	Q86UL3	GPAT4_HUMAN	lysophosphatidic acid acyltransferase zeta	110					acyl-CoA metabolic process|lactation|phosphatidylcholine biosynthetic process|triglyceride biosynthetic process	endoplasmic reticulum membrane|integral to membrane|membrane fraction	glycerol-3-phosphate O-acyltransferase activity				0	Ovarian(28;0.00769)|Colorectal(14;0.0202)|Lung SC(25;0.211)	all_lung(54;0.0131)|Lung NSC(58;0.0363)|Hepatocellular(245;0.0462)|Esophageal squamous(32;0.0844)	OV - Ovarian serous cystadenocarcinoma(14;0.00126)|Colorectal(10;0.0014)|Lung(22;0.00177)|LUSC - Lung squamous cell carcinoma(45;0.00392)|COAD - Colon adenocarcinoma(11;0.0147)															---	---	---	---
SNTG1	54212	broad.mit.edu	37	8	51664550	51664550	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:51664550C>T	uc010lxy.1	+						SNTG1_uc003xqs.1_Intron|SNTG1_uc010lxz.1_Intron|SNTG1_uc011ldl.1_Intron	NM_018967	NP_061840			syntrophin, gamma 1						cell communication	cytoplasm|cytoskeleton|nucleus|ruffle membrane|syntrophin complex	actin binding|protein C-terminus binding			ovary(5)	5		all_cancers(86;0.00754)|all_epithelial(80;9.76e-05)|Lung NSC(129;0.000865)|all_lung(136;0.00249)|Colorectal(162;0.22)																---	---	---	---
PXDNL	137902	broad.mit.edu	37	8	52322009	52322009	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:52322009C>T	uc003xqu.3	-	17	2276	c.2175G>A	c.(2173-2175)GCG>GCA	p.A725A	PXDNL_uc003xqt.3_RNA	NM_144651	NP_653252	A1KZ92	PXDNL_HUMAN	peroxidasin homolog-like precursor	725					hydrogen peroxide catabolic process	extracellular space	heme binding|peroxidase activity			ovary(1)|pancreas(1)	2		all_cancers(86;0.107)|Lung NSC(129;0.00641)|all_epithelial(80;0.00716)|all_lung(136;0.015)																---	---	---	---
ST18	9705	broad.mit.edu	37	8	53038681	53038681	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:53038681T>C	uc003xqz.2	-	18	2842	c.2686A>G	c.(2686-2688)AAT>GAT	p.N896D	ST18_uc011ldq.1_Missense_Mutation_p.N543D|ST18_uc011ldr.1_Missense_Mutation_p.N861D|ST18_uc011lds.1_Missense_Mutation_p.N801D|ST18_uc003xra.2_Missense_Mutation_p.N896D	NM_014682	NP_055497	O60284	ST18_HUMAN	suppression of tumorigenicity 18	896	C2HC-type 6.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)|skin(1)	5		Lung NSC(129;0.131)|all_epithelial(80;0.217)|all_lung(136;0.229)																---	---	---	---
TCEA1	6917	broad.mit.edu	37	8	54882849	54882849	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:54882849C>T	uc003xru.2	-						TCEA1_uc003xrv.2_Intron|TCEA1_uc011ldw.1_Intron|TCEA1_uc010lyg.2_Intron	NM_006756	NP_006747			transcription elongation factor A 1 isoform 1						positive regulation of viral transcription|regulation of transcription elongation, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription elongation from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair|viral reproduction	nucleoplasm	DNA binding|translation elongation factor activity|zinc ion binding				0		Lung NSC(129;0.109)|all_epithelial(80;0.11)|all_lung(136;0.181)	OV - Ovarian serous cystadenocarcinoma(7;9.1e-07)|Epithelial(17;9.44e-05)|all cancers(17;0.000699)					T	PLAG1	salivary adenoma								---	---	---	---
TCEA1	6917	broad.mit.edu	37	8	54906257	54906257	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:54906257C>A	uc003xru.2	-	4	614	c.291G>T	c.(289-291)TCG>TCT	p.S97S	TCEA1_uc003xrv.2_Silent_p.S76S|TCEA1_uc011ldw.1_Intron|TCEA1_uc003xrw.1_RNA	NM_006756	NP_006747	P23193	TCEA1_HUMAN	transcription elongation factor A 1 isoform 1	97					positive regulation of viral transcription|regulation of transcription elongation, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription elongation from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair|viral reproduction	nucleoplasm	DNA binding|translation elongation factor activity|zinc ion binding				0		Lung NSC(129;0.109)|all_epithelial(80;0.11)|all_lung(136;0.181)	OV - Ovarian serous cystadenocarcinoma(7;9.1e-07)|Epithelial(17;9.44e-05)|all cancers(17;0.000699)					T	PLAG1	salivary adenoma								---	---	---	---
RP1	6101	broad.mit.edu	37	8	55534132	55534132	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:55534132C>T	uc003xsd.1	+	2	754	c.606C>T	c.(604-606)GAC>GAT	p.D202D	RP1_uc011ldy.1_Silent_p.D202D	NM_006269	NP_006260	P56715	RP1_HUMAN	retinitis pigmentosa RP1 protein	202	Doublecortin 2.		D -> E (in RP1).		axoneme assembly|intracellular signal transduction|photoreceptor cell maintenance|photoreceptor cell outer segment organization|phototransduction, visible light|retinal cone cell development|retinal rod cell development	cilium axoneme|cytoplasm|microtubule|microtubule associated complex|photoreceptor connecting cilium|photoreceptor inner segment|photoreceptor outer segment	microtubule binding			skin(7)|ovary(4)|pancreas(1)	12		all_lung(136;0.0831)|Lung NSC(129;0.109)|all_epithelial(80;0.123)	OV - Ovarian serous cystadenocarcinoma(7;4.4e-07)|Epithelial(17;3.37e-05)|all cancers(17;0.000285)															---	---	---	---
RP1	6101	broad.mit.edu	37	8	55538400	55538400	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:55538400G>A	uc003xsd.1	+	4	2106	c.1958G>A	c.(1957-1959)GGT>GAT	p.G653D	RP1_uc011ldy.1_Intron	NM_006269	NP_006260	P56715	RP1_HUMAN	retinitis pigmentosa RP1 protein	653					axoneme assembly|intracellular signal transduction|photoreceptor cell maintenance|photoreceptor cell outer segment organization|phototransduction, visible light|retinal cone cell development|retinal rod cell development	cilium axoneme|cytoplasm|microtubule|microtubule associated complex|photoreceptor connecting cilium|photoreceptor inner segment|photoreceptor outer segment	microtubule binding			skin(7)|ovary(4)|pancreas(1)	12		all_lung(136;0.0831)|Lung NSC(129;0.109)|all_epithelial(80;0.123)	OV - Ovarian serous cystadenocarcinoma(7;4.4e-07)|Epithelial(17;3.37e-05)|all cancers(17;0.000285)															---	---	---	---
NSMAF	8439	broad.mit.edu	37	8	59498296	59498296	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:59498296G>A	uc003xtt.2	-	30	2788	c.2574C>T	c.(2572-2574)TCC>TCT	p.S858S	NSMAF_uc011lee.1_Silent_p.S889S	NM_003580	NP_003571	Q92636	FAN_HUMAN	neutral sphingomyelinase (N-SMase) activation	858					ceramide metabolic process	cytoplasm|soluble fraction	protein binding|receptor signaling protein activity			ovary(1)	1		all_lung(136;0.174)|Lung NSC(129;0.2)																---	---	---	---
C8orf45	157777	broad.mit.edu	37	8	67809158	67809158	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:67809158G>T	uc003xwz.3	+	12	1761	c.1590G>T	c.(1588-1590)GCG>GCT	p.A530A	C8orf45_uc011lev.1_Silent_p.A530A|C8orf45_uc011lew.1_Silent_p.A461A|C8orf45_uc011lex.1_Silent_p.A288A|C8orf45_uc003xwy.3_Silent_p.A530A	NM_173518	NP_775789	Q4G0Z9	CH045_HUMAN	minichromosome maintenance complex	530					DNA replication		ATP binding|DNA binding			ovary(1)	1	Breast(64;0.186)		Epithelial(68;0.00384)|OV - Ovarian serous cystadenocarcinoma(28;0.00913)|all cancers(69;0.0175)|BRCA - Breast invasive adenocarcinoma(89;0.206)															---	---	---	---
C8orf34	116328	broad.mit.edu	37	8	69380980	69380980	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:69380980C>T	uc010lyz.2	+	4	452	c.403C>T	c.(403-405)CGT>TGT	p.R135C	C8orf34_uc010lyy.1_Missense_Mutation_p.R135C|C8orf34_uc003xyb.2_Missense_Mutation_p.R110C	NM_052958	NP_443190	Q49A92	CH034_HUMAN	hypothetical protein LOC116328	135					signal transduction		cAMP-dependent protein kinase regulator activity			large_intestine(1)	1			Epithelial(68;0.0117)|OV - Ovarian serous cystadenocarcinoma(28;0.0227)|all cancers(69;0.0502)															---	---	---	---
ZFHX4	79776	broad.mit.edu	37	8	77765696	77765696	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:77765696C>T	uc003yav.2	+	10	6791	c.6404C>T	c.(6403-6405)ACG>ATG	p.T2135M	ZFHX4_uc003yau.1_Missense_Mutation_p.T2180M|ZFHX4_uc003yaw.1_Missense_Mutation_p.T2135M	NM_024721	NP_078997	Q86UP3	ZFHX4_HUMAN	zinc finger homeodomain 4	2135	Homeobox 1.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(8)|large_intestine(4)|breast(2)|lung(1)	15			BRCA - Breast invasive adenocarcinoma(89;0.0895)												HNSCC(33;0.089)			---	---	---	---
WWP1	11059	broad.mit.edu	37	8	87424099	87424099	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:87424099T>G	uc003ydt.2	+	9	1337	c.1057T>G	c.(1057-1059)TCA>GCA	p.S353A	WWP1_uc010mai.2_Missense_Mutation_p.S129A	NM_007013	NP_008944	Q9H0M0	WWP1_HUMAN	WW domain containing E3 ubiquitin protein ligase	353	WW 1.				central nervous system development|entry of virus into host cell|negative regulation of transcription, DNA-dependent|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|signal transduction	cytoplasm|nucleus|plasma membrane|ubiquitin ligase complex	protein binding|ubiquitin-protein ligase activity			lung(1)|liver(1)	2																		---	---	---	---
OSGIN2	734	broad.mit.edu	37	8	90937134	90937134	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:90937134C>T	uc003yeg.2	+	6	1238	c.892C>T	c.(892-894)CGT>TGT	p.R298C	OSGIN2_uc003yeh.2_Missense_Mutation_p.R342C	NM_004337	NP_004328	Q9Y236	OSGI2_HUMAN	oxidative stress induced growth inhibitor family	298					germ cell development|meiosis						0			BRCA - Breast invasive adenocarcinoma(11;0.0344)															---	---	---	---
OSGIN2	734	broad.mit.edu	37	8	90937459	90937459	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:90937459T>G	uc003yeg.2	+	6	1563	c.1217T>G	c.(1216-1218)CTG>CGG	p.L406R	OSGIN2_uc003yeh.2_Missense_Mutation_p.L450R	NM_004337	NP_004328	Q9Y236	OSGI2_HUMAN	oxidative stress induced growth inhibitor family	406					germ cell development|meiosis						0			BRCA - Breast invasive adenocarcinoma(11;0.0344)															---	---	---	---
TMEM67	91147	broad.mit.edu	37	8	94794663	94794663	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:94794663C>T	uc011lgk.1	+	11	1177	c.1106C>T	c.(1105-1107)TCA>TTA	p.S369L	TMEM67_uc010mat.1_Missense_Mutation_p.S284L|TMEM67_uc010maw.2_Intron|TMEM67_uc003yga.3_Missense_Mutation_p.S288L	NM_153704	NP_714915	Q5HYA8	MKS3_HUMAN	meckelin isoform 1	369					cilium assembly|ER-associated protein catabolic process|negative regulation of centrosome duplication	centrosome|cilium membrane|cytoplasmic vesicle membrane|endoplasmic reticulum membrane|integral to membrane|microtubule basal body	unfolded protein binding			ovary(2)	2	Breast(36;4.14e-07)		BRCA - Breast invasive adenocarcinoma(8;0.00896)															---	---	---	---
CDH17	1015	broad.mit.edu	37	8	95188761	95188761	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95188761C>T	uc003ygh.2	-						CDH17_uc011lgo.1_Intron|CDH17_uc011lgp.1_Intron	NM_004063	NP_004054			cadherin 17 precursor							integral to membrane	calcium ion binding			ovary(5)|skin(1)	6	Breast(36;4.65e-06)		BRCA - Breast invasive adenocarcinoma(8;0.00691)															---	---	---	---
PGCP	10404	broad.mit.edu	37	8	97978250	97978250	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:97978250G>A	uc003yhw.2	+	5	1103	c.937G>A	c.(937-939)GCA>ACA	p.A313T	PGCP_uc010mbe.2_Missense_Mutation_p.A313T	NM_016134	NP_057218	Q9Y646	PGCP_HUMAN	plasma glutamate carboxypeptidase precursor	313					peptide metabolic process|proteolysis	cytoplasm|extracellular space	metal ion binding|metallocarboxypeptidase activity			upper_aerodigestive_tract(1)	1	Breast(36;1.86e-05)																	---	---	---	---
RGS22	26166	broad.mit.edu	37	8	101054050	101054050	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101054050C>T	uc003yjb.1	-	12	2113	c.1918G>A	c.(1918-1920)GCT>ACT	p.A640T	RGS22_uc003yja.1_Missense_Mutation_p.A459T|RGS22_uc003yjc.1_Missense_Mutation_p.A628T|RGS22_uc011lgz.1_RNA|RGS22_uc010mbo.1_RNA	NM_015668	NP_056483	Q8NE09	RGS22_HUMAN	regulator of G-protein signaling 22	640					negative regulation of signal transduction	cytoplasm|plasma membrane	GTPase activator activity|signal transducer activity			ovary(3)|skin(2)|breast(1)|central_nervous_system(1)	7			Epithelial(11;6.71e-08)|all cancers(13;4.19e-06)|OV - Ovarian serous cystadenocarcinoma(57;0.000469)|STAD - Stomach adenocarcinoma(118;0.169)															---	---	---	---
SPAG1	6674	broad.mit.edu	37	8	101206483	101206483	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101206483C>A	uc003yjh.1	+	10	1169	c.1083C>A	c.(1081-1083)GGC>GGA	p.G361G	SPAG1_uc003yjg.1_Silent_p.G361G|SPAG1_uc003yji.1_Silent_p.G361G	NM_172218	NP_757367	Q07617	SPAG1_HUMAN	sperm associated antigen 1	361					single fertilization	cytoplasm	GTP binding|hydrolase activity			ovary(2)|central_nervous_system(1)	3	all_cancers(14;2.35e-05)|all_epithelial(15;5.2e-08)|Lung NSC(17;0.000283)|all_lung(17;0.000823)	Breast(495;0.195)	Epithelial(11;1.12e-09)|all cancers(13;1.26e-07)|OV - Ovarian serous cystadenocarcinoma(57;4.37e-05)|STAD - Stomach adenocarcinoma(118;0.0525)	KIRC - Kidney renal clear cell carcinoma(542;0.00178)|READ - Rectum adenocarcinoma(644;0.236)														---	---	---	---
YWHAZ	7534	broad.mit.edu	37	8	101961019	101961019	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101961019T>C	uc011lhe.1	-	2	276	c.99A>G	c.(97-99)GGA>GGG	p.G33G	YWHAZ_uc003yjv.2_Silent_p.G33G|YWHAZ_uc011lhf.1_Silent_p.G33G|YWHAZ_uc003yjw.2_Silent_p.G33G|YWHAZ_uc010mbq.2_Intron|YWHAZ_uc011lhg.1_Intron|YWHAZ_uc010mbr.2_Silent_p.G33G|YWHAZ_uc003yjx.2_Silent_p.G33G|YWHAZ_uc003yjy.2_Silent_p.G33G	NM_001135702	NP_001129174	P63104	1433Z_HUMAN	tyrosine 3/tryptophan 5 -monooxygenase	33					anti-apoptosis|mRNA metabolic process|platelet activation|signal transduction	cytosol|melanosome	transcription factor binding				0	all_cancers(14;7.43e-06)|all_epithelial(15;2.77e-08)|Lung NSC(17;6.08e-05)|all_lung(17;0.000197)		Epithelial(11;2.79e-11)|all cancers(13;5.45e-09)|OV - Ovarian serous cystadenocarcinoma(57;4.75e-05)		Ginkgo biloba(DB01381)													---	---	---	---
UBR5	51366	broad.mit.edu	37	8	103297902	103297902	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:103297902T>G	uc003ykr.1	-	39	5356	c.5323A>C	c.(5323-5325)AGC>CGC	p.S1775R	UBR5_uc003yks.1_Missense_Mutation_p.S1775R	NM_015902	NP_056986	O95071	UBR5_HUMAN	ubiquitin protein ligase E3 component n-recognin	1775					cell proliferation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of catenin import into nucleus|positive regulation of protein import into nucleus, translocation|progesterone receptor signaling pathway|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|response to DNA damage stimulus	nucleus|soluble fraction	protein binding|RNA binding|ubiquitin-ubiquitin ligase activity|zinc ion binding			lung(16)|ovary(4)|large_intestine(3)|breast(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)	28	all_cancers(14;8e-07)|all_epithelial(15;2.18e-08)|Lung NSC(17;2.55e-05)|all_lung(17;8.85e-05)		OV - Ovarian serous cystadenocarcinoma(57;0.000442)															---	---	---	---
RIMS2	9699	broad.mit.edu	37	8	105263283	105263283	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:105263283C>T	uc003yls.2	+	27	4018	c.3777C>T	c.(3775-3777)AAC>AAT	p.N1259N	RIMS2_uc003ylp.2_Silent_p.N1241N|RIMS2_uc003ylw.2_Silent_p.N1248N|RIMS2_uc003ylq.2_Silent_p.N1055N|RIMS2_uc003ylr.2_Silent_p.N1080N	NM_014677	NP_055492	Q9UQ26	RIMS2_HUMAN	regulating synaptic membrane exocytosis 2	1303	C2 2.				intracellular protein transport	cell junction|presynaptic membrane	metal ion binding|Rab GTPase binding			ovary(6)|lung(2)|breast(2)|skin(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	15			OV - Ovarian serous cystadenocarcinoma(57;7.7e-07)|STAD - Stomach adenocarcinoma(118;0.229)												HNSCC(12;0.0054)			---	---	---	---
SYBU	55638	broad.mit.edu	37	8	110587156	110587156	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110587156G>A	uc003ynj.3	-	7	2134	c.1971C>T	c.(1969-1971)ACC>ACT	p.T657T	SYBU_uc003yni.3_Silent_p.T654T|SYBU_uc003ynk.3_Silent_p.T538T|SYBU_uc010mco.2_Silent_p.T656T|SYBU_uc003ynl.3_Silent_p.T656T|SYBU_uc010mcp.2_Silent_p.T657T|SYBU_uc010mcq.2_Silent_p.T657T|SYBU_uc003yno.3_Silent_p.T538T|SYBU_uc010mcr.2_Silent_p.T657T|SYBU_uc003ynm.3_Silent_p.T656T|SYBU_uc003ynn.3_Silent_p.T656T|SYBU_uc010mcs.2_Silent_p.T538T|SYBU_uc010mct.2_Silent_p.T657T|SYBU_uc010mcu.2_Silent_p.T656T|SYBU_uc003ynp.3_Silent_p.T589T|SYBU_uc010mcv.2_Silent_p.T657T|SYBU_uc003ynh.3_Silent_p.T451T|SYBU_uc011lhw.1_Silent_p.T527T	NM_001099754	NP_001093224	Q9NX95	SYBU_HUMAN	Golgi-localized syntaphilin-related protein	657						cytoplasmic membrane-bounded vesicle|cytoskeleton|Golgi membrane|integral to membrane		p.R657H(1)		ovary(1)	1																		---	---	---	---
MED30	90390	broad.mit.edu	37	8	118543004	118543004	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:118543004G>A	uc003yoj.2	+	3	530	c.379G>A	c.(379-381)GAT>AAT	p.D127N	MED30_uc011lib.1_Intron	NM_080651	NP_542382	Q96HR3	MED30_HUMAN	TRAP/Mediator complex component TRAP25	127					androgen receptor signaling pathway|positive regulation of transcription, DNA-dependent|transcription initiation from RNA polymerase II promoter	mediator complex	ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding				0	all_cancers(13;3.41e-25)|Lung NSC(37;3.02e-05)|Ovarian(258;0.00163)		STAD - Stomach adenocarcinoma(47;0.0266)															---	---	---	---
EXT1	2131	broad.mit.edu	37	8	119122904	119122904	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:119122904C>T	uc003yok.1	-	1	1155	c.382G>A	c.(382-384)GCC>ACC	p.A128T		NM_000127	NP_000118	Q16394	EXT1_HUMAN	exostosin 1	128	Lumenal (Potential).				glycosaminoglycan biosynthetic process|heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process|ossification|signal transduction|skeletal system development	Golgi membrane|integral to endoplasmic reticulum membrane	glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activity|heparan sulfate N-acetylglucosaminyltransferase activity|N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase activity|protein heterodimerization activity|protein homodimerization activity			ovary(2)|lung(2)	4	all_cancers(13;2.36e-26)|Lung NSC(37;5.02e-07)|Ovarian(258;0.0173)		STAD - Stomach adenocarcinoma(47;0.012)					Mis|N|F|S			exostoses|osteosarcoma			Hereditary_Multiple_Exostoses|Langer-Giedion_syndrome				---	---	---	---
ENPP2	5168	broad.mit.edu	37	8	120581581	120581581	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:120581581C>A	uc003yot.1	-	21	2033	c.1947G>T	c.(1945-1947)CTG>CTT	p.L649L	ENPP2_uc011lic.1_Silent_p.L187L|ENPP2_uc003yor.1_Silent_p.L284L|ENPP2_uc003yos.1_Silent_p.L701L|ENPP2_uc010mdd.1_Silent_p.L674L	NM_001040092	NP_001035181	Q13822	ENPP2_HUMAN	autotaxin isoform 2 preproprotein	649					cellular component movement|chemotaxis|G-protein coupled receptor protein signaling pathway|immune response|phosphate metabolic process|phosphatidylcholine catabolic process|regulation of cell migration	extracellular space|integral to plasma membrane	alkylglycerophosphoethanolamine phosphodiesterase activity|calcium ion binding|lysophospholipase activity|nucleic acid binding|nucleotide diphosphatase activity|phosphodiesterase I activity|polysaccharide binding|scavenger receptor activity|transcription factor binding|zinc ion binding			ovary(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)|large_intestine(1)|kidney(1)	7	Lung NSC(37;5.03e-06)|Ovarian(258;0.0249)|Hepatocellular(40;0.161)		STAD - Stomach adenocarcinoma(47;0.00185)															---	---	---	---
FAM91A1	157769	broad.mit.edu	37	8	124798813	124798813	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124798813G>A	uc003yqv.2	+	12	1102	c.1041G>A	c.(1039-1041)TCG>TCA	p.S347S	FAM91A1_uc011lik.1_Silent_p.S347S|FAM91A1_uc011lil.1_Silent_p.S105S	NM_144963	NP_659400	Q658Y4	F91A1_HUMAN	hypothetical protein LOC157769	347										ovary(1)|central_nervous_system(1)	2	Lung NSC(37;8.76e-13)|Ovarian(258;0.00744)|all_neural(195;0.0741)		STAD - Stomach adenocarcinoma(47;0.00192)															---	---	---	---
MTSS1	9788	broad.mit.edu	37	8	125565503	125565503	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:125565503G>A	uc003yrk.2	-	14	2532	c.1998C>T	c.(1996-1998)AGC>AGT	p.S666S	NDUFB9_uc011lim.1_Intron|MTSS1_uc003yrh.2_Silent_p.S315S|MTSS1_uc011lin.1_Silent_p.S440S|MTSS1_uc011lio.1_Silent_p.S556S|MTSS1_uc003yri.2_Silent_p.S384S|MTSS1_uc003yrj.2_Silent_p.S641S|MTSS1_uc003yrl.2_Silent_p.S670S	NM_014751	NP_055566	O43312	MTSS1_HUMAN	metastasis suppressor 1	666	Pro-rich.				actin cytoskeleton organization|cell adhesion|cellular component movement|filopodium assembly|transmembrane receptor protein tyrosine kinase signaling pathway	actin cytoskeleton|endocytic vesicle|ruffle	actin monomer binding|cytoskeletal adaptor activity|receptor binding|SH3 domain binding			ovary(1)	1	Ovarian(258;0.00438)|all_neural(195;0.00459)|Hepatocellular(40;0.108)		STAD - Stomach adenocarcinoma(47;0.00288)															---	---	---	---
ASAP1	50807	broad.mit.edu	37	8	131130877	131130877	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:131130877C>A	uc003yta.1	-	18	1680	c.1652G>T	c.(1651-1653)AGG>ATG	p.R551M	ASAP1_uc003ysz.1_Missense_Mutation_p.R362M|ASAP1_uc011liw.1_Missense_Mutation_p.R544M	NM_018482	NP_060952	Q9ULH1	ASAP1_HUMAN	development and differentiation enhancing factor	551	Arf-GAP.				cilium morphogenesis|filopodium assembly|regulation of ARF GTPase activity|signal transduction	cytoplasm|membrane	ARF GTPase activator activity|cytoskeletal adaptor activity|SH3 domain binding|zinc ion binding			ovary(4)	4																		---	---	---	---
KCNQ3	3786	broad.mit.edu	37	8	133196478	133196478	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:133196478C>T	uc003ytj.2	-						KCNQ3_uc010mdt.2_Intron	NM_004519	NP_004510			potassium voltage-gated channel KQT-like protein						axon guidance|synaptic transmission	voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(2)|breast(1)|central_nervous_system(1)|skin(1)	5	Esophageal squamous(12;0.00507)|Ovarian(258;0.00579)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.000311)															---	---	---	---
TG	7038	broad.mit.edu	37	8	133883670	133883670	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:133883670C>T	uc003ytw.2	+	4	393	c.352C>T	c.(352-354)CCT>TCT	p.P118S		NM_003235	NP_003226	P01266	THYG_HUMAN	thyroglobulin precursor	118	Thyroglobulin type-1 2.				hormone biosynthetic process|signal transduction|thyroid gland development|thyroid hormone generation	extracellular space	hormone activity			ovary(8)|breast(4)|pancreas(1)|central_nervous_system(1)|skin(1)	15	Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)	Myeloproliferative disorder(644;0.00878)|Acute lymphoblastic leukemia(644;0.0559)|Breast(495;0.0735)	BRCA - Breast invasive adenocarcinoma(115;0.000701)	KIRC - Kidney renal clear cell carcinoma(542;0.0546)														---	---	---	---
TG	7038	broad.mit.edu	37	8	134125772	134125772	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:134125772C>T	uc003ytw.2	+	44	7720	c.7679C>T	c.(7678-7680)GCT>GTT	p.A2560V	TG_uc010mdw.2_Missense_Mutation_p.A1319V|TG_uc011ljb.1_Missense_Mutation_p.A929V|TG_uc011ljc.1_Missense_Mutation_p.A693V	NM_003235	NP_003226	P01266	THYG_HUMAN	thyroglobulin precursor	2560					hormone biosynthetic process|signal transduction|thyroid gland development|thyroid hormone generation	extracellular space	hormone activity			ovary(8)|breast(4)|pancreas(1)|central_nervous_system(1)|skin(1)	15	Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)	Myeloproliferative disorder(644;0.00878)|Acute lymphoblastic leukemia(644;0.0559)|Breast(495;0.0735)	BRCA - Breast invasive adenocarcinoma(115;0.000701)	KIRC - Kidney renal clear cell carcinoma(542;0.0546)														---	---	---	---
NDRG1	10397	broad.mit.edu	37	8	134292508	134292508	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:134292508G>T	uc003yuh.2	-	3	652	c.66C>A	c.(64-66)ACC>ACA	p.T22T	NDRG1_uc003yug.2_Silent_p.T22T|NDRG1_uc010mee.2_5'UTR|NDRG1_uc010mef.2_Intron|NDRG1_uc011ljh.1_5'UTR|NDRG1_uc011lji.1_Intron	NM_001135242	NP_001128714	Q92597	NDRG1_HUMAN	N-myc downstream regulated 1	22					cellular response to hypoxia|response to metal ion	cytoplasm|microtubule cytoskeleton|nucleus|plasma membrane	protein binding			ovary(4)	4	all_epithelial(106;4.26e-24)|Lung NSC(106;7.26e-07)|all_lung(105;2.77e-06)|Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0107)															---	---	---	---
SLC45A4	57210	broad.mit.edu	37	8	142228524	142228524	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142228524G>T	uc003ywd.1	-	4	1370	c.1062C>A	c.(1060-1062)CCC>CCA	p.P354P	SLC45A4_uc003ywc.1_Silent_p.P354P|SLC45A4_uc010meq.1_Silent_p.P352P	NM_001080431	NP_001073900	Q5BKX6	S45A4_HUMAN	solute carrier family 45, member 4	405					transport	integral to membrane				ovary(2)	2	all_cancers(97;1.52e-15)|all_epithelial(106;2.92e-14)|Lung NSC(106;1.23e-05)|all_lung(105;1.75e-05)|Ovarian(258;0.01)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0493)															---	---	---	---
FLJ43860	389690	broad.mit.edu	37	8	142500310	142500310	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142500310G>A	uc003ywi.2	-	5	685	c.604C>T	c.(604-606)CGG>TGG	p.R202W	FLJ43860_uc011ljs.1_RNA|FLJ43860_uc010meu.1_RNA	NM_207414	NP_997297	Q6ZUA9	Q6ZUA9_HUMAN	hypothetical protein LOC389690	202							binding				0	all_cancers(97;7.79e-15)|all_epithelial(106;4.52e-13)|Lung NSC(106;2.07e-05)|all_lung(105;2.89e-05)|Ovarian(258;0.0303)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0493)															---	---	---	---
FAM83H	286077	broad.mit.edu	37	8	144810216	144810216	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144810216A>G	uc003yzk.2	-	5	1484	c.1415T>C	c.(1414-1416)CTG>CCG	p.L472P	FAM83H_uc010mfk.1_RNA	NM_198488	NP_940890	Q6ZRV2	FA83H_HUMAN	FAM83H	472					biomineral tissue development					lung(1)|central_nervous_system(1)|pancreas(1)	3	all_cancers(97;3.74e-11)|all_epithelial(106;2.62e-09)|Lung NSC(106;0.00013)|all_lung(105;0.000374)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;3.38e-41)|Epithelial(56;6.8e-40)|all cancers(56;6.43e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.146)															---	---	---	---
EPPK1	83481	broad.mit.edu	37	8	144944068	144944068	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144944068A>G	uc003zaa.1	-	1	3367	c.3354T>C	c.(3352-3354)AGT>AGC	p.S1118S		NM_031308	NP_112598	P58107	EPIPL_HUMAN	epiplakin 1	1118						cytoplasm|cytoskeleton	protein binding|structural molecule activity			pancreas(1)|skin(1)	2	all_cancers(97;1.42e-10)|all_epithelial(106;1.99e-09)|Lung NSC(106;0.000126)|all_lung(105;0.000354)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;2.46e-41)|Epithelial(56;2.88e-40)|all cancers(56;1.82e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)															---	---	---	---
PARP10	84875	broad.mit.edu	37	8	145059498	145059498	+	Splice_Site	SNP	T	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145059498T>A	uc003zal.3	-	5	782	c.674_splice	c.e5-1	p.V225_splice	PARP10_uc003zak.3_Splice_Site|PARP10_uc011lku.1_Splice_Site_p.V237_splice|PARP10_uc011lkv.1_Splice_Site|PARP10_uc003zam.2_Splice_Site_p.V225_splice|PARP10_uc010mfn.1_Intron|PARP10_uc010mfo.1_Intron	NM_032789	NP_116178			poly (ADP-ribose) polymerase family, member 10							Golgi apparatus|nucleolus	NAD+ ADP-ribosyltransferase activity|nucleotide binding			ovary(2)|upper_aerodigestive_tract(1)|lung(1)|breast(1)|pancreas(1)	6	all_cancers(97;8.2e-11)|all_epithelial(106;1.1e-09)|Lung NSC(106;5.89e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.31e-40)|Epithelial(56;1.16e-39)|all cancers(56;6.43e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)															---	---	---	---
PARP10	84875	broad.mit.edu	37	8	145060298	145060298	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145060298G>A	uc003zal.3	-	2	214	c.106C>T	c.(106-108)CGC>TGC	p.R36C	PARP10_uc003zak.3_5'Flank|PARP10_uc011lku.1_Missense_Mutation_p.R48C|PARP10_uc011lkv.1_RNA|PARP10_uc003zam.2_Missense_Mutation_p.R36C|PARP10_uc010mfn.1_Missense_Mutation_p.R36C|PARP10_uc010mfo.1_Intron	NM_032789	NP_116178	Q53GL7	PAR10_HUMAN	poly (ADP-ribose) polymerase family, member 10	36						Golgi apparatus|nucleolus	NAD+ ADP-ribosyltransferase activity|nucleotide binding			ovary(2)|upper_aerodigestive_tract(1)|lung(1)|breast(1)|pancreas(1)	6	all_cancers(97;8.2e-11)|all_epithelial(106;1.1e-09)|Lung NSC(106;5.89e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.31e-40)|Epithelial(56;1.16e-39)|all cancers(56;6.43e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.105)															---	---	---	---
ADCK5	203054	broad.mit.edu	37	8	145617902	145617902	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145617902A>G	uc003zch.2	+	13	1564	c.1510A>G	c.(1510-1512)ATG>GTG	p.M504V	ADCK5_uc003zcg.2_RNA|ADCK5_uc003zci.2_Missense_Mutation_p.M93V	NM_174922	NP_777582	Q3MIX3	ADCK5_HUMAN	aarF domain containing kinase 5	504						integral to membrane	protein serine/threonine kinase activity			stomach(1)	1	all_cancers(97;6.64e-12)|all_epithelial(106;2.89e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;8.96e-41)|Epithelial(56;4.08e-40)|all cancers(56;4.51e-35)|BRCA - Breast invasive adenocarcinoma(115;0.0323)|Colorectal(110;0.055)															---	---	---	---
CPSF1	29894	broad.mit.edu	37	8	145619218	145619218	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145619218G>A	uc003zcj.2	-	35	3970	c.3895C>T	c.(3895-3897)CGG>TGG	p.R1299W		NM_013291	NP_037423	Q10570	CPSF1_HUMAN	cleavage and polyadenylation specific factor 1,	1299					mRNA cleavage|mRNA export from nucleus|mRNA polyadenylation|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	mRNA cleavage and polyadenylation specificity factor complex	mRNA 3'-UTR binding|protein binding			skin(1)	1	all_cancers(97;6.64e-12)|all_epithelial(106;2.89e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;2.88e-41)|Epithelial(56;1.67e-40)|all cancers(56;1.2e-35)|BRCA - Breast invasive adenocarcinoma(115;0.0323)|Colorectal(110;0.055)															---	---	---	---
MFSD3	113655	broad.mit.edu	37	8	145736269	145736269	+	Missense_Mutation	SNP	G	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145736269G>C	uc003zdi.1	+	4	1213	c.1048G>C	c.(1048-1050)GCC>CCC	p.A350P		NM_138431	NP_612440	Q96ES6	MFSD3_HUMAN	major facilitator superfamily domain containing	350	Leu-rich.				transmembrane transport	integral to membrane				central_nervous_system(2)	2	all_cancers(97;5.56e-11)|all_epithelial(106;3.54e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.48e-41)|Epithelial(56;1.85e-40)|all cancers(56;3.59e-35)|BRCA - Breast invasive adenocarcinoma(115;0.0483)|Colorectal(110;0.055)															---	---	---	---
DOCK8	81704	broad.mit.edu	37	9	428479	428479	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:428479C>T	uc003zgf.2	+	35	4568	c.4456C>T	c.(4456-4458)CGT>TGT	p.R1486C	DOCK8_uc010mgu.2_Missense_Mutation_p.R788C|DOCK8_uc010mgv.2_Missense_Mutation_p.R1386C|DOCK8_uc003zgk.2_Missense_Mutation_p.R944C	NM_203447	NP_982272	Q8NF50	DOCK8_HUMAN	dedicator of cytokinesis 8	1486	DHR-2.				blood coagulation	cytosol	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(3)|central_nervous_system(3)	6		all_cancers(5;2.13e-17)|all_epithelial(5;2.15e-12)|all_lung(10;6.69e-11)|Lung NSC(10;1.08e-10)|Acute lymphoblastic leukemia(5;0.000242)|all_hematologic(5;0.00317)|Breast(48;0.0151)|Prostate(43;0.128)		all cancers(5;9.3e-07)|GBM - Glioblastoma multiforme(5;2.41e-06)|Epithelial(6;0.00557)|Lung(218;0.00942)														---	---	---	---
KANK1	23189	broad.mit.edu	37	9	676999	676999	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:676999C>T	uc003zgl.1	+	6	676	c.27C>T	c.(25-27)GGC>GGT	p.G9G	KANK1_uc003zgm.2_Silent_p.G9G|KANK1_uc003zgn.1_Silent_p.G9G|KANK1_uc003zgo.1_Silent_p.G9G|KANK1_uc003zgp.1_Silent_p.G9G	NM_015158	NP_055973	Q14678	KANK1_HUMAN	KN motif and ankyrin repeat domains 1 isoform a	9					negative regulation of actin filament polymerization	cytoplasm				ovary(2)|central_nervous_system(1)|pancreas(1)	4		Lung NSC(10;9.84e-12)|all_lung(10;1.02e-11)|Breast(48;0.128)		Epithelial(6;0.000153)|OV - Ovarian serous cystadenocarcinoma(1;0.000358)|Lung(218;0.0222)														---	---	---	---
KANK1	23189	broad.mit.edu	37	9	712829	712829	+	Missense_Mutation	SNP	C	T	T	rs146648084	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:712829C>T	uc003zgl.1	+	7	2712	c.2063C>T	c.(2062-2064)ACG>ATG	p.T688M	KANK1_uc003zgm.2_Missense_Mutation_p.T688M|KANK1_uc003zgn.1_Missense_Mutation_p.T688M|KANK1_uc003zgo.1_Missense_Mutation_p.T688M|KANK1_uc003zgp.1_Missense_Mutation_p.T688M|KANK1_uc003zgq.2_Missense_Mutation_p.T530M|KANK1_uc003zgr.1_Missense_Mutation_p.T530M|KANK1_uc003zgs.1_Missense_Mutation_p.T530M	NM_015158	NP_055973	Q14678	KANK1_HUMAN	KN motif and ankyrin repeat domains 1 isoform a	688					negative regulation of actin filament polymerization	cytoplasm				ovary(2)|central_nervous_system(1)|pancreas(1)	4		Lung NSC(10;9.84e-12)|all_lung(10;1.02e-11)|Breast(48;0.128)		Epithelial(6;0.000153)|OV - Ovarian serous cystadenocarcinoma(1;0.000358)|Lung(218;0.0222)														---	---	---	---
TTC39B	158219	broad.mit.edu	37	9	15214126	15214126	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:15214126A>G	uc003zlr.1	-						TTC39B_uc003zlq.1_Intron|TTC39B_uc011lmp.1_Intron|TTC39B_uc010mie.1_Intron|TTC39B_uc011lmq.1_Intron|TTC39B_uc011lmr.1_Intron|TTC39B_uc010mif.1_Intron|TTC39B_uc003zls.1_Intron|TTC39B_uc010mig.1_Intron|TTC39B_uc011lms.1_Intron	NM_152574	NP_689787			tetratricopeptide repeat domain 39B								binding			ovary(1)	1																		---	---	---	---
ADAMTSL1	92949	broad.mit.edu	37	9	18706941	18706941	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:18706941A>G	uc003zne.3	+	14	1898	c.1771A>G	c.(1771-1773)AAC>GAC	p.N591D		NM_001040272	NP_001035362	Q8N6G6	ATL1_HUMAN	ADAMTS-like 1 isoform 4 precursor	591						proteinaceous extracellular matrix	metallopeptidase activity|zinc ion binding			ovary(3)|upper_aerodigestive_tract(1)|lung(1)	5				GBM - Glioblastoma multiforme(50;1.29e-17)														---	---	---	---
C9orf82	79886	broad.mit.edu	37	9	26842535	26842535	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:26842535C>T	uc003zqc.2	-	6	862	c.850G>A	c.(850-852)GTC>ATC	p.V284I	C9orf82_uc003zqb.2_Missense_Mutation_p.V139I	NM_024828	NP_079104	Q9H8G2	CI082_HUMAN	hypothetical protein LOC79886	284	Potential.										0		all_neural(3;3.53e-10)|Glioma(3;2.71e-09)		Lung(42;1.39e-05)|LUSC - Lung squamous cell carcinoma(38;0.000114)														---	---	---	---
PLAA	9373	broad.mit.edu	37	9	26919401	26919401	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:26919401T>C	uc003zqd.2	-	9	1749	c.1324A>G	c.(1324-1326)ATG>GTG	p.M442V	PLAA_uc003zqe.2_Missense_Mutation_p.M442V	NM_001031689	NP_001026859	Q9Y263	PLAP_HUMAN	phospholipase A2-activating protein	442	PFU.				phospholipid metabolic process|signal transduction		phospholipase A2 activator activity				0		all_neural(3;3.53e-10)|Glioma(3;2.71e-09)		Lung(218;1.32e-05)|LUSC - Lung squamous cell carcinoma(38;0.00011)														---	---	---	---
ACO1	48	broad.mit.edu	37	9	32418455	32418455	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:32418455G>A	uc003zqw.3	+	6	759	c.604G>A	c.(604-606)GTG>ATG	p.V202M	ACO1_uc010mjh.1_Missense_Mutation_p.V36M|ACO1_uc003zqx.3_Missense_Mutation_p.V202M|ACO1_uc003zqy.3_RNA	NM_002197	NP_002188	P21399	ACOC_HUMAN	aconitase 1	202					citrate metabolic process|response to iron(II) ion|tricarboxylic acid cycle	cytosol|endoplasmic reticulum|Golgi apparatus	4 iron, 4 sulfur cluster binding|aconitate hydratase activity|citrate hydro-lyase (cis-aconitate-forming) activity|iron-responsive element binding|isocitrate hydro-lyase (cis-aconitate-forming) activity|metal ion binding|protein binding				0			LUSC - Lung squamous cell carcinoma(29;0.00813)	GBM - Glioblastoma multiforme(74;3.94e-06)														---	---	---	---
BAG1	573	broad.mit.edu	37	9	33256914	33256914	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33256914G>A	uc003zsj.2	-						SUGT1P1_uc010mjq.1_Intron|BAG1_uc003zsi.2_Intron|BAG1_uc003zsk.2_Intron	NM_004323	NP_004314			BCL2-associated athanogene isoform 1L						anti-apoptosis|apoptosis|cell surface receptor linked signaling pathway|chaperone cofactor-dependent protein refolding	cytoplasm|intermediate filament cytoskeleton|nucleus	protein binding|receptor signaling protein activity			ovary(1)	1			LUSC - Lung squamous cell carcinoma(29;0.00506)															---	---	---	---
AQP7	364	broad.mit.edu	37	9	33386192	33386192	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33386192C>T	uc003zst.2	-	6	580	c.408G>A	c.(406-408)ACG>ACA	p.T136T	SUGT1P1_uc010mjq.1_Intron|AQP7_uc003zsu.1_Silent_p.T79T|AQP7_uc010mjs.2_Silent_p.T44T|AQP7_uc010mjt.2_Silent_p.T44T|AQP7_uc011lnx.1_Silent_p.T136T|AQP7_uc011lny.1_Silent_p.T135T|AQP7_uc003zss.3_Silent_p.T44T|AQP7_uc011lnz.1_Silent_p.T44T|AQP7_uc011loa.1_Intron	NM_001170	NP_001161	O14520	AQP7_HUMAN	aquaporin 7	136	Extracellular (Potential).				excretion|generation of precursor metabolites and energy	cell-cell junction|cytoplasm|integral to plasma membrane	glycerol channel activity|water channel activity				0			LUSC - Lung squamous cell carcinoma(29;0.00788)	GBM - Glioblastoma multiforme(74;0.191)														---	---	---	---
KIF24	347240	broad.mit.edu	37	9	34271901	34271901	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:34271901T>C	uc003zua.3	-	7	1363	c.1243A>G	c.(1243-1245)AGC>GGC	p.S415G	KIF24_uc010mkb.2_Missense_Mutation_p.S446G	NM_194313	NP_919289	Q5T7B8	KIF24_HUMAN	kinesin family member 24	415	Kinesin-motor.				microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity			central_nervous_system(1)	1			LUSC - Lung squamous cell carcinoma(29;0.0107)															---	---	---	---
NUDT2	318	broad.mit.edu	37	9	34339041	34339041	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:34339041G>A	uc003zub.2	+	4	362	c.4G>A	c.(4-6)GCC>ACC	p.A2T	NUDT2_uc003zuc.2_Missense_Mutation_p.A2T|NUDT2_uc003zud.2_Missense_Mutation_p.A2T	NM_001161	NP_001152	P50583	AP4A_HUMAN	nudix-type motif 2	2	Nudix hydrolase.				induction of apoptosis|nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity|bis(5'-nucleosyl)-tetraphosphatase (symmetrical) activity|GTP binding				0			LUSC - Lung squamous cell carcinoma(29;0.0107)	GBM - Glioblastoma multiforme(74;0.126)														---	---	---	---
STOML2	30968	broad.mit.edu	37	9	35101481	35101481	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35101481C>T	uc003zwi.2	-	6	584	c.521G>A	c.(520-522)CGT>CAT	p.R174H	STOML2_uc003zwh.2_Missense_Mutation_p.R65H|STOML2_uc003zwj.2_Missense_Mutation_p.R65H|STOML2_uc011lou.1_Intron|STOML2_uc003zwk.2_Missense_Mutation_p.R123H	NM_013442	NP_038470	Q9UJZ1	STML2_HUMAN	stomatin (EPB72)-like 2	174						cytoskeleton	receptor binding				0			LUSC - Lung squamous cell carcinoma(32;0.00343)|Lung(28;0.00778)															---	---	---	---
TESK1	7016	broad.mit.edu	37	9	35609590	35609590	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35609590T>G	uc003zxa.2	+	10	2068	c.1732T>G	c.(1732-1734)TTT>GTT	p.F578V	TESK1_uc003zwz.1_RNA|TESK1_uc010mks.2_Missense_Mutation_p.F418V	NM_006285	NP_006276	Q15569	TESK1_HUMAN	testis-specific protein kinase 1	578					cell junction assembly|spermatogenesis	cytosol	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			stomach(2)|breast(2)|lung(1)|ovary(1)|skin(1)	7			Lung(28;0.00276)|LUSC - Lung squamous cell carcinoma(32;0.00418)|STAD - Stomach adenocarcinoma(86;0.194)															---	---	---	---
SPAG8	26206	broad.mit.edu	37	9	35810888	35810888	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35810888G>A	uc003zye.2	-	3	1146	c.1031C>T	c.(1030-1032)CCA>CTA	p.P344L	SPAG8_uc003zyf.2_Missense_Mutation_p.P261L|SPAG8_uc003zyg.2_Missense_Mutation_p.P344L	NM_172312	NP_758516	Q99932	SPAG8_HUMAN	sperm associated antigen 8 isoform 2	344						acrosomal vesicle|membrane				ovary(1)	1	all_epithelial(49;0.161)		LUSC - Lung squamous cell carcinoma(32;0.00521)|Lung(28;0.00697)|STAD - Stomach adenocarcinoma(86;0.194)															---	---	---	---
CLTA	1211	broad.mit.edu	37	9	36209304	36209304	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:36209304G>A	uc003zzc.2	+	5	688	c.526G>A	c.(526-528)GTG>ATG	p.V176M	CLTA_uc003zzd.2_Missense_Mutation_p.V176M|CLTA_uc003zze.2_Intron|CLTA_uc011lpk.1_Intron|CLTA_uc003zzf.1_Intron	NM_007096	NP_009027	P09496	CLCA_HUMAN	clathrin, light polypeptide A isoform b	176					axon guidance|epidermal growth factor receptor signaling pathway|intracellular protein transport|negative regulation of epidermal growth factor receptor signaling pathway|nerve growth factor receptor signaling pathway|post-Golgi vesicle-mediated transport	clathrin coat of coated pit|clathrin coat of trans-Golgi network vesicle|cytosol	structural molecule activity			central_nervous_system(1)	1			STAD - Stomach adenocarcinoma(86;0.228)															---	---	---	---
ALDH1B1	219	broad.mit.edu	37	9	38396879	38396879	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:38396879G>T	uc004aay.2	+	2	1246	c.1134G>T	c.(1132-1134)CAG>CAT	p.Q378H		NM_000692	NP_000683	P30837	AL1B1_HUMAN	aldehyde dehydrogenase 1B1 precursor	378					carbohydrate metabolic process	mitochondrial matrix|nucleus	aldehyde dehydrogenase (NAD) activity			skin(1)	1				GBM - Glioblastoma multiforme(29;0.043)|Lung(182;0.115)	NADH(DB00157)													---	---	---	---
PGM5	5239	broad.mit.edu	37	9	70993145	70993145	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:70993145A>G	uc004agr.2	+	2	521	c.292A>G	c.(292-294)ATC>GTC	p.I98V		NM_021965	NP_068800	Q15124	PGM5_HUMAN	phosphoglucomutase 5	98					cell adhesion|cellular calcium ion homeostasis|glucose metabolic process	costamere|dystrophin-associated glycoprotein complex|focal adhesion|intercalated disc|internal side of plasma membrane|sarcolemma|spot adherens junction|stress fiber|Z disc	intramolecular transferase activity, phosphotransferases|magnesium ion binding|structural molecule activity			ovary(1)|pancreas(1)	2																		---	---	---	---
FAM189A2	9413	broad.mit.edu	37	9	72003185	72003185	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:72003185G>A	uc010mon.1	+	10	1072	c.968G>A	c.(967-969)CGG>CAG	p.R323Q	FAM189A2_uc004ahg.2_Missense_Mutation_p.R323Q|FAM189A2_uc010moo.1_Intron	NM_001127608	NP_001121080	Q15884	F1892_HUMAN	chromosome 9 open reading frame 61 precursor	323						integral to membrane					0																		---	---	---	---
MAMDC2	256691	broad.mit.edu	37	9	72727953	72727953	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:72727953G>A	uc004ahm.2	+	5	1165	c.548G>A	c.(547-549)CGC>CAC	p.R183H	MAMDC2_uc004ahn.2_RNA	NM_153267	NP_694999	Q7Z304	MAMC2_HUMAN	MAM domain containing 2 precursor	183	MAM 2.					endoplasmic reticulum|membrane				central_nervous_system(1)|pancreas(1)	2																		---	---	---	---
TRPM3	80036	broad.mit.edu	37	9	73152286	73152286	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:73152286T>C	uc004aid.2	-	25	3951	c.3707A>G	c.(3706-3708)AAC>AGC	p.N1236S	TRPM3_uc004ahu.2_Missense_Mutation_p.N1078S|TRPM3_uc004ahv.2_Missense_Mutation_p.N1038S|TRPM3_uc004ahw.2_Missense_Mutation_p.N1108S|TRPM3_uc004ahx.2_Missense_Mutation_p.N1095S|TRPM3_uc004ahy.2_Missense_Mutation_p.N1098S|TRPM3_uc004ahz.2_Missense_Mutation_p.N1085S|TRPM3_uc004aia.2_Missense_Mutation_p.N1083S|TRPM3_uc004aib.2_Missense_Mutation_p.N1073S|TRPM3_uc004aic.2_Missense_Mutation_p.N1236S	NM_001007471	NP_001007472	Q9HCF6	TRPM3_HUMAN	transient receptor potential cation channel,	1261	Cytoplasmic (Potential).|Potential.					integral to membrane	calcium channel activity			ovary(3)|pancreas(2)|central_nervous_system(2)|skin(2)	9																		---	---	---	---
TRPM3	80036	broad.mit.edu	37	9	73213485	73213485	+	Silent	SNP	G	A	A	rs145029936		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:73213485G>A	uc004aid.2	-	20	3106	c.2862C>T	c.(2860-2862)GTC>GTT	p.V954V	TRPM3_uc004ahu.2_Silent_p.V784V|TRPM3_uc004ahv.2_Silent_p.V756V|TRPM3_uc004ahw.2_Silent_p.V826V|TRPM3_uc004ahx.2_Silent_p.V813V|TRPM3_uc004ahy.2_Silent_p.V816V|TRPM3_uc004ahz.2_Silent_p.V803V|TRPM3_uc004aia.2_Silent_p.V801V|TRPM3_uc004aib.2_Silent_p.V791V|TRPM3_uc004aic.2_Silent_p.V954V	NM_001007471	NP_001007472	Q9HCF6	TRPM3_HUMAN	transient receptor potential cation channel,	979	Helical; (Potential).					integral to membrane	calcium channel activity			ovary(3)|pancreas(2)|central_nervous_system(2)|skin(2)	9																		---	---	---	---
PCSK5	5125	broad.mit.edu	37	9	78773924	78773924	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:78773924C>T	uc004ajz.2	+	12	1994	c.1456C>T	c.(1456-1458)CGC>TGC	p.R486C	PCSK5_uc004ajy.2_Missense_Mutation_p.R486C|PCSK5_uc004aka.2_RNA	NM_006200	NP_006191	Q92824	PCSK5_HUMAN	proprotein convertase subtilisin/kexin type 5	486	Homo B/P.				anterior/posterior pattern formation|cell-cell signaling|cytokine biosynthetic process|embryo implantation|embryonic digestive tract development|embryonic skeletal system development|heart development|kidney development|limb morphogenesis|nerve growth factor processing|nerve growth factor receptor signaling pathway|peptide biosynthetic process|renin secretion into blood stream|respiratory tube development|signal peptide processing|viral assembly, maturation, egress, and release	extracellular space|Golgi lumen|stored secretory granule	peptide binding|serine-type endopeptidase activity			ovary(2)|skin(1)	3																		---	---	---	---
FOXB2	442425	broad.mit.edu	37	9	79635540	79635540	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:79635540G>T	uc004ako.1	+	1	970	c.970G>T	c.(970-972)GCC>TCC	p.A324S		NM_001013735	NP_001013757	Q5VYV0	FOXB2_HUMAN	forkhead box B2	324	Poly-Ala.				brain development|embryo development|pattern specification process|regulation of sequence-specific DNA binding transcription factor activity|tissue development	transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding				0																		---	---	---	---
C9orf170	401535	broad.mit.edu	37	9	89763701	89763701	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:89763701G>T	uc004apa.1	+	1	143	c.56G>T	c.(55-57)GGG>GTG	p.G19V		NM_001001709	NP_001001709	A2RU37	CI170_HUMAN	hypothetical protein LOC401535	19											0																		---	---	---	---
ROR2	4920	broad.mit.edu	37	9	94486805	94486805	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:94486805G>A	uc004arj.1	-	9	2170	c.1971C>T	c.(1969-1971)CGC>CGT	p.R657R	ROR2_uc004ari.1_Silent_p.R517R	NM_004560	NP_004551	Q01974	ROR2_HUMAN	receptor tyrosine kinase-like orphan receptor 2	657	Cytoplasmic (Potential).|Protein kinase.				negative regulation of cell proliferation|positive regulation of cell migration|transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|transmembrane receptor protein tyrosine kinase activity|Wnt-protein binding			lung(8)|central_nervous_system(5)|ovary(3)|large_intestine(2)|stomach(1)|breast(1)	20																		---	---	---	---
IARS	3376	broad.mit.edu	37	9	94984874	94984874	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:94984874A>G	uc004art.1	-	33	3891	c.3634T>C	c.(3634-3636)TAT>CAT	p.Y1212H	IARS_uc004ars.1_Missense_Mutation_p.Y1005H|IARS_uc004aru.3_Missense_Mutation_p.Y1212H|IARS_uc010mqr.2_Missense_Mutation_p.Y1102H|IARS_uc010mqt.2_Missense_Mutation_p.Y435H	NM_013417	NP_038203	P41252	SYIC_HUMAN	isoleucine tRNA synthetase	1212					isoleucyl-tRNA aminoacylation	cytosol|nucleus|soluble fraction	ATP binding|isoleucine-tRNA ligase activity|protein binding			ovary(1)|skin(1)	2					L-Isoleucine(DB00167)													---	---	---	---
NOL8	55035	broad.mit.edu	37	9	95076606	95076606	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95076606C>T	uc004arv.2	-	7	2638	c.2301G>A	c.(2299-2301)GCG>GCA	p.A767A	NOL8_uc010mqw.2_RNA|NOL8_uc004arw.2_Intron|NOL8_uc011ltw.1_Silent_p.A699A	NM_017948	NP_060418	Q76FK4	NOL8_HUMAN	nucleolar protein 8	767	Potential.				DNA replication|positive regulation of cell growth	nucleolus	nucleotide binding|protein binding|RNA binding			ovary(1)	1																		---	---	---	---
BICD2	23299	broad.mit.edu	37	9	95480885	95480885	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95480885G>A	uc004aso.1	-	5	2099	c.2042C>T	c.(2041-2043)TCG>TTG	p.S681L	BICD2_uc004asp.1_Missense_Mutation_p.S681L	NM_015250	NP_056065	Q8TD16	BICD2_HUMAN	bicaudal D homolog 2 isoform 2	681	Interacts with RAB6A (By similarity).|Potential.				microtubule anchoring at microtubule organizing center|minus-end-directed organelle transport along microtubule	cytoplasmic vesicle|cytoskeleton|Golgi apparatus|plasma membrane	Rab GTPase binding			skin(1)	1																		---	---	---	---
ZNF484	83744	broad.mit.edu	37	9	95610073	95610073	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:95610073G>A	uc004asu.1	-	5	1145	c.996C>T	c.(994-996)GAC>GAT	p.D332D	ANKRD19_uc004asr.3_Intron|ZNF484_uc011lub.1_Silent_p.D334D|ZNF484_uc010mrb.1_Silent_p.D296D|ZNF484_uc004asv.1_Silent_p.D296D	NM_031486	NP_113674	Q5JVG2	ZN484_HUMAN	zinc finger protein 484 isoform a	332	C2H2-type 3; degenerate.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
FAM120A	23196	broad.mit.edu	37	9	96278468	96278468	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96278468C>T	uc004atw.2	+	7	1360	c.1335C>T	c.(1333-1335)CCC>CCT	p.P445P	FAM120A_uc004atv.2_Silent_p.P445P|FAM120A_uc004atx.2_Silent_p.P227P|FAM120A_uc004aty.2_Silent_p.P226P|FAM120A_uc004atz.2_Silent_p.P94P|FAM120A_uc010mrf.1_RNA	NM_014612	NP_055427	Q9NZB2	F120A_HUMAN	oxidative stress-associated Src activator	445						cytoplasm|plasma membrane	RNA binding				0																		---	---	---	---
PTPDC1	138639	broad.mit.edu	37	9	96859910	96859910	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96859910G>A	uc004auf.1	+	7	1240	c.900G>A	c.(898-900)GCG>GCA	p.A300A	PTPDC1_uc004aug.1_Silent_p.A300A|PTPDC1_uc004auh.1_Silent_p.A352A|PTPDC1_uc010mrj.1_Silent_p.A354A|PTPDC1_uc010mri.1_Silent_p.A352A	NM_177995	NP_818931	A2A3K4	PTPC1_HUMAN	protein tyrosine phosphatase domain containing 1	300							protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			ovary(1)	1																		---	---	---	---
C9orf102	375748	broad.mit.edu	37	9	98678714	98678714	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:98678714C>T	uc004avt.3	+	6	1577	c.1189C>T	c.(1189-1191)CGG>TGG	p.R397W	C9orf102_uc010mrx.1_RNA|C9orf102_uc011lum.1_Missense_Mutation_p.R99W|C9orf102_uc010mry.1_Missense_Mutation_p.R99W|C9orf102_uc010mrz.2_Missense_Mutation_p.R208W	NM_001010895	NP_001010895	Q5T890	RAD26_HUMAN	RAD26L hypothetical protein	397					DNA repair	nucleus	ATP binding|ATP-dependent helicase activity|DNA binding				0		Acute lymphoblastic leukemia(62;0.0559)																---	---	---	---
KIAA1529	57653	broad.mit.edu	37	9	100088885	100088885	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:100088885G>T	uc011lut.1	+	27	2917	c.2144G>T	c.(2143-2145)AGT>ATT	p.S715I	KIAA1529_uc004axe.1_Missense_Mutation_p.S715I|KIAA1529_uc004axg.1_Missense_Mutation_p.S576I|KIAA1529_uc011lus.1_Missense_Mutation_p.S533I|KIAA1529_uc010msm.1_RNA|KIAA1529_uc004axf.2_Missense_Mutation_p.S576I|KIAA1529_uc011luv.1_Missense_Mutation_p.S573I	NM_020893	NP_065944			hypothetical protein LOC57653											ovary(4)|large_intestine(2)|skin(1)	7		Acute lymphoblastic leukemia(62;0.154)																---	---	---	---
NCBP1	4686	broad.mit.edu	37	9	100433358	100433358	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:100433358G>A	uc004axq.2	+							NM_002486	NP_002477			nuclear cap binding protein subunit 1, 80kDa						gene silencing by RNA|histone mRNA metabolic process|mRNA 3'-end processing|mRNA capping|mRNA cleavage|mRNA export from nucleus|ncRNA metabolic process|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|positive regulation of mRNA 3'-end processing|positive regulation of viral transcription|regulation of translational initiation|spliceosomal snRNP assembly|termination of RNA polymerase II transcription|transcription elongation from RNA polymerase II promoter|viral reproduction	cytosol|mRNA cap binding complex|nucleoplasm|ribonucleoprotein complex	protein binding|RNA cap binding			central_nervous_system(1)	1		Acute lymphoblastic leukemia(62;0.158)																---	---	---	---
TRIM14	9830	broad.mit.edu	37	9	100849874	100849874	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:100849874C>T	uc004ayd.2	-	6	1225	c.1207G>A	c.(1207-1209)GCC>ACC	p.A403T	TRIM14_uc004ayf.1_Missense_Mutation_p.A310T|TRIM14_uc011luz.1_Missense_Mutation_p.A181T|TRIM14_uc011lva.1_Missense_Mutation_p.A184T|TRIM14_uc004ayg.1_Missense_Mutation_p.A403T|TRIM14_uc004ayh.1_Missense_Mutation_p.A403T|TRIM14_uc004ayi.1_Intron|TRIM14_uc004ayj.1_Missense_Mutation_p.A310T	NM_033220	NP_150089	Q14142	TRI14_HUMAN	tripartite motif protein TRIM14 isoform alpha	403	B30.2/SPRY.			RLRPRDDLDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRATF QEPLYPALRLWEGAISIPRLP -> ACGPATTSTGSASSWT TRPASSPSTT (in Ref. 2; BAA09478).		cytoplasm|intracellular	zinc ion binding			central_nervous_system(1)	1		Acute lymphoblastic leukemia(62;0.0559)																---	---	---	---
GABBR2	9568	broad.mit.edu	37	9	101216327	101216327	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:101216327G>A	uc004ays.2	-	7	1328	c.1172C>T	c.(1171-1173)ACG>ATG	p.T391M		NM_005458	NP_005449	O75899	GABR2_HUMAN	G protein-coupled receptor 51 precursor	391	Extracellular (Potential).				negative regulation of adenylate cyclase activity|synaptic transmission	cell junction|integral to plasma membrane|postsynaptic membrane	G-protein coupled receptor activity|GABA-B receptor activity			ovary(2)|skin(2)	4		Acute lymphoblastic leukemia(62;0.0527)			Baclofen(DB00181)													---	---	---	---
ACTL7B	10880	broad.mit.edu	37	9	111617761	111617761	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:111617761G>A	uc004bdi.2	-	1	515	c.450C>T	c.(448-450)TCC>TCT	p.S150S		NM_006686	NP_006677	Q9Y614	ACL7B_HUMAN	actin-like 7B	150						actin cytoskeleton|cytoplasm	structural constituent of cytoskeleton			pancreas(1)	1																		---	---	---	---
PTPN3	5774	broad.mit.edu	37	9	112143955	112143955	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:112143955G>A	uc004bed.2	-	25	2753	c.2641C>T	c.(2641-2643)CGC>TGC	p.R881C	PTPN3_uc004beb.2_Missense_Mutation_p.R750C|PTPN3_uc004bec.2_Missense_Mutation_p.R705C|PTPN3_uc010mtu.2_RNA|PTPN3_uc011lwg.1_Missense_Mutation_p.R836C|PTPN3_uc011lwh.1_Missense_Mutation_p.R727C|PTPN3_uc011lwd.1_Missense_Mutation_p.R349C|PTPN3_uc011lwe.1_Missense_Mutation_p.R594C|PTPN3_uc011lwf.1_Missense_Mutation_p.R549C	NM_002829	NP_002820	P26045	PTN3_HUMAN	protein tyrosine phosphatase, non-receptor type	881	Tyrosine-protein phosphatase.				negative regulation of membrane protein ectodomain proteolysis|negative regulation of mitotic cell cycle	cytoplasm|cytoskeleton|internal side of plasma membrane	ATPase binding|cytoskeletal protein binding|phosphotyrosine binding|protein tyrosine phosphatase activity			ovary(3)	3																		---	---	---	---
LPAR1	1902	broad.mit.edu	37	9	113704261	113704261	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:113704261C>T	uc004bfa.2	-	4	488	c.233G>A	c.(232-234)CGC>CAC	p.R78H	LPAR1_uc011lwm.1_Missense_Mutation_p.R79H|LPAR1_uc004bfb.2_Missense_Mutation_p.R78H|LPAR1_uc004bfc.2_Missense_Mutation_p.R78H|LPAR1_uc011lwn.1_Missense_Mutation_p.R60H|LPAR1_uc011lwo.1_Missense_Mutation_p.R79H|LPAR1_uc010mub.2_Missense_Mutation_p.R78H	NM_057159	NP_476500	Q92633	LPAR1_HUMAN	lysophosphatidic acid receptor 1	78	Cytoplasmic (Potential).				positive regulation of I-kappaB kinase/NF-kappaB cascade	cell surface|integral to plasma membrane				ovary(2)	2																		---	---	---	---
KIAA1958	158405	broad.mit.edu	37	9	115421658	115421658	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:115421658G>A	uc004bgf.1	+	4	1635	c.1460G>A	c.(1459-1461)CGC>CAC	p.R487H	KIAA1958_uc011lwx.1_Missense_Mutation_p.R515H	NM_133465	NP_597722	Q8N8K9	K1958_HUMAN	hypothetical protein LOC158405	487										skin(1)	1																		---	---	---	---
PHF19	26147	broad.mit.edu	37	9	123620372	123620372	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:123620372G>T	uc004bks.1	-	15	1846	c.1593C>A	c.(1591-1593)TCC>TCA	p.S531S	PHF19_uc011lyf.1_Silent_p.S322S|PHF19_uc004bkr.2_RNA	NM_015651	NP_056466	Q5T6S3	PHF19_HUMAN	PHD finger protein 19 isoform a	531					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	nucleic acid binding|zinc ion binding			ovary(1)|breast(1)	2																		---	---	---	---
GSN	2934	broad.mit.edu	37	9	124081159	124081159	+	Splice_Site	SNP	G	A	A	rs113048496		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:124081159G>A	uc004blf.1	+	9	1405	c.1344_splice	c.e9+1	p.Q448_splice	GSN_uc004bld.1_Splice_Site_p.Q397_splice|GSN_uc010mvq.1_Splice_Site_p.Q408_splice|GSN_uc010mvr.1_Splice_Site_p.Q408_splice|GSN_uc010mvu.1_Splice_Site_p.Q397_splice|GSN_uc010mvt.1_Splice_Site_p.Q397_splice|GSN_uc010mvs.1_Splice_Site_p.Q397_splice|GSN_uc004ble.1_Splice_Site_p.Q397_splice|GSN_uc010mvv.1_Splice_Site_p.Q397_splice|GSN_uc011lyh.1_Splice_Site_p.Q414_splice|GSN_uc011lyi.1_Splice_Site_p.Q397_splice|GSN_uc011lyj.1_Splice_Site_p.Q421_splice|GSN_uc004blg.1_Splice_Site_p.Q179_splice	NM_000177	NP_000168			gelsolin isoform a precursor						actin filament polymerization|actin filament severing|barbed-end actin filament capping|cellular component disassembly involved in apoptosis|cilium morphogenesis	actin cytoskeleton|cytosol	actin binding|calcium ion binding|protein binding			breast(2)|ovary(1)	3																		---	---	---	---
CRB2	286204	broad.mit.edu	37	9	126132397	126132397	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:126132397T>C	uc004bnx.1	+	7	1157	c.1065T>C	c.(1063-1065)TGT>TGC	p.C355C	CRB2_uc004bnw.1_Silent_p.C355C	NM_173689	NP_775960	Q5IJ48	CRUM2_HUMAN	crumbs homolog 2 precursor	355	Extracellular (Potential).|EGF-like 7; calcium-binding (Potential).					extracellular region|integral to membrane|plasma membrane	calcium ion binding			ovary(1)	1																		---	---	---	---
ANGPTL2	23452	broad.mit.edu	37	9	129870316	129870316	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:129870316C>T	uc004bqr.1	-	2	1195	c.695G>A	c.(694-696)CGC>CAC	p.R232H	RALGPS1_uc004bqo.1_Intron|RALGPS1_uc011mab.1_Intron|RALGPS1_uc011mac.1_Intron|RALGPS1_uc004bqq.3_Intron|ANGPTL2_uc010mxg.1_Intron	NM_012098	NP_036230	Q9UKU9	ANGL2_HUMAN	angiopoietin-like 2 precursor	232					multicellular organismal development|signal transduction	extracellular space	receptor binding				0																		---	---	---	---
STXBP1	6812	broad.mit.edu	37	9	130416038	130416038	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130416038C>T	uc004brl.2	+	3	329	c.132C>T	c.(130-132)TGC>TGT	p.C44C	STXBP1_uc004brk.2_Silent_p.C44C	NM_001032221	NP_001027392	P61764	STXB1_HUMAN	syntaxin binding protein 1 isoform b	44					axon target recognition|energy reserve metabolic process|glutamate secretion|negative regulation of synaptic transmission, GABAergic|neurotransmitter secretion|platelet aggregation|platelet degranulation|protein transport|regulation of insulin secretion|regulation of synaptic vesicle priming|synaptic vesicle maturation|vesicle docking involved in exocytosis	cytosol|mitochondrion|plasma membrane|platelet alpha granule|protein complex	identical protein binding|syntaxin-1 binding|syntaxin-2 binding			skin(1)	1																		---	---	---	---
C9orf119	375757	broad.mit.edu	37	9	131050962	131050962	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131050962G>A	uc004bup.2	+	5	675	c.675G>A	c.(673-675)TTG>TTA	p.L225L		NM_001040011	NP_001035100	Q1ZZU3	SWI5_HUMAN	hypothetical protein LOC375757	225					double-strand break repair via homologous recombination	Swi5-Sfr1 complex	protein binding				0																		---	---	---	---
ODF2	4957	broad.mit.edu	37	9	131254775	131254775	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131254775T>C	uc011mbd.1	+	15	1918	c.1607T>C	c.(1606-1608)GTG>GCG	p.V536A	ODF2_uc011maz.1_Missense_Mutation_p.V536A|ODF2_uc011mbb.1_Missense_Mutation_p.V470A|ODF2_uc011mbc.1_Missense_Mutation_p.V455A|ODF2_uc004bva.2_Missense_Mutation_p.V489A|ODF2_uc004bvb.2_Missense_Mutation_p.V512A|ODF2_uc011mbe.1_Missense_Mutation_p.V531A|ODF2_uc004bvc.2_Missense_Mutation_p.V512A|ODF2_uc011mbf.1_Missense_Mutation_p.V517A|ODF2_uc004bvd.3_Missense_Mutation_p.V536A|ODF2_uc004bve.2_Missense_Mutation_p.V517A	NM_002540	NP_002531	Q5BJF6	ODFP2_HUMAN	outer dense fiber of sperm tails 2 isoform 1	536	Potential.				cell differentiation|G2/M transition of mitotic cell cycle|multicellular organismal development|spermatogenesis	centriole|cilium|cytosol|microtubule|spindle pole	protein binding|structural molecule activity			ovary(1)	1																		---	---	---	---
TBC1D13	54662	broad.mit.edu	37	9	131554861	131554861	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131554861G>A	uc010myj.2	+						TBC1D13_uc010myk.2_Intron|TBC1D13_uc010myl.2_Intron	NM_018201	NP_060671			TBC1 domain family, member 13							intracellular	Rab GTPase activator activity				0																		---	---	---	---
DDX31	64794	broad.mit.edu	37	9	135470282	135470282	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135470282G>A	uc004cbq.1	-	20	2679	c.2527C>T	c.(2527-2529)CGG>TGG	p.R843W	DDX31_uc010mzu.1_Missense_Mutation_p.R770W	NM_022779	NP_073616	Q9H8H2	DDX31_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 31	843						nucleolus	ATP binding|ATP-dependent helicase activity|RNA binding			central_nervous_system(1)	1				OV - Ovarian serous cystadenocarcinoma(145;2.67e-06)|Epithelial(140;7.61e-05)														---	---	---	---
SURF4	6836	broad.mit.edu	37	9	136234223	136234223	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136234223G>A	uc004cdj.2	-	2	277	c.147C>T	c.(145-147)AGC>AGT	p.S49S	SURF4_uc011mda.1_Silent_p.S40S|SURF4_uc010nal.2_Silent_p.S81S|SURF4_uc011mdb.1_Silent_p.S6S|SURF4_uc011mdc.1_Silent_p.S6S|SURF4_uc011mdd.1_Silent_p.S49S	NM_033161	NP_149351	O15260	SURF4_HUMAN	surfeit 4	49						endoplasmic reticulum membrane|ER-Golgi intermediate compartment membrane|Golgi membrane|integral to membrane	protein binding				0				OV - Ovarian serous cystadenocarcinoma(145;5.32e-07)|Epithelial(140;4.56e-06)|all cancers(34;4.25e-05)														---	---	---	---
RXRA	6256	broad.mit.edu	37	9	137293736	137293736	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:137293736C>T	uc004cfb.2	+						RXRA_uc004cfa.1_Silent_p.C146C	NM_002957	NP_002948			retinoid X receptor, alpha						cellular lipid metabolic process|cholesterol metabolic process|interspecies interaction between organisms|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|response to retinoic acid|vitamin metabolic process	nuclear chromatin|nucleoplasm	enzyme binding|ligand-regulated transcription factor activity|protein heterodimerization activity|retinoic acid-responsive element binding|retinoid-X receptor activity|sequence-specific DNA binding transcription factor activity|steroid binding|steroid hormone receptor activity|transcription coactivator activity|vitamin D receptor binding|zinc ion binding			upper_aerodigestive_tract(1)|ovary(1)	2				OV - Ovarian serous cystadenocarcinoma(145;4.66e-08)|Epithelial(140;6.72e-08)|all cancers(34;2.22e-07)	Acitretin(DB00459)|Adapalene(DB00210)|Alitretinoin(DB00523)|Etretinate(DB00926)													---	---	---	---
FCN1	2219	broad.mit.edu	37	9	137806229	137806229	+	Splice_Site	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:137806229A>G	uc004cfi.2	-	4	399	c.307_splice	c.e4+1	p.G103_splice		NM_002003	NP_001994			ficolin 1 precursor						opsonization|signal transduction	collagen|extracellular space	antigen binding|calcium ion binding|receptor binding|sugar binding			large_intestine(1)|ovary(1)	2		Myeloproliferative disorder(178;0.0333)		OV - Ovarian serous cystadenocarcinoma(145;3.46e-08)|Epithelial(140;6.01e-08)|all cancers(34;3.69e-07)														---	---	---	---
FCN1	2219	broad.mit.edu	37	9	137809680	137809680	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:137809680G>T	uc004cfi.2	-	1	130	c.38C>A	c.(37-39)GCT>GAT	p.A13D		NM_002003	NP_001994	O00602	FCN1_HUMAN	ficolin 1 precursor	13					opsonization|signal transduction	collagen|extracellular space	antigen binding|calcium ion binding|receptor binding|sugar binding			large_intestine(1)|ovary(1)	2		Myeloproliferative disorder(178;0.0333)		OV - Ovarian serous cystadenocarcinoma(145;3.46e-08)|Epithelial(140;6.01e-08)|all cancers(34;3.69e-07)														---	---	---	---
OLFM1	10439	broad.mit.edu	37	9	137990338	137990338	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:137990338C>T	uc010nar.2	+	4	979	c.663C>T	c.(661-663)TGC>TGT	p.C221C	OLFM1_uc004cfl.3_Silent_p.C203C	NM_014279	NP_055094	Q99784	NOE1_HUMAN	olfactomedin related ER localized protein	221	Potential.				nervous system development	endoplasmic reticulum lumen	protein binding			ovary(1)|skin(1)	2		Myeloproliferative disorder(178;0.0333)		Epithelial(140;5.49e-08)|OV - Ovarian serous cystadenocarcinoma(145;9.68e-08)|all cancers(34;1.88e-07)														---	---	---	---
GPSM1	26086	broad.mit.edu	37	9	139229058	139229058	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139229058G>A	uc004chd.2	+	2	443	c.223G>A	c.(223-225)GCC>ACC	p.A75T	GPSM1_uc004chc.2_Missense_Mutation_p.A75T	NM_001145638	NP_001139110	Q86YR5	GPSM1_HUMAN	G-protein signaling modulator 1 (AGS3-like, C.	75	TPR 2.|Mediates association with membranes (By similarity).				cell differentiation|nervous system development|signal transduction	cytosol|endoplasmic reticulum membrane|Golgi membrane|plasma membrane	binding|GTPase activator activity				0		Myeloproliferative disorder(178;0.0821)		OV - Ovarian serous cystadenocarcinoma(145;2.39e-06)|Epithelial(140;3.24e-06)														---	---	---	---
MAMDC4	158056	broad.mit.edu	37	9	139748339	139748339	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139748339C>T	uc004cjs.2	+	5	615	c.565C>T	c.(565-567)CGC>TGC	p.R189C	MAMDC4_uc011mej.1_5'UTR	NM_206920	NP_996803	Q6UXC1	AEGP_HUMAN	apical early endosomal glycoprotein precursor	189	Extracellular (Potential).|MAM 1.				protein transport	integral to membrane				breast(4)|upper_aerodigestive_tract(2)|central_nervous_system(1)	7	all_cancers(76;0.0763)|all_epithelial(76;0.198)	Myeloproliferative disorder(178;0.0511)		OV - Ovarian serous cystadenocarcinoma(145;1.52e-05)|Epithelial(140;0.000171)														---	---	---	---
NOXA1	10811	broad.mit.edu	37	9	140328791	140328791	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140328791C>A	uc004cmv.2	+	14	1545	c.1410C>A	c.(1408-1410)TCC>TCA	p.S470S	C9orf167_uc011mew.1_Intron|NOXA1_uc004cmu.2_Silent_p.S477S|NOXA1_uc010nch.2_Silent_p.S421S	NM_006647	NP_006638	Q86UR1	NOXA1_HUMAN	NADPH oxidase activator 1	470			Missing (in NOXA1truncated, a cDNA isolated from Caco-2 cells treated with butyrate).		regulation of hydrogen peroxide metabolic process|regulation of respiratory burst|superoxide metabolic process	cytoplasm|NADPH oxidase complex	Rac GTPase binding|superoxide-generating NADPH oxidase activator activity				0	all_cancers(76;0.0926)			OV - Ovarian serous cystadenocarcinoma(145;0.000238)|Epithelial(140;0.000982)														---	---	---	---
ENTPD8	377841	broad.mit.edu	37	9	140330594	140330594	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140330594A>G	uc004cmw.2	-	7	1105	c.921T>C	c.(919-921)GTT>GTC	p.V307V	C9orf167_uc011mew.1_Intron|ENTPD8_uc004cmx.2_Silent_p.V307V	NM_001033113	NP_001028285	Q5MY95	ENTP8_HUMAN	ectonucleoside triphosphate diphosphohydrolase 8	307	Extracellular (Potential).					integral to membrane|plasma membrane	ATP binding			skin(1)	1	all_cancers(76;0.0926)			OV - Ovarian serous cystadenocarcinoma(145;0.000224)|Epithelial(140;0.000898)														---	---	---	---
EHMT1	79813	broad.mit.edu	37	9	140605490	140605490	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140605490C>T	uc011mfc.1	+						EHMT1_uc004coa.2_Intron|EHMT1_uc004cob.1_Intron	NM_024757	NP_079033			euchromatic histone-lysine N-methyltransferase 1						DNA methylation|embryo development|peptidyl-lysine dimethylation|peptidyl-lysine monomethylation	chromosome|nucleus	histone methyltransferase activity (H3-K27 specific)|histone methyltransferase activity (H3-K9 specific)|p53 binding|zinc ion binding			breast(2)|pancreas(1)	3	all_cancers(76;0.164)			OV - Ovarian serous cystadenocarcinoma(145;0.000183)|Epithelial(140;0.000728)														---	---	---	---
EHMT1	79813	broad.mit.edu	37	9	140729301	140729301	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140729301C>T	uc011mfc.1	+	27	3830	c.3793C>T	c.(3793-3795)CAC>TAC	p.H1265Y	EHMT1_uc004coe.2_Missense_Mutation_p.H170Y	NM_024757	NP_079033	Q9H9B1	EHMT1_HUMAN	euchromatic histone-lysine N-methyltransferase 1	1265					DNA methylation|embryo development|peptidyl-lysine dimethylation|peptidyl-lysine monomethylation	chromosome|nucleus	histone methyltransferase activity (H3-K27 specific)|histone methyltransferase activity (H3-K9 specific)|p53 binding|zinc ion binding			breast(2)|pancreas(1)	3	all_cancers(76;0.164)			OV - Ovarian serous cystadenocarcinoma(145;0.000183)|Epithelial(140;0.000728)														---	---	---	---
ZMYND11	10771	broad.mit.edu	37	10	294978	294978	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:294978C>T	uc010pzt.1	+	14	2064	c.1636C>T	c.(1636-1638)CTG>TTG	p.L546L	ZMYND11_uc001ifk.2_Silent_p.L545L|ZMYND11_uc010pzu.1_Silent_p.L546L|ZMYND11_uc010pzv.1_Silent_p.L491L|ZMYND11_uc010pzw.1_Silent_p.L461L|ZMYND11_uc001ifm.2_Silent_p.L492L|ZMYND11_uc010pzx.1_Silent_p.L546L|ZMYND11_uc001ifn.2_Silent_p.L492L|ZMYND11_uc009xhg.2_Silent_p.L529L|ZMYND11_uc009xhh.2_Silent_p.L420L|ZMYND11_uc010pzy.1_Silent_p.L398L	NM_006624	NP_006615	Q15326	ZMY11_HUMAN	zinc finger, MYND domain containing 11 isoform	506	Interaction with human adenovirus E1A.				cell cycle|cell proliferation|interspecies interaction between organisms|negative regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(4;1.32e-05)|all_lung(4;3.67e-05)|Lung NSC(4;0.000301)|all_epithelial(10;0.000416)|Colorectal(49;0.14)	OV - Ovarian serous cystadenocarcinoma(33;0.132)	Epithelial(11;0.00289)|all cancers(11;0.0108)|Lung(33;0.0689)|OV - Ovarian serous cystadenocarcinoma(14;0.106)														---	---	---	---
AKR1C1	1645	broad.mit.edu	37	10	5008192	5008192	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:5008192T>C	uc001iho.2	+	7	1012	c.171T>C	c.(169-171)AAT>AAC	p.N57N	AKR1E2_uc001ihl.1_Intron|AKR1C2_uc010qan.1_Intron|AKR1C3_uc001ihr.2_Silent_p.N57N|AKR1C1_uc009xhx.2_Silent_p.N57N|AKR1C1_uc001ihq.2_Silent_p.N57N	NM_001353	NP_001344	Q04828	AK1C1_HUMAN	aldo-keto reductase family 1, member C1	57					bile acid and bile salt transport|bile acid metabolic process|cholesterol homeostasis|intestinal cholesterol absorption|protein homooligomerization|response to organophosphorus|xenobiotic metabolic process	cytosol	17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity|aldo-keto reductase (NADP) activity|androsterone dehydrogenase (B-specific) activity|bile acid binding|indanol dehydrogenase activity|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity			ovary(2)	2					NADH(DB00157)													---	---	---	---
ITIH5	80760	broad.mit.edu	37	10	7618675	7618675	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:7618675G>A	uc001ijq.2	-	10	1798	c.1719C>T	c.(1717-1719)ATC>ATT	p.I573I	ITIH5_uc001ijp.2_Silent_p.I359I|ITIH5_uc001ijr.1_Silent_p.I573I	NM_030569	NP_085046	Q86UX2	ITIH5_HUMAN	inter-alpha trypsin inhibitor heavy chain	573					hyaluronan metabolic process	extracellular region	serine-type endopeptidase inhibitor activity			ovary(2)|central_nervous_system(2)	4																		---	---	---	---
HSPA14	51182	broad.mit.edu	37	10	14890639	14890639	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:14890639G>A	uc001inf.2	+	4	394	c.253G>A	c.(253-255)GCG>ACG	p.A85T	HSPA14_uc010qbw.1_Missense_Mutation_p.A85T	NM_016299	NP_057383	Q0VDF9	HSP7E_HUMAN	heat shock 70kDa protein 14 isoform 1	85			A -> V (in a breast cancer sample; somatic mutation).		'de novo' cotranslational protein folding	cytosol	ATP binding|protein binding	p.A85V(2)		ovary(2)|breast(2)|lung(1)	5																		---	---	---	---
CACNB2	783	broad.mit.edu	37	10	18828395	18828395	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:18828395C>A	uc001ipr.2	+	14	1785	c.1725C>A	c.(1723-1725)TCC>TCA	p.S575S	CACNB2_uc009xjz.1_Silent_p.S325S|CACNB2_uc001ips.2_Silent_p.S551S|CACNB2_uc001ipt.2_Silent_p.S537S|CACNB2_uc001ipu.2_Silent_p.S547S|CACNB2_uc001ipv.2_Silent_p.S523S|CACNB2_uc009xka.1_Silent_p.S509S|CACNB2_uc001ipw.2_Silent_p.S482S|CACNB2_uc001ipx.2_Silent_p.S520S|CACNB2_uc001ipz.2_Silent_p.S497S|CACNB2_uc001ipy.2_Silent_p.S521S|CACNB2_uc010qco.1_Silent_p.S489S|CACNB2_uc001iqa.2_Silent_p.S527S|NSUN6_uc001iqb.2_Intron	NM_201596	NP_963890	Q08289	CACB2_HUMAN	calcium channel, voltage-dependent, beta 2	575					axon guidance|neuromuscular junction development	integral to plasma membrane|sarcolemma|voltage-gated calcium channel complex	protein binding|voltage-gated calcium channel activity			large_intestine(1)|central_nervous_system(1)|skin(1)	3					Magnesium Sulfate(DB00653)|Verapamil(DB00661)													---	---	---	---
THNSL1	79896	broad.mit.edu	37	10	25313576	25313576	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:25313576G>A	uc001isi.3	+	3	1753	c.1424G>A	c.(1423-1425)CGA>CAA	p.R475Q	ENKUR_uc001ish.1_Intron	NM_024838	NP_079114	Q8IYQ7	THNS1_HUMAN	threonine synthase-like 1	475					threonine biosynthetic process		ATP binding|pyridoxal phosphate binding|shikimate kinase activity|threonine synthase activity			pancreas(1)	1					L-Threonine(DB00156)|Pyridoxal Phosphate(DB00114)													---	---	---	---
KIAA1462	57608	broad.mit.edu	37	10	30315526	30315526	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:30315526C>T	uc001iux.2	-	2	3610	c.3551G>A	c.(3550-3552)AGC>AAC	p.S1184N	KIAA1462_uc001iuy.2_Intron|KIAA1462_uc001iuz.2_Missense_Mutation_p.S1046N|KIAA1462_uc009xle.1_Missense_Mutation_p.S1184N	NM_020848	NP_065899	Q9P266	K1462_HUMAN	hypothetical protein LOC57608	1184										ovary(4)	4																		---	---	---	---
C10orf68	79741	broad.mit.edu	37	10	33137556	33137556	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:33137556G>A	uc001iwn.3	+	19	2007	c.1534G>A	c.(1534-1536)GTA>ATA	p.V512I	C10orf68_uc001iwl.1_Missense_Mutation_p.V471I|C10orf68_uc001iwm.1_Missense_Mutation_p.V516I|C10orf68_uc010qei.1_Missense_Mutation_p.V488I|C10orf68_uc001iwo.3_RNA	NM_024688	NP_078964	Q9H943	CJ068_HUMAN	chromosome 10 open reading frame 68	512										skin(2)|ovary(1)	3																		---	---	---	---
ZNF33B	7582	broad.mit.edu	37	10	43088863	43088863	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43088863A>G	uc001jaf.1	-	5	1650	c.1535T>C	c.(1534-1536)CTC>CCC	p.L512P	ZNF33B_uc009xmg.1_Intron|ZNF33B_uc001jae.1_Intron|ZNF33B_uc001jag.1_Missense_Mutation_p.L400P|ZNF33B_uc001jad.2_Intron	NM_006955	NP_008886	Q06732	ZN33B_HUMAN	zinc finger protein 33B	512	C2H2-type 7.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0																		---	---	---	---
RET	5979	broad.mit.edu	37	10	43622073	43622073	+	Silent	SNP	C	T	T	rs142859395	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43622073C>T	uc001jal.2	+	19	3280	c.3090C>T	c.(3088-3090)GAC>GAT	p.D1030D	RET_uc001jak.1_Silent_p.D1030D|RET_uc010qez.1_Silent_p.D776D	NM_020975	NP_066124	P07949	RET_HUMAN	ret proto-oncogene isoform a	1030	Cytoplasmic (Potential).				homophilic cell adhesion|positive regulation of metanephric glomerulus development|positive regulation of transcription, DNA-dependent|posterior midgut development	integral to membrane	ATP binding|calcium ion binding|transmembrane receptor protein tyrosine kinase activity			thyroid(404)|adrenal_gland(20)|lung(9)|large_intestine(5)|breast(4)|ovary(4)|central_nervous_system(3)|urinary_tract(1)|NS(1)	451		Ovarian(717;0.0423)			Sunitinib(DB01268)		1	T|Mis|N|F	H4|PRKAR1A|NCOA4|PCM1|GOLGA5|TRIM33|KTN1|TRIM27|HOOK3	medullary thyroid| papillary thyroid|pheochromocytoma	medullary thyroid| papillary thyroid|pheochromocytoma	Hirschsprung disease		Multiple_Endocrine_Neoplasia_type_2B|Multiple_Endocrine_Neoplasia_type_2A|Familial_Medullary_Thyroid_Carcinoma				---	---	---	---
C10orf71	118461	broad.mit.edu	37	10	50530853	50530853	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:50530853A>G	uc010qgp.1	+	3	602	c.263A>G	c.(262-264)CAG>CGG	p.Q88R		NM_199459	NP_955629	Q711Q0	CJ071_HUMAN	hypothetical protein LOC118461 isoform 2	88											0																		---	---	---	---
PCDH15	65217	broad.mit.edu	37	10	55582989	55582989	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55582989G>A	uc001jju.1	-	33	4892	c.4497C>T	c.(4495-4497)GAC>GAT	p.D1499D	PCDH15_uc010qhq.1_Intron|PCDH15_uc010qhr.1_Intron|PCDH15_uc010qhs.1_Intron|PCDH15_uc010qht.1_Intron|PCDH15_uc010qhu.1_Intron|PCDH15_uc001jjv.1_Intron|PCDH15_uc010qhv.1_Silent_p.D1496D|PCDH15_uc010qhw.1_Silent_p.D1459D|PCDH15_uc010qhx.1_Silent_p.D1430D|PCDH15_uc010qhy.1_Silent_p.D1506D|PCDH15_uc010qhz.1_Silent_p.D1501D|PCDH15_uc010qia.1_Silent_p.D1479D|PCDH15_uc010qib.1_Silent_p.D1476D	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	1499	Cytoplasmic (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---
PCDH15	65217	broad.mit.edu	37	10	55588345	55588345	+	Intron	SNP	A	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55588345A>T	uc001jju.1	-						PCDH15_uc010qhq.1_Intron|PCDH15_uc010qhr.1_Intron|PCDH15_uc010qhs.1_Intron|PCDH15_uc010qht.1_Intron|PCDH15_uc010qhu.1_Intron|PCDH15_uc001jjv.1_Intron|PCDH15_uc010qhv.1_Intron|PCDH15_uc010qhw.1_Intron|PCDH15_uc010qhx.1_Intron|PCDH15_uc010qhy.1_Intron|PCDH15_uc010qhz.1_Intron|PCDH15_uc010qia.1_Intron|PCDH15_uc010qib.1_Intron	NM_033056	NP_149045			protocadherin 15 isoform CD1-4 precursor						equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---
MYPN	84665	broad.mit.edu	37	10	69959203	69959203	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69959203C>A	uc001jnm.3	+	18	3549	c.3364C>A	c.(3364-3366)CTG>ATG	p.L1122M	MYPN_uc001jnn.3_Missense_Mutation_p.L847M|MYPN_uc001jno.3_Missense_Mutation_p.L1122M|MYPN_uc009xpt.2_Missense_Mutation_p.L1122M|MYPN_uc010qit.1_Missense_Mutation_p.L828M|MYPN_uc010qiu.1_RNA	NM_032578	NP_115967	Q86TC9	MYPN_HUMAN	myopalladin	1122	Ig-like 4.|Interaction with ACTN.					nucleus|sarcomere	actin binding			ovary(3)|skin(2)	5																		---	---	---	---
DNA2	1763	broad.mit.edu	37	10	70191618	70191618	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70191618C>T	uc001jof.2	-	13	2242	c.2242G>A	c.(2242-2244)GTA>ATA	p.V748I	DNA2_uc001jog.1_Splice_Site_p.L661_splice|DNA2_uc001joh.1_RNA	NM_001080449	NP_001073918	P51530	DNA2L_HUMAN	DNA replication helicase 2 homolog	662					base-excision repair|DNA replication, removal of RNA primer|mitochondrial DNA repair|mitochondrial DNA replication|positive regulation of DNA replication|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication	mitochondrial nucleoid|nucleoplasm	5'-flap endonuclease activity|ATP binding|ATP-dependent DNA helicase activity|DNA binding|site-specific endodeoxyribonuclease activity, specific for altered base				0																		---	---	---	---
STOX1	219736	broad.mit.edu	37	10	70644505	70644505	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70644505G>A	uc001jos.2	+	3	1040	c.953G>A	c.(952-954)CGC>CAC	p.R318H	STOX1_uc001jor.2_Intron|STOX1_uc009xpy.2_Intron|STOX1_uc001joq.2_Missense_Mutation_p.R208H	NM_001130161	NP_001123633	Q6ZVD7	STOX1_HUMAN	storkhead box 1 isoform a	318						cytoplasm|nucleolus	DNA binding			kidney(1)|skin(1)	2																		---	---	---	---
AIFM2	84883	broad.mit.edu	37	10	71880840	71880840	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:71880840C>T	uc010qjg.1	-						AIFM2_uc001jqp.1_Intron	NM_032797	NP_116186			apoptosis-inducing factor (AIF)-like						apoptotic mitochondrial changes|chromosome condensation|induction of apoptosis	cytosol|integral to membrane|mitochondrial outer membrane	DNA binding|electron-transferring-flavoprotein dehydrogenase activity|flavin adenine dinucleotide binding			central_nervous_system(1)	1																		---	---	---	---
KIAA1274	27143	broad.mit.edu	37	10	72299395	72299395	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72299395C>T	uc001jrd.3	+	15	2066	c.1785C>T	c.(1783-1785)CCC>CCT	p.P595P	KIAA1274_uc001jre.3_5'UTR	NM_014431	NP_055246	Q9ULE6	PALD_HUMAN	KIAA1274	595										ovary(2)|central_nervous_system(1)	3																		---	---	---	---
CAMK2G	818	broad.mit.edu	37	10	75574930	75574930	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:75574930G>A	uc001jvm.1	-	20	1633	c.1514C>T	c.(1513-1515)GCG>GTG	p.A505V	CAMK2G_uc001jvo.1_Missense_Mutation_p.A476V|CAMK2G_uc001jvq.1_Missense_Mutation_p.A453V|CAMK2G_uc001jvr.1_Missense_Mutation_p.A444V|CAMK2G_uc001jvp.1_Missense_Mutation_p.A467V|CAMK2G_uc001jvs.1_Missense_Mutation_p.A488V|CAMK2G_uc001jvt.1_RNA|CAMK2G_uc001jvu.1_Missense_Mutation_p.A445V|CAMK2G_uc009xrp.1_Missense_Mutation_p.A94V	NM_172171	NP_751911	Q13555	KCC2G_HUMAN	calcium/calmodulin-dependent protein kinase II	507					insulin secretion|interferon-gamma-mediated signaling pathway|synaptic transmission	calcium- and calmodulin-dependent protein kinase complex|cytosol|endocytic vesicle membrane|nucleoplasm|plasma membrane	ATP binding|calcium-dependent protein serine/threonine phosphatase activity|calmodulin binding|calmodulin-dependent protein kinase activity			lung(1)|stomach(1)	2	Prostate(51;0.0112)																	---	---	---	---
KCNMA1	3778	broad.mit.edu	37	10	78651453	78651453	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:78651453T>C	uc001jxn.2	-	26	3349	c.3172A>G	c.(3172-3174)ACC>GCC	p.T1058A	KCNMA1_uc001jxj.2_Missense_Mutation_p.T1004A|KCNMA1_uc001jxk.1_Missense_Mutation_p.T676A|KCNMA1_uc009xrt.1_Missense_Mutation_p.T849A|KCNMA1_uc001jxl.1_Missense_Mutation_p.T683A|KCNMA1_uc001jxo.2_Missense_Mutation_p.T1041A|KCNMA1_uc001jxm.2_Missense_Mutation_p.T1000A|KCNMA1_uc001jxq.2_Missense_Mutation_p.T1030A|uc001jxp.2_Intron	NM_001161352	NP_001154824	Q12791	KCMA1_HUMAN	large conductance calcium-activated potassium	1058	Cytoplasmic (Potential).				cellular potassium ion homeostasis|negative regulation of cell volume|platelet activation|positive regulation of apoptosis|regulation of membrane potential|response to calcium ion|response to carbon monoxide|response to hypoxia|response to osmotic stress|smooth muscle contraction involved in micturition	apical plasma membrane|caveola|integral to membrane|voltage-gated potassium channel complex	actin binding|calcium-activated potassium channel activity|large conductance calcium-activated potassium channel activity|metal ion binding|voltage-gated potassium channel activity			pancreas(2)|ovary(1)	3	all_cancers(46;0.203)|all_epithelial(25;0.00604)|Prostate(51;0.0198)		OV - Ovarian serous cystadenocarcinoma(4;0.0586)|Epithelial(14;0.081)|all cancers(16;0.183)		Bendroflumethiazide(DB00436)|Benzthiazide(DB00562)|Chlorothiazide(DB00880)|Chlorzoxazone(DB00356)|Cromoglicate(DB01003)|Cyclothiazide(DB00606)|Diazoxide(DB01119)|Enflurane(DB00228)|Hydrochlorothiazide(DB00999)|Hydroflumethiazide(DB00774)|Methyclothiazide(DB00232)|Quinethazone(DB01325)|Trichlormethiazide(DB01021)													---	---	---	---
MAT1A	4143	broad.mit.edu	37	10	82039973	82039973	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:82039973G>A	uc001kbw.2	-	5	760	c.505C>T	c.(505-507)CGC>TGC	p.R169C		NM_000429	NP_000420	Q00266	METK1_HUMAN	methionine adenosyltransferase I, alpha	169					methylation|S-adenosylmethionine biosynthetic process|xenobiotic metabolic process	cytosol	ATP binding|metal ion binding|methionine adenosyltransferase activity				0			Colorectal(32;0.229)		L-Methionine(DB00134)|S-Adenosylmethionine(DB00118)													---	---	---	---
IFIT1	3434	broad.mit.edu	37	10	91162510	91162510	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:91162510G>A	uc001kgi.2	+	2	626	c.478G>A	c.(478-480)GCC>ACC	p.A160T	LIPA_uc001kgb.3_Intron|LIPA_uc001kgc.3_Intron|IFIT1_uc009xtt.2_Missense_Mutation_p.A160T|IFIT1_uc001kgj.2_Missense_Mutation_p.A129T	NM_001548	NP_001539	P09914	IFIT1_HUMAN	interferon-induced protein with	160	TPR 3.				cellular response to exogenous dsRNA|intracellular transport of viral proteins in host cell|negative regulation of defense response to virus by host|negative regulation of helicase activity|negative regulation of protein binding|negative regulation of viral genome replication|positive regulation of viral genome replication|response to virus|type I interferon-mediated signaling pathway	cytoplasm	protein binding				0																		---	---	---	---
BTAF1	9044	broad.mit.edu	37	10	93756173	93756173	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:93756173T>C	uc001khr.2	+	24	3455	c.3357T>C	c.(3355-3357)AGT>AGC	p.S1119S	BTAF1_uc001kht.1_Silent_p.S557S	NM_003972	NP_003963	O14981	BTAF1_HUMAN	BTAF1 RNA polymerase II, B-TFIID transcription	1119	HEAT 7.				negative regulation of transcription, DNA-dependent	nucleus	ATP binding|DNA binding|helicase activity|sequence-specific DNA binding transcription factor activity			ovary(1)|central_nervous_system(1)|skin(1)	3		Colorectal(252;0.0846)																---	---	---	---
CYP2C19	1557	broad.mit.edu	37	10	96609804	96609804	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96609804C>G	uc010qnz.1	+	8	1280	c.1280C>G	c.(1279-1281)CCT>CGT	p.P427R	CYP2C19_uc010qny.1_Missense_Mutation_p.P405R	NM_000769	NP_000760	P33261	CP2CJ_HUMAN	cytochrome P450, family 2, subfamily C,	427					exogenous drug catabolic process|heterocycle metabolic process|monoterpenoid metabolic process|steroid metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	(S)-limonene 6-monooxygenase activity|(S)-limonene 7-monooxygenase activity|4-hydroxyacetophenone monooxygenase activity|electron carrier activity|enzyme binding|heme binding|oxygen binding|steroid hydroxylase activity			ovary(4)|central_nervous_system(1)|skin(1)	6		Colorectal(252;0.09)		all cancers(201;6.02e-07)|KIRC - Kidney renal clear cell carcinoma(50;0.0672)|Kidney(138;0.0838)	Adinazolam(DB00546)|Aminophenazone(DB01424)|Amitriptyline(DB00321)|Amoxicillin(DB01060)|Arformoterol(DB01274)|Bortezomib(DB00188)|Carisoprodol(DB00395)|Chlorzoxazone(DB00356)|Cilostazol(DB01166)|Citalopram(DB00215)|Clarithromycin(DB01211)|Clobazam(DB00349)|Desipramine(DB01151)|Desloratadine(DB00967)|Diclofenac(DB00586)|Diltiazem(DB00343)|Efavirenz(DB00625)|Esomeprazole(DB00736)|Famotidine(DB00927)|Felbamate(DB00949)|Finasteride(DB01216)|Flunitrazepam(DB01544)|Fluvoxamine(DB00176)|Formoterol(DB00983)|Fosphenytoin(DB01320)|Guanfacine(DB01018)|Imipramine(DB00458)|Indomethacin(DB00328)|Ketoconazole(DB01026)|Lansoprazole(DB00448)|Lapatinib(DB01259)|Loratadine(DB00455)|Melatonin(DB01065)|Mephenytoin(DB00532)|Methadone(DB00333)|Methylphenobarbital(DB00849)|Moclobemide(DB01171)|Modafinil(DB00745)|Nelfinavir(DB00220)|Nicardipine(DB00622)|Nilutamide(DB00665)|Norgestrel(DB00506)|Omeprazole(DB00338)|Oxcarbazepine(DB00776)|Pantoprazole(DB00213)|Pentamidine(DB00738)|Phenobarbital(DB01174)|Phenytoin(DB00252)|Primidone(DB00794)|Progesterone(DB00396)|Proguanil(DB01131)|Promazine(DB00420)|Quinidine(DB00908)|Rabeprazole(DB01129)|Ranitidine(DB00863)|Ritonavir(DB00503)|Selegiline(DB01037)|Sertraline(DB01104)|Temazepam(DB00231)|Teniposide(DB00444)|Terfenadine(DB00342)|Thalidomide(DB01041)|Thioridazine(DB00679)|Ticlopidine(DB00208)|Tolbutamide(DB01124)|Topiramate(DB00273)|Tranylcypromine(DB00752)|Troglitazone(DB00197)|Troleandomycin(DB01361)|Voriconazole(DB00582)													---	---	---	---
SORBS1	10580	broad.mit.edu	37	10	97096319	97096319	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97096319C>T	uc001kkp.2	-	28	3643	c.3598G>A	c.(3598-3600)GAG>AAG	p.E1200K	SORBS1_uc001kkk.2_Intron|SORBS1_uc001kkl.2_Intron|SORBS1_uc001kkn.2_Intron|SORBS1_uc001kkm.2_Intron|SORBS1_uc001kko.2_Missense_Mutation_p.E1059K|SORBS1_uc001kkq.2_Intron|SORBS1_uc001kkr.2_Intron|SORBS1_uc001kks.2_Intron|SORBS1_uc001kkt.2_Intron|SORBS1_uc001kku.2_Intron|SORBS1_uc001kkv.2_Intron|SORBS1_uc001kkw.2_Missense_Mutation_p.E1154K|SORBS1_uc010qoe.1_Intron	NM_001034954	NP_001030126	Q9BX66	SRBS1_HUMAN	sorbin and SH3 domain containing 1 isoform 3	1200					focal adhesion assembly|glucose transport|insulin receptor signaling pathway|muscle contraction|positive regulation of establishment of protein localization in plasma membrane|positive regulation of glucose import|positive regulation of glycogen biosynthetic process|positive regulation of lipid biosynthetic process|stress fiber assembly	centrosome|cytosol|focal adhesion|membrane raft|nucleus|stress fiber|zonula adherens	actin binding|insulin receptor binding|SH3/SH2 adaptor activity			breast(1)	1		Colorectal(252;0.0429)		Epithelial(162;1.7e-06)|all cancers(201;6.52e-05)														---	---	---	---
PI4K2A	55361	broad.mit.edu	37	10	99422723	99422723	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99422723C>T	uc001kog.1	+	5	1039	c.982C>T	c.(982-984)CGG>TGG	p.R328W	PI4K2A_uc010qoy.1_Missense_Mutation_p.R298W|PI4K2A_uc009xvw.1_Intron	NM_018425	NP_060895	Q9BTU6	P4K2A_HUMAN	phosphatidylinositol 4-kinase type 2 alpha	328	PI3K/PI4K.				phosphatidylinositol biosynthetic process	cytoplasm|integral to plasma membrane|membrane raft	1-phosphatidylinositol 4-kinase activity|ATP binding|magnesium ion binding			lung(1)|skin(1)	2		Colorectal(252;0.162)		Epithelial(162;1.24e-10)|all cancers(201;1.2e-08)														---	---	---	---
CRTAC1	55118	broad.mit.edu	37	10	99625339	99625339	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99625339G>A	uc001kou.1	-	15	2308	c.1952C>T	c.(1951-1953)TCG>TTG	p.S651L	GOLGA7B_uc001kos.2_Intron|CRTAC1_uc001kot.1_3'UTR	NM_018058	NP_060528	Q9NQ79	CRAC1_HUMAN	cartilage acidic protein 1 precursor	651						proteinaceous extracellular matrix	calcium ion binding			ovary(4)|pancreas(1)	5		Colorectal(252;0.24)		Epithelial(162;2.18e-10)|all cancers(201;3.27e-09)														---	---	---	---
PYROXD2	84795	broad.mit.edu	37	10	100155183	100155183	+	Nonsense_Mutation	SNP	G	A	A	rs146494121		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:100155183G>A	uc001kpc.2	-	7	738	c.652C>T	c.(652-654)CGA>TGA	p.R218*	PYROXD2_uc001kpb.2_RNA|PYROXD2_uc001kpd.2_RNA|PYROXD2_uc010qpe.1_Nonsense_Mutation_p.R218*|MIR1287_hsa-mir-1287|MI0006349_5'Flank	NM_032709	NP_116098	Q8N2H3	PYRD2_HUMAN	pyridine nucleotide-disulphide oxidoreductase	218							oxidoreductase activity			central_nervous_system(1)	1																		---	---	---	---
HPSE2	60495	broad.mit.edu	37	10	100219428	100219428	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:100219428C>T	uc001kpn.1	-	12	1742	c.1682G>A	c.(1681-1683)CGC>CAC	p.R561H	HPSE2_uc009xwc.1_3'UTR|HPSE2_uc001kpo.1_Missense_Mutation_p.R493H|HPSE2_uc009xwd.1_Missense_Mutation_p.R439H	NM_021828	NP_068600	Q8WWQ2	HPSE2_HUMAN	heparanase 2	561					carbohydrate metabolic process	intracellular|membrane	cation binding|heparanase activity			ovary(1)	1				Epithelial(162;1.8e-09)|all cancers(201;4.72e-07)														---	---	---	---
SEC31B	25956	broad.mit.edu	37	10	102247505	102247505	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102247505C>A	uc001krc.1	-	26	3510	c.3408G>T	c.(3406-3408)GTG>GTT	p.V1136V	SEC31B_uc010qpo.1_Silent_p.V1135V|SEC31B_uc001krd.1_Silent_p.V673V|SEC31B_uc001krf.1_Silent_p.V569V|SEC31B_uc001kre.1_Silent_p.V567V	NM_015490	NP_056305	Q9NQW1	SC31B_HUMAN	SEC31 homolog B	1136					protein transport|vesicle-mediated transport	endoplasmic reticulum membrane|ER to Golgi transport vesicle membrane				ovary(1)	1		Colorectal(252;0.117)		Epithelial(162;2.36e-10)|all cancers(201;2.09e-08)														---	---	---	---
LZTS2	84445	broad.mit.edu	37	10	102763814	102763814	+	Missense_Mutation	SNP	C	T	T	rs71488080		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102763814C>T	uc001ksj.2	+	3	1028	c.959C>T	c.(958-960)TCG>TTG	p.S320L	LZTS2_uc010qpw.1_Missense_Mutation_p.S320L|LZTS2_uc001ksk.2_Missense_Mutation_p.S320L|LZTS2_uc001ksl.2_Missense_Mutation_p.S320L|LZTS2_uc001ksm.2_RNA	NM_032429	NP_115805	Q9BRK4	LZTS2_HUMAN	leucine zipper, putative tumor suppressor 2	320	Required for centrosomal localization (By similarity).				cell division|mitosis|Wnt receptor signaling pathway	membrane|microtubule|microtubule organizing center				ovary(2)|large_intestine(1)|breast(1)	4				Epithelial(162;7.3e-09)|all cancers(201;3.72e-07)														---	---	---	---
SORCS1	114815	broad.mit.edu	37	10	108389108	108389108	+	Silent	SNP	G	A	A	rs144932995		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:108389108G>A	uc001kym.2	-	19	2522	c.2514C>T	c.(2512-2514)GGC>GGT	p.G838G	SORCS1_uc001kyl.2_Silent_p.G838G|SORCS1_uc009xxs.2_Silent_p.G838G|SORCS1_uc001kyn.1_Silent_p.G838G|SORCS1_uc001kyo.2_Silent_p.G838G	NM_052918	NP_443150	Q8WY21	SORC1_HUMAN	SORCS receptor 1 isoform a	838	Lumenal (Potential).|PKD.					integral to membrane	neuropeptide receptor activity|protein binding			breast(1)|central_nervous_system(1)	2		Breast(234;0.0256)|Colorectal(252;0.09)|Lung NSC(174;0.168)		Epithelial(162;1.66e-05)|all cancers(201;0.000689)														---	---	---	---
NRAP	4892	broad.mit.edu	37	10	115348747	115348747	+	Missense_Mutation	SNP	G	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:115348747G>C	uc001laj.2	-	42	5344	c.5180C>G	c.(5179-5181)GCC>GGC	p.A1727G	HABP2_uc001lai.3_3'UTR|NRAP_uc009xyb.2_Missense_Mutation_p.A480G|NRAP_uc001lak.2_Missense_Mutation_p.A1692G|NRAP_uc001lal.3_Missense_Mutation_p.A1728G	NM_198060	NP_932326	Q86VF7	NRAP_HUMAN	nebulin-related anchoring protein isoform S	1727						fascia adherens|muscle tendon junction	actin binding|muscle alpha-actinin binding|zinc ion binding			ovary(6)|central_nervous_system(3)|upper_aerodigestive_tract(1)	10		Colorectal(252;0.0233)|Breast(234;0.188)		Epithelial(162;0.00392)|all cancers(201;0.00569)														---	---	---	---
FAM160B1	57700	broad.mit.edu	37	10	116603550	116603550	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:116603550T>C	uc001lcb.2	+	7	1202	c.867T>C	c.(865-867)AGT>AGC	p.S289S	FAM160B1_uc001lcc.2_Silent_p.S289S	NM_020940	NP_065991	Q5W0V3	F16B1_HUMAN	hypothetical protein LOC57700 isoform a	289										lung(1)	1																		---	---	---	---
HTRA1	5654	broad.mit.edu	37	10	124266334	124266334	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124266334G>A	uc001lgj.2	+	4	1033	c.905G>A	c.(904-906)CGA>CAA	p.R302Q		NM_002775	NP_002766	Q92743	HTRA1_HUMAN	HtrA serine peptidase 1 precursor	302	Serine protease.				proteolysis|regulation of cell growth	extracellular space	insulin-like growth factor binding|serine-type endopeptidase activity				0		all_neural(114;0.0765)|Lung NSC(174;0.133)|all_lung(145;0.163)|Breast(234;0.238)																---	---	---	---
CTBP2	1488	broad.mit.edu	37	10	126691672	126691672	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:126691672A>G	uc009yak.2	-	5	502	c.215T>C	c.(214-216)GTT>GCT	p.V72A	CTBP2_uc009yal.2_Missense_Mutation_p.V72A|CTBP2_uc001lif.3_Missense_Mutation_p.V72A|CTBP2_uc001lih.3_Missense_Mutation_p.V72A|CTBP2_uc001lid.3_Missense_Mutation_p.V140A|CTBP2_uc001lie.3_Missense_Mutation_p.V612A	NM_001329	NP_001320	P56545	CTBP2_HUMAN	C-terminal binding protein 2 isoform 1	72					negative regulation of cell proliferation|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent|viral genome replication|white fat cell differentiation	cell junction|synapse|transcriptional repressor complex	NAD binding|oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor|protein binding				0		all_lung(145;0.0132)|Lung NSC(174;0.0193)|all_neural(114;0.116)|Colorectal(57;0.173)		Colorectal(40;0.00572)|COAD - Colon adenocarcinoma(40;0.0127)|GBM - Glioblastoma multiforme(135;0.147)														---	---	---	---
MKI67	4288	broad.mit.edu	37	10	129903109	129903109	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:129903109G>A	uc001lke.2	-	13	7190	c.6995C>T	c.(6994-6996)ACG>ATG	p.T2332M	MKI67_uc001lkf.2_Missense_Mutation_p.T1972M|MKI67_uc009yav.1_Missense_Mutation_p.T1907M|MKI67_uc009yaw.1_Missense_Mutation_p.T1482M	NM_002417	NP_002408	P46013	KI67_HUMAN	antigen identified by monoclonal antibody Ki-67	2332	16 X 122 AA approximate repeats.				cell proliferation	nucleolus	ATP binding|protein C-terminus binding			ovary(4)|central_nervous_system(2)|skin(1)	7		all_epithelial(44;2.12e-05)|all_lung(145;0.00679)|Lung NSC(174;0.00998)|all_neural(114;0.0936)|Colorectal(57;0.14)|Breast(234;0.166)|Melanoma(40;0.203)																---	---	---	---
MGMT	4255	broad.mit.edu	37	10	131334634	131334634	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:131334634G>A	uc001lkh.2	+	2	237	c.211G>A	c.(211-213)GCA>ACA	p.A71T		NM_002412	NP_002403	P16455	MGMT_HUMAN	O-6-methylguanine-DNA methyltransferase	40										ovary(1)|breast(1)	2		all_cancers(35;9.44e-09)|all_epithelial(44;6.98e-08)|Lung NSC(174;0.0157)|all_lung(145;0.0201)|all_neural(114;0.0732)|Colorectal(57;0.0792)|Breast(234;0.167)		OV - Ovarian serous cystadenocarcinoma(35;0.00291)									Direct_reversal_of_damage					---	---	---	---
INPP5A	3632	broad.mit.edu	37	10	134595384	134595384	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:134595384G>A	uc001llp.2	+	15	1426	c.1178G>A	c.(1177-1179)CGA>CAA	p.R393Q	INPP5A_uc001llq.2_Missense_Mutation_p.R288Q	NM_005539	NP_005530	Q14642	I5P1_HUMAN	inositol polyphosphate-5-phosphatase A	393					cell communication	membrane	inositol 1,3,4,5-tetrakisphosphate 5-phosphatase activity|inositol-1,4,5-trisphosphate 5-phosphatase activity|inositol-polyphosphate 5-phosphatase activity|PH domain binding			skin(1)	1		all_cancers(35;8.59e-13)|all_epithelial(44;5.49e-09)|Lung NSC(174;0.000854)|all_lung(145;0.00146)|all_neural(114;0.0299)|Colorectal(31;0.0599)|Breast(234;0.0849)|Melanoma(40;0.124)|all_hematologic(284;0.196)|Glioma(114;0.203)		OV - Ovarian serous cystadenocarcinoma(35;0.000102)|Epithelial(32;0.00023)|all cancers(32;0.000326)														---	---	---	---
ADAM8	101	broad.mit.edu	37	10	135084295	135084295	+	Missense_Mutation	SNP	C	T	T	rs149084614	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:135084295C>T	uc010qva.1	-	14	1513	c.1462G>A	c.(1462-1464)GAG>AAG	p.E488K	ADAM8_uc010quz.1_Missense_Mutation_p.E527K|ADAM8_uc009ybi.2_Missense_Mutation_p.E527K			P78325	ADAM8_HUMAN	SubName: Full=cDNA FLJ50704, highly similar to ADAM 8 (EC 3.4.24.-) (A disintegrinand metalloproteinase domain 8);	488					integrin-mediated signaling pathway|proteolysis		metalloendopeptidase activity			large_intestine(2)|central_nervous_system(1)	3		all_cancers(35;1.14e-09)|all_epithelial(44;5.79e-08)|Lung NSC(174;0.00263)|all_lung(145;0.0039)|all_neural(114;0.0299)|Melanoma(40;0.123)|Colorectal(31;0.172)|Glioma(114;0.203)		all cancers(32;7.72e-06)|OV - Ovarian serous cystadenocarcinoma(35;8.23e-06)|Epithelial(32;1.02e-05)														---	---	---	---
ECHS1	1892	broad.mit.edu	37	10	135176441	135176441	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:135176441G>A	uc001lmu.2	-							NM_004092	NP_004083			mitochondrial short-chain enoyl-coenzyme A						fatty acid beta-oxidation	mitochondrial matrix	enoyl-CoA hydratase activity|protein binding				0		all_cancers(35;1.14e-09)|all_epithelial(44;5.79e-08)|Lung NSC(174;0.00263)|all_lung(145;0.0039)|all_neural(114;0.0299)|Melanoma(40;0.123)|Colorectal(31;0.172)|Glioma(114;0.203)		all cancers(32;1.62e-06)|OV - Ovarian serous cystadenocarcinoma(35;5.75e-06)|Epithelial(32;7.58e-06)														---	---	---	---
NLRP6	171389	broad.mit.edu	37	11	279855	279855	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:279855C>T	uc010qvs.1	+	3	332	c.332C>T	c.(331-333)ACG>ATG	p.T111M	NLRP6_uc010qvt.1_Missense_Mutation_p.T111M	NM_138329	NP_612202	P59044	NALP6_HUMAN	NLR family, pyrin domain containing 6	111						cytoplasm	ATP binding			upper_aerodigestive_tract(1)|skin(1)	2		all_cancers(49;1.12e-06)|all_epithelial(84;0.000375)|Breast(177;0.00122)|Ovarian(85;0.0228)|Medulloblastoma(188;0.0321)|all_neural(188;0.0762)		all cancers(45;4.28e-28)|Epithelial(43;2.47e-27)|OV - Ovarian serous cystadenocarcinoma(40;4.66e-21)|BRCA - Breast invasive adenocarcinoma(625;3.57e-05)|Lung(200;0.0485)|LUSC - Lung squamous cell carcinoma(625;0.122)														---	---	---	---
LRDD	55367	broad.mit.edu	37	11	800567	800567	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:800567C>T	uc001lro.1	-	12	2159	c.2017G>A	c.(2017-2019)GAG>AAG	p.E673K	SLC25A22_uc009yci.2_5'Flank|SLC25A22_uc001lrj.2_5'Flank|LRDD_uc009yck.1_RNA|LRDD_uc001lrk.1_Missense_Mutation_p.E673K|LRDD_uc001lrl.1_Missense_Mutation_p.E516K|LRDD_uc001lrm.1_Missense_Mutation_p.E360K|LRDD_uc001lrn.1_Missense_Mutation_p.E516K|LRDD_uc001lrp.1_Missense_Mutation_p.E335K	NM_145886	NP_665893	Q9HB75	PIDD_HUMAN	leucine rich repeat and death domain containing	673					apoptosis|signal transduction	cytoplasm|nucleus	death receptor binding				0		all_cancers(49;1.13e-08)|all_epithelial(84;2.95e-05)|Breast(177;0.000286)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.159)|all_lung(207;0.198)		all cancers(45;1.45e-25)|Epithelial(43;1.17e-24)|OV - Ovarian serous cystadenocarcinoma(40;6.76e-19)|BRCA - Breast invasive adenocarcinoma(625;4.23e-05)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)														---	---	---	---
MUC2	4583	broad.mit.edu	37	11	1093743	1093743	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1093743T>C	uc001lsx.1	+	33	12675	c.12648T>C	c.(12646-12648)CCT>CCC	p.P4216P		NM_002457	NP_002448	Q02817	MUC2_HUMAN	mucin 2 precursor	4216						inner mucus layer|outer mucus layer	protein binding			lung(1)|breast(1)	2		all_cancers(49;1.08e-07)|all_epithelial(84;5.08e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.191)		BRCA - Breast invasive adenocarcinoma(625;0.000207)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)	Pranlukast(DB01411)													---	---	---	---
PHLDA2	7262	broad.mit.edu	37	11	2950458	2950458	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:2950458C>G	uc001lxa.1	-	1	193	c.137G>C	c.(136-138)CGC>CCC	p.R46P		NM_003311	NP_003302	Q53GA4	PHLA2_HUMAN	pleckstrin homology-like domain family A member	46	PH.				apoptosis	cytoplasm|membrane					0		all_epithelial(84;0.000124)|Medulloblastoma(188;0.00106)|Breast(177;0.00328)|Ovarian(85;0.00556)|all_neural(188;0.00681)|all_lung(207;0.198)		BRCA - Breast invasive adenocarcinoma(625;0.0025)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---
RHOG	391	broad.mit.edu	37	11	3849105	3849105	+	Silent	SNP	C	T	T	rs143155056	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:3849105C>T	uc001lyu.2	-	2	422	c.264G>A	c.(262-264)CCG>CCA	p.P88P		NM_001665	NP_001656	P84095	RHOG_HUMAN	ras homolog gene family, member G precursor	88					actin cytoskeleton organization|activation of Rac GTPase activity|axon guidance|cell chemotaxis|platelet activation|positive regulation of cell proliferation|positive regulation of establishment of protein localization in plasma membrane|positive regulation of transcription, DNA-dependent|Rac protein signal transduction|Rho protein signal transduction	cytosol|plasma membrane	GTP binding|GTPase activity|protein binding				0		Medulloblastoma(188;0.0025)|Breast(177;0.00328)|all_neural(188;0.0227)		BRCA - Breast invasive adenocarcinoma(625;0.0349)|LUSC - Lung squamous cell carcinoma(625;0.194)														---	---	---	---
OR52K1	390036	broad.mit.edu	37	11	4510990	4510990	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4510990C>A	uc001lza.1	+	1	860	c.860C>A	c.(859-861)CCC>CAC	p.P287H		NM_001005171	NP_001005171	Q8NGK4	O52K1_HUMAN	olfactory receptor, family 52, subfamily K,	287	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0		Medulloblastoma(188;0.0075)|Breast(177;0.0461)|all_neural(188;0.0577)		Epithelial(150;1.76e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0836)|LUSC - Lung squamous cell carcinoma(625;0.192)														---	---	---	---
OR52I1	390037	broad.mit.edu	37	11	4615836	4615836	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4615836A>G	uc010qyi.1	+	1	568	c.568A>G	c.(568-570)AGG>GGG	p.R190G		NM_001005169	NP_001005169	Q8NGK6	O52I1_HUMAN	olfactory receptor, family 52, subfamily I,	190	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|central_nervous_system(1)	2		Medulloblastoma(188;0.0075)|Breast(177;0.0461)|all_neural(188;0.0577)		Epithelial(150;7.98e-12)|BRCA - Breast invasive adenocarcinoma(625;0.0284)|LUSC - Lung squamous cell carcinoma(625;0.19)														---	---	---	---
OR52E2	119678	broad.mit.edu	37	11	5079943	5079943	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5079943C>A	uc010qyw.1	-	1	915	c.915G>T	c.(913-915)AAG>AAT	p.K305N		NM_001005164	NP_001005164	Q8NGJ4	O52E2_HUMAN	olfactory receptor, family 52, subfamily E,	305	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(1)	3		Medulloblastoma(188;0.0061)|all_neural(188;0.0479)|Breast(177;0.086)		Epithelial(150;1.03e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)|LUSC - Lung squamous cell carcinoma(625;0.191)														---	---	---	---
C11orf42	160298	broad.mit.edu	37	11	6231598	6231598	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6231598C>T	uc001mcj.2	+	2	639	c.591C>T	c.(589-591)TGC>TGT	p.C197C		NM_173525	NP_775796	Q8N5U0	CK042_HUMAN	hypothetical protein LOC160298	197										ovary(1)	1		Medulloblastoma(188;0.00776)|all_neural(188;0.0652)|Breast(177;0.114)		Epithelial(150;1.95e-08)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---
TRIM3	10612	broad.mit.edu	37	11	6478040	6478040	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6478040G>A	uc001mdh.2	-	7	1303	c.916C>T	c.(916-918)CGG>TGG	p.R306W	TRIM3_uc001mdi.2_Missense_Mutation_p.R306W|TRIM3_uc010raj.1_Missense_Mutation_p.R187W|TRIM3_uc009yfd.2_Missense_Mutation_p.R306W|TRIM3_uc010rak.1_Missense_Mutation_p.R306W|TRIM3_uc001mdj.2_Missense_Mutation_p.R187W	NM_006458	NP_006449	O75382	TRIM3_HUMAN	tripartite motif-containing 3	306					nervous system development|protein transport	early endosome	protein C-terminus binding|zinc ion binding			central_nervous_system(2)|large_intestine(1)|ovary(1)|skin(1)	5		all_lung(207;9.97e-06)|Lung NSC(207;1.74e-05)|Medulloblastoma(188;0.00225)|Breast(177;0.0204)|all_neural(188;0.0212)		Epithelial(150;9.34e-10)|Lung(200;0.0234)|LUSC - Lung squamous cell carcinoma(625;0.133)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---
TPP1	1200	broad.mit.edu	37	11	6638584	6638584	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6638584C>T	uc001mel.1	-	5	517	c.456G>A	c.(454-456)AGG>AGA	p.R152R	TPP1_uc001mek.1_5'UTR|TPP1_uc010rar.1_Silent_p.R152R	NM_000391	NP_000382	O14773	TPP1_HUMAN	tripeptidyl-peptidase I preproprotein	152					bone resorption|cell death|lipid metabolic process|lysosome organization|nervous system development|neuromuscular process controlling balance|peptide catabolic process|protein catabolic process|proteolysis	lysosome|melanosome|soluble fraction	metal ion binding|peptide binding|protein binding|serine-type endopeptidase activity|tripeptidyl-peptidase activity				0		Medulloblastoma(188;0.00263)|all_neural(188;0.026)		Epithelial(150;3.45e-09)|BRCA - Breast invasive adenocarcinoma(625;0.131)														---	---	---	---
DCHS1	8642	broad.mit.edu	37	11	6650064	6650064	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6650064G>A	uc001mem.1	-							NM_003737	NP_003728			dachsous 1 precursor						calcium-dependent cell-cell adhesion|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|large_intestine(1)|pancreas(1)	5		Medulloblastoma(188;0.00263)|all_neural(188;0.026)		Epithelial(150;6.35e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---
PIK3C2A	5286	broad.mit.edu	37	11	17113183	17113183	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17113183T>C	uc001mmq.3	-	30	4729	c.4663A>G	c.(4663-4665)ACT>GCT	p.T1555A	PIK3C2A_uc009ygu.1_Missense_Mutation_p.T158A|PIK3C2A_uc010rcw.1_Missense_Mutation_p.T1175A|PIK3C2A_uc001mmr.3_Intron	NM_002645	NP_002636	O00443	P3C2A_HUMAN	phosphoinositide-3-kinase, class 2 alpha	1555					cell communication|phosphatidylinositol biosynthetic process|phosphatidylinositol-mediated signaling	clathrin-coated vesicle|Golgi apparatus|nucleus|phosphatidylinositol 3-kinase complex|plasma membrane	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol binding|phosphatidylinositol-4-phosphate 3-kinase activity			lung(4)|central_nervous_system(4)|stomach(1)|ovary(1)	10					Phosphatidylserine(DB00144)													---	---	---	---
NUCB2	4925	broad.mit.edu	37	11	17333455	17333455	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17333455T>C	uc001mmw.2	+	9	1042	c.797T>C	c.(796-798)TTA>TCA	p.L266S	NUCB2_uc001mmv.1_Missense_Mutation_p.L266S|NUCB2_uc009ygz.2_Missense_Mutation_p.L266S	NM_005013	NP_005004	P80303	NUCB2_HUMAN	nucleobindin 2 precursor	266	Binds to necdin (By similarity).|EF-hand 1.					cytosol|ER-Golgi intermediate compartment|extracellular space|Golgi apparatus|plasma membrane	calcium ion binding|DNA binding				0																		---	---	---	---
NUCB2	4925	broad.mit.edu	37	11	17351800	17351800	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17351800C>T	uc001mmw.2	+	12	1374	c.1129C>T	c.(1129-1131)CGT>TGT	p.R377C	NUCB2_uc009ygz.2_Missense_Mutation_p.R347C|NUCB2_uc009yha.2_RNA|NUCB2_uc001mmx.3_RNA|uc001mmy.1_5'Flank	NM_005013	NP_005004	P80303	NUCB2_HUMAN	nucleobindin 2 precursor	377	Binds to necdin (By similarity).					cytosol|ER-Golgi intermediate compartment|extracellular space|Golgi apparatus|plasma membrane	calcium ion binding|DNA binding				0																		---	---	---	---
NAV2	89797	broad.mit.edu	37	11	20112451	20112451	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:20112451C>T	uc001mpr.3	+	27	5909	c.5548C>T	c.(5548-5550)CAG>TAG	p.Q1850*	NAV2_uc001mpp.2_Nonsense_Mutation_p.Q1783*|NAV2_uc009yhx.2_Nonsense_Mutation_p.Q911*|NAV2_uc009yhz.2_Nonsense_Mutation_p.Q492*|NAV2_uc001mpu.2_Nonsense_Mutation_p.Q285*	NM_182964	NP_892009	Q8IVL1	NAV2_HUMAN	neuron navigator 2 isoform 1	1906	Potential.					nucleus	ATP binding|helicase activity			skin(4)|ovary(1)|pancreas(1)	6																		---	---	---	---
SLC17A6	57084	broad.mit.edu	37	11	22387120	22387120	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22387120T>G	uc001mqk.2	+	7	1189	c.776T>G	c.(775-777)TTT>TGT	p.F259C		NM_020346	NP_065079	Q9P2U8	VGLU2_HUMAN	solute carrier family 17 (sodium-dependent	259	Helical; (Potential).				sodium ion transport	cell junction|integral to membrane|synaptic vesicle membrane|synaptosome	L-glutamate transmembrane transporter activity|symporter activity			ovary(3)|breast(1)	4																		---	---	---	---
BDNF	627	broad.mit.edu	37	11	27679623	27679623	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:27679623C>T	uc010rdu.1	-	2	1340	c.489G>A	c.(487-489)ACG>ACA	p.T163T	BDNFOS_uc001mrm.2_Intron|BDNFOS_uc009yij.2_Intron|BDNFOS_uc009yik.2_Intron|BDNFOS_uc009yil.2_Intron|BDNFOS_uc001mrp.2_Intron|BDNFOS_uc009yim.2_Intron|BDNFOS_uc009yin.2_Intron|BDNFOS_uc009yio.2_Intron|BDNFOS_uc009yip.2_Intron|BDNFOS_uc001mrn.2_Intron|BDNFOS_uc009yiq.2_Intron|BDNFOS_uc001mro.2_Intron|BDNFOS_uc009yir.2_Intron|BDNFOS_uc009yis.2_Intron|BDNFOS_uc009yit.2_Intron|BDNFOS_uc009yiu.2_Intron|BDNFOS_uc009yiv.2_Intron|BDNFOS_uc009yiw.2_Intron|BDNFOS_uc009yix.2_Intron|BDNFOS_uc009yiy.2_Intron|BDNFOS_uc009yiz.2_Intron|BDNFOS_uc001mrq.3_Intron|BDNFOS_uc001mrr.3_Intron|BDNFOS_uc009yja.2_Intron|BDNFOS_uc009yjb.2_Intron|BDNF_uc010rdv.1_Silent_p.T163T|BDNF_uc001mrt.2_Silent_p.T178T|BDNF_uc010rdw.1_Silent_p.T163T|BDNF_uc009yjd.2_Silent_p.T163T|BDNF_uc001mru.2_Silent_p.T163T|BDNF_uc010rdx.1_Silent_p.T163T|BDNF_uc010rdy.1_Silent_p.T163T|BDNF_uc009yjg.2_Silent_p.T163T|BDNF_uc009yje.2_Silent_p.T245T|BDNF_uc009yjf.2_Silent_p.T192T|BDNF_uc001mrv.2_Silent_p.T163T|BDNF_uc001mrw.3_Silent_p.T163T|BDNF_uc001mrx.2_Silent_p.T163T|BDNF_uc001mry.3_Silent_p.T163T|BDNF_uc001mrz.3_Silent_p.T163T|BDNF_uc001msa.2_Silent_p.T171T	NM_001143816	NP_001137288	P23560	BDNF_HUMAN	brain-derived neurotrophic factor isoform a	163						extracellular region	growth factor activity				0																		---	---	---	---
IMMP1L	196294	broad.mit.edu	37	11	31477872	31477872	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31477872T>C	uc001msy.1	-	5	452	c.256A>G	c.(256-258)ATT>GTT	p.I86V	IMMP1L_uc001msz.1_Missense_Mutation_p.I86V|IMMP1L_uc009yjo.2_Missense_Mutation_p.I86V|IMMP1L_uc009yjp.2_RNA	NM_144981	NP_659418	Q96LU5	IMP1L_HUMAN	IMP1 inner mitochondrial membrane	86					proteolysis	mitochondrial inner membrane	serine-type peptidase activity				0	Lung SC(675;0.225)																	---	---	---	---
PAX6	5080	broad.mit.edu	37	11	31822302	31822302	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:31822302C>T	uc001mtd.3	-	6	1350	c.460G>A	c.(460-462)GGA>AGA	p.G154R	PAX6_uc001mte.3_Missense_Mutation_p.G154R|PAX6_uc001mtg.3_Missense_Mutation_p.G168R|PAX6_uc001mtf.3_Missense_Mutation_p.G154R|PAX6_uc001mth.3_Missense_Mutation_p.G154R|PAX6_uc009yjr.2_Missense_Mutation_p.G154R	NM_001127612	NP_001121084	P26367	PAX6_HUMAN	paired box gene 6 isoform a	154	Gln/Gly-rich.				blood vessel development|central nervous system development|cornea development in camera-type eye|glucose homeostasis|iris morphogenesis|negative regulation of neurogenesis|neuron fate commitment|pancreatic A cell development|positive regulation of transcription, DNA-dependent|response to wounding|visual perception	cytoplasm|nuclear chromatin	R-SMAD binding|RNA polymerase II core promoter sequence-specific DNA binding|sequence-specific DNA binding RNA polymerase II transcription factor activity|ubiquitin-protein ligase activity			lung(4)|ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	9	Lung SC(675;0.225)													Wilms_tumor-Aniridia-ambiguous_Genitals-mental_Retardation				---	---	---	---
COMMD9	29099	broad.mit.edu	37	11	36298658	36298658	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:36298658G>A	uc001mwn.3	-	4	370	c.333C>T	c.(331-333)ACC>ACT	p.T111T	COMMD9_uc009ykj.2_Silent_p.T69T|COMMD9_uc010rfb.1_Silent_p.T111T	NM_014186	NP_054905	Q9P000	COMD9_HUMAN	COMM domain containing 9 isoform 1	111										ovary(1)	1	all_lung(20;0.211)	all_hematologic(20;0.107)																---	---	---	---
TRAF6	7189	broad.mit.edu	37	11	36512014	36512014	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:36512014C>T	uc001mwr.1	-	8	1283	c.943G>A	c.(943-945)GAG>AAG	p.E315K	TRAF6_uc001mws.1_Missense_Mutation_p.E315K	NM_145803	NP_665802	Q9Y4K3	TRAF6_HUMAN	TNF receptor-associated factor 6	315	Potential.|Interaction with TAX1BP1.				activation of MAPK activity|activation of NF-kappaB-inducing kinase activity|anti-apoptosis|apoptosis|induction of apoptosis by extracellular signals|innate immune response|JNK cascade|membrane protein intracellular domain proteolysis|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|ossification|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-2 production|positive regulation of JUN kinase activity|positive regulation of NF-kappaB transcription factor activity|positive regulation of osteoclast differentiation|positive regulation of T cell cytokine production|protein autoubiquitination|protein K63-linked ubiquitination|response to interleukin-1|stress-activated MAPK cascade|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	CD40 receptor complex|cell cortex|cytosol|endosome membrane|internal side of plasma membrane|nuclear membrane	histone deacetylase binding|mitogen-activated protein kinase kinase kinase binding|protein kinase B binding|protein N-terminus binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1	all_lung(20;0.211)	all_hematologic(20;0.107)																---	---	---	---
ACCSL	390110	broad.mit.edu	37	11	44072905	44072905	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:44072905G>A	uc001mxw.1	+	4	712	c.656G>A	c.(655-657)CGG>CAG	p.R219Q	ACCSL_uc009ykr.2_Missense_Mutation_p.R38Q	NM_001031854	NP_001027025	Q4AC99	1A1L2_HUMAN	1-aminocyclopropane-1-carboxylate synthase	219							1-aminocyclopropane-1-carboxylate synthase activity|pyridoxal phosphate binding|transferase activity, transferring nitrogenous groups			ovary(5)	5																		---	---	---	---
PHF21A	51317	broad.mit.edu	37	11	45992812	45992812	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:45992812A>T	uc001ncc.3	-	7	1091	c.467T>A	c.(466-468)ATT>AAT	p.I156N	PHF21A_uc001ncb.3_Missense_Mutation_p.I156N|PHF21A_uc009ykx.2_Missense_Mutation_p.I156N|PHF21A_uc001nce.2_Missense_Mutation_p.I156N|PHF21A_uc001nca.1_Translation_Start_Site	NM_001101802	NP_001095272	Q96BD5	PF21A_HUMAN	BRAF35/HDAC2 complex isoform a	156					blood coagulation|chromatin modification|negative regulation of transcription from RNA polymerase II promoter|regulation of transcription, DNA-dependent|transcription, DNA-dependent	histone deacetylase complex	DNA binding|zinc ion binding			central_nervous_system(1)|skin(1)	2																		---	---	---	---
AGBL2	79841	broad.mit.edu	37	11	47689154	47689154	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47689154A>C	uc001ngg.2	-	15	2409	c.2309T>G	c.(2308-2310)ATG>AGG	p.M770R	AGBL2_uc001ngf.2_RNA|AGBL2_uc010rhq.1_Missense_Mutation_p.M732R	NM_024783	NP_079059	Q5U5Z8	CBPC2_HUMAN	carboxypeptidase 2, cytosolic	770					proteolysis	cytosol	metallocarboxypeptidase activity|zinc ion binding			ovary(2)	2																		---	---	---	---
FNBP4	23360	broad.mit.edu	37	11	47776215	47776215	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47776215G>A	uc009ylv.2	-	3	468	c.315C>T	c.(313-315)GGC>GGT	p.G105G	FNBP4_uc001ngj.2_Silent_p.G12G|FNBP4_uc001ngl.2_Intron	NM_015308	NP_056123	Q8N3X1	FNBP4_HUMAN	formin binding protein 4	105										ovary(1)	1																		---	---	---	---
TRIM48	79097	broad.mit.edu	37	11	55035844	55035844	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55035844T>C	uc010rid.1	+	4	660	c.574T>C	c.(574-576)TAC>CAC	p.Y192H		NM_024114	NP_077019	Q8IWZ4	TRI48_HUMAN	tripartite motif-containing 48	176						intracellular	zinc ion binding				0																		---	---	---	---
OR8I2	120586	broad.mit.edu	37	11	55860815	55860815	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55860815T>C	uc010rix.1	+	1	32	c.32T>C	c.(31-33)GTC>GCC	p.V11A		NM_001003750	NP_001003750	Q8N0Y5	OR8I2_HUMAN	olfactory receptor, family 8, subfamily I,	11	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			breast(1)	1	Esophageal squamous(21;0.00693)																	---	---	---	---
OR8H3	390152	broad.mit.edu	37	11	55890135	55890135	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55890135G>A	uc001nii.1	+	1	287	c.287G>A	c.(286-288)GGC>GAC	p.G96D		NM_001005201	NP_001005201	Q8N146	OR8H3_HUMAN	olfactory receptor, family 8, subfamily H,	96	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00693)																	---	---	---	---
OR5J2	282775	broad.mit.edu	37	11	55944530	55944530	+	Missense_Mutation	SNP	C	T	T	rs138599396	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55944530C>T	uc010rjb.1	+	1	437	c.437C>T	c.(436-438)ACA>ATA	p.T146I		NM_001005492	NP_001005492	Q8NH18	OR5J2_HUMAN	olfactory receptor, family 5, subfamily J,	146	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|large_intestine(1)|breast(1)|pancreas(1)	4	Esophageal squamous(21;0.00693)																	---	---	---	---
OR5T2	219464	broad.mit.edu	37	11	55999773	55999773	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55999773T>C	uc010rjc.1	-	1	889	c.889A>G	c.(889-891)ATG>GTG	p.M297V		NM_001004746	NP_001004746	Q8NGG2	OR5T2_HUMAN	olfactory receptor, family 5, subfamily T,	297	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00448)																	---	---	---	---
SERPING1	710	broad.mit.edu	37	11	57369521	57369521	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57369521C>A	uc001nkp.1	+	4	755	c.564C>A	c.(562-564)AAC>AAA	p.N188K	SERPING1_uc001nkq.1_Missense_Mutation_p.N188K|SERPING1_uc010rju.1_Missense_Mutation_p.N136K|SERPING1_uc010rjv.1_Missense_Mutation_p.N193K|SERPING1_uc001nkr.1_Missense_Mutation_p.N188K|SERPING1_uc009ymi.1_Missense_Mutation_p.N188K|SERPING1_uc009ymj.1_Missense_Mutation_p.N188K|SERPING1_uc001nks.1_5'UTR	NM_000062	NP_000053	P05155	IC1_HUMAN	serpin peptidase inhibitor, clade G, member 1	188					blood circulation|blood coagulation, intrinsic pathway|complement activation, classical pathway|innate immune response|negative regulation of complement activation, lectin pathway|platelet activation|platelet degranulation	extracellular space|platelet alpha granule lumen	protein binding|serine-type endopeptidase inhibitor activity			central_nervous_system(1)	1														Hereditary_Angioedema				---	---	---	---
OR10Q1	219960	broad.mit.edu	37	11	57995679	57995679	+	Silent	SNP	G	A	A	rs146817552	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57995679G>A	uc010rkd.1	-	1	669	c.669C>T	c.(667-669)TAC>TAT	p.Y223Y		NM_001004471	NP_001004471	Q8NGQ4	O10Q1_HUMAN	olfactory receptor, family 10, subfamily Q,	223	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2		Breast(21;0.0589)																---	---	---	---
FAM111B	374393	broad.mit.edu	37	11	58892216	58892216	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58892216T>G	uc001nnl.2	+	4	889	c.646T>G	c.(646-648)TTG>GTG	p.L216V	FAM111B_uc001nnm.2_Missense_Mutation_p.L186V|FAM111B_uc010rko.1_Missense_Mutation_p.L186V	NM_198947	NP_945185	Q6SJ93	F111B_HUMAN	hypothetical protein LOC374393 isoform a	216							catalytic activity			ovary(2)	2																		---	---	---	---
OSBP	5007	broad.mit.edu	37	11	59368824	59368824	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:59368824A>G	uc001noc.1	-	5	1536	c.1056T>C	c.(1054-1056)GAT>GAC	p.D352D	OSBP_uc009ymr.1_5'Flank	NM_002556	NP_002547	P22059	OSBP1_HUMAN	oxysterol binding protein	352					lipid transport	Golgi membrane	oxysterol binding			large_intestine(1)	1		all_epithelial(135;0.000236)		BRCA - Breast invasive adenocarcinoma(625;0.00607)|LUSC - Lung squamous cell carcinoma(625;0.207)														---	---	---	---
VWCE	220001	broad.mit.edu	37	11	61053785	61053785	+	Splice_Site	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61053785C>T	uc001nra.2	-	5	820	c.541_splice	c.e5+1	p.D181_splice	VWCE_uc001nrb.2_Splice_Site	NM_152718	NP_689931			von Willebrand factor C and EGF domains							extracellular region	calcium ion binding			ovary(1)	1																		---	---	---	---
INCENP	3619	broad.mit.edu	37	11	61908989	61908989	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61908989T>C	uc001nsw.1	+						INCENP_uc009ynw.1_Intron|INCENP_uc001nsx.1_Intron	NM_001040694	NP_001035784			inner centromere protein antigens 135/155kDa						chromosome segregation|cytokinesis|mitotic prometaphase	centromeric heterochromatin|condensed chromosome kinetochore|cytosol|microtubule|spindle	protein binding			lung(1)	1																		---	---	---	---
AHNAK	79026	broad.mit.edu	37	11	62284419	62284419	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62284419T>C	uc001ntl.2	-	5	17770	c.17470A>G	c.(17470-17472)ACC>GCC	p.T5824A	AHNAK_uc001ntk.1_Intron	NM_001620	NP_001611	Q09666	AHNK_HUMAN	AHNAK nucleoprotein isoform 1	5824					nervous system development	nucleus	protein binding			ovary(10)|pancreas(4)|skin(4)|upper_aerodigestive_tract(1)	19		Melanoma(852;0.155)																---	---	---	---
UBXN1	51035	broad.mit.edu	37	11	62445451	62445451	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62445451G>A	uc001nul.1	-	5	562	c.430C>T	c.(430-432)CGC>TGC	p.R144C	UBXN1_uc001nuj.2_Missense_Mutation_p.R144C|UBXN1_uc001num.1_Missense_Mutation_p.R144C|UBXN1_uc001nuk.2_Missense_Mutation_p.R109C|UBXN1_uc010rme.1_Missense_Mutation_p.R144C|UBXN1_uc010rmf.1_3'UTR	NM_015853	NP_056937	Q04323	UBXN1_HUMAN	UBX domain protein 1	144	Potential.|Interaction with BRCA1.				negative regulation of proteasomal ubiquitin-dependent protein catabolic process|negative regulation of protein ubiquitination|proteasomal ubiquitin-dependent protein catabolic process	cytoplasm	ATPase binding|K6-linked polyubiquitin binding				0																		---	---	---	---
CHRM1	1128	broad.mit.edu	37	11	62677433	62677433	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:62677433C>T	uc001nwi.2	-	2	1541	c.1140G>A	c.(1138-1140)CCG>CCA	p.P380P		NM_000738	NP_000729	P11229	ACM1_HUMAN	cholinergic receptor, muscarinic 1	380	Helical; Name=6; (By similarity).				activation of phospholipase C activity by muscarinic acetylcholine receptor signaling pathway|activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|cell proliferation|nervous system development|positive regulation of cell proliferation|protein modification process	cell junction|integral to plasma membrane|membrane fraction|postsynaptic membrane	muscarinic acetylcholine receptor activity|phosphatidylinositol phospholipase C activity|protein binding				0					Anisotropine Methylbromide(DB00517)|Atropine(DB00572)|Benzquinamide(DB00767)|Benztropine(DB00245)|Bethanechol(DB01019)|Biperiden(DB00810)|Buclizine(DB00354)|Carbachol(DB00411)|Carbinoxamine(DB00748)|Cevimeline(DB00185)|Clidinium(DB00771)|Cryptenamine(DB00785)|Cyclizine(DB01176)|Cyclopentolate(DB00979)|Cycrimine(DB00942)|Desipramine(DB01151)|Dicyclomine(DB00804)|Diphenidol(DB01231)|Doxylamine(DB00366)|Ethopropazine(DB00392)|Flavoxate(DB01148)|Glycopyrrolate(DB00986)|Homatropine Methylbromide(DB00725)|Hyoscyamine(DB00424)|Ipratropium(DB00332)|Methantheline(DB00940)|Methotrimeprazine(DB01403)|Methylscopolamine(DB00462)|Metixene(DB00340)|Metoclopramide(DB01233)|Olanzapine(DB00334)|Oxybutynin(DB01062)|Oxyphencyclimine(DB00383)|Oxyphenonium(DB00219)|Pilocarpine(DB01085)|Pirenzepine(DB00670)|Procyclidine(DB00387)|Promazine(DB00420)|Promethazine(DB01069)|Propantheline(DB00782)|Propiomazine(DB00777)|Quinacrine(DB01103)|Scopolamine(DB00747)|Solifenacin(DB01591)|Succinylcholine(DB00202)|Thiethylperazine(DB00372)|Tolterodine(DB01036)|Tridihexethyl(DB00505)|Triflupromazine(DB00508)|Trihexyphenidyl(DB00376)|Trospium(DB00209)													---	---	---	---
HRASLS5	117245	broad.mit.edu	37	11	63256439	63256439	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63256439A>G	uc001nwy.2	-	3	453	c.279T>C	c.(277-279)GCT>GCC	p.A93A	HRASLS5_uc001nwz.2_Silent_p.A83A|HRASLS5_uc010rmq.1_Silent_p.A93A|HRASLS5_uc009yos.2_Intron	NM_054108	NP_473449	Q96KN8	HRSL5_HUMAN	HRAS-like suppressor family, member 5 isoform 1	93										ovary(1)	1																		---	---	---	---
RCOR2	283248	broad.mit.edu	37	11	63680357	63680357	+	Silent	SNP	T	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63680357T>A	uc001nyc.2	-	9	1342	c.954A>T	c.(952-954)CCA>CCT	p.P318P		NM_173587	NP_775858	Q8IZ40	RCOR2_HUMAN	REST corepressor 2	318					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(1)|skin(1)	2																		---	---	---	---
FLRT1	23769	broad.mit.edu	37	11	63884462	63884462	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:63884462C>T	uc001nyi.1	+	2	1064	c.723C>T	c.(721-723)GAC>GAT	p.D241D	MACROD1_uc001nyh.2_Intron	NM_013280	NP_037412	Q9NZU1	FLRT1_HUMAN	fibronectin leucine rich transmembrane protein	213	Extracellular (Potential).|LRR 7.				cell adhesion	integral to plasma membrane|proteinaceous extracellular matrix	protein binding, bridging|receptor signaling protein activity				0																		---	---	---	---
EHD1	10938	broad.mit.edu	37	11	64621945	64621945	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64621945C>T	uc001obu.1	-	5	1720	c.1465G>A	c.(1465-1467)GAC>AAC	p.D489N	EHD1_uc001obt.1_Missense_Mutation_p.D172N|EHD1_uc001obv.1_Missense_Mutation_p.D489N|EHD1_uc010rnq.1_Missense_Mutation_p.D503N	NM_006795	NP_006786	Q9H4M9	EHD1_HUMAN	EH-domain containing 1	489	EH.|EF-hand.|				blood coagulation|cholesterol homeostasis|endocytic recycling|intracellular protein transport|low-density lipoprotein particle clearance|positive regulation of cholesterol storage|protein homooligomerization	early endosome membrane|lipid particle|plasma membrane|platelet dense tubular network membrane|recycling endosome membrane	ATP binding|calcium ion binding|GTP binding|GTPase activity|protein binding				0																		---	---	---	---
SCYL1	57410	broad.mit.edu	37	11	65298178	65298178	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65298178C>T	uc001oea.1	+	7	1005	c.928C>T	c.(928-930)CGG>TGG	p.R310W	SCYL1_uc009yqk.2_Missense_Mutation_p.R310W|SCYL1_uc001oeb.1_Missense_Mutation_p.R310W|SCYL1_uc001oec.1_Missense_Mutation_p.R310W|SCYL1_uc001oed.1_Missense_Mutation_p.R167W|SCYL1_uc001oee.1_5'UTR	NM_020680	NP_065731	Q96KG9	NTKL_HUMAN	SCY1-like 1 isoform A	310	Protein kinase.				regulation of transcription, DNA-dependent|retrograde vesicle-mediated transport, Golgi to ER|transcription, DNA-dependent	cis-Golgi network|COPI vesicle coat|ER-Golgi intermediate compartment|microtubule organizing center|nucleus	ATP binding|DNA binding|protein tyrosine kinase activity			skin(1)	1																		---	---	---	---
PCNXL3	399909	broad.mit.edu	37	11	65396147	65396147	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65396147G>A	uc001oey.2	+	23	3784	c.3784G>A	c.(3784-3786)GCT>ACT	p.A1262T	PCNXL3_uc001oez.2_Missense_Mutation_p.A149T	NM_032223	NP_115599	Q9H6A9	PCX3_HUMAN	pecanex-like 3	1262	Helical; (Potential).					integral to membrane					0																		---	---	---	---
RIN1	9610	broad.mit.edu	37	11	66102465	66102465	+	Missense_Mutation	SNP	C	T	T	rs141270180	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66102465C>T	uc001ohn.1	-	6	932	c.805G>A	c.(805-807)GTG>ATG	p.V269M	RIN1_uc010roy.1_Translation_Start_Site|RIN1_uc009yrd.1_Translation_Start_Site|RIN1_uc010roz.1_Missense_Mutation_p.V164M|RIN1_uc010rpa.1_Missense_Mutation_p.V164M	NM_004292	NP_004283	Q13671	RIN1_HUMAN	ras inhibitor RIN1	269					endocytosis|signal transduction	cytoplasm|cytoskeleton|plasma membrane	GTPase activator activity|protein binding			lung(2)|breast(1)	3																		---	---	---	---
UNC93B1	81622	broad.mit.edu	37	11	67766761	67766761	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67766761T>C	uc001omw.1	-	5	649	c.569A>G	c.(568-570)TAC>TGC	p.Y190C		NM_030930	NP_112192	Q9H1C4	UN93B_HUMAN	unc-93 homolog B1	190					innate immune response|intracellular protein transport|response to virus|toll-like receptor 3 signaling pathway|toll-like receptor 7 signaling pathway|toll-like receptor 9 signaling pathway	early phagosome|endoplasmic reticulum membrane|endosome|integral to membrane|lysosome					0																		---	---	---	---
MRGPRD	116512	broad.mit.edu	37	11	68747812	68747812	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68747812T>C	uc010rqf.1	-	1	644	c.644A>G	c.(643-645)CAG>CGG	p.Q215R		NM_198923	NP_944605	Q8TDS7	MRGRD_HUMAN	MAS-related GPR, member D	215	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			pancreas(1)	1			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)															---	---	---	---
TPCN2	219931	broad.mit.edu	37	11	68822754	68822754	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68822754C>A	uc001oos.2	+	4	479	c.363C>A	c.(361-363)CCC>CCA	p.P121P	TPCN2_uc009ysk.1_RNA|TPCN2_uc001oor.2_Intron|TPCN2_uc010rqg.1_Silent_p.P121P	NM_139075	NP_620714	Q8NHX9	TPC2_HUMAN	two pore segment channel 2	121	Extracellular (Potential).				cellular calcium ion homeostasis|smooth muscle contraction	endosome membrane|integral to membrane|lysosomal membrane	NAADP-sensitive calcium-release channel activity|voltage-gated calcium channel activity				0			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)															---	---	---	---
GDPD5	81544	broad.mit.edu	37	11	75160160	75160160	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:75160160C>A	uc001owo.3	-	10	1113	c.576G>T	c.(574-576)CAG>CAT	p.Q192H	GDPD5_uc001owp.3_Missense_Mutation_p.Q192H|GDPD5_uc001own.3_Translation_Start_Site|GDPD5_uc009yuc.2_Missense_Mutation_p.Q54H|GDPD5_uc009yud.2_Missense_Mutation_p.Q73H|GDPD5_uc009yue.1_Missense_Mutation_p.Q80H	NM_030792	NP_110419	Q8WTR4	GDPD5_HUMAN	glycerophosphodiester phosphodiesterase domain	192	Cytoplasmic (Potential).				glycerol metabolic process|lipid metabolic process|nervous system development	endomembrane system|growth cone|integral to membrane|perinuclear region of cytoplasm	glycerophosphodiester phosphodiesterase activity			ovary(1)	1																		---	---	---	---
CCDC67	159989	broad.mit.edu	37	11	93148249	93148249	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:93148249C>A	uc001pdq.2	+	13	1707	c.1607C>A	c.(1606-1608)CCT>CAT	p.P536H	CCDC67_uc001pdo.1_Missense_Mutation_p.P536H	NM_181645	NP_857596	Q05D60	CCD67_HUMAN	coiled-coil domain containing 67	536										ovary(1)	1		Acute lymphoblastic leukemia(157;2.35e-05)|all_hematologic(158;0.00824)																---	---	---	---
CASP5	838	broad.mit.edu	37	11	104878019	104878019	+	Missense_Mutation	SNP	A	G	G	rs45585331	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:104878019A>G	uc010rva.1	-	3	256	c.224T>C	c.(223-225)CTG>CCG	p.L75P	CASP5_uc010ruz.1_Missense_Mutation_p.L88P|CASP5_uc010rvb.1_Missense_Mutation_p.L17P|CASP5_uc010rvc.1_Intron|CASP5_uc009yxh.2_5'UTR|CASP5_uc010rvd.1_Intron	NM_004347	NP_004338	P51878	CASP5_HUMAN	caspase 5 isoform a precursor	75	CARD.		L -> R.		apoptosis|cellular response to mechanical stimulus|proteolysis|regulation of apoptosis	intracellular	cysteine-type endopeptidase activity|protein binding			ovary(2)|lung(1)	3		Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.0017)|Melanoma(852;0.0047)		BRCA - Breast invasive adenocarcinoma(274;0.000943)|Epithelial(105;0.0104)|all cancers(92;0.042)														---	---	---	---
ALKBH8	91801	broad.mit.edu	37	11	107427670	107427670	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:107427670C>T	uc010rvr.1	-	3	264	c.189G>A	c.(187-189)CCG>CCA	p.P63P	ALKBH8_uc010rvq.1_5'UTR|ALKBH8_uc009yxp.2_Silent_p.P63P|ALKBH8_uc001pjl.2_RNA	NM_138775	NP_620130	Q96BT7	ALKB8_HUMAN	alkB, alkylation repair homolog 8	63	RRM.				response to DNA damage stimulus	cytosol|nucleus	metal ion binding|nucleotide binding|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors|protein binding|RNA binding|tRNA (uracil) methyltransferase activity				0		Melanoma(852;0.000288)|Acute lymphoblastic leukemia(157;0.000966)|all_hematologic(158;0.00301)|all_epithelial(67;0.00512)|Breast(348;0.104)		BRCA - Breast invasive adenocarcinoma(274;3.53e-05)|Epithelial(105;0.00029)|all cancers(92;0.00518)														---	---	---	---
DDX10	1662	broad.mit.edu	37	11	108811067	108811067	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:108811067G>T	uc001pkm.2	+	18	2610	c.2545G>T	c.(2545-2547)GAC>TAC	p.D849Y		NM_004398	NP_004389	Q13206	DDX10_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 10	849							ATP binding|ATP-dependent helicase activity|RNA binding|RNA helicase activity			breast(2)|lung(1)|prostate(1)	4		all_cancers(61;1.29e-11)|all_epithelial(67;2.96e-07)|Melanoma(852;1.54e-05)|Acute lymphoblastic leukemia(157;4.24e-05)|all_hematologic(158;0.000141)|Breast(348;0.026)|all_neural(223;0.0729)		BRCA - Breast invasive adenocarcinoma(274;2.48e-05)|Epithelial(105;4.35e-05)|all cancers(92;0.000609)|OV - Ovarian serous cystadenocarcinoma(223;0.133)				T	NUP98	AML*								---	---	---	---
RBM7	10179	broad.mit.edu	37	11	114278448	114278448	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:114278448G>T	uc001pov.2	+	5	730	c.720G>T	c.(718-720)AGG>AGT	p.R240S	RBM7_uc001pow.2_Missense_Mutation_p.R241S|RBM7_uc001pox.2_Missense_Mutation_p.R120S	NM_016090	NP_057174	Q9Y580	RBM7_HUMAN	RNA binding motif protein 7	240					meiosis		nucleotide binding|protein binding|RNA binding			ovary(2)	2		all_cancers(61;5.06e-12)|all_epithelial(67;5.3e-06)|all_hematologic(158;7.68e-05)|Acute lymphoblastic leukemia(157;0.000966)|Melanoma(852;0.00153)|Medulloblastoma(222;0.0523)|all_neural(223;0.0663)|Breast(348;0.0818)|Prostate(24;0.104)		BRCA - Breast invasive adenocarcinoma(274;2.56e-06)|Epithelial(105;4.17e-05)|all cancers(92;0.000348)														---	---	---	---
ZNF259	8882	broad.mit.edu	37	11	116655132	116655132	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:116655132C>T	uc001ppp.2	-	9	886	c.853G>A	c.(853-855)GCT>ACT	p.A285T	ZNF259_uc009yzd.2_Missense_Mutation_p.A285T|ZNF259_uc001ppq.2_Missense_Mutation_p.A215T	NM_003904	NP_003895	O75312	ZPR1_HUMAN	zinc finger protein 259	285	C4-type 2.				cell proliferation|signal transduction	cytoplasm|nucleolus					0	all_hematologic(175;0.0487)	all_cancers(61;1.72e-06)|all_epithelial(67;0.000735)|Melanoma(852;0.022)|Acute lymphoblastic leukemia(157;0.0255)|Medulloblastoma(222;0.0523)|Breast(348;0.056)|all_hematologic(158;0.0588)		BRCA - Breast invasive adenocarcinoma(274;1.49e-06)|Epithelial(105;5.61e-06)|all cancers(92;0.000139)|OV - Ovarian serous cystadenocarcinoma(223;0.153)														---	---	---	---
RNF214	257160	broad.mit.edu	37	11	117152818	117152818	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:117152818G>A	uc001pqt.2	+	11	1589	c.1544G>A	c.(1543-1545)GGT>GAT	p.G515D	RNF214_uc001pqu.2_Missense_Mutation_p.G515D|RNF214_uc010rxf.1_Missense_Mutation_p.G360D	NM_207343	NP_997226	Q8ND24	RN214_HUMAN	ring finger protein 214	515	Pro-rich.						zinc ion binding				0	all_hematologic(175;0.0487)	Breast(348;0.00908)|Medulloblastoma(222;0.0425)|all_hematologic(192;0.196)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;1.88e-05)|Epithelial(105;0.000397)|all cancers(92;0.00258)														---	---	---	---
SCN2B	6327	broad.mit.edu	37	11	118038845	118038845	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118038845G>A	uc001psf.2	-	3	594	c.403C>T	c.(403-405)CGC>TGC	p.R135C		NM_004588	NP_004579	O60939	SCN2B_HUMAN	sodium channel, voltage-gated, type II, beta	135	Ig-like C2-type.|Extracellular (Potential).				synaptic transmission	voltage-gated sodium channel complex	voltage-gated sodium channel activity				0	all_hematologic(175;0.046)	Medulloblastoma(222;0.0425)|Breast(348;0.181)|all_hematologic(192;0.196)|all_neural(223;0.234)		BRCA - Breast invasive adenocarcinoma(274;3.19e-05)|Epithelial(105;0.00117)														---	---	---	---
CXCR5	643	broad.mit.edu	37	11	118765004	118765004	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118765004C>T	uc001pue.3	+	2	861	c.751C>T	c.(751-753)CGC>TGC	p.R251C	CXCR5_uc001puf.2_Missense_Mutation_p.R206C	NM_001716	NP_001707	P32302	CXCR5_HUMAN	Burkitt lymphoma receptor 1 isoform 1	251	Cytoplasmic (Potential).				B cell activation|cellular component movement	integral to plasma membrane	C-X-C chemokine receptor activity			breast(1)	1	all_hematologic(175;0.0839)	Medulloblastoma(222;0.0425)|all_hematologic(192;0.103)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;7.62e-05)														---	---	---	---
VPS11	55823	broad.mit.edu	37	11	118951928	118951928	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118951928T>C	uc010ryx.1	+	16	2607	c.2565T>C	c.(2563-2565)GCT>GCC	p.A855A	VPS11_uc010ryy.1_Silent_p.A701A	NM_021729	NP_068375	Q9H270	VPS11_HUMAN	vacuolar protein sorting 11	855	RING-type.				protein transport	endocytic vesicle|HOPS complex|late endosome membrane|lysosomal membrane	nucleotide binding|protein binding|zinc ion binding			ovary(2)|central_nervous_system(1)	3	all_hematologic(175;0.0839)	Medulloblastoma(222;0.0425)|Breast(348;0.052)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;7.88e-05)														---	---	---	---
OAF	220323	broad.mit.edu	37	11	120097609	120097609	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:120097609G>T	uc001pxb.2	+	3	692	c.451G>T	c.(451-453)GGG>TGG	p.G151W		NM_178507	NP_848602	Q86UD1	OAF_HUMAN	OAF homolog precursor	151											0		Breast(109;0.00663)|Medulloblastoma(222;0.0523)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;5.1e-06)														---	---	---	---
BSX	390259	broad.mit.edu	37	11	122848567	122848567	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:122848567C>T	uc010rzs.1	-	3	492	c.492G>A	c.(490-492)AAG>AAA	p.K164K		NM_001098169	NP_001091639	Q3C1V8	BSH_HUMAN	brain specific homeobox	164	Homeobox.										0		Breast(109;0.00249)|Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0361)														---	---	---	---
OR10S1	219873	broad.mit.edu	37	11	123847892	123847892	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123847892G>A	uc001pzm.1	-	1	507	c.507C>T	c.(505-507)CAC>CAT	p.H169H		NM_001004474	NP_001004474	Q8NGN2	O10S1_HUMAN	olfactory receptor, family 10, subfamily S,	169	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0399)														---	---	---	---
OR10G4	390264	broad.mit.edu	37	11	123886291	123886291	+	Missense_Mutation	SNP	G	A	A	rs138655388		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123886291G>A	uc010sac.1	+	1	10	c.10G>A	c.(10-12)GCC>ACC	p.A4T		NM_001004462	NP_001004462	Q8NGN3	O10G4_HUMAN	olfactory receptor, family 10, subfamily G,	4	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)|central_nervous_system(1)	4		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0401)														---	---	---	---
VWA5A	4013	broad.mit.edu	37	11	123988930	123988930	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123988930G>A	uc001pzu.2	+	5	490	c.281G>A	c.(280-282)GGC>GAC	p.G94D	VWA5A_uc001pzr.2_Missense_Mutation_p.G94D|VWA5A_uc001pzs.2_Missense_Mutation_p.G94D|VWA5A_uc010sae.1_Missense_Mutation_p.G110D|VWA5A_uc001pzt.2_Missense_Mutation_p.G94D	NM_001130142	NP_001123614	O00534	VMA5A_HUMAN	BCSC-1 isoform 1	94	VIT.									upper_aerodigestive_tract(1)|ovary(1)	2																		---	---	---	---
Unknown	0	broad.mit.edu	37	11	124135700	124135700	+	IGR	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124135700C>T								OR8G2 (39390 upstream) : OR8D1 (44037 downstream)																																			---	---	---	---
OR8B4	283162	broad.mit.edu	37	11	124294398	124294398	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124294398C>T	uc010sak.1	-	1	370	c.370G>A	c.(370-372)GCC>ACC	p.A124T		NM_001005196	NP_001005196	Q96RC9	OR8B4_HUMAN	olfactory receptor, family 8, subfamily B,	124	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(1)	1		Breast(109;0.0115)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;1.49e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0279)														---	---	---	---
DDX25	29118	broad.mit.edu	37	11	125778397	125778397	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:125778397A>G	uc001qcz.3	+	6	647	c.506A>G	c.(505-507)CAG>CGG	p.Q169R	DDX25_uc010sbk.1_Missense_Mutation_p.Q169R	NM_013264	NP_037396	Q9UHL0	DDX25_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 25	169	Helicase ATP-binding.				mRNA export from nucleus|multicellular organismal development|regulation of translation|spermatid development	chromatoid body|nucleus	ATP binding|ATP-dependent RNA helicase activity|RNA binding			ovary(1)	1	all_hematologic(175;0.177)	Breast(109;0.0021)|all_lung(97;0.0203)|Lung NSC(97;0.0203)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.14e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.046)														---	---	---	---
KIRREL3	84623	broad.mit.edu	37	11	126306785	126306785	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:126306785G>A	uc001qea.2	-	12	1834	c.1473C>T	c.(1471-1473)GCC>GCT	p.A491A	KIRREL3_uc001qeb.2_Silent_p.A491A|KIRREL3_uc001qec.1_Silent_p.A491A|ST3GAL4_uc001qdx.1_Intron	NM_032531	NP_115920	Q8IZU9	KIRR3_HUMAN	kin of IRRE like 3 isoform 1	491	Extracellular (Potential).|Ig-like C2-type 5.				hemopoiesis	extracellular region|integral to membrane|plasma membrane	protein binding			ovary(3)	3	all_hematologic(175;0.145)	Lung NSC(97;0.0484)|all_lung(97;0.0522)|Medulloblastoma(222;0.0523)|Breast(109;0.0949)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;6.03e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.12)														---	---	---	---
APLP2	334	broad.mit.edu	37	11	130013273	130013273	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:130013273A>G	uc010sby.1	+	18	2379	c.2222A>G	c.(2221-2223)CAC>CGC	p.H741R	APLP2_uc001qfp.2_Missense_Mutation_p.H729R|APLP2_uc001qfq.2_Missense_Mutation_p.H673R|APLP2_uc010sbz.1_Missense_Mutation_p.H529R|APLP2_uc001qfr.2_Missense_Mutation_p.H495R|APLP2_uc001qfs.2_Missense_Mutation_p.H500R|APLP2_uc001qfv.2_Missense_Mutation_p.H632R|APLP2_uc009zcv.2_Missense_Mutation_p.H89R	NM_001642	NP_001633	Q06481	APLP2_HUMAN	amyloid beta (A4) precursor-like protein 2	741	Cytoplasmic (Potential).				G-protein coupled receptor protein signaling pathway	integral to membrane|nucleus|plasma membrane	DNA binding|identical protein binding|serine-type endopeptidase inhibitor activity			ovary(3)	3	all_hematologic(175;0.0429)	Breast(109;0.00586)|Lung NSC(97;0.00785)|all_lung(97;0.0154)|Medulloblastoma(222;0.0523)|all_neural(223;0.186)		OV - Ovarian serous cystadenocarcinoma(99;0.0197)|Lung(977;0.24)														---	---	---	---
ADAMTS8	11095	broad.mit.edu	37	11	130278368	130278368	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:130278368G>A	uc001qgg.3	-	8	2448	c.2090C>T	c.(2089-2091)ACC>ATC	p.T697I	ADAMTS8_uc001qgf.2_Missense_Mutation_p.T178I	NM_007037	NP_008968	Q9UP79	ATS8_HUMAN	ADAM metallopeptidase with thrombospondin type 1	697	Spacer.				negative regulation of cell proliferation|proteolysis	proteinaceous extracellular matrix	heparin binding|integrin binding|low affinity phosphate transmembrane transporter activity|metalloendopeptidase activity|zinc ion binding			central_nervous_system(1)	1	all_hematologic(175;0.0429)	Lung NSC(97;0.000601)|Breast(109;0.000962)|all_lung(97;0.00125)|Medulloblastoma(222;0.0425)|all_neural(223;0.0837)		OV - Ovarian serous cystadenocarcinoma(99;0.039)|Lung(977;0.213)														---	---	---	---
NCAPD3	23310	broad.mit.edu	37	11	134037945	134037945	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:134037945G>A	uc001qhd.1	-	27	4125	c.3519C>T	c.(3517-3519)GAC>GAT	p.D1173D	NCAPD3_uc010scm.1_RNA|NCAPD3_uc009zda.1_RNA|NCAPD3_uc001qhc.1_Silent_p.D123D	NM_015261	NP_056076	P42695	CNDD3_HUMAN	non-SMC condensin II complex, subunit D3	1173					cell division|mitotic chromosome condensation	nuclear centromeric heterochromatin|nuclear condensin complex	methylated histone residue binding			ovary(2)|upper_aerodigestive_tract(1)|lung(1)|kidney(1)	5	all_hematologic(175;0.127)	all_cancers(12;1.68e-21)|all_epithelial(12;5.86e-16)|all_lung(97;1.19e-05)|Lung NSC(97;2.76e-05)|Breast(109;0.000182)|Medulloblastoma(222;0.0245)|all_neural(223;0.0505)|Esophageal squamous(93;0.0559)		Epithelial(10;8.74e-10)|BRCA - Breast invasive adenocarcinoma(10;1e-08)|all cancers(11;1.46e-08)|OV - Ovarian serous cystadenocarcinoma(99;0.00345)|Lung(977;0.227)														---	---	---	---
VPS26B	112936	broad.mit.edu	37	11	134104900	134104900	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:134104900C>T	uc001qhe.2	+	2	789	c.333C>T	c.(331-333)CAC>CAT	p.H111H		NM_052875	NP_443107	Q4G0F5	VP26B_HUMAN	vacuolar protein sorting 26 homolog B	111					protein transport|vacuolar transport	cytosol|retromer complex					0	all_hematologic(175;0.127)	all_cancers(12;1.1e-21)|all_epithelial(12;3.77e-16)|all_lung(97;1.19e-05)|Lung NSC(97;2.76e-05)|Breast(109;0.000182)|Medulloblastoma(222;0.0245)|all_neural(223;0.0505)|Esophageal squamous(93;0.0559)		Epithelial(10;2.43e-10)|all cancers(11;2.94e-09)|BRCA - Breast invasive adenocarcinoma(10;9.57e-09)|OV - Ovarian serous cystadenocarcinoma(99;0.00164)|Lung(977;0.216)														---	---	---	---
ACAD8	27034	broad.mit.edu	37	11	134131231	134131231	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:134131231C>T	uc001qhk.2	+	8	965	c.904C>T	c.(904-906)CGG>TGG	p.R302W	ACAD8_uc010scp.1_RNA|ACAD8_uc010scq.1_Missense_Mutation_p.R225W|ACAD8_uc001qhl.2_Missense_Mutation_p.R175W	NM_014384	NP_055199	Q9UKU7	ACAD8_HUMAN	acyl-Coenzyme A dehydrogenase family, member 8	302		FAD; shared with dimeric partner.	R -> Q (in IBDD; complete loss of activity).		branched chain family amino acid catabolic process|lipid metabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	mitochondrial matrix	acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding				0	all_hematologic(175;0.127)	all_cancers(12;8e-23)|all_epithelial(12;2.59e-16)|all_lung(97;1.19e-05)|Lung NSC(97;2.76e-05)|Breast(109;0.000182)|all_neural(223;0.0189)|Medulloblastoma(222;0.0245)|Esophageal squamous(93;0.0559)		Epithelial(10;1.92e-10)|all cancers(11;2.26e-09)|BRCA - Breast invasive adenocarcinoma(10;8.73e-09)|OV - Ovarian serous cystadenocarcinoma(99;0.00154)|Lung(977;0.21)														---	---	---	---
CCDC77	84318	broad.mit.edu	37	12	520943	520943	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:520943C>T	uc001qig.2	+	4	249	c.69C>T	c.(67-69)GCC>GCT	p.A23A	CCDC77_uc009zdk.2_5'UTR|CCDC77_uc010sdp.1_5'UTR|CCDC77_uc010sdq.1_5'UTR	NM_032358	NP_115734	Q9BR77	CCD77_HUMAN	coiled-coil domain containing 77 isoform a	23						centrosome				ovary(1)	1	all_cancers(10;0.0149)|all_epithelial(11;0.035)|all_lung(10;0.111)|Ovarian(42;0.142)|Lung NSC(10;0.156)		OV - Ovarian serous cystadenocarcinoma(31;0.00123)|BRCA - Breast invasive adenocarcinoma(9;0.033)															---	---	---	---
ERC1	23085	broad.mit.edu	37	12	1137726	1137726	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:1137726G>T	uc001qjb.2	+	2	898	c.657G>T	c.(655-657)CAG>CAT	p.Q219H	ERC1_uc001qiz.2_RNA|ERC1_uc001qjc.2_Missense_Mutation_p.Q219H|ERC1_uc001qja.2_RNA|ERC1_uc001qjd.2_RNA|ERC1_uc001qjf.2_Missense_Mutation_p.Q219H	NM_178040	NP_829884	Q8IUD2	RB6I2_HUMAN	RAB6-interacting protein 2 isoform epsilon	219	Potential.				I-kappaB phosphorylation|multicellular organismal development|positive regulation of anti-apoptosis|positive regulation of NF-kappaB transcription factor activity|protein transport	Golgi membrane|IkappaB kinase complex|presynaptic membrane	leucine zipper domain binding			ovary(2)|lung(2)|breast(1)	5	all_epithelial(11;0.0698)|Ovarian(42;0.107)		OV - Ovarian serous cystadenocarcinoma(31;0.00239)|BRCA - Breast invasive adenocarcinoma(9;0.0567)															---	---	---	---
FGF6	2251	broad.mit.edu	37	12	4553334	4553334	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:4553334C>T	uc001qmr.1	-	2	459	c.415G>A	c.(415-417)GTT>ATT	p.V139I		NM_020996	NP_066276	P10767	FGF6_HUMAN	fibroblast growth factor 6 precursor	139					angiogenesis|cell proliferation|cell-cell signaling|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|positive regulation of cell division|positive regulation of cell proliferation	extracellular space	growth factor activity			lung(2)|ovary(1)	3			Colorectal(7;0.00165)|COAD - Colon adenocarcinoma(12;0.0229)															---	---	---	---
KCNA1	3736	broad.mit.edu	37	12	5021140	5021140	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:5021140C>T	uc001qnh.2	+	2	1701	c.596C>T	c.(595-597)ACG>ATG	p.T199M		NM_000217	NP_000208	Q09470	KCNA1_HUMAN	potassium voltage-gated channel subfamily A	199					synaptic transmission	juxtaparanode region of axon|voltage-gated potassium channel complex	delayed rectifier potassium channel activity|potassium ion transmembrane transporter activity			ovary(1)|skin(1)	2					Desflurane(DB01189)|Enflurane(DB00228)|Isoflurane(DB00753)|Methoxyflurane(DB01028)|Sevoflurane(DB01236)													---	---	---	---
SCNN1A	6337	broad.mit.edu	37	12	6472695	6472695	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6472695C>T	uc001qnx.2	-	3	887	c.598G>A	c.(598-600)GCC>ACC	p.A200T	SCNN1A_uc001qnv.2_5'UTR|SCNN1A_uc001qnw.2_Missense_Mutation_p.A259T|SCNN1A_uc010sfb.1_Missense_Mutation_p.A223T	NM_001038	NP_001029	P37088	SCNNA_HUMAN	sodium channel, nonvoltage-gated 1 alpha isoform	200	Extracellular (By similarity).				excretion|response to stimulus|sensory perception of taste	apical plasma membrane	WW domain binding				0					Amiloride(DB00594)|Triamterene(DB00384)													---	---	---	---
PTPN6	5777	broad.mit.edu	37	12	7066809	7066809	+	Intron	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7066809C>A	uc001qsb.2	+						PTPN6_uc001qsa.1_Intron|PTPN6_uc010sfr.1_Intron|PTPN6_uc009zfl.1_Intron|PTPN6_uc010sfs.1_Intron	NM_002831	NP_002822			protein tyrosine phosphatase, non-receptor type						apoptosis|cell junction assembly|G-protein coupled receptor protein signaling pathway|interferon-gamma-mediated signaling pathway|leukocyte migration|negative regulation of peptidyl-tyrosine phosphorylation|platelet activation|positive regulation of cell proliferation|positive regulation of phosphatidylinositol 3-kinase cascade|regulation of G1/S transition of mitotic cell cycle|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|T cell costimulation|type I interferon-mediated signaling pathway	cytosol|membrane|nucleus	protein binding|protein tyrosine phosphatase activity			breast(1)	1																		---	---	---	---
LPCAT3	10162	broad.mit.edu	37	12	7087667	7087667	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7087667T>G	uc001qsi.2	-	9	990	c.876A>C	c.(874-876)GAA>GAC	p.E292D	EMG1_uc010sfv.1_Intron|LPCAT3_uc010sfw.1_Missense_Mutation_p.E186D|LPCAT3_uc009zfp.2_RNA|LPCAT3_uc010sfx.1_RNA|LPCAT3_uc009zfq.1_Missense_Mutation_p.E150D	NM_005768	NP_005759	Q6P1A2	MBOA5_HUMAN	lysophosphatidylcholine acyltransferase 3	292	Helical; (Potential).				phospholipid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	1-acylglycerophosphocholine O-acyltransferase activity			ovary(1)	1																		---	---	---	---
RBP5	83758	broad.mit.edu	37	12	7277310	7277310	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7277310T>C	uc001qsq.2	-	3	364	c.269A>G	c.(268-270)GAG>GGG	p.E90G		NM_031491	NP_113679	P82980	RET5_HUMAN	retinol binding protein 5, cellular	90						cytoplasm	retinal binding|retinol binding|transporter activity			ovary(1)	1					Vitamin A(DB00162)													---	---	---	---
CLSTN3	9746	broad.mit.edu	37	12	7310180	7310180	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7310180C>T	uc001qsr.2	+	17	2901	c.2623C>T	c.(2623-2625)CGC>TGC	p.R875C	CLSTN3_uc001qss.2_Missense_Mutation_p.R887C|CLSTN3_uc001qst.2_Missense_Mutation_p.R283C	NM_014718	NP_055533	Q9BQT9	CSTN3_HUMAN	calsyntenin 3 precursor	875	Cytoplasmic (Potential).				homophilic cell adhesion	endoplasmic reticulum membrane|Golgi membrane|integral to membrane|plasma membrane	calcium ion binding			large_intestine(1)	1																		---	---	---	---
NECAP1	25977	broad.mit.edu	37	12	8242847	8242847	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:8242847G>A	uc001qtx.2	+	3	331	c.253G>A	c.(253-255)GTG>ATG	p.V85M	NECAP1_uc001qty.2_Translation_Start_Site	NM_015509	NP_056324	Q8NC96	NECP1_HUMAN	NECAP endocytosis associated 1	85					endocytosis|protein transport	clathrin coated vesicle membrane|plasma membrane				ovary(1)	1				Kidney(36;0.0915)														---	---	---	---
LOH12CR1	118426	broad.mit.edu	37	12	12514140	12514140	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12514140T>C	uc001ral.2	+	2	425	c.59T>C	c.(58-60)GTG>GCG	p.V20A	LOH12CR1_uc009zhu.2_Intron	NM_058169	NP_477517	Q969J3	L12R1_HUMAN	LOH1CR12	20										ovary(1)	1		Prostate(47;0.0802)		BRCA - Breast invasive adenocarcinoma(232;0.0205)														---	---	---	---
DUSP16	80824	broad.mit.edu	37	12	12630724	12630724	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12630724T>C	uc001rao.1	-	7	1673	c.1041A>G	c.(1039-1041)TCA>TCG	p.S347S	DUSP16_uc001ram.1_5'Flank|DUSP16_uc001ran.1_Silent_p.S199S	NM_030640	NP_085143	Q9BY84	DUS16_HUMAN	dual specificity phosphatase 16	347					inactivation of MAPK activity|MAPK export from nucleus|MAPK phosphatase export from nucleus, leptomycin B sensitive	cytoplasmic membrane-bounded vesicle|nucleus	MAP kinase tyrosine/serine/threonine phosphatase activity|protein tyrosine phosphatase activity				0		Prostate(47;0.0687)		BRCA - Breast invasive adenocarcinoma(232;0.0203)														---	---	---	---
DDX47	51202	broad.mit.edu	37	12	12974263	12974263	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12974263T>C	uc001rav.2	+	6	901	c.303T>C	c.(301-303)ACT>ACC	p.T101T	DDX47_uc009zhw.1_Silent_p.T101T|DDX47_uc001rax.2_Silent_p.T101T|DDX47_uc001ray.2_Silent_p.T101T|DDX47_uc010shn.1_Silent_p.T101T	NM_016355	NP_057439	Q9H0S4	DDX47_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 47	101	Helicase ATP-binding.					nucleolus|nucleolus	ATP binding|ATP-dependent helicase activity|protein binding|RNA binding				0		Prostate(47;0.0526)		BRCA - Breast invasive adenocarcinoma(232;0.0354)														---	---	---	---
DDX47	51202	broad.mit.edu	37	12	12974623	12974623	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12974623A>G	uc001rav.2	+	7	1003	c.405A>G	c.(403-405)CAA>CAG	p.Q135Q	DDX47_uc009zhw.1_Silent_p.Q135Q|DDX47_uc001rax.2_Silent_p.Q135Q|DDX47_uc001ray.2_Silent_p.Q135Q|DDX47_uc010shn.1_3'UTR	NM_016355	NP_057439	Q9H0S4	DDX47_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 47	135	Helicase ATP-binding.					nucleolus|nucleolus	ATP binding|ATP-dependent helicase activity|protein binding|RNA binding				0		Prostate(47;0.0526)		BRCA - Breast invasive adenocarcinoma(232;0.0354)														---	---	---	---
ERP27	121506	broad.mit.edu	37	12	15091448	15091448	+	Translation_Start_Site	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:15091448C>A	uc001rco.2	-	1	16	c.-5G>T	c.(-7--3)GAGGG>GATGG			NM_152321	NP_689534			endoplasmic reticulum protein 27 kDa precursor							endoplasmic reticulum lumen				breast(1)	1																		---	---	---	---
ETNK1	55500	broad.mit.edu	37	12	22796686	22796686	+	Intron	SNP	A	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:22796686A>T	uc001rft.2	+						ETNK1_uc009ziz.2_Intron|ETNK1_uc001rfs.2_Intron	NM_018638	NP_061108			ethanolamine kinase 1 isoform A						phosphatidylethanolamine biosynthetic process	cytoplasm	ATP binding|ethanolamine kinase activity				0																		---	---	---	---
TSPAN11	441631	broad.mit.edu	37	12	31136068	31136068	+	Missense_Mutation	SNP	G	A	A	rs140179345	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31136068G>A	uc010sju.1	+	7	1065	c.685G>A	c.(685-687)GGG>AGG	p.G229R	TSPAN11_uc001rjp.2_Missense_Mutation_p.G229R|TSPAN11_uc010sjv.1_Missense_Mutation_p.G219R	NM_001080509	NP_001073978	A1L157	TSN11_HUMAN	tetraspanin 11	229	Helical; (Potential).					integral to membrane					0	all_lung(12;3.11e-10)|Lung NSC(12;5.24e-08)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Lung SC(12;0.0592)|Esophageal squamous(101;0.233)																	---	---	---	---
SYT10	341359	broad.mit.edu	37	12	33535371	33535371	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:33535371G>T	uc001rll.1	-	5	1580	c.1283C>A	c.(1282-1284)CCT>CAT	p.P428H	SYT10_uc009zju.1_Missense_Mutation_p.P238H	NM_198992	NP_945343	Q6XYQ8	SYT10_HUMAN	synaptotagmin X	428	C2 2.|Cytoplasmic (Potential).					cell junction|integral to membrane|synaptic vesicle membrane	metal ion binding|transporter activity			ovary(1)|skin(1)	2	Lung NSC(5;8.37e-07)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0334)																	---	---	---	---
ARID2	196528	broad.mit.edu	37	12	46211518	46211518	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46211518G>T	uc001ros.1	+	5	484	c.484G>T	c.(484-486)GTG>TTG	p.V162L	ARID2_uc001ror.2_Missense_Mutation_p.V162L	NM_152641	NP_689854	Q68CP9	ARID2_HUMAN	AT rich interactive domain 2 (ARID, RFX-like)	162					chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(6)|skin(3)|upper_aerodigestive_tract(1)	10	Lung SC(27;0.192)|Renal(347;0.236)	Lung NSC(34;0.106)|all_lung(34;0.22)	OV - Ovarian serous cystadenocarcinoma(5;0.00691)	GBM - Glioblastoma multiforme(48;0.0153)														---	---	---	---
SLC38A2	54407	broad.mit.edu	37	12	46761057	46761057	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46761057A>G	uc001rpg.2	-	5	821	c.381T>C	c.(379-381)AAT>AAC	p.N127N	SLC38A2_uc010sli.1_5'Flank|SLC38A2_uc001rph.2_Silent_p.N27N	NM_018976	NP_061849	Q96QD8	S38A2_HUMAN	solute carrier family 38, member 2	127	Cytoplasmic (Potential).				cellular nitrogen compound metabolic process|glutamate secretion|neurotransmitter secretion|sodium ion transport	integral to membrane|plasma membrane	amino acid transmembrane transporter activity|symporter activity			urinary_tract(1)|skin(1)	2	Lung SC(27;0.192)|Renal(347;0.236)		OV - Ovarian serous cystadenocarcinoma(5;0.0048)|Epithelial(2;0.0374)	GBM - Glioblastoma multiforme(48;0.226)														---	---	---	---
FAM113B	91523	broad.mit.edu	37	12	47630075	47630075	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:47630075C>T	uc001rpn.2	+	4	1960	c.1229C>T	c.(1228-1230)ACG>ATG	p.T410M	FAM113B_uc001rpq.2_Missense_Mutation_p.T410M	NM_138371	NP_612380	Q96HM7	F113B_HUMAN	hypothetical protein LOC91523	410	Pro-rich.						hydrolase activity			skin(3)|ovary(2)	5	Renal(347;0.138)|Lung SC(27;0.192)																	---	---	---	---
H1FNT	341567	broad.mit.edu	37	12	48723422	48723422	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48723422C>T	uc001rrm.2	+	1	660	c.348C>T	c.(346-348)GCC>GCT	p.A116A		NM_181788	NP_861453	Q75WM6	H1FNT_HUMAN	H1 histone family, member N, testis-specific	116					chromosome condensation|multicellular organismal development|sperm chromatin condensation|spermatid nucleus elongation	nuclear chromatin	ATP binding|DNA binding			pancreas(1)	1																		---	---	---	---
NCKAP5L	57701	broad.mit.edu	37	12	50186659	50186659	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50186659G>A	uc009zlk.2	-	11	3653	c.3451C>T	c.(3451-3453)CGG>TGG	p.R1151W	NCKAP5L_uc001rvc.3_Missense_Mutation_p.R355W|NCKAP5L_uc001rvb.2_Missense_Mutation_p.R744W	NM_001037806	NP_001032895	Q9HCH0	NCK5L_HUMAN	NCK-associated protein 5-like	1147	Pro-rich.									central_nervous_system(1)	1																		---	---	---	---
BIN2	51411	broad.mit.edu	37	12	51717798	51717798	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51717798C>T	uc001ryg.2	-						BIN2_uc009zlz.2_Intron|BIN2_uc001ryh.2_Intron|BIN2_uc010sng.1_Intron	NM_016293	NP_057377			bridging integrator 2							cytoplasm	protein binding			ovary(1)	1																		---	---	---	---
SLC4A8	9498	broad.mit.edu	37	12	51856144	51856144	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51856144G>A	uc001rys.1	+	10	1330	c.1152G>A	c.(1150-1152)GCG>GCA	p.A384A	SLC4A8_uc010sni.1_Silent_p.A331A|SLC4A8_uc001rym.2_Silent_p.A331A|SLC4A8_uc001ryn.2_Silent_p.A331A|SLC4A8_uc001ryo.2_Silent_p.A331A|SLC4A8_uc001ryp.1_3'UTR|SLC4A8_uc010snj.1_Silent_p.A411A|SLC4A8_uc001ryq.3_Silent_p.A384A|SLC4A8_uc001ryr.2_Silent_p.A384A|SLC4A8_uc010snk.1_Silent_p.A331A	NM_001039960	NP_001035049	Q2Y0W8	S4A8_HUMAN	solute carrier family 4, sodium bicarbonate	384	Extracellular (Potential).				bicarbonate transport|sodium ion transport	integral to membrane|plasma membrane	inorganic anion exchanger activity			ovary(3)|pancreas(1)|skin(1)	5				BRCA - Breast invasive adenocarcinoma(357;0.15)														---	---	---	---
ACVR1B	91	broad.mit.edu	37	12	52385715	52385715	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52385715C>T	uc001rzn.2	+	8	1372	c.1330C>T	c.(1330-1332)CGA>TGA	p.R444*	ACVR1B_uc001rzm.2_Nonsense_Mutation_p.R444*|ACVR1B_uc010snn.1_Nonsense_Mutation_p.R485*	NM_004302	NP_004293	P36896	ACV1B_HUMAN	activin A receptor, type IB isoform a precursor	444	Protein kinase.|Cytoplasmic (Potential).				G1/S transition of mitotic cell cycle|induction of apoptosis|negative regulation of cell growth|peptidyl-threonine phosphorylation|positive regulation of activin receptor signaling pathway|positive regulation of erythrocyte differentiation|protein autophosphorylation|transmembrane receptor protein serine/threonine kinase signaling pathway	cell surface	activin receptor activity, type I|ATP binding|metal ion binding|SMAD binding|transforming growth factor beta receptor activity|ubiquitin protein ligase binding	p.R485*(1)		pancreas(4)|breast(2)|ovary(1)|lung(1)|kidney(1)	9				BRCA - Breast invasive adenocarcinoma(357;0.104)	Adenosine triphosphate(DB00171)													---	---	---	---
C12orf44	60673	broad.mit.edu	37	12	52470862	52470862	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52470862T>C	uc001rzu.3	+	4	1020	c.545T>C	c.(544-546)TTG>TCG	p.L182S	C12orf44_uc009zmd.2_Missense_Mutation_p.L182S|uc009zme.1_5'Flank	NM_021934	NP_068753	Q9BSB4	ATGA1_HUMAN	Atg13-interacting protein	182					autophagic vacuole assembly	pre-autophagosomal structure	identical protein binding|protein complex binding				0				BRCA - Breast invasive adenocarcinoma(357;0.0978)														---	---	---	---
KRT6A	3853	broad.mit.edu	37	12	52881626	52881626	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52881626C>A	uc001sam.2	-	9	1782	c.1573G>T	c.(1573-1575)GGT>TGT	p.G525C		NM_005554	NP_005545	P02538	K2C6A_HUMAN	keratin 6A	525	Tail.				cell differentiation|ectoderm development|positive regulation of cell proliferation	keratin filament	protein binding|structural constituent of cytoskeleton			ovary(4)|skin(1)	5				BRCA - Breast invasive adenocarcinoma(357;0.189)														---	---	---	---
KRT79	338785	broad.mit.edu	37	12	53227574	53227574	+	Silent	SNP	G	A	A	rs151245582		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53227574G>A	uc001sbb.2	-	1	504	c.471C>T	c.(469-471)ATC>ATT	p.I157I		NM_175834	NP_787028	Q5XKE5	K2C79_HUMAN	keratin 6L	157	Rod.|Coil 1A.					keratin filament	structural molecule activity			ovary(2)|skin(2)	4																		---	---	---	---
CSAD	51380	broad.mit.edu	37	12	53565712	53565712	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53565712C>T	uc001sby.2	-	6	531	c.405G>A	c.(403-405)CTG>CTA	p.L135L	CSAD_uc001sbw.2_Intron|CSAD_uc009zmt.2_5'UTR|CSAD_uc010snx.1_Silent_p.L162L|CSAD_uc001sbz.2_Silent_p.L135L|CSAD_uc009zmu.2_Intron|CSAD_uc001sca.3_RNA|CSAD_uc010sny.1_Silent_p.L135L	NM_015989	NP_057073	Q9Y600	CSAD_HUMAN	cysteine sulfinic acid decarboxylase	135					carboxylic acid metabolic process		pyridoxal phosphate binding|sulfinoalanine decarboxylase activity			ovary(1)	1					L-Cysteine(DB00151)|Pyridoxal Phosphate(DB00114)									Hereditary_Prostate_Cancer				---	---	---	---
ITGA5	3678	broad.mit.edu	37	12	54812816	54812816	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54812816G>A	uc001sga.2	-	1	235	c.167C>T	c.(166-168)CCG>CTG	p.P56L	ITGA5_uc010sow.1_RNA|ITGA5_uc009znp.1_RNA	NM_002205	NP_002196	P08648	ITA5_HUMAN	integrin alpha 5 precursor	56	Extracellular (Potential).|FG-GAP 1.				angiogenesis|axon guidance|blood coagulation|integrin-mediated signaling pathway|interspecies interaction between organisms|leukocyte migration|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of vascular endothelial growth factor receptor signaling pathway|wound healing, spreading of epidermal cells	alphav-beta3 integrin-vitronectin complex|integrin complex|ruffle	platelet-derived growth factor receptor binding|receptor activity|vascular endothelial growth factor receptor 2 binding			ovary(2)	2																		---	---	---	---
DNAJC14	85406	broad.mit.edu	37	12	56222358	56222358	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56222358C>T	uc001shx.1	-	2	289	c.85G>A	c.(85-87)GTG>ATG	p.V29M	DNAJC14_uc001shu.1_Missense_Mutation_p.V29M|DNAJC14_uc009zob.1_Missense_Mutation_p.V29M|DNAJC14_uc001shy.1_Missense_Mutation_p.V29M	NM_032364	NP_115740	Q6Y2X3	DJC14_HUMAN	dopamine receptor interacting protein	29					protein folding|protein transport	endoplasmic reticulum membrane|integral to membrane	heat shock protein binding|unfolded protein binding			ovary(3)|large_intestine(1)	4																		---	---	---	---
SILV	6490	broad.mit.edu	37	12	56355192	56355192	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56355192A>G	uc001sip.2	-	3	274	c.243T>C	c.(241-243)AAT>AAC	p.N81N	SILV_uc001siq.2_Silent_p.N81N|SILV_uc010spx.1_Intron|SILV_uc001sir.2_Silent_p.N81N	NM_006928	NP_008859	P40967	PMEL_HUMAN	silver homolog	81					melanin biosynthetic process|melanosome organization	endoplasmic reticulum membrane|extracellular region|Golgi apparatus|integral to membrane|melanosome|multivesicular body membrane|plasma membrane	protein binding				0																		---	---	---	---
ESYT1	23344	broad.mit.edu	37	12	56527633	56527633	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56527633C>T	uc001sjq.2	+	13	1499	c.1449C>T	c.(1447-1449)TAC>TAT	p.Y483Y	ESYT1_uc001sjr.2_Silent_p.Y483Y	NM_015292	NP_056107	Q9BSJ8	ESYT1_HUMAN	extended synaptotagmin-like protein 1	483	C2 2.					integral to membrane				ovary(4)|skin(1)	5																		---	---	---	---
PAN2	9924	broad.mit.edu	37	12	56717366	56717366	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56717366A>G	uc001skx.2	-	15	2574	c.2201T>C	c.(2200-2202)ATC>ACC	p.I734T	PAN2_uc001skw.2_5'UTR|PAN2_uc001skz.2_Missense_Mutation_p.I733T|PAN2_uc001sky.2_Missense_Mutation_p.I730T	NM_001127460	NP_001120932	Q504Q3	PAN2_HUMAN	PAN2 polyA specific ribonuclease subunit homolog	734					nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|nuclear-transcribed mRNA poly(A) tail shortening|ubiquitin-dependent protein catabolic process	cytosol|nucleus	nucleic acid binding|poly(A)-specific ribonuclease activity|ubiquitin thiolesterase activity			ovary(2)|skin(2)|large_intestine(1)|breast(1)	6																		---	---	---	---
GLS2	27165	broad.mit.edu	37	12	56868363	56868363	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56868363C>T	uc001slj.2	-	12	1468	c.1189G>A	c.(1189-1191)GGC>AGC	p.G397S	GLS2_uc009zos.2_RNA|GLS2_uc001slk.2_Missense_Mutation_p.G132S|GLS2_uc009zot.2_Missense_Mutation_p.G58S	NM_013267	NP_037399	Q9UI32	GLSL_HUMAN	glutaminase 2 precursor	397					cellular amino acid biosynthetic process|glutamate secretion|glutamine metabolic process|neurotransmitter secretion	mitochondrial matrix	glutaminase activity|protein binding			ovary(1)|central_nervous_system(1)	2					L-Glutamic Acid(DB00142)|L-Glutamine(DB00130)													---	---	---	---
BAZ2A	11176	broad.mit.edu	37	12	57009170	57009170	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57009170G>T	uc001slq.1	-	3	558	c.364C>A	c.(364-366)CCA>ACA	p.P122T	BAZ2A_uc001slp.1_Missense_Mutation_p.P120T|BAZ2A_uc010sqr.1_Missense_Mutation_p.P122T|BAZ2A_uc009zow.1_Missense_Mutation_p.P120T	NM_013449	NP_038477	Q9UIF9	BAZ2A_HUMAN	bromodomain adjacent to zinc finger domain, 2A	122					chromatin silencing at rDNA|DNA methylation|transcription, DNA-dependent	chromatin silencing complex|nucleolus|rDNA heterochromatin	DNA binding|histone acetyl-lysine binding|ligand-dependent nuclear receptor binding|RNA binding|zinc ion binding				0																		---	---	---	---
LRP1	4035	broad.mit.edu	37	12	57600317	57600317	+	Silent	SNP	C	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57600317C>G	uc001snd.2	+	76	12118	c.11652C>G	c.(11650-11652)GGC>GGG	p.G3884G		NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	3884	Extracellular (Potential).				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)													---	---	---	---
GLI1	2735	broad.mit.edu	37	12	57858503	57858503	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57858503C>T	uc001snx.2	+	4	319	c.241C>T	c.(241-243)CGG>TGG	p.R81W	GLI1_uc009zpp.2_RNA|GLI1_uc009zpq.2_5'UTR|GLI1_uc009zpr.1_RNA	NM_005269	NP_005260	P08151	GLI1_HUMAN	GLI family zinc finger 1 isoform 1	81					epidermal cell differentiation|negative regulation of canonical Wnt receptor signaling pathway|osteoblast differentiation|positive regulation of DNA replication|positive regulation of smoothened signaling pathway|positive regulation of transcription from RNA polymerase II promoter	cytosol|nucleus	transcription regulatory region DNA binding|zinc ion binding			skin(4)|ovary(4)|breast(3)|central_nervous_system(1)|urinary_tract(1)|kidney(1)|pancreas(1)	15			GBM - Glioblastoma multiforme(3;3.99e-32)															---	---	---	---
SLC16A7	9194	broad.mit.edu	37	12	60165148	60165148	+	Intron	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:60165148G>T	uc001sqs.2	+						SLC16A7_uc001sqt.2_Intron|SLC16A7_uc001squ.2_Intron|SLC16A7_uc009zqi.2_Intron|SLC16A7_uc010ssi.1_Intron	NM_004731	NP_004722			solute carrier family 16, member 7							integral to plasma membrane|membrane fraction	pyruvate secondary active transmembrane transporter activity|secondary active monocarboxylate transmembrane transporter activity|symporter activity			ovary(1)	1				GBM - Glioblastoma multiforme(3;0.0303)	Pyruvic acid(DB00119)													---	---	---	---
MIR617	693202	broad.mit.edu	37	12	81226314	81226314	+	RNA	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:81226314T>C	hsa-mir-617|MI0003631	-			c.95T>C			LIN7A_uc001szj.1_Intron|LIN7A_uc001szk.1_Intron																	0																		---	---	---	---
MRPL42	28977	broad.mit.edu	37	12	93863135	93863135	+	Intron	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:93863135A>C	uc001tcr.2	+						MRPL42_uc001tcq.2_Intron|MRPL42_uc001tcs.2_Intron|MRPL42_uc001tct.2_Intron	NM_172177	NP_751917			mitochondrial ribosomal protein L42 isoform a						translation	mitochondrial small ribosomal subunit	structural constituent of ribosome			ovary(2)	2																		---	---	---	---
USP44	84101	broad.mit.edu	37	12	95927734	95927734	+	Missense_Mutation	SNP	C	T	T	rs144639311		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:95927734C>T	uc001teg.2	-	2	443	c.299G>A	c.(298-300)CGT>CAT	p.R100H	USP44_uc001teh.2_Missense_Mutation_p.R100H|USP44_uc009zte.2_Missense_Mutation_p.R97H	NM_001042403	NP_001035862	Q9H0E7	UBP44_HUMAN	ubiquitin thiolesterase 44	100					anaphase|cell division|mitosis|negative regulation of mitotic anaphase-promoting complex activity|protein deubiquitination|regulation of spindle checkpoint|ubiquitin-dependent protein catabolic process	nucleus	protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity|zinc ion binding			lung(1)|breast(1)|central_nervous_system(1)	3																		---	---	---	---
UTP20	27340	broad.mit.edu	37	12	101693522	101693522	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:101693522A>G	uc001tia.1	+	13	1649	c.1493A>G	c.(1492-1494)GAC>GGC	p.D498G		NM_014503	NP_055318	O75691	UTP20_HUMAN	down-regulated in metastasis	498					endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|negative regulation of cell proliferation	90S preribosome|cytoplasm|nucleolus|nucleoplasm|preribosome, small subunit precursor|small-subunit processome	protein binding			ovary(2)|breast(2)	4																		---	---	---	---
SELPLG	6404	broad.mit.edu	37	12	109017078	109017078	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109017078C>T	uc001tni.2	-	2	1166	c.1006G>A	c.(1006-1008)GTG>ATG	p.V336M	SELPLG_uc001tnh.2_Missense_Mutation_p.V326M|SELPLG_uc010sxe.1_Missense_Mutation_p.V352M	NM_003006	NP_002997	Q14242	SELPL_HUMAN	selectin P ligand	336	Helical; (Potential).				blood coagulation|cellular response to interleukin-6	integral to plasma membrane|membrane fraction	bacterial cell surface binding|receptor binding				0																		---	---	---	---
MVK	4598	broad.mit.edu	37	12	110032921	110032921	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:110032921G>A	uc001toy.3	+	10	1158	c.974G>A	c.(973-975)CGC>CAC	p.R325H	MVK_uc009zvk.2_Missense_Mutation_p.R325H|MVK_uc010sxr.1_Missense_Mutation_p.R273H|MVK_uc001toz.3_Missense_Mutation_p.R131H|MVK_uc001tpc.3_RNA	NM_001114185	NP_001107657	Q03426	KIME_HUMAN	mevalonate kinase	325					cholesterol biosynthetic process|isoprenoid biosynthetic process	cytosol|peroxisome	ATP binding|identical protein binding|mevalonate kinase activity				0																		---	---	---	---
MYL2	4633	broad.mit.edu	37	12	111348947	111348947	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:111348947G>A	uc001try.3	-	7	506	c.435C>T	c.(433-435)GAC>GAT	p.D145D	MYL2_uc001trx.3_Silent_p.D126D	NM_000432	NP_000423	P10916	MLRV_HUMAN	slow cardiac myosin regulatory light chain 2	145	EF-hand 3.				cardiac myofibril assembly|heart contraction|muscle filament sliding|negative regulation of cell growth|regulation of striated muscle contraction|ventricular cardiac muscle tissue morphogenesis	cytosol|myosin complex|sarcomere	actin monomer binding|calcium ion binding|myosin heavy chain binding|structural constituent of muscle			ovary(1)	1																		---	---	---	---
ATXN2	6311	broad.mit.edu	37	12	111907981	111907981	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:111907981C>T	uc001tsj.2	-	20	3409	c.3247G>A	c.(3247-3249)GCC>ACC	p.A1083T	ATXN2_uc001tsh.2_Missense_Mutation_p.A818T|ATXN2_uc001tsi.2_Missense_Mutation_p.A794T|ATXN2_uc001tsk.2_RNA|ATXN2_uc001tsg.2_Missense_Mutation_p.A271T|ATXN2_uc001tsl.1_Missense_Mutation_p.A102T	NM_002973	NP_002964	Q99700	ATX2_HUMAN	ataxin 2	1083	Pro-rich.				cell death|cytoplasmic mRNA processing body assembly|regulation of translation|RNA metabolic process|RNA transport|stress granule assembly	nucleus|perinuclear region of cytoplasm|polysome|stress granule|trans-Golgi network	protein C-terminus binding|RNA binding			ovary(1)|breast(1)	2																		---	---	---	---
ATXN2	6311	broad.mit.edu	37	12	111990178	111990178	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:111990178C>T	uc001tsj.2	-	5	1119	c.957G>A	c.(955-957)CCG>CCA	p.P319P	ATXN2_uc001tsh.2_Silent_p.P54P|ATXN2_uc001tsi.2_Silent_p.P30P|ATXN2_uc001tsk.2_RNA|ATXN2_uc001tsm.1_Silent_p.P54P	NM_002973	NP_002964	Q99700	ATX2_HUMAN	ataxin 2	319					cell death|cytoplasmic mRNA processing body assembly|regulation of translation|RNA metabolic process|RNA transport|stress granule assembly	nucleus|perinuclear region of cytoplasm|polysome|stress granule|trans-Golgi network	protein C-terminus binding|RNA binding			ovary(1)|breast(1)	2																		---	---	---	---
C12orf51	283450	broad.mit.edu	37	12	112674831	112674831	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112674831G>A	uc009zwc.2	-	28	4114	c.4096C>T	c.(4096-4098)CGA>TGA	p.R1366*		NM_001109662	NP_001103132			chromosome 12 open reading frame 51											ovary(1)|lung(1)	2																		---	---	---	---
PTPN11	5781	broad.mit.edu	37	12	112926888	112926888	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112926888G>T	uc001ttx.2	+	13	1888	c.1508G>T	c.(1507-1509)GGG>GTG	p.G503V		NM_002834	NP_002825	Q06124	PTN11_HUMAN	protein tyrosine phosphatase, non-receptor type	507	Tyrosine-protein phosphatase.		G -> A (in JMML).|G -> R (in patients with growth retardation, pulmonic stenosis and juvenile myelomonocytic leukemia).		axon guidance|cell junction assembly|ephrin receptor signaling pathway|epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|interferon-gamma-mediated signaling pathway|leukocyte migration|platelet activation|regulation of cell adhesion mediated by integrin|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|T cell costimulation|type I interferon-mediated signaling pathway	cytosol	non-membrane spanning protein tyrosine phosphatase activity|protein binding	p.G503A(14)|p.G503V(8)|p.G503E(2)|p.G503L(1)|p.G503R(1)		haematopoietic_and_lymphoid_tissue(375)|lung(6)|autonomic_ganglia(2)|soft_tissue(2)|central_nervous_system(2)|large_intestine(1)|skin(1)|ovary(1)|NS(1)|kidney(1)	392								Mis		JMML|AML|MDS		Noonan Syndrome		Noonan_syndrome				---	---	---	---
SUDS3	64426	broad.mit.edu	37	12	118841254	118841254	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:118841254C>T	uc001twz.2	+	10	874	c.735C>T	c.(733-735)CCC>CCT	p.P245P		NM_022491	NP_071936	Q9H7L9	SDS3_HUMAN	suppressor of defective silencing 3	245					chromatin modification|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	Sin3 complex	histone deacetylase binding				0	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)																	---	---	---	---
GPR109A	338442	broad.mit.edu	37	12	123187766	123187766	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123187766C>T	uc001ucx.1	-	1	139	c.65G>A	c.(64-66)CGA>CAA	p.R22Q	GPR81_uc001ucw.1_Intron	NM_177551	NP_808219	Q8TDS4	HCAR2_HUMAN	G protein-coupled receptor 109A	22	Extracellular (Potential).				negative regulation of lipid catabolic process|neutrophil apoptosis|positive regulation of adiponectin secretion|positive regulation of neutrophil apoptosis	integral to membrane|plasma membrane	nicotinic acid receptor activity|purinergic nucleotide receptor activity, G-protein coupled				0	all_neural(191;0.0837)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;2.12e-05)|Epithelial(86;3.19e-05)|BRCA - Breast invasive adenocarcinoma(302;0.196)	Mepenzolate(DB04843)|Niacin(DB00627)													---	---	---	---
NCOR2	9612	broad.mit.edu	37	12	124950800	124950800	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124950800G>A	uc010tba.1	-	5	741	c.624C>T	c.(622-624)CCC>CCT	p.P208P	NCOR2_uc010tay.1_Silent_p.P208P|NCOR2_uc010taz.1_Silent_p.P208P|NCOR2_uc010tbb.1_Silent_p.P208P|NCOR2_uc010tbc.1_Silent_p.P208P|NCOR2_uc001ugj.1_Silent_p.P208P|NCOR2_uc001ugk.1_Silent_p.P208P	NM_001077261	NP_001070729	Q9Y618	NCOR2_HUMAN	nuclear receptor co-repressor 2 isoform 2	208	Potential.				cellular lipid metabolic process|negative regulation of transcription from RNA polymerase II promoter|regulation of cellular ketone metabolic process by negative regulation of transcription from an RNA polymerase II promoter|transcription, DNA-dependent	nuclear body|nucleus|transcriptional repressor complex	DNA binding|histone deacetylase binding|Notch binding|protein N-terminus binding|transcription corepressor activity			skin(3)|ovary(1)	4	all_neural(191;0.0804)|Medulloblastoma(191;0.163)			Epithelial(86;3.99e-05)|OV - Ovarian serous cystadenocarcinoma(86;9.14e-05)|all cancers(50;0.000402)|BRCA - Breast invasive adenocarcinoma(302;0.0764)														---	---	---	---
EP400	57634	broad.mit.edu	37	12	132474611	132474611	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132474611G>A	uc001ujn.2	+	7	2547	c.2512G>A	c.(2512-2514)GCC>ACC	p.A838T	EP400_uc001ujl.2_Missense_Mutation_p.A837T|EP400_uc001ujm.2_Missense_Mutation_p.A838T|EP400_uc001ujj.1_Missense_Mutation_p.A801T|EP400_uc001ujk.2_Missense_Mutation_p.A874T	NM_015409	NP_056224	Q96L91	EP400_HUMAN	E1A binding protein p400	874					histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent	NuA4 histone acetyltransferase complex|nuclear speck	ATP binding|DNA binding|helicase activity			central_nervous_system(4)|ovary(3)|breast(3)|skin(2)	12	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.198)		OV - Ovarian serous cystadenocarcinoma(86;3.01e-08)|Epithelial(86;3.43e-07)|all cancers(50;2.01e-06)														---	---	---	---
DDX51	317781	broad.mit.edu	37	12	132624231	132624231	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132624231C>T	uc001ujy.3	-	14	1962	c.1923G>A	c.(1921-1923)CCG>CCA	p.P641P		NM_175066	NP_778236	Q8N8A6	DDX51_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 51	641					rRNA processing	nucleolus	ATP binding|ATP-dependent helicase activity|RNA binding			lung(1)|pancreas(1)	2	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.241)		OV - Ovarian serous cystadenocarcinoma(86;7.59e-08)|Epithelial(86;3.62e-07)|all cancers(50;2.13e-05)														---	---	---	---
RNF17	56163	broad.mit.edu	37	13	25399806	25399806	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25399806A>G	uc001upr.2	+	16	2182	c.2141A>G	c.(2140-2142)TAT>TGT	p.Y714C	RNF17_uc010tdd.1_Missense_Mutation_p.Y573C|RNF17_uc010aab.2_RNA|RNF17_uc010tde.1_Missense_Mutation_p.Y714C|RNF17_uc001ups.2_Missense_Mutation_p.Y653C	NM_031277	NP_112567	Q9BXT8	RNF17_HUMAN	ring finger protein 17	714					multicellular organismal development	cytoplasm|nucleus	hydrolase activity, acting on ester bonds|nucleic acid binding|zinc ion binding			ovary(1)|skin(1)	2		Lung SC(185;0.0225)|Breast(139;0.077)		all cancers(112;0.0114)|OV - Ovarian serous cystadenocarcinoma(117;0.0311)|Epithelial(112;0.0524)														---	---	---	---
FAM123A	219287	broad.mit.edu	37	13	25744142	25744142	+	Missense_Mutation	SNP	C	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25744142C>G	uc001uqb.2	-	1	1716	c.1616G>C	c.(1615-1617)AGC>ACC	p.S539T	FAM123A_uc001uqa.2_Missense_Mutation_p.S420T|FAM123A_uc001uqc.2_Missense_Mutation_p.S420T	NM_152704	NP_689917	Q8N7J2	F123A_HUMAN	hypothetical protein LOC219287 isoform 1	539										ovary(2)|large_intestine(1)|lung(1)	4		Lung SC(185;0.0225)|Breast(139;0.0602)		all cancers(112;0.0071)|Epithelial(112;0.0398)|OV - Ovarian serous cystadenocarcinoma(117;0.151)|GBM - Glioblastoma multiforme(144;0.222)|Lung(94;0.241)														---	---	---	---
SLC46A3	283537	broad.mit.edu	37	13	29284952	29284952	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:29284952C>T	uc001usi.2	-	3	2059	c.1089G>A	c.(1087-1089)GTG>GTA	p.V363V	SLC46A3_uc001usg.2_Silent_p.V288V|SLC46A3_uc001usj.2_Silent_p.V363V|SLC46A3_uc001ush.2_Silent_p.V363V|SLC46A3_uc001usk.2_3'UTR	NM_181785	NP_861450	Q7Z3Q1	S46A3_HUMAN	solute carrier family 46, member 3 isoform a	363	Helical; (Potential).				transmembrane transport	integral to membrane				central_nervous_system(1)|skin(1)	2		Lung SC(185;0.0367)		all cancers(112;0.159)														---	---	---	---
MTUS2	23281	broad.mit.edu	37	13	29600876	29600876	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:29600876G>A	uc001usl.3	+	1	2129	c.2071G>A	c.(2071-2073)GAA>AAA	p.E691K		NM_001033602	NP_001028774	Q5JR59	MTUS2_HUMAN	hypothetical protein LOC23281 isoform a	681	Mediates interaction with MAPRE1.					cytoplasm|microtubule	microtubule binding|protein homodimerization activity	p.E691K(1)			0																		---	---	---	---
MTUS2	23281	broad.mit.edu	37	13	30072657	30072657	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:30072657C>T	uc001usl.3	+	12	3869	c.3811C>T	c.(3811-3813)CTT>TTT	p.L1271F	MTUS2_uc001usm.3_Missense_Mutation_p.L240F|MTUS2_uc010aau.2_Missense_Mutation_p.L150F|MTUS2_uc010tdq.1_Missense_Mutation_p.L23F	NM_001033602	NP_001028774	Q5JR59	MTUS2_HUMAN	hypothetical protein LOC23281 isoform a	1261	Potential.					cytoplasm|microtubule	microtubule binding|protein homodimerization activity				0																		---	---	---	---
BRCA2	675	broad.mit.edu	37	13	32906658	32906658	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:32906658T>C	uc001uub.1	+	10	1270	c.1043T>C	c.(1042-1044)GTG>GCG	p.V348A	BRCA2_uc001uua.1_Missense_Mutation_p.V225A	NM_000059	NP_000050	P51587	BRCA2_HUMAN	breast cancer 2, early onset	348					cell cycle cytokinesis|centrosome duplication|double-strand break repair via homologous recombination|negative regulation of mammary gland epithelial cell proliferation|nucleotide-excision repair|positive regulation of transcription, DNA-dependent|regulation of S phase of mitotic cell cycle	BRCA2-MAGE-D1 complex|centrosome|nucleoplasm|stored secretory granule	gamma-tubulin binding|H3 histone acetyltransferase activity|H4 histone acetyltransferase activity|protease binding|single-stranded DNA binding			ovary(20)|endometrium(8)|lung(7)|breast(7)|oesophagus(5)|large_intestine(4)|central_nervous_system(3)|pancreas(3)|skin(2)|upper_aerodigestive_tract(1)|cervix(1)|salivary_gland(1)|liver(1)|kidney(1)	64		Lung SC(185;0.0262)		all cancers(112;7.13e-07)|Epithelial(112;1.59e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.000732)|BRCA - Breast invasive adenocarcinoma(63;0.0291)|GBM - Glioblastoma multiforme(144;0.0704)				D|Mis|N|F|S		breast|ovarian|pancreatic	breast|ovarian|pancreatic|leukemia  (FANCB|FANCD1)		Direct_reversal_of_damage|Homologous_recombination	Fanconi_Anemia_type_D1_bi-allelic_BRCA2_mutations|Fanconi_Anemia|Pancreatic_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_BRCA2_type|Hereditary_Prostate_Cancer|Li-Fraumeni_syndrome	TCGA Ovarian(8;0.087)			---	---	---	---
KL	9365	broad.mit.edu	37	13	33591317	33591317	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:33591317G>A	uc001uus.2	+	1	747	c.739G>A	c.(739-741)GGC>AGC	p.G247S	KL_uc001uur.1_Intron	NM_004795	NP_004786	Q9UEF7	KLOT_HUMAN	klotho precursor	247	Glycosyl hydrolase-1 1.|Extracellular (Potential).				aging|carbohydrate metabolic process|insulin receptor signaling pathway|positive regulation of bone mineralization	extracellular space|extracellular space|integral to membrane|integral to plasma membrane|membrane fraction|soluble fraction	beta-glucosidase activity|beta-glucuronidase activity|cation binding|fibroblast growth factor binding|hormone activity|signal transducer activity|vitamin D binding			large_intestine(1)|ovary(1)|skin(1)	3	all_epithelial(80;0.133)	Ovarian(182;1.78e-06)|Breast(139;4.08e-05)|Hepatocellular(188;0.00886)|Lung SC(185;0.0262)		GBM - Glioblastoma multiforme(144;7.13e-230)|all cancers(112;1.33e-165)|OV - Ovarian serous cystadenocarcinoma(117;1.09e-113)|Epithelial(112;3.79e-112)|Lung(94;8.52e-27)|LUSC - Lung squamous cell carcinoma(192;1.4e-13)|Kidney(163;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(186;5.63e-08)|BRCA - Breast invasive adenocarcinoma(63;1.41e-05)														---	---	---	---
NBEA	26960	broad.mit.edu	37	13	36026370	36026370	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:36026370C>T	uc001uvb.2	+	40	6652	c.6446C>T	c.(6445-6447)GCA>GTA	p.A2149V	NBEA_uc010abi.2_Missense_Mutation_p.A805V	NM_015678	NP_056493	Q8NFP9	NBEA_HUMAN	neurobeachin	2149						cytosol|endomembrane system|plasma membrane|trans-Golgi network	protein binding			ovary(9)|large_intestine(2)	11		Breast(139;0.0141)|Lung SC(185;0.0548)|Prostate(109;0.207)		all cancers(112;1.93e-08)|Epithelial(112;1.62e-07)|BRCA - Breast invasive adenocarcinoma(63;0.00033)|OV - Ovarian serous cystadenocarcinoma(117;0.00109)|KIRC - Kidney renal clear cell carcinoma(186;0.00575)|Kidney(163;0.00656)|GBM - Glioblastoma multiforme(144;0.191)|Lung(94;0.199)														---	---	---	---
DCLK1	9201	broad.mit.edu	37	13	36401891	36401891	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:36401891C>T	uc001uvf.2	-	10	1521	c.1288G>A	c.(1288-1290)GAG>AAG	p.E430K	DCLK1_uc001uve.3_Missense_Mutation_p.E123K|DCLK1_uc010teh.1_Missense_Mutation_p.E123K|DCLK1_uc010abk.2_Intron	NM_004734	NP_004725	O15075	DCLK1_HUMAN	doublecortin-like kinase 1	430	Protein kinase.				cell differentiation|central nervous system development|endosome transport|intracellular signal transduction|response to virus	integral to plasma membrane	ATP binding|protein serine/threonine kinase activity|receptor signaling protein activity			stomach(6)|ovary(2)|skin(1)	9		Breast(139;0.0147)|Lung SC(185;0.0685)|Prostate(109;0.122)	KIRC - Kidney renal clear cell carcinoma(5;0.119)|Kidney(79;0.169)	all cancers(112;1.72e-06)|Epithelial(112;4.24e-05)|BRCA - Breast invasive adenocarcinoma(63;0.00159)|OV - Ovarian serous cystadenocarcinoma(117;0.0158)|GBM - Glioblastoma multiforme(144;0.0638)														---	---	---	---
LMO7	4008	broad.mit.edu	37	13	76432063	76432063	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:76432063G>A	uc001vjv.2	+	27	4832	c.4072G>A	c.(4072-4074)GGC>AGC	p.G1358S	LMO7_uc010thv.1_Missense_Mutation_p.R1345Q|LMO7_uc010thw.1_Missense_Mutation_p.R1271Q|LMO7_uc001vjx.1_RNA	NM_015842	NP_056667	Q8WWI1	LMO7_HUMAN	LIM domain only 7 isoform 2	Error:Variant_position_missing_in_Q8WWI1_after_alignment						cytoplasm|nucleus|ubiquitin ligase complex	ubiquitin-protein ligase activity|zinc ion binding			large_intestine(2)|ovary(1)|prostate(1)|skin(1)	5		Breast(118;0.0992)		GBM - Glioblastoma multiforme(99;0.0109)														---	---	---	---
SLITRK1	114798	broad.mit.edu	37	13	84454725	84454725	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:84454725G>A	uc001vlk.2	-	1	1804	c.918C>T	c.(916-918)AAC>AAT	p.N306N		NM_052910	NP_443142	Q96PX8	SLIK1_HUMAN	slit and trk like 1 protein precursor	306	Extracellular (Potential).					integral to membrane				ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	5	Medulloblastoma(90;0.18)	Breast(118;0.212)		GBM - Glioblastoma multiforme(99;0.07)														---	---	---	---
RNF113B	140432	broad.mit.edu	37	13	98829144	98829144	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:98829144T>C	uc001vnk.2	-	1	378	c.347A>G	c.(346-348)CAG>CGG	p.Q116R	FARP1_uc001vnh.2_Intron|FARP1_uc001vni.2_Intron|FARP1_uc001vnj.2_Intron	NM_178861	NP_849192	Q8IZP6	R113B_HUMAN	ring finger protein 113B	116							nucleic acid binding|zinc ion binding			ovary(1)|central_nervous_system(1)|skin(1)	3	all_neural(89;0.101)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)		BRCA - Breast invasive adenocarcinoma(86;0.13)															---	---	---	---
PCCA	5095	broad.mit.edu	37	13	101077918	101077918	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101077918C>T	uc001voo.2	+	20	1816	c.1778C>T	c.(1777-1779)ACC>ATC	p.T593I	PCCA_uc010aga.2_Missense_Mutation_p.T567I|PCCA_uc010tiz.1_Missense_Mutation_p.T593I|PCCA_uc001vop.2_RNA	NM_000282	NP_000273	P05165	PCCA_HUMAN	propionyl-Coenzyme A carboxylase, alpha	593					fatty acid beta-oxidation	mitochondrial matrix	ATP binding|biotin binding|biotin carboxylase activity|enzyme binding|metal ion binding|propionyl-CoA carboxylase activity			skin(2)	2	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)				Biotin(DB00121)													---	---	---	---
TMTC4	84899	broad.mit.edu	37	13	101288774	101288774	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101288774G>A	uc001vou.2	-						TMTC4_uc001vot.2_Intron|TMTC4_uc010tja.1_Intron|TMTC4_uc001vov.1_Intron|TMTC4_uc001vow.1_Intron	NM_001079669	NP_001073137			transmembrane and tetratricopeptide repeat							integral to membrane	binding			ovary(2)|breast(1)	3	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)																	---	---	---	---
TMTC4	84899	broad.mit.edu	37	13	101321023	101321023	+	5'UTR	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101321023G>A	uc001vou.2	-	2					TMTC4_uc001vot.2_Missense_Mutation_p.A10V|TMTC4_uc010tja.1_5'UTR	NM_001079669	NP_001073137			transmembrane and tetratricopeptide repeat							integral to membrane	binding			ovary(2)|breast(1)	3	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)																	---	---	---	---
NALCN	259232	broad.mit.edu	37	13	101717877	101717877	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101717877G>A	uc001vox.1	-	40	4672	c.4483C>T	c.(4483-4485)CGG>TGG	p.R1495W		NM_052867	NP_443099	Q8IZF0	NALCN_HUMAN	voltage gated channel like 1	1495	Cytoplasmic (Potential).					integral to membrane	sodium channel activity|voltage-gated ion channel activity			ovary(8)|breast(4)|skin(2)|pancreas(1)|central_nervous_system(1)	16	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---
NALCN	259232	broad.mit.edu	37	13	102047698	102047698	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:102047698G>A	uc001vox.1	-	3	316	c.127C>T	c.(127-129)CGC>TGC	p.R43C	NALCN_uc001voy.2_5'UTR|NALCN_uc001voz.2_Missense_Mutation_p.R43C|NALCN_uc001vpa.2_Missense_Mutation_p.R43C	NM_052867	NP_443099	Q8IZF0	NALCN_HUMAN	voltage gated channel like 1	43	Helical; Name=S1 of repeat I; (Potential).					integral to membrane	sodium channel activity|voltage-gated ion channel activity			ovary(8)|breast(4)|skin(2)|pancreas(1)|central_nervous_system(1)	16	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---
SOX1	6656	broad.mit.edu	37	13	112722290	112722290	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:112722290G>A	uc001vsb.1	+	1	378	c.318G>A	c.(316-318)CGG>CGA	p.R106R		NM_005986	NP_005977	O00570	SOX1_HUMAN	SRY (sex determining region Y)-box 1	106	HMG box.				chromatin organization	nucleus	core promoter sequence-specific DNA binding|protein binding|sequence-specific DNA binding transcription factor activity				0	all_lung(23;0.000652)|Lung NSC(43;0.017)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Medulloblastoma(90;0.163)	all_cancers(25;0.000331)|Lung NSC(25;0.0496)|all_lung(25;0.0831)|all_epithelial(44;0.0868)|Breast(118;0.231)		OV - Ovarian serous cystadenocarcinoma(48;0.132)														---	---	---	---
MCF2L	23263	broad.mit.edu	37	13	113744018	113744018	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:113744018A>G	uc001vsu.2	+	26	3122	c.3100A>G	c.(3100-3102)ACA>GCA	p.T1034A	MCF2L_uc001vsq.2_Missense_Mutation_p.T1034A|MCF2L_uc010tjr.1_Missense_Mutation_p.T977A|MCF2L_uc001vsr.2_Missense_Mutation_p.T981A|MCF2L_uc001vss.3_Missense_Mutation_p.T975A|MCF2L_uc010tjs.1_Missense_Mutation_p.T975A	NM_001112732	NP_001106203	O15068	MCF2L_HUMAN	MCF.2 cell line derived transforming	1007					apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|plasma membrane	Rho guanyl-nucleotide exchange factor activity			ovary(1)|kidney(1)	2	all_lung(23;0.000374)|Lung NSC(43;0.0107)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)	all_cancers(25;0.118)|all_lung(25;0.0368)|all_epithelial(44;0.0396)|Lung NSC(25;0.129)|Breast(118;0.188)																---	---	---	---
TEP1	7011	broad.mit.edu	37	14	20871978	20871978	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20871978C>T	uc001vxe.2	-	6	1138	c.1098G>A	c.(1096-1098)ACG>ACA	p.T366T	TEP1_uc010tlf.1_RNA|TEP1_uc010tlg.1_Intron	NM_007110	NP_009041	Q99973	TEP1_HUMAN	telomerase-associated protein 1	366	TROVE.				telomere maintenance via recombination	chromosome, telomeric region|cytoplasm|nuclear matrix|soluble fraction|telomerase holoenzyme complex	ATP binding|RNA binding			ovary(5)	5	all_cancers(95;0.00123)	all_lung(585;0.235)	Epithelial(56;7.42e-08)|all cancers(55;6.46e-07)	GBM - Glioblastoma multiforme(265;0.028)|READ - Rectum adenocarcinoma(17;0.233)														---	---	---	---
SLC22A17	51310	broad.mit.edu	37	14	23821303	23821303	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23821303C>T	uc001wjl.2	-	1	177	c.121G>A	c.(121-123)GCT>ACT	p.A41T	SLC22A17_uc010akk.2_5'UTR|SLC22A17_uc001wjn.2_RNA|SLC22A17_uc001wjm.2_Missense_Mutation_p.A41T|SLC22A17_uc010akl.1_Missense_Mutation_p.A41T	NM_020372	NP_065105	Q8WUG5	S22AH_HUMAN	solute carrier family 22, member 17 isoform a	41					siderophore transport	integral to organelle membrane|integral to plasma membrane|vacuolar membrane	transmembrane receptor activity|transmembrane transporter activity				0	all_cancers(95;7.12e-06)			GBM - Glioblastoma multiforme(265;0.00643)														---	---	---	---
MYH7	4625	broad.mit.edu	37	14	23884861	23884861	+	Missense_Mutation	SNP	G	A	A	rs121913650		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23884861G>A	uc001wjx.2	-	35	5240	c.5134C>T	c.(5134-5136)CGG>TGG	p.R1712W		NM_000257	NP_000248	P12883	MYH7_HUMAN	myosin, heavy chain 7, cardiac muscle, beta	1712	Potential.		R -> W (in CMH1).		adult heart development|muscle filament sliding|regulation of heart rate|ventricular cardiac muscle tissue morphogenesis	focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(3)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00725)														---	---	---	---
NGDN	25983	broad.mit.edu	37	14	23944862	23944862	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23944862A>G	uc001wjy.2	+						NGDN_uc001wjz.2_Intron|NGDN_uc001wka.2_5'Flank	NM_001042635	NP_001036100			neuroguidin isoform 1						regulation of translation	axon|cytoplasm|dendrite|filopodium|nucleus					0	all_cancers(95;0.000251)			GBM - Glioblastoma multiforme(265;0.00654)														---	---	---	---
NFATC4	4776	broad.mit.edu	37	14	24842494	24842494	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24842494G>A	uc001wpc.2	+	4	1798	c.1477G>A	c.(1477-1479)GCC>ACC	p.A493T	NFATC4_uc010tok.1_Missense_Mutation_p.A556T|NFATC4_uc010tol.1_Missense_Mutation_p.A556T|NFATC4_uc010alr.2_Missense_Mutation_p.A556T|NFATC4_uc010als.2_Missense_Mutation_p.A506T|NFATC4_uc010tom.1_Missense_Mutation_p.A506T|NFATC4_uc010ton.1_Missense_Mutation_p.A506T|NFATC4_uc010too.1_Missense_Mutation_p.A506T|NFATC4_uc010alt.2_Missense_Mutation_p.A525T|NFATC4_uc010top.1_Missense_Mutation_p.A525T|NFATC4_uc010toq.1_Missense_Mutation_p.A525T|NFATC4_uc010alu.2_Missense_Mutation_p.A185T|NFATC4_uc010tor.1_Missense_Mutation_p.A493T|NFATC4_uc010tos.1_Missense_Mutation_p.A423T|NFATC4_uc010tot.1_Missense_Mutation_p.A481T|NFATC4_uc010tou.1_Missense_Mutation_p.A423T|NFATC4_uc010tov.1_Missense_Mutation_p.A481T|NFATC4_uc010tow.1_Missense_Mutation_p.A423T|NFATC4_uc010alv.2_Missense_Mutation_p.A481T|NFATC4_uc010tox.1_Missense_Mutation_p.A423T|NFATC4_uc001wpd.2_Missense_Mutation_p.A28T|NFATC4_uc010toy.1_Missense_Mutation_p.A28T|NFATC4_uc010toz.1_Missense_Mutation_p.A28T|NFATC4_uc010tpa.1_5'Flank|NFATC4_uc010tpb.1_5'Flank	NM_004554	NP_004545	Q14934	NFAC4_HUMAN	nuclear factor of activated T-cells,	493	RHD.				cell differentiation|inflammatory response|transcription from RNA polymerase II promoter	cytoplasm|intermediate filament cytoskeleton|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity			ovary(1)|central_nervous_system(1)|skin(1)	3				GBM - Glioblastoma multiforme(265;0.018)														---	---	---	---
COCH	1690	broad.mit.edu	37	14	31355427	31355427	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31355427G>T	uc001wqr.2	+	11	1466	c.1386G>T	c.(1384-1386)AGG>AGT	p.R462S	COCH_uc001wqp.2_Missense_Mutation_p.R462S|COCH_uc001wqq.3_Missense_Mutation_p.R462S|uc001wqs.2_RNA|COCH_uc001wqt.1_Missense_Mutation_p.R313S	NM_004086	NP_004077	O43405	COCH_HUMAN	cochlin precursor	462	VWFA 2.				sensory perception of sound	proteinaceous extracellular matrix				pancreas(1)|central_nervous_system(1)|skin(1)	3	Hepatocellular(127;0.0877)|Breast(36;0.148)		LUAD - Lung adenocarcinoma(48;0.00192)|Lung(238;0.0119)|BRCA - Breast invasive adenocarcinoma(188;0.0805)	GBM - Glioblastoma multiforme(265;0.00645)														---	---	---	---
NPAS3	64067	broad.mit.edu	37	14	34266683	34266683	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:34266683C>T	uc001wru.2	+	11	1386	c.1322C>T	c.(1321-1323)ACA>ATA	p.T441I	NPAS3_uc001wrs.2_Missense_Mutation_p.T428I|NPAS3_uc001wrt.2_Missense_Mutation_p.T409I|NPAS3_uc001wrv.2_Missense_Mutation_p.T411I	NM_173159	NP_071406	Q8IXF0	NPAS3_HUMAN	neuronal PAS domain protein 3 isoform 3	441					regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|signal transducer activity			ovary(1)|skin(1)	2	Breast(36;0.0102)|Hepatocellular(127;0.133)		LUAD - Lung adenocarcinoma(48;0.00169)|Lung(238;0.00968)	GBM - Glioblastoma multiforme(1;1.31e-09)|all cancers(1;0.000112)|OV - Ovarian serous cystadenocarcinoma(311;0.115)														---	---	---	---
KLHDC2	23588	broad.mit.edu	37	14	50249176	50249176	+	Splice_Site	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50249176G>T	uc001wwx.2	+	11	1444	c.1044_splice	c.e11+1	p.A348_splice	SDCCAG1_uc010anj.1_Intron|KLHDC2_uc001wwy.2_Splice_Site_p.A348_splice|KLHDC2_uc010anp.2_Splice_Site	NM_014315	NP_055130			kelch domain containing 2							nucleus	protein binding			ovary(1)	1	all_epithelial(31;0.000959)|Breast(41;0.0117)																	---	---	---	---
TRIM9	114088	broad.mit.edu	37	14	51561482	51561482	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:51561482T>G	uc001wyx.3	-	1	941	c.176A>C	c.(175-177)GAC>GCC	p.D59A	TRIM9_uc001wyy.2_Missense_Mutation_p.D59A|TRIM9_uc001wyz.3_Missense_Mutation_p.D59A	NM_015163	NP_055978	Q9C026	TRIM9_HUMAN	tripartite motif protein 9 isoform 1	59					proteasomal ubiquitin-dependent protein catabolic process	cell junction|cytoskeleton|dendrite|synaptic vesicle	protein homodimerization activity|ubiquitin-protein ligase activity|zinc ion binding			skin(2)|lung(1)	3	all_epithelial(31;0.00418)|Breast(41;0.148)																	---	---	---	---
TXNDC16	57544	broad.mit.edu	37	14	52948967	52948967	+	Silent	SNP	A	G	G	rs143047031		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52948967A>G	uc001wzs.2	-	14	1742	c.1293T>C	c.(1291-1293)GAT>GAC	p.D431D	TXNDC16_uc010tqu.1_Silent_p.D426D|TXNDC16_uc010aoe.2_RNA	NM_020784	NP_065835	Q9P2K2	TXD16_HUMAN	thioredoxin domain containing 16 isoform 1	431	Thioredoxin.				cell redox homeostasis	extracellular region					0	Breast(41;0.0716)																	---	---	---	---
MUDENG	55745	broad.mit.edu	37	14	57747008	57747008	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:57747008A>G	uc001xcv.2	+	3	1243	c.816A>G	c.(814-816)GTA>GTG	p.V272V	MUDENG_uc010tri.1_Silent_p.V26V|MUDENG_uc010trj.1_Silent_p.V169V	NM_018229	NP_060699	Q9H0R1	MUDEN_HUMAN	Mu-2 related death-inducing protein	272	MHD.				intracellular protein transport|vesicle-mediated transport	clathrin adaptor complex				ovary(1)	1																		---	---	---	---
RHOJ	57381	broad.mit.edu	37	14	63671636	63671636	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:63671636G>A	uc001xgb.1	+	1	492	c.49G>A	c.(49-51)GAC>AAC	p.D17N		NM_020663	NP_065714	Q9H4E5	RHOJ_HUMAN	ras homolog gene family, member J precursor	17					actin cytoskeleton organization|regulation of cell shape|regulation of small GTPase mediated signal transduction	cytosol|plasma membrane	GTP binding|GTPase activity				0				OV - Ovarian serous cystadenocarcinoma(108;0.00326)|all cancers(60;0.031)|BRCA - Breast invasive adenocarcinoma(234;0.119)														---	---	---	---
PPP2R5E	5529	broad.mit.edu	37	14	63851161	63851161	+	Splice_Site	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:63851161C>T	uc001xgd.1	-	12	1792	c.1202_splice	c.e12+1	p.P401_splice	PPP2R5E_uc010tsf.1_Splice_Site_p.P325_splice|PPP2R5E_uc010tsg.1_Splice_Site_p.P325_splice|PPP2R5E_uc001xge.2_Splice_Site_p.P401_splice|PPP2R5E_uc010tsh.1_Splice_Site_p.P401_splice|PPP2R5E_uc001xgf.1_Splice_Site	NM_006246	NP_006237			epsilon isoform of regulatory subunit B56,						signal transduction	cytoplasm|intracellular membrane-bounded organelle|protein phosphatase type 2A complex	protein binding|protein phosphatase type 2A regulator activity			ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(108;0.00197)|all cancers(60;0.0153)|BRCA - Breast invasive adenocarcinoma(234;0.128)														---	---	---	---
MTHFD1	4522	broad.mit.edu	37	14	64867549	64867549	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64867549T>C	uc001xhb.2	+	2	467	c.80T>C	c.(79-81)TTG>TCG	p.L27S	MTHFD1_uc010aqe.2_Missense_Mutation_p.L83S|MTHFD1_uc010aqf.2_Missense_Mutation_p.L83S	NM_005956	NP_005947	P11586	C1TC_HUMAN	methylenetetrahydrofolate dehydrogenase 1	27	Methylenetetrahydrofolate dehydrogenase and cyclohydrolase.				folic acid metabolic process|folic acid-containing compound biosynthetic process|histidine biosynthetic process|methionine biosynthetic process|one-carbon metabolic process|purine nucleotide biosynthetic process	cytosol|mitochondrion	ATP binding|formate-tetrahydrofolate ligase activity|methenyltetrahydrofolate cyclohydrolase activity|methylenetetrahydrofolate dehydrogenase (NADP+) activity|methylenetetrahydrofolate dehydrogenase|protein binding			ovary(2)	2				OV - Ovarian serous cystadenocarcinoma(108;8.7e-12)|all cancers(60;3.29e-11)|BRCA - Breast invasive adenocarcinoma(234;0.0488)	NADH(DB00157)|Tetrahydrofolic acid(DB00116)													---	---	---	---
PLEKHG3	26030	broad.mit.edu	37	14	65198835	65198835	+	Missense_Mutation	SNP	G	A	A	rs138713446	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:65198835G>A	uc001xho.1	+	10	1417	c.1148G>A	c.(1147-1149)CGG>CAG	p.R383Q	PLEKHG3_uc001xhn.1_Missense_Mutation_p.R327Q|PLEKHG3_uc001xhp.2_Missense_Mutation_p.R383Q|PLEKHG3_uc010aqh.1_5'UTR	NM_015549	NP_056364	A1L390	PKHG3_HUMAN	pleckstrin homology domain containing, family G,	383	PH.				regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			skin(1)	1				all cancers(60;0.00802)|OV - Ovarian serous cystadenocarcinoma(108;0.0109)|BRCA - Breast invasive adenocarcinoma(234;0.0485)														---	---	---	---
SPTB	6710	broad.mit.edu	37	14	65260557	65260557	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:65260557G>A	uc001xht.2	-	13	1878	c.1824C>T	c.(1822-1824)ATC>ATT	p.I608I	SPTB_uc001xhr.2_Silent_p.I608I|SPTB_uc001xhs.2_Silent_p.I608I|SPTB_uc001xhu.2_Silent_p.I608I	NM_000347	NP_000338	P11277	SPTB1_HUMAN	spectrin beta isoform b	608	Spectrin 4.				actin filament capping|axon guidance	cell surface|cytosol|intrinsic to internal side of plasma membrane|protein complex|spectrin|spectrin-associated cytoskeleton	actin filament binding|structural constituent of cytoskeleton			ovary(7)|skin(2)|lung(1)|central_nervous_system(1)	11		all_lung(585;4.15e-09)		all cancers(60;4.33e-34)|OV - Ovarian serous cystadenocarcinoma(108;8.32e-20)|BRCA - Breast invasive adenocarcinoma(234;0.0628)														---	---	---	---
ZFYVE26	23503	broad.mit.edu	37	14	68246963	68246963	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:68246963C>T	uc001xka.2	-	23	4808	c.4669G>A	c.(4669-4671)GCA>ACA	p.A1557T	ZFYVE26_uc010tsz.1_RNA|ZFYVE26_uc001xkc.3_Missense_Mutation_p.A1557T	NM_015346	NP_056161	Q68DK2	ZFY26_HUMAN	zinc finger, FYVE domain containing 26	1557					cell cycle|cell death|cytokinesis|double-strand break repair via homologous recombination	centrosome|midbody	metal ion binding|phosphatidylinositol-3-phosphate binding|protein binding			ovary(9)|breast(2)	11				all cancers(60;0.000763)|OV - Ovarian serous cystadenocarcinoma(108;0.0011)|BRCA - Breast invasive adenocarcinoma(234;0.0115)														---	---	---	---
EXD2	55218	broad.mit.edu	37	14	69695627	69695627	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:69695627G>A	uc001xkt.2	+	5	712	c.53G>A	c.(52-54)TGT>TAT	p.C18Y	EXD2_uc001xku.2_Translation_Start_Site|EXD2_uc001xkv.2_Missense_Mutation_p.C143Y|EXD2_uc001xkw.2_Missense_Mutation_p.C18Y|EXD2_uc001xkx.2_RNA|EXD2_uc010aqt.2_Missense_Mutation_p.C143Y|EXD2_uc010tte.1_Missense_Mutation_p.C143Y|EXD2_uc001xky.2_Missense_Mutation_p.C18Y	NM_018199	NP_060669	Q9NVH0	EXD2_HUMAN	exonuclease 3'-5' domain containing 2	18					nucleobase, nucleoside, nucleotide and nucleic acid metabolic process	intracellular	3'-5' exonuclease activity|nucleic acid binding				0																		---	---	---	---
HEATR4	399671	broad.mit.edu	37	14	73985743	73985743	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:73985743C>A	uc010tub.1	-	5	1516	c.1194G>T	c.(1192-1194)CAG>CAT	p.Q398H	HEATR4_uc010tua.1_Missense_Mutation_p.Q351H	NM_203309	NP_976054			HEAT repeat containing 4											ovary(1)	1				BRCA - Breast invasive adenocarcinoma(234;0.00386)|OV - Ovarian serous cystadenocarcinoma(108;0.0719)														---	---	---	---
C14orf115	55237	broad.mit.edu	37	14	74824432	74824432	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:74824432G>A	uc001xpw.3	+	2	1137	c.946G>A	c.(946-948)GCC>ACC	p.A316T		NM_018228	NP_060698	Q9H8Y1	VRTN_HUMAN	hypothetical protein LOC55237	316					transposition, DNA-mediated		DNA binding|transposase activity				0				BRCA - Breast invasive adenocarcinoma(234;0.00147)														---	---	---	---
LTBP2	4053	broad.mit.edu	37	14	74969544	74969544	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:74969544G>A	uc001xqa.2	-	34	5369	c.4982C>T	c.(4981-4983)CCC>CTC	p.P1661L		NM_000428	NP_000419	Q14767	LTBP2_HUMAN	latent transforming growth factor beta binding	1661					protein secretion|protein targeting|transforming growth factor beta receptor signaling pathway	extracellular space|proteinaceous extracellular matrix	calcium ion binding|growth factor binding			liver(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(234;0.00219)|READ - Rectum adenocarcinoma(1;0.0649)														---	---	---	---
YLPM1	56252	broad.mit.edu	37	14	75284986	75284986	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75284986G>A	uc001xqj.3	+	16	6123	c.5999G>A	c.(5998-6000)CGT>CAT	p.R2000H	YLPM1_uc001xql.3_RNA|YLPM1_uc001xqm.1_Missense_Mutation_p.R483H	NM_019589	NP_062535	P49750	YLPM1_HUMAN	YLP motif containing 1	1805					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear speck				ovary(2)|pancreas(1)	3			KIRC - Kidney renal clear cell carcinoma(43;0.238)	BRCA - Breast invasive adenocarcinoma(234;0.00162)														---	---	---	---
RPS6KL1	83694	broad.mit.edu	37	14	75388057	75388057	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75388057C>T	uc010tux.1	-	2	716	c.188G>A	c.(187-189)CGC>CAC	p.R63H	RPS6KL1_uc001xqw.2_Missense_Mutation_p.R63H|RPS6KL1_uc010asd.1_RNA|RPS6KL1_uc001xqy.1_Missense_Mutation_p.R63H	NM_031464	NP_113652	Q9Y6S9	RPKL1_HUMAN	ribosomal protein S6 kinase-like 1	63						ribosome	ATP binding|protein serine/threonine kinase activity			ovary(1)|stomach(1)|central_nervous_system(1)	3				BRCA - Breast invasive adenocarcinoma(234;0.00658)														---	---	---	---
C14orf4	64207	broad.mit.edu	37	14	77492010	77492010	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77492010T>C	uc001xsy.2	-	1	3025	c.2126A>G	c.(2125-2127)AAC>AGC	p.N709S		NM_024496	NP_078772	Q9H1B7	I2BPL_HUMAN	chromosome 14 open reading frame 4	709						nucleus					0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.00347)|KIRC - Kidney renal clear cell carcinoma(182;0.0878)														---	---	---	---
GALC	2581	broad.mit.edu	37	14	88448557	88448557	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:88448557A>G	uc001xvt.2	-	6	1012	c.613T>C	c.(613-615)TAT>CAT	p.Y205H	GALC_uc010tvw.1_5'Flank|GALC_uc010tvx.1_Missense_Mutation_p.Y179H|GALC_uc010tvy.1_Missense_Mutation_p.Y182H|GALC_uc010tvz.1_Missense_Mutation_p.Y149H|GALC_uc001xvu.1_Missense_Mutation_p.Y205H	NM_000153	NP_000144	P54803	GALC_HUMAN	galactosylceramidase isoform a precursor	205					carbohydrate metabolic process|galactosylceramide catabolic process	lysosome	cation binding|galactosylceramidase activity				0																		---	---	---	---
KCNK10	54207	broad.mit.edu	37	14	88654340	88654340	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:88654340G>A	uc001xwo.2	-	6	1424	c.967C>T	c.(967-969)CGG>TGG	p.R323W	KCNK10_uc001xwm.2_Missense_Mutation_p.R328W|KCNK10_uc001xwn.2_Missense_Mutation_p.R328W	NM_021161	NP_066984	P57789	KCNKA_HUMAN	potassium channel, subfamily K, member 10	323	Cytoplasmic (Potential).				signal transduction	integral to membrane	potassium channel activity|voltage-gated ion channel activity	p.R323Q(1)		ovary(2)|skin(2)|pancreas(1)	5																		---	---	---	---
TTC7B	145567	broad.mit.edu	37	14	91282553	91282553	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:91282553G>A	uc001xyp.2	-	1	209	c.87C>T	c.(85-87)CTC>CTT	p.L29L		NM_001010854	NP_001010854	Q86TV6	TTC7B_HUMAN	tetratricopeptide repeat domain 7B	29							binding			ovary(2)	2		Melanoma(154;0.222)																---	---	---	---
CCDC88C	440193	broad.mit.edu	37	14	91875074	91875074	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:91875074C>T	uc010aty.2	-	3	298	c.199G>A	c.(199-201)GTC>ATC	p.V67I	CCDC88C_uc010twk.1_Missense_Mutation_p.V31I|CCDC88C_uc001xzl.3_Missense_Mutation_p.V67I	NM_001080414	NP_001073883	Q9P219	DAPLE_HUMAN	DVL-binding protein DAPLE	67					microtubule cytoskeleton organization|protein destabilization|protein homooligomerization|regulation of protein phosphorylation|Wnt receptor signaling pathway	cytoplasm|insoluble fraction	microtubule binding|PDZ domain binding|protein self-association			ovary(3)	3		all_cancers(154;0.0468)																---	---	---	---
SERPINA4	5267	broad.mit.edu	37	14	95033560	95033560	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95033560G>A	uc001ydk.2	+	3	969	c.903G>A	c.(901-903)TGG>TGA	p.W301*	SERPINA4_uc010avd.2_Nonsense_Mutation_p.W338*|SERPINA4_uc001ydl.2_Nonsense_Mutation_p.W301*	NM_006215	NP_006206	P29622	KAIN_HUMAN	serine (or cysteine) proteinase inhibitor, clade	301					regulation of proteolysis	extracellular space	serine-type endopeptidase inhibitor activity			ovary(3)|skin(1)	4				COAD - Colon adenocarcinoma(157;0.211)														---	---	---	---
DICER1	23405	broad.mit.edu	37	14	95557666	95557666	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95557666C>T	uc001ydw.2	-	26	5583	c.5401G>A	c.(5401-5403)GAT>AAT	p.D1801N	DICER1_uc010avh.1_Missense_Mutation_p.D699N|DICER1_uc001ydv.2_Missense_Mutation_p.D1791N|DICER1_uc001ydx.2_Missense_Mutation_p.D1801N	NM_030621	NP_085124	Q9UPY3	DICER_HUMAN	dicer1	1801	RNase III 2.				negative regulation of Schwann cell proliferation|negative regulation of transcription from RNA polymerase II promoter|nerve development|neuron projection morphogenesis|peripheral nervous system myelin formation|positive regulation of myelination|positive regulation of Schwann cell differentiation|pre-miRNA processing|production of siRNA involved in RNA interference|targeting of mRNA for destruction involved in RNA interference	cytosol|RNA-induced silencing complex	ATP binding|ATP-dependent helicase activity|double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity			skin(2)|ovary(1)|pancreas(1)|lung(1)	5		all_cancers(154;0.0621)|all_epithelial(191;0.223)		Epithelial(152;0.211)|COAD - Colon adenocarcinoma(157;0.215)				Mis F|N			pleuropulmonary blastoma			DICER_1_syndrome_|Familial_Multinodular_Goiter_				---	---	---	---
RCOR1	23186	broad.mit.edu	37	14	103173859	103173859	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103173859T>C	uc001ymb.2	+							NM_015156	NP_055971			REST corepressor 1						blood coagulation|histone H4 deacetylation|interspecies interaction between organisms	transcriptional repressor complex	protein binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription|transcription regulatory region DNA binding			ovary(1)	1																		---	---	---	---
MAGEL2	54551	broad.mit.edu	37	15	23889184	23889184	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:23889184C>T	uc001ywj.3	-	1	1992	c.1897G>A	c.(1897-1899)GGT>AGT	p.G633S		NM_019066	NP_061939			MAGE-like protein 2												0		all_cancers(20;1.78e-24)|all_epithelial(15;7.75e-22)|Lung NSC(15;2.96e-18)|all_lung(15;2.8e-17)|Breast(32;0.000625)|Colorectal(260;0.14)		all cancers(64;1.84e-06)|Epithelial(43;1.2e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00177)														---	---	---	---
HERC2	8924	broad.mit.edu	37	15	28463702	28463702	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28463702G>A	uc001zbj.2	-	38	6067	c.5961C>T	c.(5959-5961)AGC>AGT	p.S1987S		NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2	1987					DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)														---	---	---	---
OTUD7A	161725	broad.mit.edu	37	15	31862339	31862339	+	Silent	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:31862339T>G	uc001zfq.2	-	2	306	c.213A>C	c.(211-213)ACA>ACC	p.T71T	OTUD7A_uc001zfr.2_Silent_p.T71T|OTUD7A_uc001zfs.1_RNA|OTUD7A_uc010baa.1_Silent_p.T71T	NM_130901	NP_570971	Q8TE49	OTU7A_HUMAN	OTU domain containing 7A	71						cytoplasm|nucleus	cysteine-type peptidase activity|DNA binding|zinc ion binding			pancreas(1)|skin(1)	2		all_lung(180;1.6e-09)		all cancers(64;2.44e-19)|Epithelial(43;6.82e-14)|GBM - Glioblastoma multiforme(186;1.49e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00189)|Lung(196;0.208)														---	---	---	---
RYR3	6263	broad.mit.edu	37	15	33938602	33938602	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:33938602G>A	uc001zhi.2	+	29	3886	c.3816G>A	c.(3814-3816)ACG>ACA	p.T1272T	RYR3_uc010bar.2_Silent_p.T1272T	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	1272	4 X approximate repeats.|B30.2/SPRY 3.|Cytoplasmic (By similarity).				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---
RYR3	6263	broad.mit.edu	37	15	34032146	34032146	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34032146C>A	uc001zhi.2	+	51	7840	c.7770C>A	c.(7768-7770)ATC>ATA	p.I2590I	RYR3_uc010bar.2_Silent_p.I2590I	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	2590	3.|Cytoplasmic (By similarity).|4 X approximate repeats.				cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---
RYR3	6263	broad.mit.edu	37	15	34102805	34102805	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34102805A>G	uc001zhi.2	+	71	10222	c.10152A>G	c.(10150-10152)CCA>CCG	p.P3384P	RYR3_uc010bar.2_Silent_p.P3379P	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	3384					cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)														---	---	---	---
GJD2	57369	broad.mit.edu	37	15	35044711	35044711	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:35044711T>C	uc001zis.1	-	2	934	c.934A>G	c.(934-936)AGG>GGG	p.R312G	uc001zit.1_5'Flank	NM_020660	NP_065711	Q9UKL4	CXD2_HUMAN	gap junction protein, delta 2, 36kDa	312	Cytoplasmic (Potential).				synaptic transmission	connexon complex|integral to membrane	gap junction channel activity				0		all_lung(180;9.67e-07)		all cancers(64;2.75e-18)|GBM - Glioblastoma multiforme(113;1.9e-07)|BRCA - Breast invasive adenocarcinoma(123;0.0156)														---	---	---	---
DISP2	85455	broad.mit.edu	37	15	40661129	40661129	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40661129C>A	uc001zlk.1	+	8	2905	c.2816C>A	c.(2815-2817)CCT>CAT	p.P939H		NM_033510	NP_277045	A7MBM2	DISP2_HUMAN	dispatched B	939					smoothened signaling pathway	integral to membrane				ovary(2)	2		all_cancers(109;9.35e-19)|all_epithelial(112;1.18e-15)|Lung NSC(122;2.45e-11)|all_lung(180;6.47e-10)|Melanoma(134;0.0574)|Ovarian(310;0.0822)|Colorectal(260;0.117)		GBM - Glioblastoma multiforme(113;3.39e-06)|Colorectal(105;0.0114)|READ - Rectum adenocarcinoma(2;0.0649)|BRCA - Breast invasive adenocarcinoma(123;0.0798)|Lung(196;0.15)|LUAD - Lung adenocarcinoma(183;0.247)														---	---	---	---
SPTBN5	51332	broad.mit.edu	37	15	42185101	42185101	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42185101G>A	uc001zos.2	-	3	603	c.270C>T	c.(268-270)CTC>CTT	p.L90L	uc010bcp.1_RNA	NM_016642	NP_057726	Q9NRC6	SPTN5_HUMAN	spectrin, beta, non-erythrocytic 5	125	Actin-binding.|CH 1.				actin cytoskeleton organization|actin filament capping|axon guidance	cytosol|membrane|spectrin				ovary(1)|central_nervous_system(1)	2		all_cancers(109;1.84e-17)|all_epithelial(112;1.12e-15)|Lung NSC(122;7.6e-10)|all_lung(180;4.15e-09)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.173)		all cancers(2;4.33e-34)|Epithelial(2;1.72e-25)|OV - Ovarian serous cystadenocarcinoma(18;8.32e-20)|GBM - Glioblastoma multiforme(94;4.69e-07)|Colorectal(2;0.00104)|COAD - Colon adenocarcinoma(120;0.0405)|READ - Rectum adenocarcinoma(92;0.0908)														---	---	---	---
DTWD1	56986	broad.mit.edu	37	15	49917367	49917367	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:49917367G>A	uc001zxq.2	+	3	280	c.3G>A	c.(1-3)ATG>ATA	p.M1I	DTWD1_uc001zxp.3_RNA|DTWD1_uc001zxs.2_Missense_Mutation_p.M1I|DTWD1_uc001zxr.2_5'UTR|DTWD1_uc001zxo.2_Missense_Mutation_p.M1I	NM_020234	NP_064619	Q8N5C7	DTWD1_HUMAN	DTW domain containing 1	1											0		all_lung(180;0.0384)		all cancers(107;3.27e-08)|GBM - Glioblastoma multiforme(94;7.6e-05)														---	---	---	---
TRPM7	54822	broad.mit.edu	37	15	50931674	50931674	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:50931674C>T	uc001zyt.3	-	6	871	c.607G>A	c.(607-609)GGA>AGA	p.G203R	TRPM7_uc010bew.1_Missense_Mutation_p.G203R	NM_017672	NP_060142	Q96QT4	TRPM7_HUMAN	transient receptor potential cation channel,	203	Cytoplasmic (Potential).				cell death	integral to membrane	ATP binding|calcium channel activity|metal ion binding|protein serine/threonine kinase activity			ovary(4)|stomach(3)|breast(1)|central_nervous_system(1)|skin(1)	10				all cancers(107;0.000819)|GBM - Glioblastoma multiforme(94;0.0045)														---	---	---	---
SCG3	29106	broad.mit.edu	37	15	51984349	51984349	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:51984349A>G	uc002abh.2	+						SCG3_uc010ufz.1_Intron	NM_013243	NP_037375			secretogranin III isoform 1 precursor						platelet activation|platelet degranulation	extracellular region|stored secretory granule				ovary(1)	1				all cancers(107;0.00488)														---	---	---	---
MYO5A	4644	broad.mit.edu	37	15	52611494	52611494	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:52611494A>G	uc002aby.2	-	38	5166	c.4922T>C	c.(4921-4923)GTG>GCG	p.V1641A	MYO5A_uc002abx.3_Missense_Mutation_p.V1614A|MYO5A_uc010ugd.1_Missense_Mutation_p.V363A	NM_000259	NP_000250	Q9Y4I1	MYO5A_HUMAN	myosin VA isoform 1	1641	Dilute.				actin filament-based movement|transport	cytoplasm|growth cone|myosin complex|ruffle	actin binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(3)|central_nervous_system(1)	4				all cancers(107;0.0085)|Colorectal(133;0.077)|READ - Rectum adenocarcinoma(133;0.196)														---	---	---	---
FBXL22	283807	broad.mit.edu	37	15	63893593	63893593	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63893593C>A	uc002amn.2	+	2	448	c.434C>A	c.(433-435)CCT>CAT	p.P145H	uc002amj.2_5'Flank|uc002amk.2_5'Flank|uc002aml.2_5'Flank	NM_203373	NP_976307	Q6P050	FXL22_HUMAN	F-box and leucine-rich repeat protein 22	145											0																		---	---	---	---
KIF23	9493	broad.mit.edu	37	15	69737166	69737166	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:69737166G>A	uc002asb.2	+	19	2534	c.2417G>A	c.(2416-2418)CGT>CAT	p.R806H	KIF23_uc002asc.2_Missense_Mutation_p.R702H|KIF23_uc010bii.2_Intron|KIF23_uc010ukc.1_Missense_Mutation_p.R519H	NM_138555	NP_612565	Q02241	KIF23_HUMAN	kinesin family member 23 isoform 1	806					blood coagulation|cytokinesis|microtubule-based movement|mitosis|mitotic spindle elongation	cytosol|kinesin complex|microtubule|midbody|nucleoplasm|spindle	ATP binding|microtubule motor activity|protein binding				0																		---	---	---	---
THSD4	79875	broad.mit.edu	37	15	71952908	71952908	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:71952908G>A	uc002atb.1	+	7	1271	c.1192G>A	c.(1192-1194)GTG>ATG	p.V398M	THSD4_uc002atd.1_Missense_Mutation_p.V72M|THSD4_uc010ukg.1_Missense_Mutation_p.V38M|THSD4_uc002ate.2_Missense_Mutation_p.V38M	NM_024817	NP_079093	Q6ZMP0	THSD4_HUMAN	thrombospondin, type I, domain containing 4	398						proteinaceous extracellular matrix	metalloendopeptidase activity			ovary(2)	2																		---	---	---	---
STOML1	9399	broad.mit.edu	37	15	74276451	74276451	+	Missense_Mutation	SNP	C	T	T	rs141171144	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:74276451C>T	uc002awe.2	-	7	1095	c.1024G>A	c.(1024-1026)GGG>AGG	p.G342R	STOML1_uc002awf.2_Missense_Mutation_p.G341R|STOML1_uc010bje.2_Missense_Mutation_p.G271R|STOML1_uc010uld.1_Missense_Mutation_p.G299R|STOML1_uc002awh.2_Missense_Mutation_p.G292R|STOML1_uc002awg.2_Missense_Mutation_p.G291R|STOML1_uc002awi.2_Missense_Mutation_p.G254R	NM_004809	NP_004800	Q9UBI4	STML1_HUMAN	stomatin (EPB72)-like 1	342	Cytoplasmic (Potential).|SCP2.					integral to membrane	sterol binding			skin(1)	1																		---	---	---	---
CYP11A1	1583	broad.mit.edu	37	15	74630343	74630343	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:74630343C>A	uc002axt.2	-	9	1691	c.1536G>T	c.(1534-1536)TGG>TGT	p.W512C	CYP11A1_uc002axs.2_Missense_Mutation_p.W354C|CYP11A1_uc010bjm.1_Missense_Mutation_p.W354C|CYP11A1_uc010bjn.1_RNA|CYP11A1_uc010bjo.1_Missense_Mutation_p.W430C	NM_000781	NP_000772	P05108	CP11A_HUMAN	cytochrome P450, family 11, subfamily A,	512					C21-steroid hormone biosynthetic process|cholesterol metabolic process|vitamin D metabolic process|xenobiotic metabolic process	mitochondrial matrix	cholesterol monooxygenase (side-chain-cleaving) activity|electron carrier activity|heme binding			ovary(2)	2					Aminoglutethimide(DB00357)|Cholecalciferol(DB00169)|Cimetidine(DB00501)|Clotrimazole(DB00257)|Digitoxin(DB01396)|Digoxin(DB00390)|Medroxyprogesterone(DB00603)|Ouabain(DB01092)|Progesterone(DB00396)|Testosterone(DB00624)|Trilostane(DB01108)													---	---	---	---
PTPN9	5780	broad.mit.edu	37	15	75819488	75819488	+	Missense_Mutation	SNP	G	A	A	rs114183309	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75819488G>A	uc002bal.2	-	2	686	c.178C>T	c.(178-180)CGT>TGT	p.R60C		NM_002833	NP_002824	P43378	PTN9_HUMAN	protein tyrosine phosphatase, non-receptor type	60						cytoplasmic part	non-membrane spanning protein tyrosine phosphatase activity|protein binding			lung(1)|skin(1)	2																		---	---	---	---
AP3B2	8120	broad.mit.edu	37	15	83348969	83348969	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:83348969G>A	uc010uoh.1	-	9	1245	c.1068C>T	c.(1066-1068)TAC>TAT	p.Y356Y	AP3B2_uc010uoi.1_Silent_p.Y356Y|AP3B2_uc010uoj.1_Silent_p.Y324Y|AP3B2_uc010uog.1_Translation_Start_Site	NM_004644	NP_004635	Q13367	AP3B2_HUMAN	adaptor-related protein complex 3, beta 2	356					endocytosis|intracellular protein transport|post-Golgi vesicle-mediated transport	clathrin coated vesicle membrane|COPI-coated vesicle|membrane coat	binding|protein transporter activity			ovary(3)|breast(1)|pancreas(1)	5			BRCA - Breast invasive adenocarcinoma(143;0.229)															---	---	---	---
ZSCAN2	54993	broad.mit.edu	37	15	85164613	85164613	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:85164613G>T	uc002bkr.2	+	3	1413	c.1187G>T	c.(1186-1188)GGG>GTG	p.G396V	ZSCAN2_uc010bmz.1_Missense_Mutation_p.G394V|ZSCAN2_uc010bna.2_Missense_Mutation_p.G246V|ZSCAN2_uc010uox.1_Intron|ZSCAN2_uc010uoy.1_Intron|ZSCAN2_uc010uoz.1_Intron	NM_181877	NP_870992	Q7Z7L9	ZSCA2_HUMAN	zinc finger protein 29 isoform 1	396	C2H2-type 7.				cell differentiation|multicellular organismal development|spermatogenesis|viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2				UCEC - Uterine corpus endometrioid carcinoma (272;0.168)|all cancers(203;5.43e-22)														---	---	---	---
IGF1R	3480	broad.mit.edu	37	15	99486214	99486214	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:99486214C>T	uc002bul.2	+	19	3570	c.3520C>T	c.(3520-3522)CTG>TTG	p.L1174L	IGF1R_uc010bon.2_Silent_p.L1173L	NM_000875	NP_000866	P08069	IGF1R_HUMAN	insulin-like growth factor 1 receptor precursor	1174	Protein kinase.|Cytoplasmic (Potential).				anti-apoptosis|immune response|insulin receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of DNA replication|protein autophosphorylation|protein tetramerization	microsome	ATP binding|identical protein binding|insulin binding|insulin receptor binding|insulin receptor substrate binding|insulin-like growth factor I binding|insulin-like growth factor receptor activity|metal ion binding|phosphatidylinositol 3-kinase binding			lung(3)|kidney(3)|ovary(1)|central_nervous_system(1)	8	all_cancers(4;4.17e-14)|all_epithelial(3;4.34e-15)|Lung NSC(78;0.00175)|all_lung(78;0.00351)|Melanoma(26;0.00505)|Medulloblastoma(229;0.163)		Epithelial(2;1.94e-12)|all cancers(5;6.83e-11)|BRCA - Breast invasive adenocarcinoma(2;2.88e-09)|OV - Ovarian serous cystadenocarcinoma(32;0.00261)		Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Mecasermin(DB01277)													---	---	---	---
CRAMP1L	57585	broad.mit.edu	37	16	1709993	1709993	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1709993G>A	uc010uvh.1	+	10	2342	c.2342G>A	c.(2341-2343)CGC>CAC	p.R781H	CRAMP1L_uc002cmf.2_RNA	NM_020825	NP_065876	Q96RY5	CRML_HUMAN	Crm, cramped-like	781						nucleus	DNA binding				0																		---	---	---	---
TRAF7	84231	broad.mit.edu	37	16	2215906	2215906	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2215906C>T	uc002cow.2	+	3	207	c.108C>T	c.(106-108)CCC>CCT	p.P36P		NM_032271	NP_115647	Q6Q0C0	TRAF7_HUMAN	TNF receptor-associated factor 7	36					activation of MAPKKK activity|apoptosis|regulation of apoptosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic membrane-bounded vesicle|ubiquitin ligase complex	identical protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|lung(1)|breast(1)	3																		---	---	---	---
TCEB2	6923	broad.mit.edu	37	16	2822060	2822060	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2822060C>T	uc002crn.2	-	4	345	c.288G>A	c.(286-288)CCG>CCA	p.P96P	TCEB2_uc002crm.2_Silent_p.P96P	NM_007108	NP_009039	Q15370	ELOB_HUMAN	elongin B isoform a	96					positive regulation of viral transcription|protein complex assembly|regulation of transcription, DNA-dependent|transcription elongation from RNA polymerase II promoter|viral reproduction	cytosol|nucleoplasm	protein binding				0																		---	---	---	---
GLYR1	84656	broad.mit.edu	37	16	4862174	4862174	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:4862174A>G	uc002cxx.3	-	13	1232	c.1195T>C	c.(1195-1197)TTG>CTG	p.L399L	GLYR1_uc002cxy.2_RNA|GLYR1_uc002cxz.1_Silent_p.L313L|GLYR1_uc002cya.2_Silent_p.L393L|GLYR1_uc010uxv.1_Silent_p.L318L	NM_032569	NP_115958	Q49A26	GLYR1_HUMAN	cytokine-like nuclear factor n-pac	399					pentose-phosphate shunt	nucleus	coenzyme binding|DNA binding|methylated histone residue binding|phosphogluconate dehydrogenase (decarboxylating) activity				0																		---	---	---	---
TXNDC11	51061	broad.mit.edu	37	16	11785525	11785525	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11785525T>C	uc010buu.1	-	9	1664	c.1602A>G	c.(1600-1602)GCA>GCG	p.A534A	TXNDC11_uc002dbg.1_Silent_p.A507A	NM_015914	NP_056998	Q6PKC3	TXD11_HUMAN	thioredoxin domain containing 11	534					cell redox homeostasis	endoplasmic reticulum membrane|integral to membrane					0																		---	---	---	---
GSPT1	2935	broad.mit.edu	37	16	11979123	11979123	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11979123G>A	uc002dbr.2	-	8	875	c.848C>T	c.(847-849)CCG>CTG	p.P283L	GSPT1_uc002dbu.2_Missense_Mutation_p.P420L|GSPT1_uc002dbt.2_Missense_Mutation_p.P421L|GSPT1_uc010bux.2_Missense_Mutation_p.P283L	NM_001130007	NP_001123479	P15170	ERF3A_HUMAN	G1 to S phase transition 1 isoform 3	283					G1/S transition of mitotic cell cycle|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|protein methylation	intracellular	GTP binding|GTPase activity|protein binding|translation release factor activity			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3																		---	---	---	---
TMC7	79905	broad.mit.edu	37	16	19063046	19063046	+	Silent	SNP	G	A	A	rs150607973		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19063046G>A	uc002dfq.2	+	13	1909	c.1779G>A	c.(1777-1779)CCG>CCA	p.P593P	TMC7_uc002dfp.2_Silent_p.P593P|TMC7_uc010vap.1_Silent_p.P483P	NM_024847	NP_079123	Q7Z402	TMC7_HUMAN	transmembrane channel-like 7 isoform a	593	Cytoplasmic (Potential).					integral to membrane				skin(2)|ovary(1)	3																		---	---	---	---
ACSM2A	123876	broad.mit.edu	37	16	20471449	20471449	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20471449C>T	uc010bwe.2	+	3	252	c.13C>T	c.(13-15)CGA>TGA	p.R5*	ACSM2A_uc010bwd.1_RNA|ACSM2A_uc010vax.1_Intron|ACSM2A_uc002dhf.3_Nonsense_Mutation_p.R5*|ACSM2A_uc002dhg.3_Nonsense_Mutation_p.R5*|ACSM2A_uc010vay.1_Intron	NM_001010845	NP_001010845	Q08AH3	ACS2A_HUMAN	acyl-CoA synthetase medium-chain family member	5					fatty acid metabolic process	mitochondrial matrix	ATP binding|butyrate-CoA ligase activity|metal ion binding			skin(2)|breast(1)	3																		---	---	---	---
ACSM2B	348158	broad.mit.edu	37	16	20554592	20554592	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20554592C>T	uc002dhj.3	-						ACSM2B_uc002dhk.3_Intron|ACSM2B_uc010bwf.1_Intron	NM_182617	NP_872423			acyl-CoA synthetase medium-chain family member						fatty acid metabolic process|xenobiotic metabolic process	mitochondrial matrix	ATP binding|butyrate-CoA ligase activity|CoA-ligase activity|metal ion binding			skin(3)|ovary(1)|central_nervous_system(1)	5																		---	---	---	---
DNAH3	55567	broad.mit.edu	37	16	20981102	20981102	+	Intron	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20981102G>T	uc010vbe.1	-						DNAH3_uc010vbd.1_Intron	NM_017539	NP_060009			dynein, axonemal, heavy chain 3						ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(10)|skin(3)|large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)	18				GBM - Glioblastoma multiforme(48;0.207)														---	---	---	---
DNAH3	55567	broad.mit.edu	37	16	20994175	20994175	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20994175C>T	uc010vbe.1	-	49	7727	c.7727G>A	c.(7726-7728)CGC>CAC	p.R2576H	DNAH3_uc010vbd.1_Missense_Mutation_p.R11H	NM_017539	NP_060009	Q8TD57	DYH3_HUMAN	dynein, axonemal, heavy chain 3	2576	AAA 4 (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(10)|skin(3)|large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)	18				GBM - Glioblastoma multiforme(48;0.207)														---	---	---	---
TNRC6A	27327	broad.mit.edu	37	16	24802952	24802952	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24802952C>T	uc002dmm.2	+	6	3103	c.2989C>T	c.(2989-2991)CGC>TGC	p.R997C	TNRC6A_uc010bxs.2_Missense_Mutation_p.R744C|TNRC6A_uc010vcc.1_Missense_Mutation_p.R744C|TNRC6A_uc002dmn.2_Missense_Mutation_p.R744C|TNRC6A_uc002dmo.2_Missense_Mutation_p.R744C	NM_014494	NP_055309	Q8NDV7	TNR6A_HUMAN	trinucleotide repeat containing 6A	997	Sufficient for interaction with EIF2C1 and EIF2C4.				negative regulation of translation involved in gene silencing by miRNA	cytoplasmic mRNA processing body|micro-ribonucleoprotein complex	nucleotide binding|RNA binding			ovary(2)	2				GBM - Glioblastoma multiforme(48;0.0394)														---	---	---	---
AQP8	343	broad.mit.edu	37	16	25228611	25228611	+	Silent	SNP	G	A	A	rs138426074		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:25228611G>A	uc002doc.2	+	2	187	c.105G>A	c.(103-105)GTG>GTA	p.V35V		NM_001169	NP_001160	O94778	AQP8_HUMAN	aquaporin 8	35	Cytoplasmic (Potential).				cellular response to cAMP	integral to plasma membrane	water channel activity			upper_aerodigestive_tract(1)|breast(1)|pancreas(1)	3				GBM - Glioblastoma multiforme(48;0.044)														---	---	---	---
ZKSCAN2	342357	broad.mit.edu	37	16	25255513	25255513	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:25255513T>C	uc002dod.3	-	6	1981	c.1574A>G	c.(1573-1575)CAT>CGT	p.H525R	ZKSCAN2_uc010vcl.1_Missense_Mutation_p.H321R	NM_001012981	NP_001012999	Q63HK3	ZKSC2_HUMAN	zinc finger with KRAB and SCAN domains 2	525					viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(3)|breast(1)	4				GBM - Glioblastoma multiforme(48;0.0378)														---	---	---	---
HS3ST4	9951	broad.mit.edu	37	16	26147212	26147212	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:26147212G>A	uc002dof.2	+	2	1406	c.1014G>A	c.(1012-1014)CTG>CTA	p.L338L		NM_006040	NP_006031	Q9Y661	HS3S4_HUMAN	heparan sulfate D-glucosaminyl	338	Lumenal (Potential).				heparan sulfate proteoglycan metabolic process	extracellular region|Golgi membrane|integral to membrane	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity			large_intestine(1)|breast(1)	2				GBM - Glioblastoma multiforme(48;0.0988)														---	---	---	---
JMJD5	79831	broad.mit.edu	37	16	27231806	27231806	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:27231806G>T	uc002doh.2	+	7	1268	c.1086G>T	c.(1084-1086)CAG>CAT	p.Q362H	JMJD5_uc010vcn.1_Missense_Mutation_p.Q400H|JMJD5_uc010bxw.2_Intron|JMJD5_uc010bxx.2_RNA	NM_024773	NP_079049	Q8N371	KDM8_HUMAN	jumonji domain containing 5 isoform 2	362	JmjC.				G2/M transition of mitotic cell cycle|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	chromatin binding|histone demethylase activity (H3-K36 specific)|metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			ovary(2)|upper_aerodigestive_tract(1)	3																		---	---	---	---
SH2B1	25970	broad.mit.edu	37	16	28883900	28883900	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28883900C>T	uc002dri.2	+	10	2210	c.1771C>T	c.(1771-1773)CAC>TAC	p.H591Y	uc010vct.1_Intron|SH2B1_uc010vdc.1_Missense_Mutation_p.H281Y|SH2B1_uc002drj.2_Missense_Mutation_p.H591Y|SH2B1_uc002drk.2_Missense_Mutation_p.H591Y|SH2B1_uc002drl.2_Missense_Mutation_p.H591Y|SH2B1_uc010vdd.1_Missense_Mutation_p.H255Y|SH2B1_uc010vde.1_Missense_Mutation_p.H591Y|SH2B1_uc002drm.2_Missense_Mutation_p.H591Y	NM_001145795	NP_001139267	Q9NRF2	SH2B1_HUMAN	SH2B adaptor protein 1 isoform 1	591	SH2.				blood coagulation|intracellular signal transduction	cytosol|membrane|nucleus	signal transducer activity			ovary(2)	2																		---	---	---	---
FAM57B	83723	broad.mit.edu	37	16	30040741	30040741	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30040741C>T	uc002dvt.2	-						uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|FAM57B_uc002dvu.2_Intron	NM_031478	NP_113666			hypothetical protein LOC83723							endoplasmic reticulum|integral to membrane					0																		---	---	---	---
ZNF689	115509	broad.mit.edu	37	16	30616043	30616043	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30616043G>A	uc002dyx.2	-	3	1365	c.1045C>T	c.(1045-1047)CAC>TAC	p.H349Y	ZNF689_uc010bzy.2_Silent_p.S4S	NM_138447	NP_612456	Q96CS4	ZN689_HUMAN	zinc finger protein HIT-39	349	C2H2-type 8.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0			Colorectal(24;0.198)															---	---	---	---
SRCAP	10847	broad.mit.edu	37	16	30734020	30734020	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30734020C>A	uc002dze.1	+	23	4228	c.3843C>A	c.(3841-3843)AGC>AGA	p.S1281R	SRCAP_uc002dzf.2_Intron|SRCAP_uc002dzg.1_Intron|SRCAP_uc010bzz.1_Missense_Mutation_p.S851R	NM_006662	NP_006653	Q6ZRS2	SRCAP_HUMAN	Snf2-related CBP activator protein	1281	Pro-rich.				interspecies interaction between organisms|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	Golgi apparatus|nucleus|protein complex	ATP binding|DNA binding|helicase activity|histone acetyltransferase activity|transcription coactivator activity			ovary(3)|skin(1)	4			Colorectal(24;0.198)															---	---	---	---
ZNF646	9726	broad.mit.edu	37	16	31088784	31088784	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31088784G>A	uc002eap.2	+	2	1428	c.1139G>A	c.(1138-1140)GGC>GAC	p.G380D		NM_014699	NP_055514	O15015	ZN646_HUMAN	zinc finger protein 646	380	C2H2-type 7.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			breast(2)	2																		---	---	---	---
MYST1	84148	broad.mit.edu	37	16	31141482	31141482	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31141482C>T	uc002eay.2	+						MYST1_uc002eax.2_Intron|MYST1_uc002eaz.2_Intron|MYST1_uc002eba.2_Intron|MYST1_uc002ebb.2_Intron	NM_032188	NP_115564			MYST histone acetyltransferase 1 isoform 1						histone H4-K16 acetylation|myeloid cell differentiation|negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	MLL1 complex|MSL complex	histone acetyltransferase activity|metal ion binding|methylated histone residue binding|transcription factor binding			ovary(1)	1																		---	---	---	---
ITGAX	3687	broad.mit.edu	37	16	31372506	31372506	+	Missense_Mutation	SNP	A	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31372506A>T	uc002ebu.1	+	9	1051	c.984A>T	c.(982-984)CAA>CAT	p.Q328H	ITGAX_uc002ebt.2_Missense_Mutation_p.Q328H|ITGAX_uc010vfk.1_5'Flank	NM_000887	NP_000878	P20702	ITAX_HUMAN	integrin alpha X precursor	328	VWFA.|Extracellular (Potential).				blood coagulation|cell adhesion|integrin-mediated signaling pathway|leukocyte migration|organ morphogenesis	integrin complex	protein binding|receptor activity			ovary(2)|central_nervous_system(1)|pancreas(1)	4																		---	---	---	---
C16orf58	64755	broad.mit.edu	37	16	31512030	31512030	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31512030G>A	uc002eci.1	-	3	450	c.438C>T	c.(436-438)CGC>CGT	p.R146R	C16orf58_uc010vfq.1_Silent_p.R4R	NM_022744	NP_073581	Q96GQ5	CP058_HUMAN	hypothetical protein LOC64755	146						integral to membrane				ovary(1)|breast(1)	2																		---	---	---	---
MYLK3	91807	broad.mit.edu	37	16	46766181	46766181	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:46766181C>T	uc002eei.3	-	4	1517	c.1401G>A	c.(1399-1401)CCG>CCA	p.P467P	MYLK3_uc010vge.1_Silent_p.P126P|MYLK3_uc002eej.1_Silent_p.P126P	NM_182493	NP_872299	Q32MK0	MYLK3_HUMAN	myosin light chain kinase 3	467					cardiac myofibril assembly|cellular response to interleukin-1|positive regulation of sarcomere organization|regulation of vascular permeability involved in acute inflammatory response|sarcomere organization|sarcomerogenesis	cytosol	ATP binding|calmodulin-dependent protein kinase activity|myosin light chain kinase activity			stomach(2)|skin(2)|large_intestine(1)|ovary(1)|central_nervous_system(1)	7		all_cancers(37;0.00023)|all_epithelial(9;0.000543)|all_lung(18;0.00585)|Lung NSC(13;0.0496)|Breast(268;0.116)																---	---	---	---
NETO2	81831	broad.mit.edu	37	16	47165899	47165899	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:47165899G>A	uc002eer.1	-	2	457	c.72C>T	c.(70-72)GCC>GCT	p.A24A	NETO2_uc002ees.1_Silent_p.A24A	NM_018092	NP_060562	Q8NC67	NETO2_HUMAN	neuropilin- and tolloid-like protein 2	24	Extracellular (Potential).					integral to membrane	receptor activity				0		all_cancers(37;0.00114)|all_lung(18;0.00432)|Lung NSC(13;0.0384)|Breast(268;0.174)													HNSCC(25;0.065)			---	---	---	---
ABCC11	85320	broad.mit.edu	37	16	48226616	48226616	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:48226616G>A	uc002eff.1	-	19	2871	c.2521C>T	c.(2521-2523)CGA>TGA	p.R841*	ABCC11_uc002efg.1_Nonsense_Mutation_p.R841*|ABCC11_uc002efh.1_Nonsense_Mutation_p.R841*|ABCC11_uc010vgk.1_RNA	NM_033151	NP_149163	Q96J66	ABCCB_HUMAN	ATP-binding cassette, sub-family C, member 11	841	ABC transmembrane type-1 2.					integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(3)|skin(2)|central_nervous_system(1)	6		all_cancers(37;0.127)|all_lung(18;0.132)|Breast(268;0.166)												Cerumen_Type				---	---	---	---
SALL1	6299	broad.mit.edu	37	16	51175241	51175241	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:51175241C>T	uc010vgs.1	-	2	923	c.892G>A	c.(892-894)GGA>AGA	p.G298R	SALL1_uc010vgr.1_Missense_Mutation_p.G201R|SALL1_uc010cbv.2_Intron	NM_002968	NP_002959	Q9NSC2	SALL1_HUMAN	sal-like 1 isoform a	298					adrenal gland development|branching involved in ureteric bud morphogenesis|embryonic digestive tract development|embryonic digit morphogenesis|gonad development|histone deacetylation|inductive cell-cell signaling|mesenchymal to epithelial transition involved in metanephros morphogenesis|negative regulation of transcription from RNA polymerase II promoter|olfactory bulb interneuron differentiation|olfactory bulb mitral cell layer development|olfactory nerve development|outer ear morphogenesis|pituitary gland development|positive regulation of transcription from RNA polymerase II promoter|positive regulation of Wnt receptor signaling pathway|ureteric bud invasion|ventricular septum development	chromocenter|cytoplasm|heterochromatin|nucleus	beta-catenin binding|DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(5)|ovary(3)	8		all_cancers(37;0.0322)	COAD - Colon adenocarcinoma(2;0.24)															---	---	---	---
CAPNS2	84290	broad.mit.edu	37	16	55600706	55600706	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:55600706G>A	uc002eid.1	+	1	123	c.38G>A	c.(37-39)CGA>CAA	p.R13Q	LPCAT2_uc002eie.3_Intron|LPCAT2_uc002eic.2_Intron	NM_032330	NP_115706	Q96L46	CPNS2_HUMAN	calpain small subunit 2	13	Gly-rich.					cytoplasm|plasma membrane	calcium ion binding				0																		---	---	---	---
AMFR	267	broad.mit.edu	37	16	56401438	56401438	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:56401438C>T	uc002eiy.2	-	12	1722	c.1517G>A	c.(1516-1518)CGG>CAG	p.R506Q	AMFR_uc002eix.2_Missense_Mutation_p.R140Q	NM_001144	NP_001135	Q9UKV5	AMFR2_HUMAN	autocrine motility factor receptor	506					endoplasmic reticulum unfolded protein response|ER-associated protein catabolic process|protein oligomerization|protein polyubiquitination	integral to endoplasmic reticulum membrane|integral to membrane of membrane fraction	protein binding|protein binding|receptor activity|ubiquitin-protein ligase activity|zinc ion binding			breast(2)	2																		---	---	---	---
NUP93	9688	broad.mit.edu	37	16	56862946	56862946	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:56862946C>T	uc002eka.2	+	9	973	c.852C>T	c.(850-852)GGC>GGT	p.G284G	NUP93_uc002ekb.2_Silent_p.G161G|NUP93_uc010vhi.1_Silent_p.G161G	NM_014669	NP_055484	Q8N1F7	NUP93_HUMAN	nucleoporin 93kDa	284					carbohydrate metabolic process|glucose transport|mRNA transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	nuclear pore	protein binding			ovary(1)|lung(1)	2																		---	---	---	---
CDH8	1006	broad.mit.edu	37	16	61747844	61747844	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:61747844C>T	uc002eog.1	-	10	1807	c.1555G>A	c.(1555-1557)GCC>ACC	p.A519T		NM_001796	NP_001787	P55286	CADH8_HUMAN	cadherin 8, type 2 preproprotein	519	Extracellular (Potential).|Cadherin 5.				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|skin(2)|breast(1)	9		Ovarian(137;0.0799)|Melanoma(118;0.16)		UCEC - Uterine corpus endometrioid carcinoma (183;0.196)|Epithelial(162;0.0155)|all cancers(182;0.0305)|OV - Ovarian serous cystadenocarcinoma(108;0.0499)|BRCA - Breast invasive adenocarcinoma(181;0.249)														---	---	---	---
CES2	8824	broad.mit.edu	37	16	66974142	66974142	+	Silent	SNP	C	T	T	rs150573301	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:66974142C>T	uc002eqr.2	+	4	1633	c.633C>T	c.(631-633)CAC>CAT	p.H211H	CES2_uc002eqq.2_Silent_p.H211H|CES2_uc002eqs.2_Silent_p.H54H	NM_003869	NP_003860	O00748	EST2_HUMAN	carboxylesterase 2 isoform 1	147					catabolic process	endoplasmic reticulum lumen	carboxylesterase activity|methyl indole-3-acetate esterase activity|methyl jasmonate esterase activity|methyl salicylate esterase activity				0		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0663)|Epithelial(162;0.166)														---	---	---	---
HSF4	3299	broad.mit.edu	37	16	67199519	67199519	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67199519G>A	uc002erl.1	+	4	1183	c.218G>A	c.(217-219)CGC>CAC	p.R73H	HSF4_uc002erm.1_Missense_Mutation_p.R73H|HSF4_uc002ern.1_RNA|HSF4_uc010cec.1_RNA	NM_001040667	NP_001035757	Q9ULV5	HSF4_HUMAN	heat shock transcription factor 4 isoform b	73	By similarity.		R -> H (in CZ-HSF4).		response to stress	nucleus	sequence-specific DNA binding transcription factor activity|transcription corepressor activity				0		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0143)|Epithelial(162;0.0335)|all cancers(182;0.184)														---	---	---	---
SLC9A5	6553	broad.mit.edu	37	16	67293791	67293791	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67293791G>A	uc002esm.2	+	12	1847	c.1784G>A	c.(1783-1785)CGT>CAT	p.R595H	SLC9A5_uc010cee.2_Missense_Mutation_p.R300H|SLC9A5_uc010vji.1_Missense_Mutation_p.R99H|uc002esn.1_5'Flank	NM_004594	NP_004585	Q14940	SL9A5_HUMAN	solute carrier family 9 (sodium/hydrogen	595					regulation of pH	integral to membrane|plasma membrane	sodium:hydrogen antiporter activity			ovary(1)|pancreas(1)	2		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.00376)|Epithelial(162;0.0173)|all cancers(182;0.116)														---	---	---	---
PLEKHG4	25894	broad.mit.edu	37	16	67314221	67314221	+	Missense_Mutation	SNP	G	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67314221G>C	uc002eso.3	+	1	2809	c.274G>C	c.(274-276)GTC>CTC	p.V92L	PLEKHG4_uc002esp.3_5'UTR|PLEKHG4_uc002esq.3_Missense_Mutation_p.V92L|PLEKHG4_uc002esr.1_Intron|PLEKHG4_uc010cef.2_Missense_Mutation_p.V92L|PLEKHG4_uc002ess.3_Missense_Mutation_p.V92L|PLEKHG4_uc010ceg.2_Missense_Mutation_p.V92L	NM_015432	NP_056247	Q58EX7	PKHG4_HUMAN	pleckstrin homology domain containing, family G	92					regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			skin(1)|pancreas(1)	2				OV - Ovarian serous cystadenocarcinoma(108;0.00376)|Epithelial(162;0.0173)|all cancers(182;0.116)|Kidney(780;0.119)														---	---	---	---
ATP6V0D1	9114	broad.mit.edu	37	16	67472975	67472975	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67472975T>C	uc002ete.1	-	6	815	c.715A>G	c.(715-717)AAG>GAG	p.K239E	ATP6V0D1_uc010vjo.1_Missense_Mutation_p.K280E|ATP6V0D1_uc010vjn.1_Missense_Mutation_p.K162E	NM_004691	NP_004682	P61421	VA0D1_HUMAN	ATPase, H+ transporting, lysosomal, V0 subunit	239					ATP hydrolysis coupled proton transport|cellular iron ion homeostasis|insulin receptor signaling pathway|transferrin transport	endosome membrane|proton-transporting V-type ATPase, V0 domain|vacuolar proton-transporting V-type ATPase complex					0		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0439)|Epithelial(162;0.101)														---	---	---	---
PSMB10	5699	broad.mit.edu	37	16	67968747	67968747	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67968747G>A	uc002eux.1	-	7	764	c.663C>T	c.(661-663)GGC>GGT	p.G221G	CTRL_uc002euw.2_5'Flank	NM_002801	NP_002792	P40306	PSB10_HUMAN	proteasome beta 10 subunit proprotein	221					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|humoral immune response|interspecies interaction between organisms|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	cytoplasm|nucleus|proteasome core complex	threonine-type endopeptidase activity				0		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.00415)|Epithelial(162;0.0182)|all cancers(182;0.119)														---	---	---	---
CDH1	999	broad.mit.edu	37	16	68862117	68862117	+	Silent	SNP	G	A	A	rs138493551	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68862117G>A	uc002ewg.1	+	14	2329	c.2205G>A	c.(2203-2205)GCG>GCA	p.A735A	CDH1_uc010vlj.1_RNA|CDH1_uc010cfg.1_Silent_p.A674A	NM_004360	NP_004351	P12830	CADH1_HUMAN	cadherin 1, type 1 preproprotein	735	Cytoplasmic (Potential).				adherens junction organization|cellular component disassembly involved in apoptosis|cellular response to indole-3-methanol|cellular response to lithium ion|homophilic cell adhesion|negative regulation of cell-cell adhesion|positive regulation of transcription factor import into nucleus|positive regulation of transcription, DNA-dependent|regulation of immune response	actin cytoskeleton|aggresome|apical junction complex|catenin complex|cell-cell adherens junction|endosome|focal adhesion|Golgi apparatus|integral to membrane|internal side of plasma membrane|lateral plasma membrane|perinuclear region of cytoplasm	cell adhesion molecule binding|gamma-catenin binding			breast(148)|stomach(71)|biliary_tract(8)|endometrium(3)|soft_tissue(2)|large_intestine(2)|urinary_tract(2)|oesophagus(2)|ovary(2)|thyroid(1)|central_nervous_system(1)|lung(1)	243		all_neural(199;0.0189)|Ovarian(137;0.0563)		Epithelial(162;8.44e-05)|all cancers(182;0.000404)|OV - Ovarian serous cystadenocarcinoma(108;0.000426)|BRCA - Breast invasive adenocarcinoma(181;0.0261)				Mis|N|F|S		lobular breast|gastric	gastric			Hereditary_Diffuse_Gastric_Cancer				---	---	---	---
NFAT5	10725	broad.mit.edu	37	16	69687167	69687167	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:69687167G>A	uc002exm.1	+	4	1995	c.787G>A	c.(787-789)GTA>ATA	p.V263I	NFAT5_uc002exh.1_Missense_Mutation_p.V57I|NFAT5_uc002exi.2_Missense_Mutation_p.V187I|NFAT5_uc002exj.1_Missense_Mutation_p.V187I|NFAT5_uc002exk.1_Missense_Mutation_p.V187I|NFAT5_uc002exl.1_Missense_Mutation_p.V281I|NFAT5_uc002exn.1_Missense_Mutation_p.V281I	NM_006599	NP_006590	O94916	NFAT5_HUMAN	nuclear factor of activated T-cells 5 isoform c	263					excretion|signal transduction|transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
HYDIN	54768	broad.mit.edu	37	16	70954971	70954971	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70954971C>A	uc002ezr.2	-	46	7433	c.7305G>T	c.(7303-7305)CAG>CAT	p.Q2435H		NM_032821	NP_116210	Q4G0P3	HYDIN_HUMAN	hydrocephalus inducing isoform a	2436										ovary(1)|skin(1)	2		Ovarian(137;0.0654)																---	---	---	---
AP1G1	164	broad.mit.edu	37	16	71803538	71803538	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71803538C>T	uc010cgg.2	-	6	944	c.630G>A	c.(628-630)GCG>GCA	p.A210A	AP1G1_uc002fba.2_Silent_p.A210A|AP1G1_uc002fbb.2_Silent_p.A233A|AP1G1_uc010vmg.1_RNA|AP1G1_uc010vmh.1_Silent_p.A292A	NM_001128	NP_001119	O43747	AP1G1_HUMAN	adaptor-related protein complex 1, gamma 1	210					endocytosis|intracellular protein transport|post-Golgi vesicle-mediated transport|regulation of defense response to virus by virus|viral reproduction	clathrin adaptor complex|clathrin coated vesicle membrane|cytosol|Golgi membrane|lysosomal membrane|recycling endosome	kinesin binding|protein transporter activity			ovary(2)	2		Ovarian(137;0.125)																---	---	---	---
ZFHX3	463	broad.mit.edu	37	16	72831632	72831632	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72831632G>T	uc002fck.2	-	9	5622	c.4949C>A	c.(4948-4950)TCC>TAC	p.S1650Y	ZFHX3_uc002fcl.2_Missense_Mutation_p.S736Y	NM_006885	NP_008816	Q15911	ZFHX3_HUMAN	zinc finger homeobox 3 isoform A	1650					muscle organ development|negative regulation of myoblast differentiation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|positive regulation of myoblast differentiation	transcription factor complex	enzyme binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(2)|skin(2)	4		Ovarian(137;0.13)																---	---	---	---
ZFHX3	463	broad.mit.edu	37	16	72991509	72991509	+	Missense_Mutation	SNP	G	A	A	rs141276031		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72991509G>A	uc002fck.2	-	2	3209	c.2536C>T	c.(2536-2538)CGC>TGC	p.R846C	ZFHX3_uc002fcl.2_Intron	NM_006885	NP_008816	Q15911	ZFHX3_HUMAN	zinc finger homeobox 3 isoform A	846				RHLG -> HHRV (in Ref. 1).	muscle organ development|negative regulation of myoblast differentiation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|positive regulation of myoblast differentiation	transcription factor complex	enzyme binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(2)|skin(2)	4		Ovarian(137;0.13)																---	---	---	---
ZFHX3	463	broad.mit.edu	37	16	72992629	72992629	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72992629C>T	uc002fck.2	-	2	2089	c.1416G>A	c.(1414-1416)GCG>GCA	p.A472A	ZFHX3_uc002fcl.2_Intron	NM_006885	NP_008816	Q15911	ZFHX3_HUMAN	zinc finger homeobox 3 isoform A	472	Poly-Glu.				muscle organ development|negative regulation of myoblast differentiation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|positive regulation of myoblast differentiation	transcription factor complex	enzyme binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(2)|skin(2)	4		Ovarian(137;0.13)																---	---	---	---
ADAMTS18	170692	broad.mit.edu	37	16	77359782	77359782	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:77359782T>G	uc002ffc.3	-	13	2432	c.2013A>C	c.(2011-2013)AAA>AAC	p.K671N	ADAMTS18_uc010chc.1_Missense_Mutation_p.K259N|ADAMTS18_uc002ffe.1_Missense_Mutation_p.K367N	NM_199355	NP_955387	Q8TE60	ATS18_HUMAN	ADAM metallopeptidase with thrombospondin type 1	671	Cys-rich.				proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			large_intestine(4)|lung(4)|kidney(4)|skin(3)|breast(1)|ovary(1)|pancreas(1)	18																		---	---	---	---
ATMIN	23300	broad.mit.edu	37	16	81076065	81076065	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:81076065C>T	uc002ffz.1	+	3	660	c.642C>T	c.(640-642)CAC>CAT	p.H214H	ATMIN_uc002fga.2_Silent_p.H56H|ATMIN_uc010vnn.1_Intron|ATMIN_uc002fgb.1_Silent_p.H56H	NM_015251	NP_056066	O43313	ATMIN_HUMAN	ATM interactor	214					response to DNA damage stimulus	nucleus	zinc ion binding				0																		---	---	---	---
GAN	8139	broad.mit.edu	37	16	81390563	81390563	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:81390563G>T	uc002fgo.2	+	4	955	c.807G>T	c.(805-807)CGG>CGT	p.R269R		NM_022041	NP_071324	Q9H2C0	GAN_HUMAN	gigaxonin	269			R -> Q (in GAN).		cell death	cytoplasm|neurofilament	protein binding			ovary(2)	2		Colorectal(91;0.153)																---	---	---	---
CDH13	1012	broad.mit.edu	37	16	83378575	83378575	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:83378575C>T	uc002fgx.2	+	6	865	c.745C>T	c.(745-747)CCC>TCC	p.P249S	CDH13_uc010vns.1_Missense_Mutation_p.P296S|CDH13_uc010vnt.1_5'UTR|CDH13_uc010vnu.1_Missense_Mutation_p.P210S	NM_001257	NP_001248	P55290	CAD13_HUMAN	cadherin 13 preproprotein	249	Cadherin 2.				adherens junction organization|calcium-dependent cell-cell adhesion|cell junction assembly|endothelial cell migration|homophilic cell adhesion|keratinocyte proliferation|lamellipodium assembly|localization within membrane|low-density lipoprotein particle mediated signaling|negative regulation of cell adhesion|negative regulation of cell proliferation|positive regulation of calcium-mediated signaling|positive regulation of cell migration|positive regulation of cell-matrix adhesion|positive regulation of endothelial cell proliferation|positive regulation of positive chemotaxis|positive regulation of smooth muscle cell proliferation|positive regulation of survival gene product expression|Rac protein signal transduction|regulation of endocytosis|regulation of epidermal growth factor receptor signaling pathway|Rho protein signal transduction|sprouting angiogenesis	anchored to membrane|caveola|extracellular space|integral to membrane|neuron projection	adiponectin binding|cadherin binding|calcium ion binding|low-density lipoprotein particle binding			large_intestine(1)	1		all_cancers(2;1.34e-11)|all_epithelial(2;4.3e-09)		COAD - Colon adenocarcinoma(5;0.0268)														---	---	---	---
NECAB2	54550	broad.mit.edu	37	16	84005769	84005769	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84005769C>T	uc002fhd.2	+	2	232	c.215C>T	c.(214-216)GCG>GTG	p.A72V	NECAB2_uc002fhe.2_5'UTR	NM_019065	NP_061938	Q7Z6G3	NECA2_HUMAN	neuronal calcium-binding protein 2	72	EF-hand 1.				antibiotic biosynthetic process	cytoplasm	calcium ion binding|oxidoreductase activity|protein binding			ovary(2)	2																		---	---	---	---
NECAB2	54550	broad.mit.edu	37	16	84031932	84031932	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84031932C>T	uc002fhd.2	+						NECAB2_uc002fhe.2_Intron	NM_019065	NP_061938			neuronal calcium-binding protein 2						antibiotic biosynthetic process	cytoplasm	calcium ion binding|oxidoreductase activity|protein binding			ovary(2)	2																		---	---	---	---
FOXL1	2300	broad.mit.edu	37	16	86612470	86612470	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:86612470G>A	uc002fjr.2	+	1	356	c.141G>A	c.(139-141)CCG>CCA	p.P47P		NM_005250	NP_005241	Q12952	FOXL1_HUMAN	forkhead box L1	47					brain development|camera-type eye development|cartilage development|embryo development|forelimb morphogenesis|heart development|organ morphogenesis|pattern specification process|proteoglycan biosynthetic process|regulation of sequence-specific DNA binding transcription factor activity|regulation of Wnt receptor signaling pathway|visceral mesoderm-endoderm interaction involved in midgut development	transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding			skin(1)	1																		---	---	---	---
MVD	4597	broad.mit.edu	37	16	88725067	88725067	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88725067G>A	uc002flg.1	-	2	139	c.132C>T	c.(130-132)CAC>CAT	p.H44H	MVD_uc002flf.1_5'Flank	NM_002461	NP_002452	P53602	MVD1_HUMAN	diphosphomevalonate decarboxylase	44					cholesterol biosynthetic process|positive regulation of cell proliferation	cytosol	ATP binding|diphosphomevalonate decarboxylase activity|Hsp70 protein binding|kinase activity|protein homodimerization activity				0				BRCA - Breast invasive adenocarcinoma(80;0.0478)														---	---	---	---
SNAI3	333929	broad.mit.edu	37	16	88748006	88748006	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88748006C>T	uc002flj.2	-	2	261	c.193G>A	c.(193-195)GTC>ATC	p.V65I	MGC23284_uc002fli.3_Intron	NM_178310	NP_840101	Q3KNW1	SNAI3_HUMAN	snail homolog 3	65					oxidation-reduction process		copper ion binding|DNA binding|zinc ion binding			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(80;0.048)														---	---	---	---
TUBB3	10381	broad.mit.edu	37	16	89986279	89986279	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89986279G>A	uc002fpf.2	+	1	1021	c.613G>A	c.(613-615)GTG>ATG	p.V205M	MC1R_uc002fpe.3_Missense_Mutation_p.V205M|TUBB3_uc010ciz.1_5'Flank	NM_006086	NP_006077	Q13509	TBB3_HUMAN	tubulin, beta, 4	Error:Variant_position_missing_in_Q13509_after_alignment					'de novo' posttranslational protein folding|axon guidance|microtubule-based movement|protein polymerization	cytoplasm|microtubule	GTP binding|GTPase activity|structural molecule activity			ovary(2)|pancreas(1)	3		all_cancers(9;1.69e-11)|Lung NSC(15;8.94e-06)|all_lung(18;1.39e-05)|all_neural(9;0.00581)|all_hematologic(23;0.0194)		BRCA - Breast invasive adenocarcinoma(80;0.0273)														---	---	---	---
MYO1C	4641	broad.mit.edu	37	17	1373988	1373988	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1373988G>A	uc002fsp.2	-						MYO1C_uc002fsn.2_Intron|MYO1C_uc002fso.2_Intron|MYO1C_uc010vqj.1_Intron|MYO1C_uc010vqk.1_Intron	NM_001080779	NP_001074248			myosin IC isoform a						mRNA transport|protein transport|transmembrane transport	basal plasma membrane|cytoplasm|filamentous actin|lateral plasma membrane|nuclear pore|nucleolus|nucleoplasm|stereocilium membrane	actin binding|ATP binding|calmodulin binding|motor activity				0				UCEC - Uterine corpus endometrioid carcinoma (25;0.0822)														---	---	---	---
MYO1C	4641	broad.mit.edu	37	17	1378128	1378128	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1378128A>G	uc002fsp.2	-	16	1914	c.1694T>C	c.(1693-1695)CTT>CCT	p.L565P	MYO1C_uc002fsn.2_Missense_Mutation_p.L546P|MYO1C_uc002fso.2_Missense_Mutation_p.L530P|MYO1C_uc010vqj.1_Missense_Mutation_p.L530P|MYO1C_uc010vqk.1_Missense_Mutation_p.L541P	NM_001080779	NP_001074248	O00159	MYO1C_HUMAN	myosin IC isoform a	565	Myosin head-like.				mRNA transport|protein transport|transmembrane transport	basal plasma membrane|cytoplasm|filamentous actin|lateral plasma membrane|nuclear pore|nucleolus|nucleoplasm|stereocilium membrane	actin binding|ATP binding|calmodulin binding|motor activity				0				UCEC - Uterine corpus endometrioid carcinoma (25;0.0822)														---	---	---	---
TSR1	55720	broad.mit.edu	37	17	2236284	2236284	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:2236284G>A	uc002fuj.2	-	7	2233	c.1276C>T	c.(1276-1278)CAT>TAT	p.H426Y	SNORD91A_uc002ful.1_5'Flank	NM_018128	NP_060598	Q2NL82	TSR1_HUMAN	TSR1, 20S rRNA accumulation	426	Glu-rich.				ribosome assembly	nucleolus	protein binding			ovary(1)	1																		---	---	---	---
SPNS3	201305	broad.mit.edu	37	17	4352608	4352608	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:4352608G>A	uc002fxt.2	+	7	893	c.849G>A	c.(847-849)AAG>AAA	p.K283K	SPNS3_uc002fxu.2_Silent_p.K156K	NM_182538	NP_872344	Q6ZMD2	SPNS3_HUMAN	spinster homolog 3	283					lipid transport|transmembrane transport	integral to membrane				large_intestine(1)	1																		---	---	---	---
MED11	400569	broad.mit.edu	37	17	4635160	4635160	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:4635160G>A	uc002fyp.2	+	2	237	c.175G>A	c.(175-177)GTG>ATG	p.V59M		NM_001001683	NP_001001683	Q9P086	MED11_HUMAN	mediator complex subunit 11	59					regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	mediator complex	protein binding				0																OREG0024104	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
BCL6B	255877	broad.mit.edu	37	17	6927489	6927489	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:6927489C>T	uc002geg.2	+	3	324	c.267C>T	c.(265-267)TTC>TTT	p.F89F	BCL6B_uc010clt.1_Silent_p.F89F	NM_181844	NP_862827	Q8N143	BCL6B_HUMAN	B-cell CLL/lymphoma 6, member B (zinc finger	89	BTB.					nucleus	zinc ion binding			skin(1)	1																		---	---	---	---
KDM6B	23135	broad.mit.edu	37	17	7750430	7750430	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7750430G>A	uc002giw.1	+	10	1293	c.917G>A	c.(916-918)CGG>CAG	p.R306Q	KDM6B_uc002gix.2_5'Flank	NM_001080424	NP_001073893	O15054	KDM6B_HUMAN	lysine (K)-specific demethylase 6B	306	Pro-rich.				inflammatory response	nucleus	metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			central_nervous_system(1)|pancreas(1)	2																		---	---	---	---
KDM6B	23135	broad.mit.edu	37	17	7752175	7752175	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7752175G>A	uc002giw.1	+	11	2945	c.2569G>A	c.(2569-2571)GCC>ACC	p.A857T	KDM6B_uc002gix.2_Missense_Mutation_p.A159T	NM_001080424	NP_001073893	O15054	KDM6B_HUMAN	lysine (K)-specific demethylase 6B	857	Pro-rich.				inflammatory response	nucleus	metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			central_nervous_system(1)|pancreas(1)	2																		---	---	---	---
PIK3R6	146850	broad.mit.edu	37	17	8726318	8726318	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8726318G>T	uc002glq.1	-	15	1952	c.1712C>A	c.(1711-1713)CCC>CAC	p.P571H	PIK3R6_uc002glr.1_RNA|PIK3R6_uc002gls.1_RNA	NM_001010855	NP_001010855	Q5UE93	PI3R6_HUMAN	phosphoinositide-3-kinase, regulatory subunit 6	571					platelet activation	cytosol					0																		---	---	---	---
MYH13	8735	broad.mit.edu	37	17	10222241	10222241	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10222241C>A	uc002gmk.1	-	27	3694	c.3604G>T	c.(3604-3606)GAT>TAT	p.D1202Y		NM_003802	NP_003793	Q9UKX3	MYH13_HUMAN	myosin, heavy polypeptide 13, skeletal muscle	1202	Potential.				muscle contraction	muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(4)|skin(2)	6																		---	---	---	---
MYH2	4620	broad.mit.edu	37	17	10428368	10428368	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10428368A>G	uc010coi.2	-	34	4805	c.4677T>C	c.(4675-4677)CAT>CAC	p.H1559H	uc002gml.1_Intron|MYH2_uc002gmp.3_Silent_p.H1559H|MYH2_uc010coj.2_Intron	NM_001100112	NP_001093582	Q9UKX2	MYH2_HUMAN	myosin heavy chain IIa	1559	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(5)|pancreas(4)|skin(3)|lung(1)|kidney(1)	14																		---	---	---	---
MYH2	4620	broad.mit.edu	37	17	10428789	10428789	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10428789G>A	uc010coi.2	-	32	4644	c.4516C>T	c.(4516-4518)CGA>TGA	p.R1506*	uc002gml.1_Intron|MYH2_uc002gmp.3_Nonsense_Mutation_p.R1506*|MYH2_uc010coj.2_Intron	NM_001100112	NP_001093582	Q9UKX2	MYH2_HUMAN	myosin heavy chain IIa	1506	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle	p.R1506*(1)		ovary(5)|pancreas(4)|skin(3)|lung(1)|kidney(1)	14																		---	---	---	---
FLCN	201163	broad.mit.edu	37	17	17117098	17117098	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:17117098G>A	uc002gra.3	-	14	2115	c.1611C>T	c.(1609-1611)AGC>AGT	p.S537S	PLD6_uc010cpn.2_Intron	NM_144997	NP_659434	Q8NFG4	FLCN_HUMAN	folliculin isoform 1	537					regulation of protein phosphorylation	cytoplasm|nucleus|plasma membrane	protein binding			thyroid(1)|haematopoietic_and_lymphoid_tissue(1)|lung(1)	3														Birt-Hogg-Dub__syndrome|Familial_Non-VHL_Clear_Cell_Renal_Cancer				---	---	---	---
LLGL1	3996	broad.mit.edu	37	17	18133328	18133328	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18133328G>A	uc002gsp.2	+	2	216	c.155G>A	c.(154-156)GGC>GAC	p.G52D		NM_004140	NP_004131	Q15334	L2GL1_HUMAN	lethal giant larvae homolog 1	52	WD 1.				cortical actin cytoskeleton organization|exocytosis|protein complex assembly	cortical actin cytoskeleton	protein kinase binding|structural molecule activity			breast(2)|skin(2)|ovary(1)|haematopoietic_and_lymphoid_tissue(1)	6	all_neural(463;0.228)																	---	---	---	---
LLGL1	3996	broad.mit.edu	37	17	18138263	18138263	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18138263G>A	uc002gsp.2	+	9	1077	c.1016G>A	c.(1015-1017)CGC>CAC	p.R339H		NM_004140	NP_004131	Q15334	L2GL1_HUMAN	lethal giant larvae homolog 1	339					cortical actin cytoskeleton organization|exocytosis|protein complex assembly	cortical actin cytoskeleton	protein kinase binding|structural molecule activity			breast(2)|skin(2)|ovary(1)|haematopoietic_and_lymphoid_tissue(1)	6	all_neural(463;0.228)																	---	---	---	---
FAM83G	644815	broad.mit.edu	37	17	18881935	18881935	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:18881935C>T	uc002guw.2	-	5	1211	c.1044G>A	c.(1042-1044)AAG>AAA	p.K348K	SLC5A10_uc002gur.1_Intron|SLC5A10_uc002guu.1_Intron|SLC5A10_uc002gut.1_Intron|SLC5A10_uc002guv.1_Intron|SLC5A10_uc010vyl.1_Intron	NM_001039999	NP_001035088	A6ND36	FA83G_HUMAN	hypothetical protein LOC644815	348										ovary(1)|central_nervous_system(1)	2																		---	---	---	---
SLC47A1	55244	broad.mit.edu	37	17	19452949	19452949	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:19452949C>T	uc002gvy.1	+	5	543	c.457C>T	c.(457-459)CTT>TTT	p.L153F	SLC47A1_uc010vyy.1_RNA|SLC47A1_uc002gvx.2_Missense_Mutation_p.L153F|SLC47A1_uc010vyz.1_Missense_Mutation_p.L130F|SLC47A1_uc010cqp.1_Missense_Mutation_p.L153F|SLC47A1_uc010cqq.1_Silent_p.G4G	NM_018242	NP_060712	Q96FL8	S47A1_HUMAN	solute carrier family 47, member 1	153	Helical; (Potential).					integral to membrane|plasma membrane	drug:hydrogen antiporter activity				0	all_cancers(12;2.49e-05)|all_epithelial(12;0.00263)|Hepatocellular(7;0.00345)																	---	---	---	---
SUPT6H	6830	broad.mit.edu	37	17	27001457	27001457	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27001457G>A	uc002hby.2	+	3	356	c.266G>A	c.(265-267)CGC>CAC	p.R89H	SUPT6H_uc010crt.2_Missense_Mutation_p.R89H	NM_003170	NP_003161	Q7KZ85	SPT6H_HUMAN	suppressor of Ty 6 homolog	89	Asp/Glu-rich.				chromatin remodeling|regulation of transcription elongation, DNA-dependent|regulation of transcription from RNA polymerase II promoter	nucleus	hydrolase activity, acting on ester bonds|RNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)|skin(1)	3	Lung NSC(42;0.00431)																	---	---	---	---
NEK8	284086	broad.mit.edu	37	17	27064381	27064381	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27064381C>T	uc002hcp.2	+	5	676	c.676C>T	c.(676-678)CGG>TGG	p.R226W		NM_178170	NP_835464	Q86SG6	NEK8_HUMAN	NIMA-related kinase 8	226	Protein kinase.					cytoplasm|primary cilium	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			stomach(2)|ovary(1)|pancreas(1)|liver(1)|skin(1)	6	Lung NSC(42;0.0158)																	---	---	---	---
FLOT2	2319	broad.mit.edu	37	17	27207775	27207775	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27207775G>A	uc002hdc.2	-	10	1327	c.1204C>T	c.(1204-1206)CTG>TTG	p.L402L		NM_004475	NP_004466	Q14254	FLOT2_HUMAN	flotillin 2	402					cell adhesion|epidermis development	cell surface|endocytic vesicle|endosome|membrane fraction					0	all_cancers(5;2.12e-15)|all_epithelial(6;3.44e-19)|Lung NSC(42;0.01)		Epithelial(11;3.26e-06)|all cancers(11;1.76e-05)|BRCA - Breast invasive adenocarcinoma(11;0.00015)|OV - Ovarian serous cystadenocarcinoma(11;0.0602)															---	---	---	---
PIPOX	51268	broad.mit.edu	37	17	27381715	27381715	+	Intron	SNP	C	T	T	rs141334769	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27381715C>T	uc002hdr.1	+							NM_016518	NP_057602			pipecolic acid oxidase						tetrahydrofolate metabolic process	peroxisome	L-pipecolate oxidase activity|sarcosine oxidase activity				0	Lung NSC(42;0.015)		Epithelial(11;9.87e-06)|BRCA - Breast invasive adenocarcinoma(11;3.92e-05)|all cancers(11;5.59e-05)|Colorectal(6;0.0102)|COAD - Colon adenocarcinoma(6;0.031)		Glycine(DB00145)													---	---	---	---
SSH2	85464	broad.mit.edu	37	17	27977813	27977813	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27977813C>T	uc002heo.1	-	12	1004	c.1004G>A	c.(1003-1005)CGG>CAG	p.R335Q	SSH2_uc010wbh.1_Missense_Mutation_p.R362Q|SSH2_uc002hep.1_Missense_Mutation_p.R335Q	NM_033389	NP_203747	Q76I76	SSH2_HUMAN	slingshot 2	335	Tyrosine-protein phosphatase.				actin cytoskeleton organization|regulation of actin polymerization or depolymerization|regulation of axonogenesis|regulation of lamellipodium assembly	cytoplasm|cytoskeleton	actin binding|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			skin(2)	2																		---	---	---	---
EFCAB5	374786	broad.mit.edu	37	17	28296322	28296322	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:28296322A>G	uc002het.2	+	4	896	c.704A>G	c.(703-705)CAG>CGG	p.Q235R	EFCAB5_uc010wbi.1_Intron|EFCAB5_uc010wbj.1_Missense_Mutation_p.Q179R|EFCAB5_uc010wbk.1_Intron|EFCAB5_uc010csd.2_RNA|EFCAB5_uc010cse.2_Missense_Mutation_p.Q114R|EFCAB5_uc010csf.2_Missense_Mutation_p.Q114R	NM_198529	NP_940931	A4FU69	EFCB5_HUMAN	EF-hand calcium binding domain 5 isoform a	235							calcium ion binding			ovary(1)|skin(1)	2																		---	---	---	---
ACCN1	40	broad.mit.edu	37	17	31416001	31416001	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:31416001C>T	uc002hhu.2	-	3	988	c.714G>A	c.(712-714)ACG>ACA	p.T238T	ACCN1_uc002hht.2_Silent_p.T289T	NM_001094	NP_001085	Q16515	ACCN1_HUMAN	amiloride-sensitive cation channel 1, neuronal	238	Extracellular (By similarity).				central nervous system development|peripheral nervous system development|synaptic transmission	integral to plasma membrane	ligand-gated sodium channel activity|protein binding			ovary(2)|large_intestine(1)|central_nervous_system(1)	4		Breast(31;0.042)|Ovarian(249;0.202)		UCEC - Uterine corpus endometrioid carcinoma (308;0.13)|BRCA - Breast invasive adenocarcinoma(366;0.215)	Amiloride(DB00594)													---	---	---	---
SLFN5	162394	broad.mit.edu	37	17	33586247	33586247	+	Missense_Mutation	SNP	C	T	T	rs139273106		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:33586247C>T	uc002hjf.3	+	2	655	c.538C>T	c.(538-540)CGG>TGG	p.R180W	SLFN5_uc002hje.2_Missense_Mutation_p.R180W|SLFN5_uc010wcg.1_Missense_Mutation_p.R180W	NM_144975	NP_659412	Q08AF3	SLFN5_HUMAN	schlafen family member 5	180					cell differentiation		ATP binding			ovary(1)|central_nervous_system(1)|skin(1)	3		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0191)														---	---	---	---
RDM1	201299	broad.mit.edu	37	17	34251608	34251608	+	Nonsense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:34251608C>A	uc002hkh.2	-	4	617	c.568G>T	c.(568-570)GGA>TGA	p.G190*	RDM1_uc010cty.2_Intron|RDM1_uc010ctz.2_Intron|RDM1_uc010cua.2_Nonsense_Mutation_p.G167*|RDM1_uc002hkg.3_Nonsense_Mutation_p.E167*|RDM1_uc010cub.2_Intron|RDM1_uc010cud.2_Nonsense_Mutation_p.E190*|RDM1_uc010cuf.2_Intron|RDM1_uc010cue.2_Intron|RDM1_uc010cug.2_Intron|RDM1_uc010cuc.2_Intron|RDM1_uc010wco.1_Intron|RDM1_uc010wcp.1_Nonsense_Mutation_p.G167*|RDM1_uc002hki.2_Nonsense_Mutation_p.G190*	NM_145654	NP_663629	Q8NG50	RDM1_HUMAN	RAD52 motif 1 isoform 1	190					DNA recombination|DNA repair	Cajal body|cytoplasm|nucleolus|PML body	DNA binding|nucleotide binding|RNA binding			ovary(1)	1		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0185)									Direct_reversal_of_damage|Other_identified_genes_with_known_or_suspected_DNA_repair_function					---	---	---	---
GPR179	440435	broad.mit.edu	37	17	36499438	36499438	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:36499438G>A	uc002hpz.2	-	1	256	c.235C>T	c.(235-237)CGC>TGC	p.R79C		NM_001004334	NP_001004334	Q6PRD1	GP179_HUMAN	GPR158-like 1 precursor	79	Extracellular (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)	3	Breast(7;2.97e-12)	Breast(25;0.0101)|Ovarian(249;0.15)																---	---	---	---
MLLT6	4302	broad.mit.edu	37	17	36880978	36880978	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:36880978C>T	uc002hqi.3	+	19	3002	c.2989C>T	c.(2989-2991)CTG>TTG	p.L997L	MLLT6_uc002hqk.3_Silent_p.L328L|MLLT6_uc010cvn.1_5'Flank	NM_005937	NP_005928	P55198	AF17_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	997					regulation of transcription, DNA-dependent	nucleus	protein binding|zinc ion binding			breast(3)|prostate(1)|lung(1)|skin(1)	6	Breast(7;4.43e-21)							T	MLL	AL								---	---	---	---
CDK12	51755	broad.mit.edu	37	17	37657601	37657601	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37657601A>G	uc010cvv.2	+	6	3104	c.2518A>G	c.(2518-2520)ATG>GTG	p.M840V	CDK12_uc010wef.1_Missense_Mutation_p.M839V|CDK12_uc002hrw.3_Missense_Mutation_p.M840V	NM_016507	NP_057591	Q9NYV4	CDK12_HUMAN	Cdc2-related kinase, arginine/serine-rich	840	Protein kinase.				mRNA processing|phosphorylation of RNA polymerase II C-terminal domain|protein autophosphorylation|regulation of MAP kinase activity|RNA splicing	nuclear cyclin-dependent protein kinase holoenzyme complex|nuclear speck|nucleolus	ATP binding|cyclin-dependent protein kinase activity|protein binding|RNA polymerase II carboxy-terminal domain kinase activity			ovary(10)|lung(4)|breast(2)|skin(2)|large_intestine(1)	19															TCGA Ovarian(9;0.13)			---	---	---	---
PSMD3	5709	broad.mit.edu	37	17	38153813	38153813	+	Missense_Mutation	SNP	T	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38153813T>A	uc002htn.1	+	12	1748	c.1584T>A	c.(1582-1584)GAT>GAA	p.D528E	PSMD3_uc010wen.1_RNA|PSMD3_uc010weo.1_Missense_Mutation_p.D429E	NM_002809	NP_002800	O43242	PSMD3_HUMAN	proteasome 26S non-ATPase subunit 3	528					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|regulation of protein catabolic process|S phase of mitotic cell cycle|viral reproduction	proteasome complex	enzyme regulator activity|protein binding			ovary(1)|pancreas(1)	2	Colorectal(19;0.000442)																	---	---	---	---
KRT27	342574	broad.mit.edu	37	17	38933343	38933343	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38933343G>T	uc002hvg.2	-	8	1329	c.1288C>A	c.(1288-1290)CCT>ACT	p.P430T		NM_181537	NP_853515	Q7Z3Y8	K1C27_HUMAN	keratin 27	430	Tail.					cytoplasm|intermediate filament	structural molecule activity				0		Breast(137;0.000812)																---	---	---	---
HAP1	9001	broad.mit.edu	37	17	39888507	39888507	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39888507G>A	uc002hxm.1	-	3	701	c.689C>T	c.(688-690)GCC>GTC	p.A230V	JUP_uc010wfs.1_Intron|HAP1_uc002hxn.1_Missense_Mutation_p.A230V|HAP1_uc002hxo.1_Missense_Mutation_p.A238V|HAP1_uc002hxp.1_Missense_Mutation_p.A230V	NM_177977	NP_817084	P54257	HAP1_HUMAN	huntingtin-associated protein 1 isoform 2	230	HAP1 N-terminal.				brain development|protein localization|synaptic transmission	actin cytoskeleton	protein binding			ovary(2)	2		Breast(137;0.000162)	BRCA - Breast invasive adenocarcinoma(4;0.0677)															---	---	---	---
KLHL10	317719	broad.mit.edu	37	17	39994259	39994259	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:39994259C>A	uc010cxr.2	+	1	217	c.75C>A	c.(73-75)GCC>GCA	p.A25A	NT5C3L_uc010wfu.1_5'Flank|NT5C3L_uc002hyb.3_5'Flank|NT5C3L_uc002hyc.3_5'Flank|NT5C3L_uc002hyd.3_5'Flank|NT5C3L_uc002hxy.3_5'Flank|NT5C3L_uc002hxz.3_5'Flank|NT5C3L_uc002hya.3_5'Flank|KLHL10_uc010wfv.1_Silent_p.A25A|KLHL10_uc010wfw.1_Translation_Start_Site	NM_152467	NP_689680	Q6JEL2	KLH10_HUMAN	kelch-like 10	25						cytoplasm				ovary(1)|lung(1)|breast(1)|central_nervous_system(1)	4		Breast(137;0.000162)																---	---	---	---
HSD17B1	3292	broad.mit.edu	37	17	40705607	40705607	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40705607T>C	uc002hzw.2	+	3	1384	c.416T>C	c.(415-417)TTG>TCG	p.L139S	HSD17B1_uc002hzx.2_Missense_Mutation_p.L139S|HSD17B1_uc010wgm.1_RNA|uc002hzy.2_5'UTR|HSD17B1_uc010cyi.2_Missense_Mutation_p.L170S	NM_000413	NP_000404	P14061	DHB1_HUMAN	hydroxysteroid (17-beta) dehydrogenase 1	139					estrogen biosynthetic process	cytosol	binding|estradiol 17-beta-dehydrogenase activity				0		all_cancers(22;5.59e-08)|all_epithelial(22;7e-07)|Ovarian(249;0.0261)		BRCA - Breast invasive adenocarcinoma(366;0.129)	NADH(DB00157)													---	---	---	---
EZH1	2145	broad.mit.edu	37	17	40856673	40856673	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40856673C>T	uc002iaz.2	-	18	2109	c.1964G>A	c.(1963-1965)CGC>CAC	p.R655H	EZH1_uc002iba.2_Missense_Mutation_p.R646H|EZH1_uc010wgt.1_Missense_Mutation_p.R585H|EZH1_uc010wgu.1_Missense_Mutation_p.R661H|EZH1_uc010wgv.1_Missense_Mutation_p.R615H|EZH1_uc010wgw.1_Missense_Mutation_p.R516H|EZH1_uc010cyp.2_Missense_Mutation_p.R556H|EZH1_uc010cyq.2_Missense_Mutation_p.R572H|EZH1_uc010cyo.1_Missense_Mutation_p.R318H	NM_001991	NP_001982	Q92800	EZH1_HUMAN	enhancer of zeste homolog 1	655	SET.				anatomical structure morphogenesis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	ESC/E(Z) complex	chromatin binding|DNA binding			ovary(3)	3		Breast(137;0.00104)		BRCA - Breast invasive adenocarcinoma(366;0.0784)														---	---	---	---
UBTF	7343	broad.mit.edu	37	17	42293150	42293150	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42293150G>T	uc002igb.2	-	4	413	c.346C>A	c.(346-348)CTG>ATG	p.L116M	UBTF_uc002igc.2_Missense_Mutation_p.L116M|UBTF_uc010czs.2_Missense_Mutation_p.L116M|UBTF_uc002igd.2_Missense_Mutation_p.L116M|UBTF_uc010czt.2_Missense_Mutation_p.L116M|UBTF_uc002ige.2_Missense_Mutation_p.L116M	NM_014233	NP_055048	P17480	UBF1_HUMAN	upstream binding transcription factor, RNA	116	HMG box 1.				positive regulation of transcription from RNA polymerase I promoter|termination of RNA polymerase I transcription|transcription elongation from RNA polymerase I promoter|transcription initiation from RNA polymerase I promoter	nucleolus|nucleoplasm	DNA binding|protein binding				0		Breast(137;0.00765)|Prostate(33;0.0181)		BRCA - Breast invasive adenocarcinoma(366;0.114)														---	---	---	---
GPATCH8	23131	broad.mit.edu	37	17	42476878	42476878	+	Missense_Mutation	SNP	G	T	T	rs145134773		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42476878G>T	uc002igw.1	-	8	2631	c.2567C>A	c.(2566-2568)TCT>TAT	p.S856Y	GPATCH8_uc002igv.1_Missense_Mutation_p.S778Y|GPATCH8_uc010wiz.1_Missense_Mutation_p.S778Y	NM_001002909	NP_001002909	Q9UKJ3	GPTC8_HUMAN	G patch domain containing 8	856	Ser-rich.					intracellular	nucleic acid binding|zinc ion binding			ovary(2)|kidney(1)|skin(1)	4		Prostate(33;0.0181)		BRCA - Breast invasive adenocarcinoma(366;0.206)														---	---	---	---
KIF18B	146909	broad.mit.edu	37	17	43009431	43009431	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:43009431G>A	uc010wji.1	-	10	1519	c.1418C>T	c.(1417-1419)GCT>GTT	p.A473V	KIF18B_uc002iht.2_Missense_Mutation_p.A473V|KIF18B_uc010wjh.1_Missense_Mutation_p.A461V	NM_001080443	NP_001073912			kinesin family member 18B											ovary(2)	2		Prostate(33;0.155)																---	---	---	---
NSF	4905	broad.mit.edu	37	17	44828940	44828940	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:44828940A>G	uc002iku.2	+	19	2219	c.2115A>G	c.(2113-2115)ATA>ATG	p.I705M	NSF_uc010wke.1_Missense_Mutation_p.I611M|NSF_uc010wkf.1_Missense_Mutation_p.I611M|NSF_uc010wkg.1_Missense_Mutation_p.I700M	NM_006178	NP_006169	P46459	NSF_HUMAN	vesicle-fusing ATPase	705					protein transport|synaptic transmission	cytosol	ATP binding|metal ion binding			ovary(1)	1		Melanoma(429;0.203)	BRCA - Breast invasive adenocarcinoma(9;0.0257)	BRCA - Breast invasive adenocarcinoma(366;0.241)														---	---	---	---
WNT9B	7484	broad.mit.edu	37	17	44950021	44950021	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:44950021C>T	uc002ikw.1	+	2	253	c.216C>T	c.(214-216)CCC>CCT	p.P72P	WNT9B_uc002ikx.1_Silent_p.P72P	NM_003396	NP_003387	O14905	WNT9B_HUMAN	wingless-type MMTV integration site family,	72					anterior/posterior pattern formation|axis specification|branching involved in ureteric bud morphogenesis|canonical Wnt receptor signaling pathway|cell-cell signaling|cellular response to retinoic acid|collecting duct development|cornea development in camera-type eye|endoderm development|establishment of planar polarity involved in nephron morphogenesis|kidney rudiment formation|male genitalia development|mesonephric duct formation|metanephric tubule development|neuron differentiation|palate development|regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis|uterus morphogenesis|Wnt receptor signaling pathway, calcium modulating pathway|Wnt receptor signaling pathway, planar cell polarity pathway	extracellular space|plasma membrane|proteinaceous extracellular matrix	extracellular matrix structural constituent|G-protein-coupled receptor binding			lung(2)	2			BRCA - Breast invasive adenocarcinoma(9;0.0257)															---	---	---	---
TBKBP1	9755	broad.mit.edu	37	17	45787930	45787930	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45787930G>A	uc002ilu.2	+	9	2635	c.1786G>A	c.(1786-1788)GGG>AGG	p.G596R		NM_014726	NP_055541	A7MCY6	TBKB1_HUMAN	TBK1 binding protein 1	596					innate immune response						0																		---	---	---	---
XYLT2	64132	broad.mit.edu	37	17	48434049	48434049	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48434049A>G	uc002iqo.2	+	8	1769	c.1660A>G	c.(1660-1662)ATG>GTG	p.M554V	XYLT2_uc010dbo.2_RNA	NM_022167	NP_071450	Q9H1B5	XYLT2_HUMAN	xylosyltransferase II	554	Lumenal (Potential).				glycosaminoglycan biosynthetic process	endoplasmic reticulum membrane|Golgi membrane|integral to membrane	acetylglucosaminyltransferase activity|protein xylosyltransferase activity			pancreas(1)	1	Breast(11;7.18e-19)																	---	---	---	---
ABCC3	8714	broad.mit.edu	37	17	48753735	48753735	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48753735C>T	uc002isl.2	+	23	3244	c.3164C>T	c.(3163-3165)TCG>TTG	p.S1055L	ABCC3_uc002isn.2_5'Flank	NM_003786	NP_003777	O15438	MRP3_HUMAN	ATP-binding cassette, sub-family C, member 3	1055	Cytoplasmic (By similarity).|ABC transmembrane type-1 2.				bile acid metabolic process	integral to plasma membrane|membrane fraction	ATP binding|bile acid-exporting ATPase activity|organic anion transmembrane transporter activity			skin(3)|central_nervous_system(1)	4			BRCA - Breast invasive adenocarcinoma(22;3.05e-09)		Glibenclamide(DB01016)													---	---	---	---
LUC7L3	51747	broad.mit.edu	37	17	48821055	48821055	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48821055T>C	uc002isr.2	+						LUC7L3_uc002isp.1_Intron|LUC7L3_uc010wmw.1_Intron|LUC7L3_uc002isq.2_Intron|LUC7L3_uc002iss.2_Intron	NM_006107	NP_006098			LUC7-like 3						apoptosis|mRNA processing|response to stress|RNA splicing	focal adhesion|nuclear speck	DNA binding|mRNA binding|protein binding				0																		---	---	---	---
BZRAP1	9256	broad.mit.edu	37	17	56400407	56400407	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56400407G>A	uc002ivx.3	-						BZRAP1_uc010dcs.2_Intron|BZRAP1_uc010wnt.1_Intron	NM_004758	NP_004749			peripheral benzodiazepine receptor-associated							mitochondrion	benzodiazepine receptor binding			upper_aerodigestive_tract(2)|skin(1)	3	Medulloblastoma(34;0.127)|all_neural(34;0.237)																	---	---	---	---
SUPT4H1	6827	broad.mit.edu	37	17	56424577	56424577	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56424577C>T	uc002iwe.1	-	4	325	c.258G>A	c.(256-258)GCG>GCA	p.A86A	uc010dct.1_Intron|uc010dcu.1_Intron|uc002ivz.2_Intron|uc010dcv.1_Intron|uc002iwa.2_Intron|uc002iwb.2_Intron|uc002iwc.2_Intron|SUPT4H1_uc002iwd.1_RNA	NM_003168	NP_003159	P63272	SPT4H_HUMAN	suppressor of Ty 4 homolog 1	86					chromatin remodeling|negative regulation of transcription elongation, DNA-dependent|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription elongation, DNA-dependent|positive regulation of transcription from RNA polymerase II promoter|positive regulation of viral transcription|transcription elongation from RNA polymerase II promoter|viral reproduction	nucleoplasm	protein heterodimerization activity|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(2)	2	Medulloblastoma(34;0.127)|all_neural(34;0.237)																	---	---	---	---
RNF43	54894	broad.mit.edu	37	17	56436149	56436149	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56436149G>A	uc002iwf.2	-	8	2944	c.988C>T	c.(988-990)CGA>TGA	p.R330*	RNF43_uc010wnv.1_Nonsense_Mutation_p.R289*|RNF43_uc002iwh.3_Nonsense_Mutation_p.R330*|RNF43_uc002iwg.3_Nonsense_Mutation_p.R330*|RNF43_uc010dcw.2_Nonsense_Mutation_p.R203*	NM_017763	NP_060233	Q68DV7	RNF43_HUMAN	ring finger protein 43 precursor	330	Cytoplasmic (Potential).					endoplasmic reticulum membrane|integral to membrane|nuclear envelope	ligase activity|protein binding|zinc ion binding			ovary(1)	1	Medulloblastoma(34;0.127)|all_neural(34;0.237)																	---	---	---	---
RNF43	54894	broad.mit.edu	37	17	56437515	56437515	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56437515A>G	uc002iwf.2	-	7	2903	c.947T>C	c.(946-948)ATC>ACC	p.I316T	RNF43_uc010wnv.1_Missense_Mutation_p.I275T|RNF43_uc002iwh.3_Missense_Mutation_p.I316T|RNF43_uc002iwg.3_Missense_Mutation_p.I316T|RNF43_uc010dcw.2_Missense_Mutation_p.I189T	NM_017763	NP_060233	Q68DV7	RNF43_HUMAN	ring finger protein 43 precursor	316	Cytoplasmic (Potential).					endoplasmic reticulum membrane|integral to membrane|nuclear envelope	ligase activity|protein binding|zinc ion binding			ovary(1)	1	Medulloblastoma(34;0.127)|all_neural(34;0.237)																	---	---	---	---
PPM1E	22843	broad.mit.edu	37	17	57058168	57058168	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57058168A>G	uc002iwx.2	+	7	2171	c.2044A>G	c.(2044-2046)AGG>GGG	p.R682G	PPM1E_uc010ddd.2_Missense_Mutation_p.R445G	NM_014906	NP_055721	Q8WY54	PPM1E_HUMAN	protein phosphatase 1E	691					protein dephosphorylation	cytoplasm|nucleolus|protein serine/threonine phosphatase complex	metal ion binding|protein serine/threonine phosphatase activity			breast(3)|lung(1)|skin(1)	5	Medulloblastoma(34;0.127)|all_neural(34;0.237)		BRCA - Breast invasive adenocarcinoma(1;5.76e-11)															---	---	---	---
DHX40	79665	broad.mit.edu	37	17	57684403	57684403	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57684403C>T	uc002ixn.1	+	18	2357	c.2210C>T	c.(2209-2211)TCG>TTG	p.S737L	DHX40_uc010woe.1_Missense_Mutation_p.S660L|DHX40_uc010wof.1_Missense_Mutation_p.S252L	NM_024612	NP_078888	Q8IX18	DHX40_HUMAN	DEAH (Asp-Glu-Ala-His) box polypeptide 40	737							ATP binding|ATP-dependent helicase activity|nucleic acid binding				0	all_neural(34;0.0878)|Medulloblastoma(34;0.0922)																	---	---	---	---
CLTC	1213	broad.mit.edu	37	17	57743872	57743872	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57743872T>C	uc002ixq.1	+	12	2257	c.1814T>C	c.(1813-1815)TTC>TCC	p.F605S	CLTC_uc002ixp.2_Missense_Mutation_p.F605S|CLTC_uc002ixr.1_Missense_Mutation_p.F609S	NM_004859	NP_004850	Q00610	CLH1_HUMAN	clathrin heavy chain 1	605	Heavy chain arm.|Distal segment.				axon guidance|epidermal growth factor receptor signaling pathway|intracellular protein transport|mitosis|negative regulation of epidermal growth factor receptor signaling pathway|nerve growth factor receptor signaling pathway|post-Golgi vesicle-mediated transport|receptor internalization|transferrin transport	clathrin coat of coated pit|clathrin coat of trans-Golgi network vesicle|cytosol|melanosome|spindle	protein binding|structural molecule activity		CLTC/ALK(44)|CLTC/TFE3(2)	haematopoietic_and_lymphoid_tissue(33)|soft_tissue(11)|kidney(2)|ovary(1)|breast(1)	48	all_neural(34;0.0878)|Medulloblastoma(34;0.0922)							T	ALK|TFE3	ALCL|renal 								---	---	---	---
MRC2	9902	broad.mit.edu	37	17	60741989	60741989	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:60741989G>A	uc002jad.2	+	2	601	c.199G>A	c.(199-201)GCT>ACT	p.A67T	MRC2_uc002jac.2_Missense_Mutation_p.A67T	NM_006039	NP_006030	Q9UBG0	MRC2_HUMAN	mannose receptor, C type 2	67	Extracellular (Potential).|Ricin B-type lectin.				endocytosis	integral to membrane	receptor activity|sugar binding			ovary(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
STRADA	92335	broad.mit.edu	37	17	61781922	61781922	+	Silent	SNP	G	A	A	rs147552949		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61781922G>A	uc002jbm.2	-	11	1038	c.879C>T	c.(877-879)AAC>AAT	p.N293N	STRADA_uc002jbn.2_Silent_p.N235N|STRADA_uc002jbo.2_Silent_p.N256N|STRADA_uc002jbp.2_Silent_p.N256N|STRADA_uc002jbq.2_Silent_p.N235N|STRADA_uc010wpq.1_Silent_p.N249N|STRADA_uc010wpr.1_Silent_p.N264N|STRADA_uc010ddw.2_Silent_p.N264N|STRADA_uc002jbr.2_3'UTR	NM_001003787	NP_001003787	Q7RTN6	STRAA_HUMAN	STE20-related kinase adaptor alpha isoform 1	293	Protein kinase.				activation of protein kinase activity|cell cycle arrest|insulin receptor signaling pathway|protein export from nucleus|regulation of fatty acid oxidation	cytosol|nucleus	ATP binding|kinase binding|protein kinase activity			ovary(1)	1																		---	---	---	---
GH2	2689	broad.mit.edu	37	17	61958092	61958092	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61958092G>A	uc002jco.1	-						GH2_uc002jcj.2_Intron|CSH2_uc002jck.2_Intron|GH2_uc002jcl.1_Silent_p.L166L|GH2_uc002jcm.1_Intron|GH2_uc002jcn.1_Intron	NM_002059	NP_002050			growth hormone 2 isoform 1							extracellular region	hormone activity			upper_aerodigestive_tract(2)|pancreas(1)	3																		---	---	---	---
CCDC45	90799	broad.mit.edu	37	17	62525505	62525505	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:62525505G>A	uc002jem.2	+	12	1464	c.1406G>A	c.(1405-1407)CGC>CAC	p.R469H	CCDC45_uc002jen.2_RNA|CCDC45_uc010wqb.1_Missense_Mutation_p.R305H	NM_138363	NP_612372	Q96GE4	CEP95_HUMAN	coiled-coil domain containing 45	469						centrosome|spindle pole	protein binding				0	Breast(5;1.32e-14)		BRCA - Breast invasive adenocarcinoma(8;8.6e-12)															---	---	---	---
LRRC37A3	374819	broad.mit.edu	37	17	62852005	62852005	+	Missense_Mutation	SNP	G	C	C	rs140806799	by1000genomes	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:62852005G>C	uc002jey.2	-	13	5343	c.4812C>G	c.(4810-4812)ATC>ATG	p.I1604M	LRRC37A3_uc010wqg.1_Missense_Mutation_p.I722M|LRRC37A3_uc002jex.1_Missense_Mutation_p.I581M|LRRC37A3_uc010wqf.1_Missense_Mutation_p.I642M	NM_199340	NP_955372	O60309	L37A3_HUMAN	leucine rich repeat containing 37, member A3	1604	Cytoplasmic (Potential).					integral to membrane					0																		---	---	---	---
ABCA6	23460	broad.mit.edu	37	17	67130006	67130006	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:67130006G>T	uc002jhw.1	-	6	742	c.567C>A	c.(565-567)ATC>ATA	p.I189I		NM_080284	NP_525023	Q8N139	ABCA6_HUMAN	ATP-binding cassette, sub-family A, member 6	189					transport	integral to membrane	ATP binding|ATPase activity			upper_aerodigestive_tract(2)|large_intestine(2)|ovary(2)|skin(1)	7	Breast(10;5.65e-12)																	---	---	---	---
USH1G	124590	broad.mit.edu	37	17	72916266	72916266	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:72916266C>T	uc002jme.1	-	2	848	c.665G>A	c.(664-666)CGG>CAG	p.R222Q	USH1G_uc010wro.1_Missense_Mutation_p.R119Q	NM_173477	NP_775748	Q495M9	USH1G_HUMAN	Usher syndrome 1G protein	222					equilibrioception|photoreceptor cell maintenance|sensory perception of sound	actin cytoskeleton				skin(2)	2	all_lung(278;0.172)|Lung NSC(278;0.207)																	---	---	---	---
RECQL5	9400	broad.mit.edu	37	17	73627686	73627686	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73627686C>T	uc010dgl.2	-	9	1448	c.1292G>A	c.(1291-1293)TGC>TAC	p.C431Y	RECQL5_uc010dgk.2_Missense_Mutation_p.C404Y|RECQL5_uc002jot.3_5'Flank|LOC643008_uc002jow.2_5'Flank	NM_004259	NP_004250	O94762	RECQ5_HUMAN	RecQ protein-like 5 isoform 1	431					DNA recombination|DNA repair	cytoplasm|nuclear membrane|nucleolus|nucleoplasm	ATP binding|ATP-dependent helicase activity|DNA helicase activity|nucleic acid binding			kidney(3)	3	all_cancers(13;2.73e-08)|Breast(9;6.04e-09)|all_epithelial(9;6.79e-09)		all cancers(21;1.15e-06)|Epithelial(20;2.19e-06)|Lung(188;0.101)|LUSC - Lung squamous cell carcinoma(166;0.112)										Other_identified_genes_with_known_or_suspected_DNA_repair_function					---	---	---	---
PRPSAP1	5635	broad.mit.edu	37	17	74324878	74324878	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74324878G>A	uc010wta.1	-	7	1147	c.701C>T	c.(700-702)ACG>ATG	p.T234M	PRPSAP1_uc010wtb.1_Missense_Mutation_p.T131M	NM_002766	NP_002757	Q14558	KPRA_HUMAN	phosphoribosyl pyrophosphate	205					nucleotide biosynthetic process		enzyme inhibitor activity|identical protein binding|magnesium ion binding|ribose phosphate diphosphokinase activity			ovary(1)	1																		---	---	---	---
USP36	57602	broad.mit.edu	37	17	76798447	76798447	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:76798447C>T	uc002jvz.1	-	17	3306	c.2981G>A	c.(2980-2982)TGC>TAC	p.C994Y	USP36_uc002jwa.1_Missense_Mutation_p.C994Y|USP36_uc002jwb.1_Missense_Mutation_p.C606Y|USP36_uc002jvy.1_Missense_Mutation_p.C54Y	NM_025090	NP_079366	Q9P275	UBP36_HUMAN	ubiquitin specific peptidase 36	992					ubiquitin-dependent protein catabolic process	nucleolus	cysteine-type peptidase activity|ubiquitin thiolesterase activity			lung(2)|ovary(1)|breast(1)|kidney(1)	5			BRCA - Breast invasive adenocarcinoma(99;0.000842)|OV - Ovarian serous cystadenocarcinoma(97;0.151)															---	---	---	---
RNF213	57674	broad.mit.edu	37	17	78319326	78319326	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78319326C>A	uc002jyh.1	+	4	1633	c.1410C>A	c.(1408-1410)ACC>ACA	p.T470T		NM_020914	NP_065965	Q9HCF4	ALO17_HUMAN	ring finger protein 213	Error:Variant_position_missing_in_Q9HCF4_after_alignment										ovary(8)|lung(6)|breast(3)|large_intestine(2)|central_nervous_system(1)|pancreas(1)	21	all_neural(118;0.0538)		BRCA - Breast invasive adenocarcinoma(99;0.0252)|OV - Ovarian serous cystadenocarcinoma(97;0.057)															---	---	---	---
BAIAP2	10458	broad.mit.edu	37	17	79027553	79027553	+	Intron	SNP	C	T	T	rs12943872		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79027553C>T	uc002jzg.2	+						BAIAP2_uc002jyz.3_Intron|BAIAP2_uc002jza.2_Intron|BAIAP2_uc002jzc.2_Intron|BAIAP2_uc002jzb.2_Intron|BAIAP2_uc002jzd.2_Intron|BAIAP2_uc002jzf.2_Intron|BAIAP2_uc002jze.2_Intron|BAIAP2_uc010wuh.1_Intron	NM_017451	NP_059345			BAI1-associated protein 2 isoform 2						axonogenesis|filopodium assembly|insulin receptor signaling pathway|regulation of actin cytoskeleton organization|response to bacterium	cell junction|cytoskeleton|cytosol|filopodium|nucleus|ruffle	cytoskeletal adaptor activity|proline-rich region binding|protein C-terminus binding|SH3 domain binding				0	all_neural(118;0.101)		BRCA - Breast invasive adenocarcinoma(99;0.0228)|OV - Ovarian serous cystadenocarcinoma(97;0.0524)															---	---	---	---
C17orf56	146705	broad.mit.edu	37	17	79202797	79202797	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79202797C>T	uc002jzu.1	-	12	1531	c.1509G>A	c.(1507-1509)TCG>TCA	p.S503S	C17orf56_uc002jzr.1_Silent_p.S173S|C17orf56_uc002jzs.1_Silent_p.S419S|C17orf56_uc002jzt.1_Silent_p.S419S|C17orf56_uc002jzv.1_Silent_p.S351S|uc002jzw.1_RNA	NM_144679	NP_653280	Q96N21	CQ056_HUMAN	hypothetical protein LOC146705	503						integral to membrane					0	all_neural(118;0.0804)|Melanoma(429;0.242)		BRCA - Breast invasive adenocarcinoma(99;0.0272)|OV - Ovarian serous cystadenocarcinoma(97;0.117)															---	---	---	---
SLC38A10	124565	broad.mit.edu	37	17	79220848	79220848	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79220848C>T	uc002jzz.1	-	15	2454	c.2079G>A	c.(2077-2079)GCG>GCA	p.A693A	SLC38A10_uc002jzy.1_Silent_p.A611A	NM_001037984	NP_001033073	Q9HBR0	S38AA_HUMAN	solute carrier family 38, member 10 isoform a	693					amino acid transport|sodium ion transport	integral to membrane				pancreas(1)|skin(1)	2	all_neural(118;0.0804)|Melanoma(429;0.242)		BRCA - Breast invasive adenocarcinoma(99;0.0272)|OV - Ovarian serous cystadenocarcinoma(97;0.117)															---	---	---	---
NPLOC4	55666	broad.mit.edu	37	17	79573742	79573742	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79573742G>A	uc002kat.3	-	7	811	c.629C>T	c.(628-630)CCG>CTG	p.P210L	NPLOC4_uc002kau.3_Missense_Mutation_p.P210L|NPLOC4_uc010wur.1_Missense_Mutation_p.P49L	NM_017921	NP_060391	Q8TAT6	NPL4_HUMAN	nuclear protein localization 4	210					cellular membrane fusion|ER-associated protein catabolic process|Golgi organization	cytosol|endoplasmic reticulum|nuclear outer membrane-endoplasmic reticulum membrane network|nucleus	zinc ion binding			ovary(1)|central_nervous_system(1)	2	all_neural(118;0.0878)|Melanoma(429;0.242)|all_lung(278;0.246)		BRCA - Breast invasive adenocarcinoma(99;0.0282)|OV - Ovarian serous cystadenocarcinoma(97;0.0739)															---	---	---	---
PYCR1	5831	broad.mit.edu	37	17	79894022	79894022	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79894022G>A	uc002kcr.1	-	2	393	c.115C>T	c.(115-117)CTG>TTG	p.L39L	PYCR1_uc002kcq.1_Silent_p.L39L|PYCR1_uc002kcp.2_Silent_p.L39L|PYCR1_uc002kcs.1_Silent_p.L39L|PYCR1_uc010wvd.1_Silent_p.L66L|PYCR1_uc002kct.1_Silent_p.L39L|PYCR1_uc002kcu.1_Silent_p.L39L|PYCR1_uc010wve.1_5'Flank	NM_006907	NP_008838	P32322	P5CR1_HUMAN	pyrroline-5-carboxylate reductase 1 isoform 1	39					cellular response to oxidative stress|proline biosynthetic process	mitochondrial matrix	binding|pyrroline-5-carboxylate reductase activity				0	all_neural(118;0.0878)|Ovarian(332;0.12)		BRCA - Breast invasive adenocarcinoma(99;0.0165)|OV - Ovarian serous cystadenocarcinoma(97;0.0382)		L-Proline(DB00172)|NADH(DB00157)													---	---	---	---
ASPSCR1	79058	broad.mit.edu	37	17	79968693	79968693	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79968693C>A	uc002kcx.2	+	10	1283	c.1186C>A	c.(1186-1188)CTG>ATG	p.L396M	ASPSCR1_uc002kcw.1_Missense_Mutation_p.L396M|ASPSCR1_uc002kcy.2_Missense_Mutation_p.L396M|ASPSCR1_uc002kcz.2_Missense_Mutation_p.L290M|ASPSCR1_uc002kda.2_Missense_Mutation_p.L319M	NM_024083	NP_076988	Q9BZE9	ASPC1_HUMAN	alveolar soft part sarcoma chromosome region,	396	UBX.						protein binding		ASPSCR1/TFE3(161)	soft_tissue(118)|kidney(43)|breast(1)	162	all_neural(118;0.0878)|Ovarian(332;0.12)|all_lung(278;0.246)		BRCA - Breast invasive adenocarcinoma(99;0.0114)|OV - Ovarian serous cystadenocarcinoma(97;0.0191)					T	TFE3	alveolar soft part sarcoma								---	---	---	---
ASPSCR1	79058	broad.mit.edu	37	17	79973185	79973185	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79973185G>A	uc002kcx.2	+						ASPSCR1_uc002kcw.1_Intron|ASPSCR1_uc002kcy.2_Missense_Mutation_p.D530N|ASPSCR1_uc002kcz.2_Intron|ASPSCR1_uc002kda.2_Intron	NM_024083	NP_076988			alveolar soft part sarcoma chromosome region,								protein binding		ASPSCR1/TFE3(161)	soft_tissue(118)|kidney(43)|breast(1)	162	all_neural(118;0.0878)|Ovarian(332;0.12)|all_lung(278;0.246)		BRCA - Breast invasive adenocarcinoma(99;0.0114)|OV - Ovarian serous cystadenocarcinoma(97;0.0191)					T	TFE3	alveolar soft part sarcoma								---	---	---	---
CCDC57	284001	broad.mit.edu	37	17	80085655	80085655	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80085655C>T	uc002kdx.1	-	16	2513	c.2476G>A	c.(2476-2478)GCC>ACC	p.A826T	CCDC57_uc002kdy.2_Missense_Mutation_p.A133T	NM_198082	NP_932348	Q2TAC2	CCD57_HUMAN	coiled-coil domain containing 57	827										ovary(2)	2	Breast(20;0.00285)|all_neural(118;0.0878)|all_lung(278;0.0949)|Lung NSC(278;0.128)|Ovarian(332;0.227)		BRCA - Breast invasive adenocarcinoma(99;0.0232)|OV - Ovarian serous cystadenocarcinoma(97;0.0253)															---	---	---	---
CD7	924	broad.mit.edu	37	17	80274765	80274765	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80274765G>T	uc002kel.1	-	2	284	c.175C>A	c.(175-177)CTG>ATG	p.L59M	CD7_uc010din.2_Missense_Mutation_p.L59M|CD7_uc002kem.2_Missense_Mutation_p.P40H|CD7_uc010wvk.1_Missense_Mutation_p.L59M	NM_006137	NP_006128	P09564	CD7_HUMAN	CD7 antigen precursor	59	Ig-like.|Extracellular (Probable).				immune response|T cell activation|transmembrane receptor protein tyrosine kinase signaling pathway	integral to membrane|membrane fraction|plasma membrane	receptor activity				0	Breast(20;0.000675)|all_neural(118;0.0804)|Lung NSC(278;0.128)|all_lung(278;0.145)|Ovarian(332;0.249)		OV - Ovarian serous cystadenocarcinoma(97;0.00463)|BRCA - Breast invasive adenocarcinoma(99;0.0667)															---	---	---	---
TUBB6	84617	broad.mit.edu	37	18	12325560	12325560	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:12325560G>A	uc002kqw.2	+	4	817	c.772G>A	c.(772-774)GTG>ATG	p.V258M	TUBB6_uc002kqv.2_Missense_Mutation_p.V186M|TUBB6_uc010dld.2_RNA|TUBB6_uc002kqx.2_Missense_Mutation_p.V221M|TUBB6_uc002kqy.2_Intron	NM_032525	NP_115914	Q9BUF5	TBB6_HUMAN	tubulin, beta 6	258					'de novo' posttranslational protein folding|microtubule-based movement|protein polymerization	cytoplasm|microtubule	GTP binding|GTPase activity|structural molecule activity				0				READ - Rectum adenocarcinoma(1;0.0649)														---	---	---	---
ROCK1	6093	broad.mit.edu	37	18	18566911	18566911	+	Missense_Mutation	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:18566911T>G	uc002kte.2	-	19	3245	c.2304A>C	c.(2302-2304)GAA>GAC	p.E768D		NM_005406	NP_005397	Q13464	ROCK1_HUMAN	Rho-associated, coiled-coil containing protein	768	Glu-rich.				actin cytoskeleton organization|axon guidance|cellular component disassembly involved in apoptosis|cytokinesis|leukocyte tethering or rolling|membrane to membrane docking|Rho protein signal transduction	centriole|cytosol|Golgi membrane	ATP binding|identical protein binding|metal ion binding|protein serine/threonine kinase activity			lung(2)|breast(2)|central_nervous_system(1)	5	Melanoma(1;0.165)																	---	---	---	---
ZNF521	25925	broad.mit.edu	37	18	22805217	22805217	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:22805217C>T	uc002kvk.2	-	4	2912	c.2665G>A	c.(2665-2667)GAC>AAC	p.D889N	ZNF521_uc010xbe.1_RNA|ZNF521_uc010dly.2_Missense_Mutation_p.D889N|ZNF521_uc002kvl.2_Missense_Mutation_p.D669N	NM_015461	NP_056276	Q96K83	ZN521_HUMAN	zinc finger protein 521	889	C2H2-type 21; degenerate.				cell differentiation|multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein domain specific binding|zinc ion binding			ovary(4)|large_intestine(2)|lung(1)	7	all_cancers(21;0.0025)|all_epithelial(16;3.62e-05)|Ovarian(20;0.0991)							T	PAX5	ALL								---	---	---	---
FAM59A	64762	broad.mit.edu	37	18	29868123	29868123	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29868123A>G	uc002kxl.2	-	4	493	c.437T>C	c.(436-438)ATC>ACC	p.I146T	FAM59A_uc002kxk.1_Missense_Mutation_p.I146T	NM_022751	NP_073588	Q9H706	FA59A_HUMAN	family with sequence similarity 59, member A	146	CABIT.									ovary(1)|skin(1)	2																		---	---	---	---
FHOD3	80206	broad.mit.edu	37	18	34298660	34298660	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:34298660G>T	uc002kzt.1	+	15	2920	c.2823G>T	c.(2821-2823)AAG>AAT	p.K941N	FHOD3_uc002kzs.1_Missense_Mutation_p.K958N|FHOD3_uc010dmz.1_Missense_Mutation_p.K673N|FHOD3_uc010dna.1_Missense_Mutation_p.K261N	NM_025135	NP_079411	Q2V2M9	FHOD3_HUMAN	formin homology 2 domain containing 3	941	FH2.				actin cytoskeleton organization	cytoplasm|cytoskeleton	actin binding			skin(3)|large_intestine(2)|breast(2)|ovary(1)	8		all_epithelial(2;0.0181)|Colorectal(2;0.0195)																---	---	---	---
CELF4	56853	broad.mit.edu	37	18	34833844	34833844	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:34833844C>T	uc002lae.2	-	12	1787	c.1391G>A	c.(1390-1392)GGC>GAC	p.G464D	CELF4_uc010dnd.1_Missense_Mutation_p.G462D|CELF4_uc002lag.2_Missense_Mutation_p.G426D|CELF4_uc002laf.2_Missense_Mutation_p.G458D	NM_020180	NP_064565	Q9BZC1	CELF4_HUMAN	bruno-like 4, RNA binding protein isoform 1	464	RRM 3.				embryo development|germ cell development|regulation of alternative nuclear mRNA splicing, via spliceosome	cytoplasm|nucleus	BRE binding|nucleotide binding|translation repressor activity, nucleic acid binding			ovary(2)	2																		---	---	---	---
SETBP1	26040	broad.mit.edu	37	18	42531906	42531906	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:42531906C>T	uc010dni.2	+	4	2897	c.2601C>T	c.(2599-2601)AGC>AGT	p.S867S		NM_015559	NP_056374	Q9Y6X0	SETBP_HUMAN	SET binding protein 1 isoform a	867						nucleus	DNA binding			upper_aerodigestive_tract(2)|large_intestine(1)	3				Colorectal(1;0.0622)|COAD - Colon adenocarcinoma(74;0.201)										Schinzel-Giedion_syndrome				---	---	---	---
KIAA0427	9811	broad.mit.edu	37	18	46288052	46288052	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:46288052A>G	uc002ldc.2	+	9	1648	c.1363A>G	c.(1363-1365)ATG>GTG	p.M455V	KIAA0427_uc002ldd.2_Missense_Mutation_p.M457V|KIAA0427_uc002lde.3_Missense_Mutation_p.M84V	NM_014772	NP_055587	O43310	CTIF_HUMAN	hypothetical protein LOC9811 isoform 1	455	MIF4G.				nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|regulation of translational initiation	perinuclear region of cytoplasm	protein binding				0																		---	---	---	---
DCC	1630	broad.mit.edu	37	18	51052985	51052985	+	Splice_Site	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:51052985A>G	uc002lfe.1	+	28	4699	c.4112_splice	c.e28-2	p.G1371_splice	DCC_uc010dpf.1_Splice_Site_p.G1004_splice	NM_005215	NP_005206			netrin receptor DCC precursor						apoptosis|induction of apoptosis|negative regulation of collateral sprouting|negative regulation of dendrite development	cytosol|integral to membrane				skin(8)|ovary(6)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	17		all_cancers(7;0.11)|all_epithelial(6;0.00126)		Colorectal(16;0.0251)|COAD - Colon adenocarcinoma(17;0.0942)														---	---	---	---
WDR7	23335	broad.mit.edu	37	18	54398838	54398838	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:54398838A>G	uc002lgk.1	+						WDR7_uc010dpk.1_Intron|WDR7_uc002lgl.1_Intron	NM_015285	NP_056100			rabconnectin-3 beta isoform 1											ovary(2)|skin(1)	3				Lung(128;0.0238)|Colorectal(16;0.0296)														---	---	---	---
WDR7	23335	broad.mit.edu	37	18	54483305	54483305	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:54483305T>C	uc002lgk.1	+	20	3445	c.3234T>C	c.(3232-3234)CCT>CCC	p.P1078P	WDR7_uc010dpk.1_RNA|WDR7_uc002lgl.1_Silent_p.P1045P	NM_015285	NP_056100	Q9Y4E6	WDR7_HUMAN	rabconnectin-3 beta isoform 1	1078										ovary(2)|skin(1)	3				Lung(128;0.0238)|Colorectal(16;0.0296)														---	---	---	---
WDR7	23335	broad.mit.edu	37	18	54629676	54629676	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:54629676C>T	uc002lgk.1	+	26	4291	c.4080C>T	c.(4078-4080)AGC>AGT	p.S1360S	WDR7_uc002lgl.1_Silent_p.S1327S	NM_015285	NP_056100	Q9Y4E6	WDR7_HUMAN	rabconnectin-3 beta isoform 1	1360	WD 8.									ovary(2)|skin(1)	3				Lung(128;0.0238)|Colorectal(16;0.0296)														---	---	---	---
ZNF516	9658	broad.mit.edu	37	18	74091691	74091691	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74091691C>T	uc010dqx.1	-	3	2614	c.2379G>A	c.(2377-2379)CCG>CCA	p.P793P	ZNF516_uc002lme.2_RNA|ZNF516_uc002lmd.2_RNA	NM_014643	NP_055458	Q92618	ZN516_HUMAN	zinc finger protein 516	793					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Prostate(75;0.0869)|Esophageal squamous(42;0.129)		OV - Ovarian serous cystadenocarcinoma(15;7.64e-06)|BRCA - Breast invasive adenocarcinoma(31;0.238)														---	---	---	---
ZNF236	7776	broad.mit.edu	37	18	74620360	74620360	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74620360C>A	uc002lmi.2	+	14	2574	c.2376C>A	c.(2374-2376)GCC>GCA	p.A792A	ZNF236_uc002lmj.2_RNA	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	792					cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)														---	---	---	---
ZNF236	7776	broad.mit.edu	37	18	74639295	74639295	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74639295G>T	uc002lmi.2	+	24	4428	c.4230G>T	c.(4228-4230)ACG>ACT	p.T1410T	ZNF236_uc002lmj.2_RNA	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	1410					cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)														---	---	---	---
SALL3	27164	broad.mit.edu	37	18	76753440	76753440	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:76753440G>A	uc002lmt.2	+	2	1449	c.1449G>A	c.(1447-1449)CCG>CCA	p.P483P	SALL3_uc010dra.2_Silent_p.P90P	NM_171999	NP_741996	Q9BXA9	SALL3_HUMAN	sal-like 3	483					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|large_intestine(1)|central_nervous_system(1)	4		Esophageal squamous(42;0.129)|Melanoma(33;0.16)|Prostate(75;0.167)		OV - Ovarian serous cystadenocarcinoma(15;4.69e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0256)														---	---	---	---
ATP9B	374868	broad.mit.edu	37	18	77037089	77037089	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77037089A>G	uc002lmx.2	+	13	1318	c.1304A>G	c.(1303-1305)TAT>TGT	p.Y435C	ATP9B_uc002lmv.1_RNA|ATP9B_uc002lmw.1_Missense_Mutation_p.Y435C|ATP9B_uc002lmy.1_RNA|ATP9B_uc002lmz.1_Missense_Mutation_p.Y129C	NM_198531	NP_940933	O43861	ATP9B_HUMAN	ATPase, class II, type 9B	435	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	aminophospholipid transporter activity|ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|cation-transporting ATPase activity|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(3)	3		Esophageal squamous(42;0.018)|Melanoma(33;0.0964)|Prostate(75;0.171)		OV - Ovarian serous cystadenocarcinoma(15;1.44e-07)|BRCA - Breast invasive adenocarcinoma(31;0.0405)														---	---	---	---
PQLC1	80148	broad.mit.edu	37	18	77679353	77679353	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:77679353C>T	uc002lnl.2	-	5	611	c.439G>A	c.(439-441)GTG>ATG	p.V147M	PQLC1_uc010dre.2_Missense_Mutation_p.V64M|PQLC1_uc002lnk.2_Missense_Mutation_p.V129M|PQLC1_uc010xfm.1_Intron	NM_025078	NP_079354	Q8N2U9	PQLC1_HUMAN	PQ loop repeat containing 1 isoform 1	147	Helical; (Potential).					integral to membrane				large_intestine(1)|ovary(1)	2		Esophageal squamous(42;0.0212)|Melanoma(33;0.2)		OV - Ovarian serous cystadenocarcinoma(15;8.2e-07)|BRCA - Breast invasive adenocarcinoma(31;0.0258)														---	---	---	---
POLRMT	5442	broad.mit.edu	37	19	617821	617821	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:617821C>T	uc002lpf.1	-	18	3507	c.3451G>A	c.(3451-3453)GAC>AAC	p.D1151N		NM_005035	NP_005026	O00411	RPOM_HUMAN	mitochondrial DNA-directed RNA polymerase	1151	Mediates interaction with TEFM.	By similarity.			transcription initiation from mitochondrial promoter	mitochondrial nucleoid	DNA binding|DNA-directed RNA polymerase activity|protein binding			ovary(1)|pancreas(1)	2		all_epithelial(18;2.78e-22)|Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;3.55e-06)|all_lung(49;5.41e-06)|Breast(49;4.08e-05)|Hepatocellular(1079;0.137)|Renal(1328;0.228)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
DAZAP1	26528	broad.mit.edu	37	19	1433740	1433740	+	Intron	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1433740C>A	uc002lsn.2	+						DAZAP1_uc002lsm.2_Missense_Mutation_p.L351M|DAZAP1_uc002lso.2_Intron|DAZAP1_uc002lsl.1_Intron	NM_018959	NP_061832			DAZ associated protein 1 isoform b						cell differentiation|multicellular organismal development|spermatogenesis	cytoplasm|nucleus	nucleotide binding|RNA binding			breast(1)	1		Acute lymphoblastic leukemia(61;3.02e-13)|all_hematologic(61;4.32e-09)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
MBD3	53615	broad.mit.edu	37	19	1578342	1578342	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1578342G>A	uc002ltl.1	-	6	895	c.873C>T	c.(871-873)GTC>GTT	p.V291V	uc002lti.1_5'Flank|MBD3_uc002ltj.2_Silent_p.V291V|MBD3_uc002ltk.2_Silent_p.V259V	NM_003926	NP_003917	O95983	MBD3_HUMAN	methyl-CpG binding domain protein 3	291					transcription, DNA-dependent	NuRD complex	DNA binding|protein binding			ovary(1)|pancreas(1)|skin(1)	3		Acute lymphoblastic leukemia(61;3.02e-13)|all_hematologic(61;4.32e-09)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|Lung(535;0.179)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
DOT1L	84444	broad.mit.edu	37	19	2193687	2193687	+	Splice_Site	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2193687G>A	uc002lvb.3	+	6	530	c.494_splice	c.e6-1	p.G165_splice		NM_032482	NP_115871			DOT1-like, histone H3 methyltransferase							nucleus	DNA binding|histone-lysine N-methyltransferase activity|protein binding			pancreas(2)|upper_aerodigestive_tract(1)|lung(1)	4		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
DOT1L	84444	broad.mit.edu	37	19	2213960	2213960	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2213960C>T	uc002lvb.3	+	18	1808	c.1772C>T	c.(1771-1773)GCG>GTG	p.A591V	DOT1L_uc002lvc.1_5'UTR|uc002lvd.1_RNA|DOT1L_uc002lve.1_5'Flank	NM_032482	NP_115871	Q8TEK3	DOT1L_HUMAN	DOT1-like, histone H3 methyltransferase	591						nucleus	DNA binding|histone-lysine N-methyltransferase activity|protein binding			pancreas(2)|upper_aerodigestive_tract(1)|lung(1)	4		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
LINGO3	645191	broad.mit.edu	37	19	2291504	2291504	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2291504G>A	uc010dsx.1	-	2	400	c.272C>T	c.(271-273)GCG>GTG	p.A91V	SPPL2B_uc010dsw.1_Intron|uc002lvo.1_Missense_Mutation_p.R106H	NM_001101391	NP_001094861	P0C6S8	LIGO3_HUMAN	leucine rich repeat and Ig domain containing 3	91	LRR 2.|Extracellular (Potential).					integral to membrane					0																		---	---	---	---
GNG7	2788	broad.mit.edu	37	19	2515096	2515096	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2515096C>T	uc002lwd.2	-	5	368	c.131G>A	c.(130-132)CGG>CAG	p.R44Q	GNG7_uc010dte.1_Intron	NM_052847	NP_443079	O60262	GBG7_HUMAN	guanine nucleotide binding protein (G protein),	44					cellular response to glucagon stimulus|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|regulation of G-protein coupled receptor protein signaling pathway|synaptic transmission	heterotrimeric G-protein complex	signal transducer activity				0		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
TJP3	27134	broad.mit.edu	37	19	3733835	3733835	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3733835G>A	uc010xhv.1	+	6	859	c.859G>A	c.(859-861)GTG>ATG	p.V287M	TJP3_uc010xhs.1_Missense_Mutation_p.V268M|TJP3_uc010xht.1_Missense_Mutation_p.V232M|TJP3_uc010xhu.1_Missense_Mutation_p.V277M|TJP3_uc010xhw.1_Missense_Mutation_p.V287M	NM_014428	NP_055243	O95049	ZO3_HUMAN	tight junction protein 3	268	PDZ 2.					tight junction	protein binding			ovary(1)|central_nervous_system(1)|skin(1)	3				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0118)|STAD - Stomach adenocarcinoma(1328;0.18)														---	---	---	---
ANKRD24	170961	broad.mit.edu	37	19	4217166	4217166	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4217166C>T	uc010dtt.1	+	18	2285	c.2009C>T	c.(2008-2010)ACA>ATA	p.T670I	ANKRD24_uc002lzs.2_Missense_Mutation_p.T641I|ANKRD24_uc002lzt.2_Missense_Mutation_p.T642I	NM_133475	NP_597732	Q8TF21	ANR24_HUMAN	ankyrin repeat domain 24	670											0				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0233)|STAD - Stomach adenocarcinoma(1328;0.181)														---	---	---	---
UBXN6	80700	broad.mit.edu	37	19	4445590	4445590	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4445590C>T	uc002man.1	-	11	1327	c.1231G>A	c.(1231-1233)GAC>AAC	p.D411N	UBXN6_uc010dty.1_Missense_Mutation_p.D315N|UBXN6_uc002mam.1_Missense_Mutation_p.D358N	NM_025241	NP_079517	Q9BZV1	UBXN6_HUMAN	UBX domain protein 6	411						microtubule organizing center|nucleus	protein binding				0																		---	---	---	---
TICAM1	148022	broad.mit.edu	37	19	4817190	4817190	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4817190G>T	uc002mbi.2	-	2	1451	c.1200C>A	c.(1198-1200)CTC>CTA	p.L400L		NM_182919	NP_891549	Q8IUC6	TCAM1_HUMAN	toll-like receptor adaptor molecule 1	400	TIR.				apoptosis|I-kappaB kinase/NF-kappaB cascade|inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|endosome membrane|plasma membrane	protein kinase binding|signal transducer activity			breast(1)	1				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0139)														---	---	---	---
KDM4B	23030	broad.mit.edu	37	19	5110750	5110750	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5110750C>T	uc002mbq.3	+	10	1262	c.1036C>T	c.(1036-1038)CGG>TGG	p.R346W	KDM4B_uc010xil.1_Missense_Mutation_p.R346W|KDM4B_uc010xim.1_Missense_Mutation_p.R346W|KDM4B_uc002mbr.3_Missense_Mutation_p.R104W	NM_015015	NP_055830	O94953	KDM4B_HUMAN	jumonji domain containing 2B	346					chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	nucleic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|zinc ion binding			lung(1)	1																		---	---	---	---
PTPRS	5802	broad.mit.edu	37	19	5218818	5218818	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5218818G>A	uc002mbv.2	-						PTPRS_uc002mbu.1_Intron|PTPRS_uc010xin.1_Intron|PTPRS_uc002mbw.2_Intron|PTPRS_uc002mbx.2_Intron|PTPRS_uc002mby.2_Intron	NM_002850	NP_002841			protein tyrosine phosphatase, receptor type,						cell adhesion	integral to plasma membrane	protein binding|transmembrane receptor protein tyrosine phosphatase activity			large_intestine(2)|ovary(1)|central_nervous_system(1)	4				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0321)|Lung(535;0.182)														---	---	---	---
CD70	970	broad.mit.edu	37	19	6590986	6590986	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6590986C>T	uc002mfi.2	-	1	178	c.28G>A	c.(28-30)GTG>ATG	p.V10M	CD70_uc010xjf.1_Missense_Mutation_p.V10M	NM_001252	NP_001243	P32970	CD70_HUMAN	tumor necrosis factor ligand superfamily, member	10	Cytoplasmic (Potential).				cell proliferation|cell-cell signaling|immune response|induction of apoptosis|signal transduction	extracellular space|integral to membrane of membrane fraction|integral to plasma membrane	cytokine activity|protease binding|tumor necrosis factor receptor binding				0																		---	---	---	---
ZNF358	140467	broad.mit.edu	37	19	7585040	7585040	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7585040G>A	uc002mgn.2	+	2	1082	c.912G>A	c.(910-912)TCG>TCA	p.S304S	MCOLN1_uc010dvh.1_5'Flank|MCOLN1_uc002mgo.2_5'Flank|MCOLN1_uc002mgp.2_5'Flank	NM_018083	NP_060553	Q9NW07	ZN358_HUMAN	zinc finger protein 358	304	C2H2-type 6.				embryonic forelimb morphogenesis|neural tube development|regulation of transcription, DNA-dependent|stem cell maintenance|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			central_nervous_system(1)	1																		---	---	---	---
EVI5L	115704	broad.mit.edu	37	19	7928374	7928374	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7928374C>T	uc002min.2	+	19	2325	c.2171C>T	c.(2170-2172)GCG>GTG	p.A724V	EVI5L_uc010xjz.1_Missense_Mutation_p.A735V	NM_145245	NP_660288	Q96CN4	EVI5L_HUMAN	ecotropic viral integration site 5-like isoform	724						intracellular	protein binding|Rab GTPase activator activity			ovary(1)	1																		---	---	---	---
MAP2K7	5609	broad.mit.edu	37	19	7975260	7975260	+	Splice_Site	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7975260T>C	uc002mit.2	+	4	512	c.447_splice	c.e4+2	p.K149_splice	MAP2K7_uc002miv.2_Splice_Site_p.K149_splice|MAP2K7_uc010xka.1_Splice_Site|MAP2K7_uc010xkb.1_Splice_Site_p.K149_splice|MAP2K7_uc010dvv.2_Splice_Site_p.K24_splice	NM_145185	NP_660186			mitogen-activated protein kinase kinase 7						activation of JUN kinase activity|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleus	ATP binding|JUN kinase kinase activity|magnesium ion binding|protein binding|protein kinase binding|protein phosphatase binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			large_intestine(7)|central_nervous_system(2)|ovary(1)|lung(1)	11					Etoposide(DB00773)													---	---	---	---
MAP2K7	5609	broad.mit.edu	37	19	7975970	7975970	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7975970G>A	uc002mit.2	+	7	846	c.781G>A	c.(781-783)GAC>AAC	p.D261N	MAP2K7_uc002miv.2_Missense_Mutation_p.D261N|MAP2K7_uc010xka.1_RNA|MAP2K7_uc010xkb.1_Missense_Mutation_p.D261N|MAP2K7_uc010dvv.2_Missense_Mutation_p.D136N	NM_145185	NP_660186	O14733	MP2K7_HUMAN	mitogen-activated protein kinase kinase 7	261	Protein kinase.				activation of JUN kinase activity|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleus	ATP binding|JUN kinase kinase activity|magnesium ion binding|protein binding|protein kinase binding|protein phosphatase binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			large_intestine(7)|central_nervous_system(2)|ovary(1)|lung(1)	11					Etoposide(DB00773)													---	---	---	---
FBN3	84467	broad.mit.edu	37	19	8194245	8194245	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8194245G>A	uc002mjf.2	-	16	2070	c.2049C>T	c.(2047-2049)ATC>ATT	p.I683I		NM_032447	NP_115823	Q75N90	FBN3_HUMAN	fibrillin 3 precursor	683	EGF-like 8; calcium-binding.					proteinaceous extracellular matrix	calcium ion binding|extracellular matrix structural constituent			ovary(6)|skin(3)|pancreas(1)|central_nervous_system(1)	11																		---	---	---	---
MUC16	94025	broad.mit.edu	37	19	9024942	9024942	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9024942T>C	uc002mkp.2	-	16	37124	c.36920A>G	c.(36919-36921)GAC>GGC	p.D12307G		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	12309	SEA 2.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---
MUC16	94025	broad.mit.edu	37	19	9046900	9046900	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9046900C>T	uc002mkp.2	-	5	34935	c.34731G>A	c.(34729-34731)TGG>TGA	p.W11577*		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	11579	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---
MUC16	94025	broad.mit.edu	37	19	9068944	9068944	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9068944C>A	uc002mkp.2	-	3	18706	c.18502G>T	c.(18502-18504)GGC>TGC	p.G6168C		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	6170	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---
MUC16	94025	broad.mit.edu	37	19	9076908	9076908	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9076908G>A	uc002mkp.2	-	3	10742	c.10538C>T	c.(10537-10539)GCT>GTT	p.A3513V		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	3514	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57																		---	---	---	---
OLFM2	93145	broad.mit.edu	37	19	9965341	9965341	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9965341G>A	uc002mmp.2	-	6	914	c.886C>T	c.(886-888)CGC>TGC	p.R296C	OLFM2_uc002mmo.2_Missense_Mutation_p.R218C	NM_058164	NP_477512	O95897	NOE2_HUMAN	olfactomedin 2 precursor	296	Olfactomedin-like.					extracellular region				large_intestine(1)|skin(1)	2																		---	---	---	---
ICAM5	7087	broad.mit.edu	37	19	10404943	10404943	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10404943G>A	uc002mnu.3	+	8	2004	c.1939G>A	c.(1939-1941)GCC>ACC	p.A647T	ICAM5_uc002mnv.3_Missense_Mutation_p.A522T	NM_003259	NP_003250	Q9UMF0	ICAM5_HUMAN	intercellular adhesion molecule 5 precursor	647	Extracellular (Potential).|Ig-like C2-type 7.				cell-cell adhesion	integral to plasma membrane				breast(3)	3			OV - Ovarian serous cystadenocarcinoma(20;2.64e-09)|Epithelial(33;4.31e-06)|all cancers(31;9.75e-06)															---	---	---	---
DOCK6	57572	broad.mit.edu	37	19	11332521	11332521	+	Intron	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11332521A>G	uc002mqs.3	-						DOCK6_uc010xlq.1_Intron	NM_020812	NP_065863			dedicator of cytokinesis 6						blood coagulation	cytosol	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(2)|skin(1)	3																		---	---	---	---
ECSIT	51295	broad.mit.edu	37	19	11617215	11617215	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11617215G>A	uc002msb.2	-	8	1214	c.1080C>T	c.(1078-1080)TGC>TGT	p.C360C	ZNF653_uc002mrz.1_5'Flank|ECSIT_uc002msa.1_RNA|ECSIT_uc010dyc.1_3'UTR|ECSIT_uc010dyd.2_3'UTR|ECSIT_uc010xma.1_Silent_p.C146C	NM_016581	NP_057665	Q9BQ95	ECSIT_HUMAN	evolutionarily conserved signaling intermediate	360					innate immune response|regulation of oxidoreductase activity	mitochondrion	oxidoreductase activity, acting on NADH or NADPH|protein binding			ovary(1)	1																		---	---	---	---
ZNF625	90589	broad.mit.edu	37	19	12257031	12257031	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12257031A>G	uc002mth.2	-	4	352	c.2T>C	c.(1-3)ATG>ACG	p.M1T	ZNF20_uc002mtg.1_Intron|ZNF625_uc010dyn.1_RNA|ZNF625_uc010dyo.1_Missense_Mutation_p.M35T	NM_145233	NP_660276	Q96I27	ZN625_HUMAN	zinc finger protein 625	1					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0																		---	---	---	---
DHPS	1725	broad.mit.edu	37	19	12790343	12790343	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12790343C>T	uc002muh.1	-	5	703	c.606G>A	c.(604-606)ACG>ACA	p.T202T	DHPS_uc002muf.1_Silent_p.T79T|DHPS_uc002mug.1_Silent_p.T160T|DHPS_uc002mui.1_Silent_p.T202T|DHPS_uc002muj.1_Silent_p.T202T|DHPS_uc002muk.1_RNA|DHPS_uc010xmn.1_RNA	NM_001930	NP_001921	P49366	DHYS_HUMAN	deoxyhypusine synthase isoform a	202					peptidyl-lysine modification to hypusine|positive regulation of cell proliferation|post-translational protein modification|spermidine catabolic process to deoxyhypusine, using deoxyhypusine synthase|translation	cytosol	deoxyhypusine synthase activity|protein binding			central_nervous_system(1)	1					Sulfadoxine(DB01299)													---	---	---	---
MAST1	22983	broad.mit.edu	37	19	12969475	12969475	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12969475G>A	uc002mvm.2	+	12	1416	c.1288G>A	c.(1288-1290)GAG>AAG	p.E430K	MAST1_uc002mvk.2_Missense_Mutation_p.E426K	NM_014975	NP_055790	Q9Y2H9	MAST1_HUMAN	microtubule associated serine/threonine kinase	430	Protein kinase.				cytoskeleton organization|intracellular protein kinase cascade	cytoplasm|cytoskeleton|plasma membrane	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			ovary(3)|lung(2)|large_intestine(1)|skin(1)	7																		---	---	---	---
ASF1B	55723	broad.mit.edu	37	19	14231480	14231480	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:14231480G>A	uc002mye.2	-						PRKACA_uc002myc.2_5'Flank	NM_018154	NP_060624			anti-silencing function 1B						cell differentiation|chromatin modification|multicellular organismal development|regulation of transcription, DNA-dependent|spermatogenesis|transcription, DNA-dependent	nucleus					0																		---	---	---	---
AKAP8L	26993	broad.mit.edu	37	19	15512143	15512143	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15512143T>C	uc002naw.1	-	5	733	c.634A>G	c.(634-636)ATG>GTG	p.M212V	AKAP8L_uc002nax.1_RNA|AKAP8L_uc010xoh.1_Missense_Mutation_p.M151V|AKAP8L_uc002nay.1_Missense_Mutation_p.M212V|AKAP8L_uc002naz.2_Missense_Mutation_p.M60V	NM_014371	NP_055186	Q9ULX6	AKP8L_HUMAN	A kinase (PRKA) anchor protein 8-like	212						cytoplasm|nuclear matrix	DEAD/H-box RNA helicase binding|DNA binding|zinc ion binding			ovary(1)	1																		---	---	---	---
PGLYRP2	114770	broad.mit.edu	37	19	15586344	15586344	+	Intron	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15586344C>A	uc002nbf.3	-						PGLYRP2_uc002nbg.3_Intron	NM_052890	NP_443122			peptidoglycan recognition protein 2 precursor						defense response to Gram-positive bacterium|detection of bacterium|innate immune response|peptide amidation|peptidoglycan catabolic process	extracellular region|intracellular|membrane	N-acetylmuramoyl-L-alanine amidase activity|peptidoglycan receptor activity|zinc ion binding			ovary(3)	3																		---	---	---	---
SIN3B	23309	broad.mit.edu	37	19	16942458	16942458	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16942458G>T	uc002ney.1	+	3	395	c.381G>T	c.(379-381)CAG>CAT	p.Q127H	SIN3B_uc002new.2_Missense_Mutation_p.Q127H|SIN3B_uc002nex.2_Missense_Mutation_p.Q59H|SIN3B_uc002nez.1_Missense_Mutation_p.Q127H	NM_015260	NP_056075	O75182	SIN3B_HUMAN	SIN3 homolog B, transcription regulator	127					cellular lipid metabolic process|transcription, DNA-dependent	nucleoplasm	protein binding			ovary(2)	2																		---	---	---	---
SIN3B	23309	broad.mit.edu	37	19	16980513	16980513	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16980513G>A	uc002ney.1	+	14	2159	c.2145G>A	c.(2143-2145)GAG>GAA	p.E715E	SIN3B_uc002nez.1_Silent_p.E683E|SIN3B_uc010xpi.1_Silent_p.E273E	NM_015260	NP_056075	O75182	SIN3B_HUMAN	SIN3 homolog B, transcription regulator	715					cellular lipid metabolic process|transcription, DNA-dependent	nucleoplasm	protein binding			ovary(2)	2																		---	---	---	---
MYO9B	4650	broad.mit.edu	37	19	17283255	17283255	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17283255C>T	uc010eak.2	+	12	2055	c.1903C>T	c.(1903-1905)CAC>TAC	p.H635Y	MYO9B_uc002nfi.2_Missense_Mutation_p.H635Y|MYO9B_uc002nfj.1_Missense_Mutation_p.H635Y	NM_004145	NP_004136	Q13459	MYO9B_HUMAN	myosin IXB isoform 1	635	Myosin head-like.				actin filament-based movement	cell cortex|cytosol|filamentous actin|myosin complex|perinuclear region of cytoplasm	actin binding|ADP binding|ATP binding|ATPase activity|calmodulin binding|metal ion binding|microfilament motor activity|Rho GTPase activator activity			breast(1)	1																		---	---	---	---
USE1	55850	broad.mit.edu	37	19	17330563	17330563	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17330563G>A	uc002nfo.2	+	8	781	c.721G>A	c.(721-723)GTC>ATC	p.V241I	USE1_uc010eal.1_3'UTR	NM_018467	NP_060937	Q9NZ43	USE1_HUMAN	unconventional SNARE in the ER 1 homolog	241	Helical; Anchor for type IV membrane protein; (Potential).				lysosomal transport|protein catabolic process|protein transport|secretion by cell|vesicle-mediated transport	endoplasmic reticulum membrane|integral to membrane	protein binding				0																		---	---	---	---
DDA1	79016	broad.mit.edu	37	19	17420478	17420478	+	Intron	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17420478C>A	uc002ngd.2	+						DDA1_uc002nge.2_Intron	NM_024050	NP_076955			DET1 and DDB1 associated 1											ovary(1)	1																		---	---	---	---
FAM129C	199786	broad.mit.edu	37	19	17648229	17648229	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17648229G>A	uc010xpr.1	+	6	703	c.565G>A	c.(565-567)GTG>ATG	p.V189M	FAM129C_uc010xpq.1_Missense_Mutation_p.V189M|FAM129C_uc010xps.1_Missense_Mutation_p.V158M|FAM129C_uc010xpt.1_RNA|FAM129C_uc002ngy.3_5'Flank|FAM129C_uc010xpu.1_5'Flank|FAM129C_uc002ngz.3_5'Flank|FAM129C_uc010eaw.2_5'Flank|FAM129C_uc002nhb.2_5'Flank	NM_173544	NP_775815	Q86XR2	NIBL2_HUMAN	B-cell novel protein 1 isoform a	189											0																		---	---	---	---
KIAA1683	80726	broad.mit.edu	37	19	18368642	18368642	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:18368642C>T	uc002nin.2	-	4	3107	c.2891G>A	c.(2890-2892)CGT>CAT	p.R964H	PDE4C_uc002nil.3_5'Flank|KIAA1683_uc010ebn.2_Missense_Mutation_p.R1151H|KIAA1683_uc010xqe.1_Missense_Mutation_p.R918H|KIAA1683_uc010xqf.1_RNA	NM_025249	NP_079525	Q9H0B3	K1683_HUMAN	KIAA1683 isoform b	964	IQ 3.					mitochondrion				ovary(2)	2																		---	---	---	---
ELL	8178	broad.mit.edu	37	19	18557279	18557279	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:18557279G>A	uc002njh.2	-	10	1616	c.1544C>T	c.(1543-1545)GCC>GTC	p.A515V	ELL_uc010ebq.2_Missense_Mutation_p.A458V|ELL_uc002njg.2_Missense_Mutation_p.A382V	NM_006532	NP_006523	P55199	ELL_HUMAN	elongation factor RNA polymerase II	515					positive regulation of transcription elongation, DNA-dependent|positive regulation of viral transcription|transcription elongation from RNA polymerase II promoter|viral reproduction	Cajal body|nuclear speck|transcription elongation factor complex	protein binding			lung(1)	1				GBM - Glioblastoma multiforme(1328;7.81e-07)				T	MLL	AL								---	---	---	---
DDX49	54555	broad.mit.edu	37	19	19032668	19032668	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19032668G>A	uc002nkq.1	+	4	399	c.342G>A	c.(340-342)GCG>GCA	p.A114A	COPE_uc002nkk.2_5'Flank|COPE_uc002nkl.2_5'Flank|COPE_uc002nkm.2_5'Flank|COPE_uc002nkn.2_5'Flank|HOMER3_uc002nko.1_Intron|HOMER3_uc002nkp.1_Intron|DDX49_uc002nkr.1_RNA|DDX49_uc002nks.1_Silent_p.A7A|DDX49_uc002nkt.1_5'UTR	NM_019070	NP_061943	Q9Y6V7	DDX49_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 49	114	Helicase ATP-binding.						ATP binding|ATP-dependent helicase activity|RNA binding			ovary(1)	1			Epithelial(12;0.0289)															---	---	---	---
CCNE1	898	broad.mit.edu	37	19	30311678	30311678	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:30311678G>A	uc002nsn.2	+	7	715	c.532G>A	c.(532-534)GCG>ACG	p.A178T	CCNE1_uc002nso.2_Missense_Mutation_p.A163T|CCNE1_uc002nsp.2_5'Flank	NM_001238	NP_001229	P24864	CCNE1_HUMAN	cyclin E1 isoform 1	178					androgen receptor signaling pathway|cell division|positive regulation of transcription, DNA-dependent|regulation of cyclin-dependent protein kinase activity|regulation of transcription involved in G1/S phase of mitotic cell cycle	cytosol|nucleoplasm	androgen receptor binding|protein kinase binding|transcription coactivator activity			lung(2)	2	all_cancers(1;2.19e-31)|all_epithelial(1;1.49e-30)|all_lung(1;1.37e-11)|Lung NSC(1;2.35e-11)|Ovarian(5;0.000902)|Breast(6;0.0203)|Esophageal squamous(110;0.195)		UCEC - Uterine corpus endometrioid carcinoma (4;2.65e-06)|Epithelial(1;6.85e-98)|all cancers(1;1.38e-94)|OV - Ovarian serous cystadenocarcinoma(1;1.38e-90)|STAD - Stomach adenocarcinoma(5;5.8e-07)|GBM - Glioblastoma multiforme(4;0.0394)|Lung(7;0.092)|LUAD - Lung adenocarcinoma(5;0.115)|BRCA - Breast invasive adenocarcinoma(6;0.183)|COAD - Colon adenocarcinoma(1;0.188)|Colorectal(1;0.202)															---	---	---	---
WDR88	126248	broad.mit.edu	37	19	33623259	33623259	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33623259G>A	uc002nui.2	+	1	262	c.184G>A	c.(184-186)GCC>ACC	p.A62T		NM_173479	NP_775750	Q6ZMY6	WDR88_HUMAN	PQQ repeat and WD repeat domain containing	62										ovary(1)|breast(1)|central_nervous_system(1)	3	Esophageal squamous(110;0.137)																	---	---	---	---
WDR88	126248	broad.mit.edu	37	19	33666454	33666454	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33666454G>A	uc002nui.2	+	11	1473	c.1395G>A	c.(1393-1395)CCG>CCA	p.P465P		NM_173479	NP_775750	Q6ZMY6	WDR88_HUMAN	PQQ repeat and WD repeat domain containing	465										ovary(1)|breast(1)|central_nervous_system(1)	3	Esophageal squamous(110;0.137)																	---	---	---	---
CHST8	64377	broad.mit.edu	37	19	34263265	34263265	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:34263265G>A	uc002nus.3	+	5	1077	c.572G>A	c.(571-573)CGC>CAC	p.R191H	CHST8_uc002nut.3_Missense_Mutation_p.R191H|CHST8_uc002nuu.2_Missense_Mutation_p.R191H	NM_001127895	NP_001121367	Q9H2A9	CHST8_HUMAN	carbohydrate (N-acetylgalactosamine 4-0)	191	Lumenal (Potential).				carbohydrate biosynthetic process|central nervous system development|hormone biosynthetic process|proteoglycan biosynthetic process|sulfur compound metabolic process	Golgi membrane|integral to membrane	N-acetylgalactosamine 4-O-sulfotransferase activity			skin(2)|large_intestine(1)|ovary(1)	4	Esophageal squamous(110;0.162)																	---	---	---	---
CHST8	64377	broad.mit.edu	37	19	34263278	34263278	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:34263278C>T	uc002nus.3	+	5	1090	c.585C>T	c.(583-585)TGC>TGT	p.C195C	CHST8_uc002nut.3_Silent_p.C195C|CHST8_uc002nuu.2_Silent_p.C195C	NM_001127895	NP_001121367	Q9H2A9	CHST8_HUMAN	carbohydrate (N-acetylgalactosamine 4-0)	195	Lumenal (Potential).				carbohydrate biosynthetic process|central nervous system development|hormone biosynthetic process|proteoglycan biosynthetic process|sulfur compound metabolic process	Golgi membrane|integral to membrane	N-acetylgalactosamine 4-O-sulfotransferase activity			skin(2)|large_intestine(1)|ovary(1)	4	Esophageal squamous(110;0.162)																	---	---	---	---
SCGBL	284402	broad.mit.edu	37	19	35085149	35085149	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35085149G>A	uc002nvn.2	-	2	199	c.177C>T	c.(175-177)TCC>TCT	p.S59S		NM_001025591	NP_001020762	Q4G0G5	SCGBL_HUMAN	secretoglobin-like precursor	59						extracellular region	binding				0																		---	---	---	---
ZNF302	55900	broad.mit.edu	37	19	35175800	35175800	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35175800A>G	uc002nvr.1	+	6	1253	c.990A>G	c.(988-990)GAA>GAG	p.E330E	ZNF302_uc002nvp.1_Silent_p.E286E|ZNF302_uc002nvq.1_Silent_p.E286E|ZNF302_uc002nvs.1_Silent_p.E286E	NM_018443	NP_060913	Q9NR11	ZN302_HUMAN	zinc finger protein 302	365	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_lung(56;6.16e-07)|Lung NSC(56;9.71e-07)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0849)															---	---	---	---
FAM187B	148109	broad.mit.edu	37	19	35719007	35719007	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35719007G>A	uc002nyk.1	-	1	622	c.577C>T	c.(577-579)CGG>TGG	p.R193W		NM_152481	NP_689694	Q17R55	F187B_HUMAN	family with sequence similarity 187, member B	193	Extracellular (Potential).					integral to membrane				ovary(2)	2																		---	---	---	---
HAUS5	23354	broad.mit.edu	37	19	36109010	36109010	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36109010C>T	uc002oam.1	+	10	785	c.734C>T	c.(733-735)GCT>GTT	p.A245V		NM_015302	NP_056117	O94927	HAUS5_HUMAN	HAUS augmin-like complex, subunit 5	245					cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|spindle					0																		---	---	---	---
TBCB	1155	broad.mit.edu	37	19	36611634	36611634	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36611634G>A	uc002odg.1	+	3	856	c.281G>A	c.(280-282)CGC>CAC	p.R94H	TBCB_uc002odh.1_Missense_Mutation_p.R75H	NM_001281	NP_001272	Q99426	TBCB_HUMAN	cytoskeleton associated protein 1	94					'de novo' posttranslational protein folding|cell differentiation|nervous system development	cytoplasm|microtubule	protein binding				0	Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.06)															---	---	---	---
LGALS4	3960	broad.mit.edu	37	19	39294176	39294176	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39294176G>T	uc002ojg.2	-	7	770	c.556C>A	c.(556-558)CCA>ACA	p.P186T	LGALS4_uc010xuj.1_3'UTR	NM_006149	NP_006140	P56470	LEG4_HUMAN	galectin-4	186					cell adhesion	cytosol|plasma membrane	sugar binding			ovary(1)|skin(1)	2	all_cancers(60;1.02e-05)|Ovarian(47;0.0454)		Lung(45;0.00416)|LUSC - Lung squamous cell carcinoma(53;0.00741)															---	---	---	---
LRFN1	57622	broad.mit.edu	37	19	39799075	39799075	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39799075G>A	uc002okw.2	-	2	1514	c.1514C>T	c.(1513-1515)CCG>CTG	p.P505L		NM_020862	NP_065913	Q9P244	LRFN1_HUMAN	leucine rich repeat and fibronectin type III	505	Fibronectin type-III.|Extracellular (Potential).					cell junction|integral to membrane|postsynaptic density|postsynaptic membrane				ovary(2)	2	all_cancers(60;1.85e-07)|all_lung(34;4.03e-08)|Lung NSC(34;4.66e-08)|all_epithelial(25;6.4e-07)|Ovarian(47;0.0512)		Epithelial(26;1.96e-27)|all cancers(26;2.05e-24)|Lung(45;0.000278)|LUSC - Lung squamous cell carcinoma(53;0.000335)															---	---	---	---
SAMD4B	55095	broad.mit.edu	37	19	39870681	39870681	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39870681C>T	uc002olb.2	+	12	2641	c.1606C>T	c.(1606-1608)CGC>TGC	p.R536C	SAMD4B_uc002ola.2_Missense_Mutation_p.R536C	NM_018028	NP_060498	Q5PRF9	SMAG2_HUMAN	sterile alpha motif domain containing 4B	536							protein binding				0	all_cancers(60;2.5e-07)|all_lung(34;4.03e-08)|Lung NSC(34;4.66e-08)|all_epithelial(25;6.4e-07)|Ovarian(47;0.0512)		Epithelial(26;9.6e-28)|all cancers(26;9.14e-25)|Lung(45;0.000168)|LUSC - Lung squamous cell carcinoma(53;0.000199)															---	---	---	---
FCGBP	8857	broad.mit.edu	37	19	40373995	40373995	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40373995G>A	uc002omp.3	-	26	12091	c.12083C>T	c.(12082-12084)CCG>CTG	p.P4028L		NM_003890	NP_003881	Q9Y6R7	FCGBP_HUMAN	Fc fragment of IgG binding protein precursor	4028	Cys-rich.					extracellular region	protein binding			ovary(4)|skin(4)|central_nervous_system(1)	9	all_cancers(60;6.03e-06)|all_lung(34;5.58e-08)|Lung NSC(34;6.62e-08)|Ovarian(47;0.06)		Epithelial(26;6.25e-23)|all cancers(26;1.13e-20)															---	---	---	---
PSMC4	5704	broad.mit.edu	37	19	40480513	40480513	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40480513G>A	uc002omq.2	+	5	589	c.552G>A	c.(550-552)CCG>CCA	p.P184P	PSMC4_uc002omr.2_Silent_p.P153P	NM_006503	NP_006494	P43686	PRS6B_HUMAN	proteasome 26S ATPase subunit 4 isoform 1	184					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	mitochondrion|nucleus|proteasome complex	ATP binding|ATPase activity|protein binding			ovary(1)	1	all_cancers(60;9.55e-06)|all_lung(34;1.17e-07)|Lung NSC(34;1.41e-07)|Ovarian(47;0.0925)																	---	---	---	---
SERTAD3	29946	broad.mit.edu	37	19	40947828	40947828	+	Silent	SNP	T	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40947828T>G	uc002onu.3	-	2	438	c.160A>C	c.(160-162)AGG>CGG	p.R54R	SERTAD3_uc002onv.3_Silent_p.R54R	NM_013368	NP_037500	Q9UJW9	SRTD3_HUMAN	RPA-binding trans-activator	54	SERTA.				negative regulation of cell growth|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding				0			Lung(22;6.24e-05)|LUSC - Lung squamous cell carcinoma(20;0.000384)															---	---	---	---
SPTBN4	57731	broad.mit.edu	37	19	41062146	41062146	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41062146G>A	uc002ony.2	+	25	5327	c.5241G>A	c.(5239-5241)GAG>GAA	p.E1747E	SPTBN4_uc002onx.2_Silent_p.E1747E|SPTBN4_uc002onz.2_Silent_p.E1747E|SPTBN4_uc010egx.2_Silent_p.E490E|SPTBN4_uc002ooa.2_Silent_p.E423E	NM_020971	NP_066022	Q9H254	SPTN4_HUMAN	spectrin, beta, non-erythrocytic 4 isoform	1747	Spectrin 15.				actin filament capping|axon guidance|cytoskeletal anchoring at plasma membrane|vesicle-mediated transport	cytosol|nuclear matrix|PML body|spectrin	actin binding|ankyrin binding|structural constituent of cytoskeleton			ovary(3)|central_nervous_system(1)|skin(1)	5			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)															---	---	---	---
CYP2A13	1553	broad.mit.edu	37	19	41600201	41600201	+	Missense_Mutation	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41600201A>C	uc002opt.2	+	7	1034	c.1025A>C	c.(1024-1026)AAG>ACG	p.K342T		NM_000766	NP_000757	Q16696	CP2AD_HUMAN	cytochrome P450, family 2, subfamily A,	342					xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	aromatase activity|coumarin 7-hydroxylase activity|electron carrier activity|heme binding			ovary(2)|skin(1)	3					Clomipramine(DB01242)|Nicotine(DB00184)													---	---	---	---
CCDC97	90324	broad.mit.edu	37	19	41822288	41822288	+	Splice_Site	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41822288G>T	uc002oqg.2	+	2	169	c.47_splice	c.e2-1	p.G16_splice	CYP2F1_uc010xvw.1_Intron	NM_052848	NP_443080			coiled-coil domain containing 97												0																		---	---	---	---
B9D2	80776	broad.mit.edu	37	19	41863901	41863901	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41863901C>T	uc002oqj.2	-	3	335	c.115G>A	c.(115-117)GTG>ATG	p.V39M	CYP2F1_uc010xvw.1_Intron|TMEM91_uc002oqi.2_Intron	NM_030578	NP_085055	Q9BPU9	B9D2_HUMAN	B9 protein domain 2	39	B9.				cilium assembly|mitotic prometaphase	centrosome|cilium axoneme|cytosol|microtubule basal body|nucleus	gamma-tubulin binding			ovary(1)	1																		---	---	---	---
DMRTC2	63946	broad.mit.edu	37	19	42354596	42354596	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42354596C>A	uc002ors.2	+	8	902	c.819C>A	c.(817-819)GCC>GCA	p.A273A	DMRTC2_uc002orr.1_Silent_p.A201A|DMRTC2_uc010xwe.1_Silent_p.A324A	NM_001040283	NP_001035373	Q8IXT2	DMRTD_HUMAN	DMRT-like family C2	273	Pro-rich.				cell differentiation|sex differentiation	nucleus	DNA binding|metal ion binding|sequence-specific DNA binding transcription factor activity				0																		---	---	---	---
CIC	23152	broad.mit.edu	37	19	42798378	42798378	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42798378C>T	uc002otf.1	+	18	4289	c.4249C>T	c.(4249-4251)CGC>TGC	p.R1417C		NM_015125	NP_055940	Q96RK0	CIC_HUMAN	capicua homolog	1417					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding			ovary(4)|breast(4)|lung(1)|central_nervous_system(1)|skin(1)	11		Prostate(69;0.00682)						T	DUX4	soft tissue sarcoma								---	---	---	---
CADM4	199731	broad.mit.edu	37	19	44130991	44130991	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44130991C>T	uc002oxc.1	-	4	493	c.444G>A	c.(442-444)CCG>CCA	p.P148P		NM_145296	NP_660339	Q8NFZ8	CADM4_HUMAN	cell adhesion molecule 4 precursor	148	Extracellular (Potential).|Ig-like C2-type 1.				cell adhesion	integral to membrane					0		Prostate(69;0.0199)																---	---	---	---
SFRS16	11129	broad.mit.edu	37	19	45573322	45573322	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45573322C>T	uc002pak.2	+	19	2015	c.1917C>T	c.(1915-1917)CGC>CGT	p.R639R	SFRS16_uc002pal.2_RNA|SFRS16_uc010xxh.1_Silent_p.R577R|SFRS16_uc002pam.2_Silent_p.R620R	NM_007056	NP_008987	Q8N2M8	CLASR_HUMAN	splicing factor, arginine/serine-rich 16	639	Potential.|Arg-rich.				mRNA processing|RNA splicing	nucleus					0		Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0102)														---	---	---	---
MARK4	57787	broad.mit.edu	37	19	45797635	45797635	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45797635G>A	uc002pbb.1	+	14	1528	c.1523G>A	c.(1522-1524)CGC>CAC	p.R508H	MARK4_uc002pba.1_Missense_Mutation_p.R508H			Q96L34	MARK4_HUMAN	RecName: Full=MAP/microtubule affinity-regulating kinase 4;          EC=2.7.11.1; AltName: Full=MAP/microtubule affinity-regulating kinase-like 1;	508					microtubule bundle formation|nervous system development|positive regulation of programmed cell death	centrosome|neuron projection	ATP binding|gamma-tubulin binding|microtubule binding|protein serine/threonine kinase activity|tau-protein kinase activity|ubiquitin binding			central_nervous_system(2)|large_intestine(1)	3		all_neural(266;0.224)|Ovarian(192;0.231)		OV - Ovarian serous cystadenocarcinoma(262;0.0102)														---	---	---	---
IRF2BP1	26145	broad.mit.edu	37	19	46387358	46387358	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46387358C>T	uc002pds.1	-	1	2019	c.1675G>A	c.(1675-1677)GTG>ATG	p.V559M		NM_015649	NP_056464	Q8IU81	I2BP1_HUMAN	interferon regulatory factor 2 binding protein	559					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus					0		all_neural(266;0.113)|Ovarian(192;0.127)		OV - Ovarian serous cystadenocarcinoma(262;0.00442)|GBM - Glioblastoma multiforme(486;0.0402)|Epithelial(262;0.231)														---	---	---	---
PNMAL1	55228	broad.mit.edu	37	19	46973314	46973314	+	Missense_Mutation	SNP	C	T	T	rs146703714	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46973314C>T	uc002peq.3	-	2	1285	c.979G>A	c.(979-981)GAG>AAG	p.E327K	PNMAL1_uc002per.3_Missense_Mutation_p.E327K	NM_018215	NP_060685	Q86V59	PNML1_HUMAN	PNMA-like 1 isoform a	327											0		Ovarian(192;0.00965)|all_neural(266;0.0459)		OV - Ovarian serous cystadenocarcinoma(262;0.000166)|all cancers(93;0.0014)|GBM - Glioblastoma multiforme(486;0.0421)|Epithelial(262;0.0427)														---	---	---	---
MEIS3	56917	broad.mit.edu	37	19	47912499	47912499	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:47912499C>T	uc002pgu.2	-	8	1162	c.715G>A	c.(715-717)GGG>AGG	p.G239R	MEIS3_uc010xyp.1_5'Flank|MEIS3_uc002pgo.2_Missense_Mutation_p.G38R|MEIS3_uc002pgp.2_Missense_Mutation_p.G71R|MEIS3_uc002pgq.2_Missense_Mutation_p.G320R|MEIS3_uc002pgr.2_Missense_Mutation_p.G107R|MEIS3_uc002pgt.2_Missense_Mutation_p.G222R|MEIS3_uc002pgv.2_Missense_Mutation_p.G222R|MEIS3_uc002pgs.2_Missense_Mutation_p.G239R|MEIS3_uc010eld.2_Missense_Mutation_p.G239R	NM_001009813	NP_001009813	Q99687	MEIS3_HUMAN	Meis1, myeloid ecotropic viral integration site	239	Ser/Thr-rich.					nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0		all_cancers(25;1.65e-09)|all_epithelial(76;9.95e-08)|all_lung(116;7.27e-07)|Lung NSC(112;1.6e-06)|Ovarian(192;0.0139)|all_neural(266;0.026)|Breast(70;0.0503)		all cancers(93;0.000198)|OV - Ovarian serous cystadenocarcinoma(262;0.000439)|Epithelial(262;0.0113)|GBM - Glioblastoma multiforme(486;0.0223)														---	---	---	---
TMEM143	55260	broad.mit.edu	37	19	48845964	48845964	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:48845964C>T	uc002pix.1	-	6	807	c.798G>A	c.(796-798)CTG>CTA	p.L266L	TMEM143_uc002piw.1_Intron|TMEM143_uc002piy.1_Silent_p.L231L|TMEM143_uc010xzn.1_Silent_p.L201L|TMEM143_uc010elw.1_Silent_p.L166L|TMEM143_uc010xzo.1_Silent_p.L56L	NM_018273	NP_060743	Q96AN5	TM143_HUMAN	transmembrane protein 143	266						integral to membrane|mitochondrion					0		all_epithelial(76;9.64e-05)|all_lung(116;0.000147)|Lung NSC(112;0.000251)|Prostate(7;0.0187)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.000149)|all cancers(93;0.000198)|Epithelial(262;0.0151)|GBM - Glioblastoma multiforme(486;0.0157)														---	---	---	---
SPHK2	56848	broad.mit.edu	37	19	49132082	49132082	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49132082C>T	uc002pjr.2	+	7	1383	c.1017C>T	c.(1015-1017)TTC>TTT	p.F339F	SPHK2_uc010xzt.1_Silent_p.F280F|SPHK2_uc002pjs.2_Silent_p.F339F|SPHK2_uc002pjt.2_Silent_p.F133F|SPHK2_uc002pju.2_Intron|SPHK2_uc002pjv.2_Silent_p.F303F|SPHK2_uc002pjw.2_Silent_p.F401F	NM_020126	NP_064511	Q9NRA0	SPHK2_HUMAN	sphingosine kinase 2	339					activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|anti-apoptosis|cell proliferation|sphinganine-1-phosphate biosynthetic process	cytosol|lysosomal membrane|membrane fraction	ATP binding|D-erythro-sphingosine kinase activity|diacylglycerol kinase activity|Ras GTPase binding|sphinganine kinase activity			lung(1)	1		all_lung(116;0.000125)|Lung NSC(112;0.000202)|all_epithelial(76;0.000283)|all_neural(266;0.0506)|Ovarian(192;0.113)		OV - Ovarian serous cystadenocarcinoma(262;0.000102)|all cancers(93;0.000117)|GBM - Glioblastoma multiforme(486;0.00627)|Epithelial(262;0.0158)														---	---	---	---
FUT1	2523	broad.mit.edu	37	19	49253910	49253910	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49253910C>T	uc002pkk.2	-	4	1604	c.629G>A	c.(628-630)CGC>CAC	p.R210H		NM_000148	NP_000139	P19526	FUT1_HUMAN	fucosyltransferase 1	210	Lumenal (Potential).				L-fucose catabolic process|protein glycosylation	Golgi cisterna membrane|integral to plasma membrane|membrane fraction	galactoside 2-alpha-L-fucosyltransferase activity			ovary(1)	1		all_lung(116;1.7e-06)|all_epithelial(76;3.52e-06)|Lung NSC(112;3.55e-06)|all_neural(266;0.0189)|Ovarian(192;0.0261)		OV - Ovarian serous cystadenocarcinoma(262;0.000135)|all cancers(93;0.000354)|Epithelial(262;0.0191)|GBM - Glioblastoma multiforme(486;0.0222)														---	---	---	---
PPFIA3	8541	broad.mit.edu	37	19	49651461	49651461	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49651461A>G	uc002pmr.2	+	24	3289	c.2957A>G	c.(2956-2958)CAC>CGC	p.H986R	PPFIA3_uc010yai.1_RNA|PPFIA3_uc002pms.2_Missense_Mutation_p.H845R|PPFIA3_uc002pmt.2_Missense_Mutation_p.H125R|PPFIA3_uc002pmu.1_Missense_Mutation_p.H35R	NM_003660	NP_003651	O75145	LIPA3_HUMAN	PTPRF interacting protein alpha 3	986	SAM 2.					cell surface|cytoplasm	protein binding			lung(1)	1		all_lung(116;3.16e-06)|Lung NSC(112;6.25e-06)|all_neural(266;0.0189)|Ovarian(192;0.0392)		all cancers(93;2.36e-05)|OV - Ovarian serous cystadenocarcinoma(262;0.000203)|GBM - Glioblastoma multiforme(486;0.00307)|Epithelial(262;0.00677)														---	---	---	---
MED25	81857	broad.mit.edu	37	19	50332236	50332236	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50332236G>T	uc002ppw.1	+	5	467	c.414G>T	c.(412-414)ACG>ACT	p.T138T	MED25_uc010ybe.1_Intron|MED25_uc002ppx.1_5'Flank	NM_030973	NP_112235	Q71SY5	MED25_HUMAN	mediator complex subunit 25	138	Interaction with the Mediator complex.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm				ovary(1)	1		all_lung(116;3.24e-07)|Lung NSC(112;1.6e-06)|all_neural(266;0.0459)|Ovarian(192;0.0728)		OV - Ovarian serous cystadenocarcinoma(262;0.00822)|GBM - Glioblastoma multiforme(134;0.0122)														---	---	---	---
NUP62	23636	broad.mit.edu	37	19	50411536	50411536	+	Missense_Mutation	SNP	C	T	T	rs142980354		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50411536C>T	uc002pqx.2	-	2	1633	c.1529G>A	c.(1528-1530)CGC>CAC	p.R510H	IL4I1_uc002pqv.1_Intron|IL4I1_uc010eno.1_Intron|IL4I1_uc002pqw.1_Intron|IL4I1_uc002pqu.1_Intron|NUP62_uc002pqy.2_Missense_Mutation_p.R510H|NUP62_uc002pqz.2_Missense_Mutation_p.R510H|NUP62_uc002pra.2_Missense_Mutation_p.R510H|NUP62_uc002prb.2_Missense_Mutation_p.R510H|NUP62_uc002prc.2_Missense_Mutation_p.R434H	NM_153719	NP_714941	P37198	NUP62_HUMAN	nucleoporin 62kDa	510					carbohydrate metabolic process|cell death|cell surface receptor linked signaling pathway|glucose transport|hormone-mediated signaling pathway|mRNA transport|negative regulation of apoptosis|negative regulation of cell proliferation|nucleocytoplasmic transport|positive regulation of epidermal growth factor receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of transcription, DNA-dependent|protein transport|regulation of glucose transport|transcription, DNA-dependent|transmembrane transport|viral reproduction	cytoplasm|nuclear membrane|nuclear pore|nucleocytoplasmic shuttling complex|ribonucleoprotein complex|spindle pole	chromatin binding|protein serine/threonine kinase activity|receptor signaling complex scaffold activity|SH2 domain binding|structural constituent of nuclear pore|thyroid hormone receptor binding|ubiquitin binding				0		all_lung(116;1.47e-05)|all_neural(266;0.0459)|Ovarian(192;0.0481)		GBM - Glioblastoma multiforme(134;0.00242)|OV - Ovarian serous cystadenocarcinoma(262;0.0177)														---	---	---	---
POLD1	5424	broad.mit.edu	37	19	50918097	50918097	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50918097G>A	uc002psb.3	+	20	2470	c.2414G>A	c.(2413-2415)AGC>AAC	p.S805N	POLD1_uc002psc.3_Missense_Mutation_p.S805N|POLD1_uc010enx.2_RNA|POLD1_uc010eny.2_Missense_Mutation_p.S831N	NM_002691	NP_002682	P28340	DPOD1_HUMAN	DNA-directed DNA polymerase delta 1	805					base-excision repair, gap-filling|DNA replication proofreading|DNA replication, removal of RNA primer|DNA synthesis involved in DNA repair|nucleotide-excision repair, DNA gap filling|regulation of mitotic cell cycle|response to UV|S phase of mitotic cell cycle|telomere maintenance via recombination|telomere maintenance via semi-conservative replication|transcription-coupled nucleotide-excision repair	delta DNA polymerase complex|nucleoplasm|nucleotide-excision repair complex	3'-5'-exodeoxyribonuclease activity|chromatin binding|DNA binding|DNA-directed DNA polymerase activity|metal ion binding|nucleotide binding|protein binding			upper_aerodigestive_tract(1)|central_nervous_system(1)	2		all_neural(266;0.0571)		OV - Ovarian serous cystadenocarcinoma(262;0.00794)|GBM - Glioblastoma multiforme(134;0.0195)									DNA_polymerases_(catalytic_subunits)			OREG0025635	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
ZNF578	147660	broad.mit.edu	37	19	53015138	53015138	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53015138C>T	uc002pzp.3	+	6	1748	c.1504C>T	c.(1504-1506)CGT>TGT	p.R502C		NM_001099694	NP_001093164	Q96N58	ZN578_HUMAN	zinc finger protein 578	277	C2H2-type 10.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.00819)|OV - Ovarian serous cystadenocarcinoma(262;0.01)														---	---	---	---
ZNF415	55786	broad.mit.edu	37	19	53611976	53611976	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53611976T>C	uc002qax.2	-	7	1815	c.1466A>G	c.(1465-1467)AAG>AGG	p.K489R	ZNF415_uc002qat.2_Missense_Mutation_p.K453R|ZNF415_uc002qaw.2_Missense_Mutation_p.K441R|ZNF415_uc010yds.1_Missense_Mutation_p.K441R|ZNF415_uc010ydt.1_Missense_Mutation_p.K441R|ZNF415_uc002qau.2_Missense_Mutation_p.K428R|ZNF415_uc002qav.2_Missense_Mutation_p.K453R|ZNF415_uc002qba.2_Missense_Mutation_p.K211R|ZNF415_uc002qay.2_Missense_Mutation_p.K428R|ZNF415_uc002qaz.2_Missense_Mutation_p.K489R	NR_028343		Q09FC8	ZN415_HUMAN	RecName: Full=Zinc finger protein 415;	489	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|microtubule cytoskeleton|nucleolus	DNA binding|zinc ion binding			ovary(1)	1				GBM - Glioblastoma multiforme(134;0.0191)														---	---	---	---
VN1R4	317703	broad.mit.edu	37	19	53770718	53770718	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53770718T>C	uc010ydu.1	-	1	201	c.201A>G	c.(199-201)GCA>GCG	p.A67A		NM_173857	NP_776256	Q7Z5H5	VN1R4_HUMAN	vomeronasal 1 receptor 4	67	Helical; Name=2; (Potential).				response to pheromone	actin cytoskeleton|cytoplasm|integral to membrane|plasma membrane	pheromone receptor activity			ovary(2)	2				GBM - Glioblastoma multiforme(134;0.00294)											HNSCC(26;0.072)			---	---	---	---
LENG8	114823	broad.mit.edu	37	19	54967257	54967257	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54967257G>A	uc002qfv.1	+	8	1170	c.1026G>A	c.(1024-1026)CCG>CCA	p.P342P	LENG8_uc002qfw.2_Silent_p.P379P			Q96PV6	LENG8_HUMAN	RecName: Full=Leukocyte receptor cluster member 8;	342							protein binding			central_nervous_system(1)|pancreas(1)	2	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.139)														---	---	---	---
LILRB1	10859	broad.mit.edu	37	19	55144563	55144563	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55144563T>C	uc002qgj.2	+	8	1395	c.1055T>C	c.(1054-1056)ATG>ACG	p.M352T	LILRB1_uc010erp.1_Intron|LILRB1_uc002qgl.2_Missense_Mutation_p.M352T|LILRB1_uc002qgk.2_Missense_Mutation_p.M352T|LILRB1_uc002qgm.2_Missense_Mutation_p.M352T|LILRB1_uc010erq.2_Missense_Mutation_p.M352T|LILRB1_uc010err.2_RNA	NM_006669	NP_006660	Q8NHL6	LIRB1_HUMAN	leukocyte immunoglobulin-like receptor,	352	Ig-like C2-type 4.|Extracellular (Potential).				regulation of immune response|response to virus	integral to membrane|plasma membrane	protein phosphatase 1 binding|receptor activity			large_intestine(1)|ovary(1)|skin(1)	3				GBM - Glioblastoma multiforme(193;0.0188)											HNSCC(37;0.09)			---	---	---	---
PPP1R12C	54776	broad.mit.edu	37	19	55602837	55602837	+	3'UTR	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55602837G>T	uc002qix.2	-	22					PPP1R12C_uc010yfs.1_3'UTR|PPP1R12C_uc002qiy.2_3'UTR	NM_017607	NP_060077			protein phosphatase 1, regulatory subunit 12C							cytoplasm				ovary(1)|central_nervous_system(1)	2			BRCA - Breast invasive adenocarcinoma(297;0.209)	GBM - Glioblastoma multiforme(193;0.0449)														---	---	---	---
SYT5	6861	broad.mit.edu	37	19	55686555	55686555	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55686555C>T	uc002qjm.1	-	5	1753	c.693G>A	c.(691-693)GCG>GCA	p.A231A	SYT5_uc002qjp.2_Silent_p.A228A|SYT5_uc002qjn.1_Silent_p.A231A|SYT5_uc002qjo.1_Silent_p.A231A	NM_003180	NP_003171	O00445	SYT5_HUMAN	synaptotagmin V	231	Cytoplasmic (Potential).				energy reserve metabolic process|regulation of insulin secretion|synaptic transmission	cell junction|integral to membrane|recycling endosome membrane|synaptic vesicle membrane	metal ion binding|transporter activity				0			BRCA - Breast invasive adenocarcinoma(297;0.209)	GBM - Glioblastoma multiforme(193;0.0452)														---	---	---	---
ZNF628	89887	broad.mit.edu	37	19	55994335	55994335	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55994335G>A	uc002qld.2	+	3	2328	c.1763G>A	c.(1762-1764)CGG>CAG	p.R588Q	NAT14_uc002qle.1_5'Flank	NM_033113	NP_149104	Q5EBL2	ZN628_HUMAN	zinc finger protein 628	588						nucleus	DNA binding|zinc ion binding				0	Breast(117;0.155)		BRCA - Breast invasive adenocarcinoma(297;0.18)|LUSC - Lung squamous cell carcinoma(43;0.193)	GBM - Glioblastoma multiforme(193;0.0531)														---	---	---	---
ZNF543	125919	broad.mit.edu	37	19	57839961	57839961	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57839961C>T	uc002qoi.1	+	4	1476	c.1131C>T	c.(1129-1131)TGC>TGT	p.C377C		NM_213598	NP_998763	Q08ER8	ZN543_HUMAN	zinc finger protein 543	377	C2H2-type 7.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)|pancreas(1)	2		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.221)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0257)														---	---	---	---
ZNF671	79891	broad.mit.edu	37	19	58232616	58232616	+	Missense_Mutation	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58232616T>C	uc002qpz.3	-	4	937	c.838A>G	c.(838-840)ATG>GTG	p.M280V	ZNF776_uc002qpx.2_Intron|ZNF671_uc010eug.2_Missense_Mutation_p.M203V|ZNF671_uc010yhf.1_Missense_Mutation_p.M182V	NM_024833	NP_079109	Q8TAW3	ZN671_HUMAN	zinc finger protein 671	280					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0257)														---	---	---	---
ZSCAN1	284312	broad.mit.edu	37	19	58565272	58565272	+	Silent	SNP	C	T	T	rs144381428		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58565272C>T	uc002qrc.1	+	6	1327	c.1080C>T	c.(1078-1080)TCC>TCT	p.S360S		NM_182572	NP_872378	Q8NBB4	ZSCA1_HUMAN	zinc finger and SCAN domain containing 1	360					viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2		Colorectal(82;5.46e-05)|all_neural(62;0.0182)|Breast(46;0.0389)|Ovarian(87;0.0443)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0152)														---	---	---	---
MZF1	7593	broad.mit.edu	37	19	59074394	59074394	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:59074394C>A	uc002qto.2	-	6	1811	c.1250G>T	c.(1249-1251)TGT>TTT	p.C417F	LOC100131691_uc002qtm.2_Intron|MZF1_uc002qtn.2_Missense_Mutation_p.C417F	NM_198055	NP_932172	P28698	MZF1_HUMAN	zinc finger protein 42 isoform 2	417	C2H2-type 3.				viral reproduction	nucleus	protein homodimerization activity|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(1)	1		all_cancers(17;4.4e-22)|all_epithelial(17;2.15e-16)|Lung NSC(17;1.24e-06)|all_lung(17;5.41e-06)|Colorectal(82;3.46e-05)|Renal(17;0.00179)|all_neural(62;0.00607)|Ovarian(87;0.0443)|Breast(46;0.0928)|Medulloblastoma(540;0.184)		UCEC - Uterine corpus endometrioid carcinoma (67;0.0443)|all cancers(4;7.92e-14)|Epithelial(4;5.57e-11)|OV - Ovarian serous cystadenocarcinoma(4;1.13e-09)|GBM - Glioblastoma multiforme(193;0.0108)|Lung(386;0.182)														---	---	---	---
NSFL1C	55968	broad.mit.edu	37	20	1444988	1444988	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:1444988T>C	uc002wfc.2	-	2	1137	c.189A>G	c.(187-189)AGA>AGG	p.R63R	NSFL1C_uc002wfd.2_Intron|NSFL1C_uc002wfe.2_Silent_p.R63R|NSFL1C_uc002wff.2_RNA	NM_016143	NP_057227	Q9UNZ2	NSF1C_HUMAN	p47 protein isoform a	63						chromosome|Golgi stack|nucleus	lipid binding|protein binding				0																		---	---	---	---
C20orf194	25943	broad.mit.edu	37	20	3362099	3362099	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3362099A>G	uc002wii.2	-	3	261	c.210T>C	c.(208-210)TAT>TAC	p.Y70Y	C20orf194_uc010gay.1_RNA	NM_001009984	NP_001009984	Q5TEA3	CT194_HUMAN	hypothetical protein LOC25943	70											0																		---	---	---	---
PANK2	80025	broad.mit.edu	37	20	3897602	3897602	+	Nonsense_Mutation	SNP	C	T	T	rs137852968		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:3897602C>T	uc002wkc.2	+	5	1447	c.1441C>T	c.(1441-1443)CGA>TGA	p.R481*	PANK2_uc002wkb.2_Nonsense_Mutation_p.R190*|PANK2_uc002wkd.2_RNA|PANK2_uc002wke.2_Nonsense_Mutation_p.R190*|PANK2_uc002wkf.2_Nonsense_Mutation_p.R45*|uc002wkg.2_5'Flank|MIR103-2_hsa-mir-103-2|MI0000108_5'Flank	NM_153638	NP_705902	Q9BZ23	PANK2_HUMAN	pantothenate kinase 2 isoform 1 preproprotein	481					cell death|coenzyme A biosynthetic process|pantothenate metabolic process	mitochondrial intermembrane space|nucleus	ATP binding|pantothenate kinase activity|protein binding				0																		---	---	---	---
RASSF2	9770	broad.mit.edu	37	20	4776521	4776521	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:4776521C>T	uc002wld.2	-	4	281	c.227G>A	c.(226-228)CGC>CAC	p.R76H	RASSF2_uc002wlc.2_5'Flank|RASSF2_uc002wle.2_RNA|RASSF2_uc002wlf.2_Missense_Mutation_p.R76H	NM_170774	NP_739580	P50749	RASF2_HUMAN	Ras association domain family 2	76					cell cycle|signal transduction	nucleus	protein binding			ovary(3)|lung(2)|large_intestine(1)	6																		---	---	---	---
C20orf7	79133	broad.mit.edu	37	20	13773858	13773858	+	Silent	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:13773858T>C	uc002wom.2	+	4	393	c.360T>C	c.(358-360)ATT>ATC	p.I120I	C20orf7_uc002wol.1_Silent_p.I120I|C20orf7_uc002won.2_Missense_Mutation_p.L127S|C20orf7_uc002woo.2_RNA	NM_024120	NP_077025	Q5TEU4	CT007_HUMAN	hypothetical protein LOC79133 isoform 1	120					mitochondrial respiratory chain complex I assembly	extrinsic to mitochondrial inner membrane	methyltransferase activity				0		Myeloproliferative disorder(85;0.00878)																---	---	---	---
OTOR	56914	broad.mit.edu	37	20	16729076	16729076	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:16729076G>A	uc002wpj.2	+	1	74	c.30G>A	c.(28-30)CCG>CCA	p.P10P	OTOR_uc002wpk.2_5'Flank	NM_020157	NP_064542	Q9NRC9	OTOR_HUMAN	otoraplin precursor	10					sensory perception of sound	extracellular region				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
DSTN	11034	broad.mit.edu	37	20	17587777	17587777	+	Nonsense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:17587777G>T	uc002wpr.2	+	4	739	c.484G>T	c.(484-486)GGA>TGA	p.G162*	DSTN_uc002wpq.2_Nonsense_Mutation_p.G145*|DSTN_uc010gck.2_Nonsense_Mutation_p.G145*	NM_006870	NP_006861	P60981	DEST_HUMAN	destrin isoform a	162					actin filament severing|actin polymerization or depolymerization		actin binding			large_intestine(1)|skin(1)	2																		---	---	---	---
C20orf12	55184	broad.mit.edu	37	20	18434563	18434563	+	Intron	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:18434563C>A	uc010zsa.1	-						C20orf12_uc002wqr.3_Intron|C20orf12_uc002wqs.3_Intron|C20orf12_uc002wqq.3_Intron|C20orf12_uc002wqu.1_Intron|C20orf12_uc010gct.1_Intron	NM_001099407	NP_001092877			hypothetical protein LOC55184							intracellular	zinc ion binding			ovary(1)	1		Myeloproliferative disorder(85;0.0122)																---	---	---	---
CD93	22918	broad.mit.edu	37	20	23065495	23065495	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:23065495G>A	uc002wsv.2	-	1	1483	c.1335C>T	c.(1333-1335)AAC>AAT	p.N445N		NM_012072	NP_036204	Q9NPY3	C1QR1_HUMAN	CD93 antigen precursor	445	Extracellular (Potential).|EGF-like 5; calcium-binding (Potential).				cell-cell adhesion|interspecies interaction between organisms|macrophage activation|phagocytosis	plasma membrane	calcium ion binding|complement component C1q binding|receptor activity|sugar binding			large_intestine(2)	2	Colorectal(13;0.0352)|Lung NSC(19;0.0542)|all_lung(19;0.118)																	---	---	---	---
GZF1	64412	broad.mit.edu	37	20	23346303	23346303	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:23346303C>T	uc010gdb.2	+	3	1457	c.1283C>T	c.(1282-1284)ACA>ATA	p.T428I	GZF1_uc002wsy.2_Missense_Mutation_p.T428I|GZF1_uc010zsq.1_Intron|GZF1_uc010zsr.1_Intron|GZF1_uc002wsz.2_Missense_Mutation_p.T428I	NM_022482	NP_071927	Q9H116	GZF1_HUMAN	GDNF-inducible zinc finger protein 1	428	C2H2-type 4.				transcription, DNA-dependent	nucleolus|nucleoplasm	sequence-specific DNA binding|zinc ion binding			kidney(1)	1	Lung NSC(19;0.0605)|Colorectal(13;0.0993)|all_lung(19;0.135)																	---	---	---	---
NINL	22981	broad.mit.edu	37	20	25478840	25478840	+	Intron	SNP	T	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:25478840T>C	uc002wux.1	-						NINL_uc010gdn.1_Intron|NINL_uc010gdo.1_Intron|NINL_uc010ztf.1_Intron	NM_025176	NP_079452			ninein-like						G2/M transition of mitotic cell cycle	cytosol|microtubule|microtubule organizing center	calcium ion binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5																		---	---	---	---
C20orf185	359710	broad.mit.edu	37	20	31656644	31656644	+	Silent	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31656644A>G	uc002wym.1	+	10	1014	c.1014A>G	c.(1012-1014)CTA>CTG	p.L338L		NM_182658	NP_872599	P59826	LPLC3_HUMAN	antimicrobial peptide RYA3 precursor	338					innate immune response	cytoplasm|extracellular region	lipid binding|protein binding			ovary(4)	4																		---	---	---	---
C20orf185	359710	broad.mit.edu	37	20	31661412	31661412	+	3'UTR	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:31661412G>T	uc002wym.1	+	15						NM_182658	NP_872599			antimicrobial peptide RYA3 precursor						innate immune response	cytoplasm|extracellular region	lipid binding|protein binding			ovary(4)	4																		---	---	---	---
CPNE1	8904	broad.mit.edu	37	20	34214277	34214277	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34214277G>A	uc002xdf.2	-	18	1863	c.1500C>T	c.(1498-1500)ACC>ACT	p.T500T	CPNE1_uc002xdc.2_Silent_p.T162T|CPNE1_uc010zvj.1_Silent_p.T505T|CPNE1_uc002xde.2_Silent_p.T476T|CPNE1_uc002xdg.2_Silent_p.T444T|CPNE1_uc010gfi.2_RNA|CPNE1_uc010gfj.2_RNA|CPNE1_uc002xdh.2_Silent_p.T500T|CPNE1_uc002xdi.2_Silent_p.T500T|CPNE1_uc002xdj.2_Silent_p.T500T|CPNE1_uc002xdk.2_Silent_p.T500T|CPNE1_uc002xdl.2_Silent_p.T500T|CPNE1_uc002xdm.2_Silent_p.T500T	NM_152931	NP_690908	Q99829	CPNE1_HUMAN	copine I isoform a	500	VWFA.				lipid metabolic process|vesicle-mediated transport		calcium-dependent phospholipid binding|phosphatidylserine binding|transporter activity			upper_aerodigestive_tract(1)	1	Lung NSC(9;0.0053)|all_lung(11;0.00785)		BRCA - Breast invasive adenocarcinoma(18;0.00953)															---	---	---	---
RBL1	5933	broad.mit.edu	37	20	35668582	35668582	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35668582C>T	uc002xgi.2	-	14	1956	c.1877G>A	c.(1876-1878)CGA>CAA	p.R626Q	RBL1_uc010zvt.1_RNA|RBL1_uc002xgj.1_Missense_Mutation_p.R626Q	NM_002895	NP_002886	P28749	RBL1_HUMAN	retinoblastoma-like protein 1 isoform a	626	Pocket; binds T and E1A.|Spacer.				cell cycle|chromatin modification|interspecies interaction between organisms|regulation of cell cycle|regulation of lipid kinase activity|transcription, DNA-dependent		transcription factor binding			lung(5)|skin(3)|ovary(2)	10		Myeloproliferative disorder(115;0.00878)																---	---	---	---
PLCG1	5335	broad.mit.edu	37	20	39791364	39791364	+	Missense_Mutation	SNP	C	T	T	rs141297485		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:39791364C>T	uc002xjp.1	+	6	801	c.680C>T	c.(679-681)ACG>ATG	p.T227M	PLCG1_uc002xjo.1_Missense_Mutation_p.T227M|PLCG1_uc010zwe.1_5'Flank	NM_182811	NP_877963	P19174	PLCG1_HUMAN	phospholipase C, gamma 1 isoform b	227					activation of phospholipase C activity|axon guidance|blood coagulation|cellular response to epidermal growth factor stimulus|epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|interspecies interaction between organisms|intracellular signal transduction|leukocyte migration|nerve growth factor receptor signaling pathway|phospholipid catabolic process|positive regulation of angiogenesis|positive regulation of blood vessel endothelial cell migration|positive regulation of epithelial cell migration|T cell receptor signaling pathway	cytosol|lamellipodium|plasma membrane|ruffle	calcium ion binding|phosphatidylinositol phospholipase C activity|protein binding|receptor signaling protein activity			lung(3)|breast(3)|skin(2)	8		Myeloproliferative disorder(115;0.00878)																---	---	---	---
KCNK15	60598	broad.mit.edu	37	20	43379051	43379051	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43379051G>A	uc002xmr.2	+	2	629	c.565G>A	c.(565-567)GCC>ACC	p.A189T		NM_022358	NP_071753	Q9H427	KCNKF_HUMAN	potassium family, subfamily K, member 15	189						integral to membrane	potassium channel activity|voltage-gated ion channel activity				0		Myeloproliferative disorder(115;0.0122)																---	---	---	---
MATN4	8785	broad.mit.edu	37	20	43926646	43926646	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43926646C>T	uc002xnn.2	-	8	1678	c.1491G>A	c.(1489-1491)TCG>TCA	p.S497S	MATN4_uc002xno.2_Silent_p.S456S|MATN4_uc002xnp.2_Silent_p.S415S|MATN4_uc010zwr.1_Silent_p.S445S|MATN4_uc002xnr.1_Silent_p.S497S	NM_003833	NP_003824	O95460	MATN4_HUMAN	matrilin 4 isoform 1 precursor	538	VWFA 2.					extracellular region	protein binding				0		Myeloproliferative disorder(115;0.0122)																---	---	---	---
MATN4	8785	broad.mit.edu	37	20	43926973	43926973	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43926973G>A	uc002xnn.2	-	7	1450	c.1263C>T	c.(1261-1263)GGC>GGT	p.G421G	MATN4_uc002xno.2_Silent_p.G380G|MATN4_uc002xnp.2_Silent_p.G339G|MATN4_uc010zwr.1_Silent_p.G369G|MATN4_uc002xnr.1_Silent_p.G421G	NM_003833	NP_003824	O95460	MATN4_HUMAN	matrilin 4 isoform 1 precursor	462	VWFA 2.					extracellular region	protein binding				0		Myeloproliferative disorder(115;0.0122)																---	---	---	---
TP53TG5	27296	broad.mit.edu	37	20	44003782	44003782	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44003782G>A	uc002xny.2	-	4	746	c.665C>T	c.(664-666)GCG>GTG	p.A222V	SYS1_uc002xnw.1_3'UTR|SYS1-DBNDD2_uc002xnx.2_Intron	NM_014477	NP_055292	Q9Y2B4	T53G5_HUMAN	TP53-target gene 5 protein	222					intracellular signal transduction|negative regulation of cell growth	cytoplasm|nucleus				central_nervous_system(1)	1																		---	---	---	---
PCIF1	63935	broad.mit.edu	37	20	44569462	44569462	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44569462G>A	uc002xqs.2	+	6	716	c.402G>A	c.(400-402)GTG>GTA	p.V134V		NM_022104	NP_071387	Q9H4Z3	PCIF1_HUMAN	phosphorylated CTD interacting factor 1	134						nucleus				skin(1)	1																		---	---	---	---
ZMYND8	23613	broad.mit.edu	37	20	45905096	45905096	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:45905096G>A	uc002xta.1	-	11	1636	c.1382C>T	c.(1381-1383)GCG>GTG	p.A461V	ZMYND8_uc010ghq.1_Missense_Mutation_p.A138V|ZMYND8_uc010ghr.1_Missense_Mutation_p.A436V|ZMYND8_uc002xst.1_Missense_Mutation_p.A436V|ZMYND8_uc002xsu.1_Missense_Mutation_p.A461V|ZMYND8_uc002xsv.1_Missense_Mutation_p.A436V|ZMYND8_uc002xsw.1_Missense_Mutation_p.A213V|ZMYND8_uc002xsx.1_Missense_Mutation_p.A213V|ZMYND8_uc002xsy.1_Missense_Mutation_p.A436V|ZMYND8_uc002xsz.1_Missense_Mutation_p.A398V|ZMYND8_uc010zxy.1_Missense_Mutation_p.A488V|ZMYND8_uc002xtb.1_Missense_Mutation_p.A481V|ZMYND8_uc002xss.2_Missense_Mutation_p.A461V|ZMYND8_uc010zxz.1_Missense_Mutation_p.A456V|ZMYND8_uc002xtc.1_Missense_Mutation_p.A481V|ZMYND8_uc002xtd.1_Missense_Mutation_p.A456V|ZMYND8_uc002xte.1_Missense_Mutation_p.A461V|ZMYND8_uc010zya.1_Missense_Mutation_p.A461V|ZMYND8_uc002xtf.1_Missense_Mutation_p.A481V|ZMYND8_uc002xtg.2_Missense_Mutation_p.A455V|ZMYND8_uc010ghs.1_Missense_Mutation_p.A455V	NM_012408	NP_036540	Q9ULU4	PKCB1_HUMAN	zinc finger, MYND-type containing 8 isoform b	461							protein binding|zinc ion binding			central_nervous_system(2)|urinary_tract(1)|ovary(1)|skin(1)	5			Epithelial(1;0.0289)|all cancers(1;0.0962)|OV - Ovarian serous cystadenocarcinoma(1;0.154)															---	---	---	---
PREX1	57580	broad.mit.edu	37	20	47266655	47266655	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47266655G>T	uc002xtw.1	-	24	2930	c.2907C>A	c.(2905-2907)CCC>CCA	p.P969P	PREX1_uc002xtv.1_Silent_p.P266P	NM_020820	NP_065871	Q8TCU6	PREX1_HUMAN	phosphatidylinositol-3,4,	969					actin filament polymerization|apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|neutrophil activation|small GTPase mediated signal transduction|superoxide metabolic process	cytosol|plasma membrane	enzyme binding|phospholipid binding|Rho GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			lung(3)|ovary(2)|pancreas(1)	6			BRCA - Breast invasive adenocarcinoma(12;0.0135)|Colorectal(8;0.198)															---	---	---	---
STAU1	6780	broad.mit.edu	37	20	47734382	47734382	+	Missense_Mutation	SNP	C	T	T	rs146630196		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47734382C>T	uc002xud.2	-	11	1852	c.1441G>A	c.(1441-1443)GTA>ATA	p.V481I	STAU1_uc002xua.2_Missense_Mutation_p.V400I|STAU1_uc002xub.2_Missense_Mutation_p.V406I|STAU1_uc002xuc.2_Missense_Mutation_p.V400I|STAU1_uc002xue.2_Missense_Mutation_p.V400I|STAU1_uc002xuf.2_Missense_Mutation_p.V406I|STAU1_uc002xug.2_Missense_Mutation_p.V481I	NM_017453	NP_059347	O95793	STAU1_HUMAN	staufen isoform b	481						microtubule associated complex|rough endoplasmic reticulum|stress granule	double-stranded RNA binding			ovary(4)|kidney(1)	5			BRCA - Breast invasive adenocarcinoma(12;0.000644)|Colorectal(8;0.198)															---	---	---	---
KCNG1	3755	broad.mit.edu	37	20	49626173	49626173	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:49626173G>A	uc002xwa.3	-	2	998	c.703C>T	c.(703-705)CTC>TTC	p.L235F	KCNG1_uc002xwb.2_Missense_Mutation_p.L235F	NM_002237	NP_002228	Q9UIX4	KCNG1_HUMAN	potassium voltage-gated channel, subfamily G,	235	Helical; Name=Segment S1; (Potential).					voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(1)|central_nervous_system(1)	2																		---	---	---	---
CASS4	57091	broad.mit.edu	37	20	55033652	55033652	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:55033652G>A	uc002xxp.2	+	7	2435	c.2210G>A	c.(2209-2211)AGC>AAC	p.S737N	CASS4_uc002xxr.2_Missense_Mutation_p.S737N|CASS4_uc010zze.1_Missense_Mutation_p.S683N|CASS4_uc010gio.2_Missense_Mutation_p.S300N	NM_001164116	NP_001157588	Q9NQ75	CASS4_HUMAN	HEF-like protein isoform a	737					cell adhesion	cytoplasm|cytoskeleton|focal adhesion	two-component sensor activity			ovary(2)|skin(1)	3																		---	---	---	---
BMP7	655	broad.mit.edu	37	20	55803373	55803373	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:55803373G>T	uc010gip.1	-	2	1052	c.523C>A	c.(523-525)CGG>AGG	p.R175R	BMP7_uc010giq.1_Silent_p.R175R|BMP7_uc002xyc.2_Silent_p.R175R	NM_001719	NP_001710	P18075	BMP7_HUMAN	bone morphogenetic protein 7 precursor	175					BMP signaling pathway|cartilage development|cellular response to hypoxia|epithelial to mesenchymal transition|growth|mesonephros development|negative regulation of glomerular mesangial cell proliferation|negative regulation of MAP kinase activity|negative regulation of mitosis|negative regulation of neuron differentiation|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|negative regulation of phosphorylation|negative regulation of striated muscle cell apoptosis|negative regulation of transcription, DNA-dependent|ossification|pathway-restricted SMAD protein phosphorylation|positive regulation of bone mineralization|positive regulation of osteoblast differentiation|positive regulation of pathway-restricted SMAD protein phosphorylation|protein localization to nucleus|regulation of removal of superoxide radicals|SMAD protein signal transduction|steroid hormone mediated signaling pathway|ureteric bud development	extracellular space	cytokine activity|growth factor activity			skin(1)	1	all_lung(29;0.0133)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(4;2.49e-13)|Epithelial(14;1.74e-08)|all cancers(14;2.05e-07)															---	---	---	---
BMP7	655	broad.mit.edu	37	20	55840772	55840772	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:55840772A>G	uc010gip.1	-	1	936	c.407T>C	c.(406-408)TTC>TCC	p.F136S	BMP7_uc010giq.1_Missense_Mutation_p.F136S|BMP7_uc002xyc.2_Missense_Mutation_p.F136S|uc010gir.1_5'Flank	NM_001719	NP_001710	P18075	BMP7_HUMAN	bone morphogenetic protein 7 precursor	136					BMP signaling pathway|cartilage development|cellular response to hypoxia|epithelial to mesenchymal transition|growth|mesonephros development|negative regulation of glomerular mesangial cell proliferation|negative regulation of MAP kinase activity|negative regulation of mitosis|negative regulation of neuron differentiation|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|negative regulation of phosphorylation|negative regulation of striated muscle cell apoptosis|negative regulation of transcription, DNA-dependent|ossification|pathway-restricted SMAD protein phosphorylation|positive regulation of bone mineralization|positive regulation of osteoblast differentiation|positive regulation of pathway-restricted SMAD protein phosphorylation|protein localization to nucleus|regulation of removal of superoxide radicals|SMAD protein signal transduction|steroid hormone mediated signaling pathway|ureteric bud development	extracellular space	cytokine activity|growth factor activity			skin(1)	1	all_lung(29;0.0133)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(4;2.49e-13)|Epithelial(14;1.74e-08)|all cancers(14;2.05e-07)															---	---	---	---
ZNF831	128611	broad.mit.edu	37	20	57769496	57769496	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:57769496A>G	uc002yan.2	+	1	3422	c.3422A>G	c.(3421-3423)CAG>CGG	p.Q1141R		NM_178457	NP_848552	Q5JPB2	ZN831_HUMAN	zinc finger protein 831	1141						intracellular	nucleic acid binding|zinc ion binding			skin(13)|ovary(1)	14	all_lung(29;0.0085)																	---	---	---	---
PHACTR3	116154	broad.mit.edu	37	20	58348498	58348498	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:58348498C>T	uc002yau.2	+	6	1383	c.916C>T	c.(916-918)CGC>TGC	p.R306C	PHACTR3_uc002yat.2_Missense_Mutation_p.R303C|PHACTR3_uc010zzw.1_Missense_Mutation_p.R265C|PHACTR3_uc002yav.2_Missense_Mutation_p.R265C|PHACTR3_uc002yaw.2_Missense_Mutation_p.R265C|PHACTR3_uc002yax.2_Missense_Mutation_p.R195C	NM_080672	NP_542403	Q96KR7	PHAR3_HUMAN	phosphatase and actin regulator 3 isoform 1	306						nuclear matrix	actin binding|protein phosphatase inhibitor activity			ovary(2)|pancreas(1)	3	all_lung(29;0.00344)		BRCA - Breast invasive adenocarcinoma(7;2.76e-09)															---	---	---	---
CDH4	1002	broad.mit.edu	37	20	60503309	60503309	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:60503309C>T	uc002ybn.1	+	12	1847	c.1833C>T	c.(1831-1833)AAC>AAT	p.N611N	CDH4_uc002ybp.1_Silent_p.N537N	NM_001794	NP_001785	P55283	CADH4_HUMAN	cadherin 4, type 1 preproprotein	611	Cadherin 4.|Extracellular (Potential).				adherens junction organization|cell junction assembly		calcium ion binding			lung(3)|ovary(2)|skin(1)	6			BRCA - Breast invasive adenocarcinoma(19;2.36e-08)															---	---	---	---
LAMA5	3911	broad.mit.edu	37	20	60904112	60904112	+	Splice_Site	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:60904112C>T	uc002ycq.2	-	34	4303	c.4236_splice	c.e34-1	p.S1412_splice		NM_005560	NP_005551			laminin alpha 5 precursor						angiogenesis|cell proliferation|cell recognition|cytoskeleton organization|endothelial cell differentiation|focal adhesion assembly|integrin-mediated signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development|substrate adhesion-dependent cell spreading	extracellular space|laminin-1 complex|laminin-10 complex|laminin-11 complex	integrin binding			ovary(1)|pancreas(1)|skin(1)	3	Breast(26;1.57e-08)		BRCA - Breast invasive adenocarcinoma(19;4.36e-06)		Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---
COL20A1	57642	broad.mit.edu	37	20	61959716	61959716	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61959716A>G	uc011aau.1	+	34	3747	c.3647A>G	c.(3646-3648)AAC>AGC	p.N1216S	COL20A1_uc011aav.1_Missense_Mutation_p.N1043S	NM_020882	NP_065933	Q9P218	COKA1_HUMAN	collagen, type XX, alpha 1	1216					cell adhesion	collagen|extracellular space	structural molecule activity			central_nervous_system(1)	1	all_cancers(38;1.39e-10)																	---	---	---	---
EEF1A2	1917	broad.mit.edu	37	20	62126345	62126345	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62126345A>G	uc002yfd.1	-	3	535	c.434T>C	c.(433-435)GTG>GCG	p.V145A	EEF1A2_uc002yfe.1_Missense_Mutation_p.V145A|EEF1A2_uc010gkg.1_Missense_Mutation_p.V145A	NM_001958	NP_001949	Q05639	EF1A2_HUMAN	eukaryotic translation elongation factor 1 alpha	145						nucleus	GTP binding|GTPase activity|protein binding|translation elongation factor activity				0	all_cancers(38;9.45e-12)		BRCA - Breast invasive adenocarcinoma(10;1.22e-05)															---	---	---	---
SON	6651	broad.mit.edu	37	21	34921957	34921957	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:34921957G>A	uc002yse.1	+	3	469	c.420G>A	c.(418-420)ACG>ACA	p.T140T	SON_uc002ysb.1_Silent_p.T140T|SON_uc002ysc.2_Silent_p.T140T|SON_uc002ysd.2_5'UTR|SON_uc002ysf.1_Intron|SON_uc002ysg.2_5'Flank	NM_138927	NP_620305	P18583	SON_HUMAN	SON DNA-binding protein isoform F	140					anti-apoptosis|cytokinesis|mRNA processing|regulation of cell cycle|regulation of RNA splicing|RNA splicing|spindle pole body separation	nuclear speck	DNA binding|double-stranded RNA binding			ovary(4)|skin(2)	6																OREG0003562	type=REGULATORY REGION|Gene=AK091233|Dataset=Stanford ENCODE Dataset|EvidenceSubtype=Transient transfection luciferase assay	---	---	---	---
DOPEY2	9980	broad.mit.edu	37	21	37597930	37597930	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:37597930G>A	uc002yvg.2	+	12	1517	c.1438G>A	c.(1438-1440)GCC>ACC	p.A480T	DOPEY2_uc011aeb.1_Missense_Mutation_p.A480T	NM_005128	NP_005119	Q9Y3R5	DOP2_HUMAN	pad-1-like	480					endoplasmic reticulum organization|Golgi to endosome transport|multicellular organismal development|protein transport	Golgi membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
DOPEY2	9980	broad.mit.edu	37	21	37603085	37603085	+	Missense_Mutation	SNP	C	T	T	rs143591918		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:37603085C>T	uc002yvg.2	+	14	2082	c.2003C>T	c.(2002-2004)ACG>ATG	p.T668M	DOPEY2_uc011aeb.1_Missense_Mutation_p.T668M	NM_005128	NP_005119	Q9Y3R5	DOP2_HUMAN	pad-1-like	668					endoplasmic reticulum organization|Golgi to endosome transport|multicellular organismal development|protein transport	Golgi membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
ZNF295	49854	broad.mit.edu	37	21	43411449	43411449	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:43411449G>A	uc002zab.3	-	3	2970	c.2756C>T	c.(2755-2757)ACG>ATG	p.T919M	ZNF295_uc002yzz.3_Missense_Mutation_p.T718M|ZNF295_uc002yzy.3_Missense_Mutation_p.T919M|ZNF295_uc002zaa.3_Missense_Mutation_p.T919M	NM_001098402	NP_001091872	Q9ULJ3	ZN295_HUMAN	zinc finger protein 295 isoform L	919	C2H2-type 6; atypical.				negative regulation of transcription, DNA-dependent|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus|nucleus	methyl-CpG binding|protein binding|zinc ion binding	p.T919P(1)		ovary(1)|central_nervous_system(1)|skin(1)	3																		---	---	---	---
RSPH1	89765	broad.mit.edu	37	21	43897412	43897412	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:43897412G>A	uc002zbg.2	-	7	821	c.716C>T	c.(715-717)CCA>CTA	p.P239L		NM_080860	NP_543136	Q8WYR4	RSPH1_HUMAN	testis-specific gene A2	239					meiosis	cytosol|nucleus				ovary(1)	1																		---	---	---	---
PDXK	8566	broad.mit.edu	37	21	45175603	45175603	+	Missense_Mutation	SNP	A	G	G	rs145229797	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45175603A>G	uc002zdm.3	+	10	982	c.784A>G	c.(784-786)ACC>GCC	p.T262A	PDXK_uc010gpj.2_Intron|PDXK_uc002zdn.3_Missense_Mutation_p.T234A|PDXK_uc002zdq.3_Missense_Mutation_p.T189A	NM_003681	NP_003672	O00764	PDXK_HUMAN	pyridoxal kinase	262					cell proliferation|pyridoxal 5'-phosphate salvage	cytosol	ATP binding|lithium ion binding|magnesium ion binding|potassium ion binding|protein homodimerization activity|pyridoxal kinase activity|pyridoxal phosphate binding|sodium ion binding|zinc ion binding				0				Colorectal(79;0.109)|READ - Rectum adenocarcinoma(84;0.161)|STAD - Stomach adenocarcinoma(101;0.18)	Pyridoxal(DB00147)|Pyridoxine(DB00165)													---	---	---	---
TRPM2	7226	broad.mit.edu	37	21	45833838	45833838	+	Silent	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45833838C>A	uc002zet.1	+	21	3240	c.3027C>A	c.(3025-3027)CCC>CCA	p.P1009P	TRPM2_uc002zeu.1_Silent_p.P1009P|TRPM2_uc002zew.1_Silent_p.P1009P|TRPM2_uc010gpt.1_Silent_p.P1009P|TRPM2_uc002zex.1_Silent_p.P795P|TRPM2_uc002zey.1_Silent_p.P522P	NM_003307	NP_003298	O94759	TRPM2_HUMAN	transient receptor potential cation channel,	1009	Extracellular (Potential).					integral to plasma membrane	ADP-ribose diphosphatase activity|calcium channel activity|sodium channel activity			ovary(1)|central_nervous_system(1)|pancreas(1)	3																		---	---	---	---
COL18A1	80781	broad.mit.edu	37	21	46932171	46932171	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:46932171G>A	uc011afs.1	+	42	5136	c.5115G>A	c.(5113-5115)ACG>ACA	p.T1705T	COL18A1_uc002zhg.2_Silent_p.T1290T|COL18A1_uc002zhi.2_Silent_p.T1470T|SLC19A1_uc010gpy.1_Intron|COL18A1_uc002zhj.2_Silent_p.T271T|COL18A1_uc002zhk.2_Silent_p.T115T	NM_130444	NP_569711	P39060	COIA1_HUMAN	alpha 1 type XVIII collagen isoform 3 precursor	1708	Nonhelical region 11 (NC11).				cell adhesion|negative regulation of cell proliferation|organ morphogenesis|visual perception	collagen|extracellular space	extracellular matrix structural constituent|metal ion binding|protein binding			central_nervous_system(1)	1				Colorectal(79;0.0157)|READ - Rectum adenocarcinoma(84;0.0929)														---	---	---	---
PCNT	5116	broad.mit.edu	37	21	47855992	47855992	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:47855992A>G	uc002zji.3	+	39	9034	c.8927A>G	c.(8926-8928)GAG>GGG	p.E2976G	PCNT_uc002zjj.2_Missense_Mutation_p.E2779G	NM_006031	NP_006022	O95613	PCNT_HUMAN	pericentrin	2976	Potential.				cilium assembly|G2/M transition of mitotic cell cycle	cytosol|microtubule	calmodulin binding			ovary(4)|breast(2)|pancreas(2)	8	Breast(49;0.112)																	---	---	---	---
MICAL3	57553	broad.mit.edu	37	22	18300751	18300751	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:18300751G>A	uc002zng.3	-	26	5029	c.4676C>T	c.(4675-4677)CCG>CTG	p.P1559L	MICAL3_uc011agl.1_Missense_Mutation_p.P1475L|MICAL3_uc010gre.1_5'Flank	NM_015241	NP_056056	Q7RTP6	MICA3_HUMAN	microtubule associated monoxygenase, calponin	1559						cytoplasm|cytoskeleton	monooxygenase activity|zinc ion binding				0		all_epithelial(15;0.198)		Lung(27;0.0427)														---	---	---	---
PRODH	5625	broad.mit.edu	37	22	18910323	18910323	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:18910323G>A	uc010grl.2	-						PRODH_uc002zoj.3_Intron|PRODH_uc002zol.3_Intron|PRODH_uc002zok.3_Intron	NM_016335	NP_057419			proline dehydrogenase 1						glutamate biosynthetic process|induction of apoptosis by oxidative stress|proline catabolic process	mitochondrial inner membrane|mitochondrial matrix	proline dehydrogenase activity			breast(1)	1					L-Proline(DB00172)													---	---	---	---
TXNRD2	10587	broad.mit.edu	37	22	19898899	19898899	+	Splice_Site	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19898899C>T	uc011ahc.1	-	8	695	c.662_splice	c.e8+1	p.T221_splice	TXNRD2_uc002zql.1_5'UTR|TXNRD2_uc002zqm.1_Splice_Site|TXNRD2_uc002zqn.1_RNA|TXNRD2_uc002zqo.1_Splice_Site|TXNRD2_uc002zqp.1_RNA|TXNRD2_uc002zqr.1_Splice_Site_p.T220_splice|TXNRD2_uc010grv.1_Splice_Site_p.T221_splice|TXNRD2_uc002zqj.1_Splice_Site|TXNRD2_uc002zqs.2_Splice_Site_p.T189_splice	NM_006440	NP_006431			thioredoxin reductase 2 precursor						cell redox homeostasis|response to oxygen radical	mitochondrion	flavin adenine dinucleotide binding|NADP binding|thioredoxin-disulfide reductase activity			ovary(2)	2	Colorectal(54;0.0993)																	---	---	---	---
TRMT2A	27037	broad.mit.edu	37	22	20100980	20100980	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:20100980G>A	uc002zrk.1	-	10	1622	c.1407C>T	c.(1405-1407)GAC>GAT	p.D469D	TRMT2A_uc002zrl.1_Silent_p.D469D|TRMT2A_uc002zrm.1_Silent_p.D291D|TRMT2A_uc002zrn.1_Silent_p.D487D	NM_182984	NP_892029	Q8IZ69	TRM2A_HUMAN	HpaII tiny fragments locus 9C	469					RNA processing		nucleotide binding|RNA binding|RNA methyltransferase activity			breast(1)	1																		---	---	---	---
KLHL22	84861	broad.mit.edu	37	22	20819491	20819491	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:20819491G>A	uc002zsl.1	-	4	875	c.766C>T	c.(766-768)CGG>TGG	p.R256W	KLHL22_uc011ahr.1_Missense_Mutation_p.R113W|KLHL22_uc002zsm.1_Missense_Mutation_p.R256W	NM_032775	NP_116164	Q53GT1	KLH22_HUMAN	kelch-like	256					cell division	Cul3-RING ubiquitin ligase complex				lung(1)	1	Melanoma(16;0.000465)|Ovarian(15;0.00167)|Colorectal(54;0.0221)|all_neural(72;0.142)	Lung SC(17;0.0262)	LUSC - Lung squamous cell carcinoma(15;0.00102)|Lung(15;0.0173)															---	---	---	---
KLHL22	84861	broad.mit.edu	37	22	20825700	20825700	+	Silent	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:20825700G>T	uc002zsl.1	-	3	439	c.330C>A	c.(328-330)ACC>ACA	p.T110T	KLHL22_uc011ahr.1_Intron|KLHL22_uc002zsm.1_Silent_p.T110T	NM_032775	NP_116164	Q53GT1	KLH22_HUMAN	kelch-like	110	BTB.				cell division	Cul3-RING ubiquitin ligase complex				lung(1)	1	Melanoma(16;0.000465)|Ovarian(15;0.00167)|Colorectal(54;0.0221)|all_neural(72;0.142)	Lung SC(17;0.0262)	LUSC - Lung squamous cell carcinoma(15;0.00102)|Lung(15;0.0173)															---	---	---	---
PPM1F	9647	broad.mit.edu	37	22	22285570	22285570	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:22285570G>A	uc002zvp.1	-	6	955	c.841C>T	c.(841-843)CAG>TAG	p.Q281*	PPM1F_uc011aik.1_Nonsense_Mutation_p.Q177*|PPM1F_uc002zvq.2_Nonsense_Mutation_p.Q281*	NM_014634	NP_055449	P49593	PPM1F_HUMAN	protein phosphatase 1F	281					apoptosis|protein dephosphorylation	protein serine/threonine phosphatase complex	metal ion binding|protein serine/threonine phosphatase activity			ovary(2)|large_intestine(1)|breast(1)|kidney(1)	5	Colorectal(54;0.105)			READ - Rectum adenocarcinoma(21;0.155)														---	---	---	---
MYO18B	84700	broad.mit.edu	37	22	26423430	26423430	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26423430A>G	uc003abz.1	+	43	7740	c.7490A>G	c.(7489-7491)GAG>GGG	p.E2497G	MYO18B_uc003aca.1_Missense_Mutation_p.E2378G|MYO18B_uc010guy.1_Missense_Mutation_p.E2379G|MYO18B_uc010guz.1_Missense_Mutation_p.E2377G|MYO18B_uc011aka.1_Missense_Mutation_p.E1651G|MYO18B_uc011akb.1_Missense_Mutation_p.E2010G|MYO18B_uc010gva.1_Missense_Mutation_p.E480G|MYO18B_uc010gvb.1_RNA	NM_032608	NP_115997	Q8IUG5	MY18B_HUMAN	myosin XVIIIB	2497						nucleus|sarcomere|unconventional myosin complex	actin binding|ATP binding|motor activity			ovary(5)|central_nervous_system(3)|large_intestine(2)|breast(2)	12																		---	---	---	---
TPST2	8459	broad.mit.edu	37	22	26937534	26937534	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26937534C>T	uc003acv.2	-	2	231	c.63G>A	c.(61-63)GCG>GCA	p.A21A	TPST2_uc003acw.2_Silent_p.A21A|TPST2_uc003acx.2_Silent_p.A21A|TPST2_uc011akf.1_Silent_p.A21A	NM_003595	NP_003586	O60704	TPST2_HUMAN	tyrosylprotein sulfotransferase 2	21	Helical; Signal-anchor for type II membrane protein; (Potential).				peptidyl-tyrosine sulfation	endoplasmic reticulum|Golgi membrane|integral to membrane|membrane fraction	protein-tyrosine sulfotransferase activity			central_nervous_system(1)	1																		---	---	---	---
AP1B1	162	broad.mit.edu	37	22	29754808	29754808	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:29754808G>A	uc003afj.2	-	5	616	c.432C>T	c.(430-432)TGC>TGT	p.C144C	AP1B1_uc003afi.2_Silent_p.C144C|AP1B1_uc003afk.2_Silent_p.C144C|AP1B1_uc003afl.2_Silent_p.C144C	NM_001127	NP_001118	Q10567	AP1B1_HUMAN	adaptor-related protein complex 1 beta 1 subunit	144					endocytosis|intracellular protein transport|post-Golgi vesicle-mediated transport|regulation of defense response to virus by virus|viral reproduction	clathrin adaptor complex|clathrin coated vesicle membrane|cytosol|Golgi membrane|lysosomal membrane	protein binding|protein transporter activity			ovary(1)|skin(1)	2																		---	---	---	---
GATSL3	652968	broad.mit.edu	37	22	30685368	30685368	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:30685368G>A	uc003ahd.2	-						GATSL3_uc003ahc.2_Intron|GATSL3_uc003ahe.2_Intron|GATSL3_uc003ahf.2_Intron|GATSL3_uc003ahg.2_Intron|GATSL3_uc003ahh.2_Intron|GATSL3_uc010gvq.2_Intron|GATSL3_uc003ahi.2_Intron|GATSL3_uc010gvr.2_Intron|GATSL3_uc010gvs.2_Intron	NM_001037666	NP_001032755			GATS protein-like 3											breast(1)	1																		---	---	---	---
DEPDC5	9681	broad.mit.edu	37	22	32302472	32302472	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:32302472A>G	uc003als.2	+	42	4850	c.4708A>G	c.(4708-4710)AGT>GGT	p.S1570G	DEPDC5_uc011als.1_Missense_Mutation_p.S1501G|DEPDC5_uc011alu.1_Missense_Mutation_p.S1601G|DEPDC5_uc011alv.1_RNA|DEPDC5_uc003alt.2_Missense_Mutation_p.S1592G|DEPDC5_uc003alu.2_Missense_Mutation_p.S1019G|DEPDC5_uc003alv.2_RNA|DEPDC5_uc003alw.2_Missense_Mutation_p.S868G|DEPDC5_uc011alx.1_Missense_Mutation_p.S418G|DEPDC5_uc010gwk.2_3'UTR|DEPDC5_uc011aly.1_Missense_Mutation_p.S418G	NM_014662	NP_055477	O75140	DEPD5_HUMAN	DEP domain containing 5 isoform 1	1570					intracellular signal transduction					ovary(4)|central_nervous_system(3)|pancreas(1)	8																		---	---	---	---
LARGE	9215	broad.mit.edu	37	22	33700243	33700243	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:33700243G>A	uc003and.3	-	13	2281	c.1702C>T	c.(1702-1704)CCC>TCC	p.P568S	LARGE_uc011amd.1_Missense_Mutation_p.P367S|LARGE_uc003ane.3_Missense_Mutation_p.P568S|LARGE_uc010gwp.2_Missense_Mutation_p.P516S|LARGE_uc011ame.1_Missense_Mutation_p.P500S|LARGE_uc011amf.1_Missense_Mutation_p.P568S	NM_004737	NP_004728	O95461	LARGE_HUMAN	like-glycosyltransferase	568	Lumenal (Potential).				glycosphingolipid biosynthetic process|muscle cell homeostasis|N-acetylglucosamine metabolic process|protein glycosylation	integral to Golgi membrane	acetylglucosaminyltransferase activity			ovary(1)|central_nervous_system(1)|skin(1)	3		Lung NSC(1;0.219)																---	---	---	---
APOL3	80833	broad.mit.edu	37	22	36537420	36537420	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:36537420C>T	uc003aot.2	-	3	1075	c.1037G>A	c.(1036-1038)GGC>GAC	p.G346D	APOL3_uc003aoq.2_Missense_Mutation_p.G275D|APOL3_uc003aor.2_Missense_Mutation_p.G275D|APOL3_uc003aos.2_Missense_Mutation_p.G275D|APOL3_uc003aou.2_Missense_Mutation_p.G146D|APOL3_uc003aov.2_Missense_Mutation_p.G146D	NM_145640	NP_663615	O95236	APOL3_HUMAN	apolipoprotein L3 isoform 1	346					inflammatory response|lipoprotein metabolic process|positive regulation of I-kappaB kinase/NF-kappaB cascade	cytoplasm|extracellular region	lipid binding|lipid transporter activity|signal transducer activity				0																		---	---	---	---
TRIOBP	11078	broad.mit.edu	37	22	38165162	38165162	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38165162C>T	uc003atr.2	+	20	6974	c.6703C>T	c.(6703-6705)CAG>TAG	p.Q2235*	TRIOBP_uc003atu.2_Nonsense_Mutation_p.Q2063*|TRIOBP_uc003atw.2_Nonsense_Mutation_p.Q522*|TRIOBP_uc003atx.1_Nonsense_Mutation_p.Q118*|TRIOBP_uc010gxh.2_Nonsense_Mutation_p.Q118*	NM_001039141	NP_001034230	Q9H2D6	TARA_HUMAN	TRIO and F-actin binding protein isoform 6	2235	Potential.				actin modification|barbed-end actin filament capping	actin cytoskeleton|cytoplasm|nucleus	actin binding|GTP-Rho binding|myosin II binding|protein binding|ubiquitin protein ligase binding			central_nervous_system(1)	1	Melanoma(58;0.0574)																	---	---	---	---
CSNK1E	1454	broad.mit.edu	37	22	38698968	38698968	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38698968G>A	uc003avj.2	-	4	495	c.234C>T	c.(232-234)AAC>AAT	p.N78N	CSNK1E_uc003avk.2_Silent_p.N78N|CSNK1E_uc003avl.1_RNA|CSNK1E_uc003avm.1_Silent_p.N78N|CSNK1E_uc003avo.2_Silent_p.N78N|CSNK1E_uc003avp.1_Silent_p.N78N|CSNK1E_uc003avq.1_Silent_p.N78N|LOC400927_uc010gxm.2_RNA	NM_152221	NP_689407	P49674	KC1E_HUMAN	casein kinase 1 epsilon	78	Protein kinase.				DNA repair|G2/M transition of mitotic cell cycle|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|signal transduction	cytosol|nucleus	ATP binding|protein binding|protein serine/threonine kinase activity			ovary(1)|lung(1)|central_nervous_system(1)	3	Melanoma(58;0.045)																	---	---	---	---
MKL1	57591	broad.mit.edu	37	22	40814864	40814864	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:40814864C>T	uc003ayv.1	-	9	1785	c.1578G>A	c.(1576-1578)ATG>ATA	p.M526I	MKL1_uc003ayw.1_Missense_Mutation_p.M526I|MKL1_uc010gye.1_Missense_Mutation_p.M526I|MKL1_uc010gyf.1_Missense_Mutation_p.M476I	NM_020831	NP_065882	Q969V6	MKL1_HUMAN	megakaryoblastic leukemia 1 protein	526	Potential.				positive regulation of transcription from RNA polymerase II promoter|smooth muscle cell differentiation|transcription, DNA-dependent	cytoplasm|nucleus	actin monomer binding|leucine zipper domain binding|nucleic acid binding|transcription coactivator activity			ovary(2)|lung(1)|breast(1)|central_nervous_system(1)	5								T	RBM15	acute megakaryocytic leukemia								---	---	---	---
CSDC2	27254	broad.mit.edu	37	22	41970732	41970732	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41970732G>A	uc003bak.1	+							NM_014460	NP_055275			RNA-binding protein pippin						histone mRNA 3'-end processing|regulation of transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|protein binding|RNA binding				0																		---	---	---	---
RRP7A	27341	broad.mit.edu	37	22	42908940	42908940	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:42908940G>A	uc003bcq.2	-	7	835	c.819C>T	c.(817-819)GCC>GCT	p.A273A	SERHL_uc011apm.1_Intron|RRP7A_uc003bcp.2_Silent_p.A296A	NM_015703	NP_056518	Q9Y3A4	RRP7A_HUMAN	ribosomal RNA processing 7 homolog A	273							nucleotide binding|RNA binding			central_nervous_system(1)|skin(1)	2																		---	---	---	---
EFCAB6	64800	broad.mit.edu	37	22	43926756	43926756	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43926756C>T	uc003bdy.1	-	31	4537	c.4322G>A	c.(4321-4323)CGC>CAC	p.R1441H	EFCAB6_uc003bdz.1_Missense_Mutation_p.R1289H|EFCAB6_uc010gzi.1_Missense_Mutation_p.R1289H	NM_022785	NP_073622	Q5THR3	EFCB6_HUMAN	CAP-binding protein complex interacting protein	1441	Interaction with AR.|EF-hand 16.|Interaction with PARK7.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	calcium ion binding			ovary(3)|skin(2)|upper_aerodigestive_tract(1)|pancreas(1)	7		Ovarian(80;0.0247)|all_neural(38;0.025)																---	---	---	---
FAM118A	55007	broad.mit.edu	37	22	45719228	45719228	+	Missense_Mutation	SNP	G	A	A	rs34197967		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:45719228G>A	uc003bfz.3	+	4	836	c.220G>A	c.(220-222)GTC>ATC	p.V74I	FAM118A_uc003bga.3_Missense_Mutation_p.V74I	NM_001104595	NP_001098065	Q9NWS6	F118A_HUMAN	hypothetical protein LOC55007	74						integral to membrane					0		Ovarian(80;0.00965)|all_neural(38;0.0416)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0178)														---	---	---	---
WNT7B	7477	broad.mit.edu	37	22	46318884	46318884	+	Missense_Mutation	SNP	G	A	A	rs61735041		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:46318884G>A	uc003bgo.2	-	4	1276	c.902C>T	c.(901-903)GCG>GTG	p.A301V	WNT7B_uc010haa.2_Missense_Mutation_p.A305V	NM_058238	NP_478679	P56706	WNT7B_HUMAN	wingless-type MMTV integration site family,	301					activation of JUN kinase activity|anterior/posterior pattern formation|axis specification|axonogenesis|canonical Wnt receptor signaling pathway|cell-cell signaling|cellular response to retinoic acid|central nervous system vasculogenesis|chorio-allantoic fusion|developmental growth involved in morphogenesis|embryonic placenta morphogenesis|establishment or maintenance of polarity of embryonic epithelium|fibroblast proliferation|forebrain regionalization|inner medullary collecting duct development|lens fiber cell development|lobar bronchus development|lung epithelium development|lung morphogenesis|lung-associated mesenchyme development|mammary gland epithelium development|metanephric collecting duct development|metanephric loop of Henle development|metanephros morphogenesis|negative regulation of smoothened signaling pathway|outer medullary collecting duct development|oxygen homeostasis|positive regulation of JNK cascade|positive regulation of osteoblast differentiation|renal inner medulla development|renal outer medulla development|stem cell proliferation|synapse organization|trachea cartilage morphogenesis|Wnt receptor signaling pathway, calcium modulating pathway	extracellular space|plasma membrane|proteinaceous extracellular matrix	extracellular matrix structural constituent|frizzled binding|signal transducer activity			lung(1)	1		Ovarian(80;0.00965)|all_neural(38;0.0416)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0178)|LUAD - Lung adenocarcinoma(64;0.247)														---	---	---	---
GTSE1	51512	broad.mit.edu	37	22	46725365	46725365	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:46725365C>T	uc011aqy.1	+	11	2249	c.2037C>T	c.(2035-2037)CAC>CAT	p.H679H	GTSE1_uc011aqz.1_Silent_p.H526H|GTSE1_uc003bhn.2_RNA|uc011ara.1_5'Flank|uc003bho.3_5'Flank	NM_016426	NP_057510	Q9NYZ3	GTSE1_HUMAN	G-2 and S-phase expressed 1	660					DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G2 phase of mitotic cell cycle|microtubule-based process	cytoplasmic microtubule				ovary(1)	1		Ovarian(80;0.00965)|all_neural(38;0.0416)		UCEC - Uterine corpus endometrioid carcinoma (28;0.00462)														---	---	---	---
CELSR1	9620	broad.mit.edu	37	22	46761287	46761287	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:46761287C>T	uc003bhw.1	-							NM_014246	NP_055061			cadherin EGF LAG seven-pass G-type receptor 1						central nervous system development|homophilic cell adhesion|neural tube closure|neuropeptide signaling pathway	integral to plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein dimerization activity			lung(4)|breast(4)|pancreas(2)|skin(1)	11		Ovarian(80;0.00142)|Breast(42;0.00296)|all_neural(38;0.0416)|Colorectal(5;0.0766)		UCEC - Uterine corpus endometrioid carcinoma (28;0.00643)|BRCA - Breast invasive adenocarcinoma(115;0.171)														---	---	---	---
PANX2	56666	broad.mit.edu	37	22	50609382	50609382	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50609382G>A	uc003bjn.3	+	1	223	c.223G>A	c.(223-225)GCA>ACA	p.A75T	PANX2_uc003bjp.3_5'UTR|PANX2_uc003bjo.3_Missense_Mutation_p.A75T	NM_052839	NP_443071	Q96RD6	PANX2_HUMAN	pannexin 2 isoform 1	75	Extracellular (Potential).				protein hexamerization|synaptic transmission	gap junction|integral to membrane	gap junction hemi-channel activity|ion channel activity			breast(1)	1		all_cancers(38;1.14e-10)|all_epithelial(38;2.12e-09)|all_lung(38;7.01e-05)|Breast(42;0.000523)|Lung NSC(38;0.0018)|Ovarian(80;0.0365)|Lung SC(80;0.113)		LUAD - Lung adenocarcinoma(64;0.105)														---	---	---	---
ARSA	410	broad.mit.edu	37	22	51065135	51065135	+	Silent	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:51065135G>A	uc003bnb.3	-	5	985	c.732C>T	c.(730-732)CGC>CGT	p.R244R	ARSA_uc003bna.3_Silent_p.R160R|ARSA_uc003bnc.3_Silent_p.R244R|ARSA_uc003bnd.3_Silent_p.R244R|ARSA_uc003bmz.3_Silent_p.R244R|ARSA_uc010hbf.2_3'UTR	NM_001085426	NP_001078895	P15289	ARSA_HUMAN	arylsulfatase A isoform a precursor	244			R -> C (in MLD; juvenile-onset).|R -> H (in MLD; infantile-onset).			lysosome	arylsulfatase activity|calcium ion binding|cerebroside-sulfatase activity			pancreas(1)|skin(1)	2		all_cancers(38;8.8e-15)|all_epithelial(38;1.12e-12)|all_lung(38;3.07e-05)|Breast(42;6.27e-05)|Lung NSC(38;0.000813)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		BRCA - Breast invasive adenocarcinoma(115;0.205)|LUAD - Lung adenocarcinoma(64;0.247)	Micafungin(DB01141)													---	---	---	---
P2RY8	286530	broad.mit.edu	37	X	1585333	1585333	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1585333C>T	uc004cpz.2	-	2	367	c.119G>A	c.(118-120)GGC>GAC	p.G40D		NM_178129	NP_835230	Q86VZ1	P2RY8_HUMAN	G-protein coupled purinergic receptor P2Y8	40	Helical; Name=1; (Potential).					integral to membrane|plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			lung(5)	5		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)						T	CRLF2	B-ALL|Downs associated ALL								---	---	---	---
MXRA5	25878	broad.mit.edu	37	X	3241477	3241477	+	Missense_Mutation	SNP	G	A	A	rs144303250	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:3241477G>A	uc004crg.3	-	5	2406	c.2249C>T	c.(2248-2250)TCG>TTG	p.S750L		NM_015419	NP_056234	Q9NR99	MXRA5_HUMAN	adlican precursor	750						extracellular region				ovary(5)|lung(1)|central_nervous_system(1)|skin(1)	8		all_lung(23;0.00031)|Lung NSC(23;0.000946)																---	---	---	---
GPR64	10149	broad.mit.edu	37	X	19028726	19028726	+	Intron	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:19028726C>T	uc004cyx.2	-						GPR64_uc004cyy.2_Intron|GPR64_uc004cyz.2_Intron|GPR64_uc004czb.2_Intron|GPR64_uc004czc.2_Intron|GPR64_uc004czd.2_Intron|GPR64_uc004cze.2_Intron|GPR64_uc004czf.2_Intron|GPR64_uc004cza.2_Intron|GPR64_uc004cyw.2_Intron|GPR64_uc010nfj.2_Intron	NM_001079858	NP_001073327			G protein-coupled receptor 64 isoform 1						neuropeptide signaling pathway|spermatogenesis	cytoplasm|integral to plasma membrane	G-protein coupled receptor activity				0	Hepatocellular(33;0.183)																	---	---	---	---
KLHL34	257240	broad.mit.edu	37	X	21675213	21675213	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:21675213C>T	uc004czz.1	-	1	1236	c.694G>A	c.(694-696)GTA>ATA	p.V232I		NM_153270	NP_695002	Q8N239	KLH34_HUMAN	kelch-like 34	232	BACK.									ovary(1)	1																		---	---	---	---
FAM47C	442444	broad.mit.edu	37	X	37026509	37026509	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:37026509G>A	uc004ddl.1	+	1	40	c.26G>A	c.(25-27)CGG>CAG	p.R9Q		NM_001013736	NP_001013758	Q5HY64	FA47C_HUMAN	hypothetical protein LOC442444	9										ovary(3)	3																		---	---	---	---
FAM47C	442444	broad.mit.edu	37	X	37027955	37027955	+	Missense_Mutation	SNP	C	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:37027955C>A	uc004ddl.1	+	1	1486	c.1472C>A	c.(1471-1473)CCC>CAC	p.P491H		NM_001013736	NP_001013758	Q5HY64	FA47C_HUMAN	hypothetical protein LOC442444	491										ovary(3)	3																		---	---	---	---
CYBB	1536	broad.mit.edu	37	X	37663304	37663304	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:37663304G>A	uc004ddr.2	+	9	1133	c.1072G>A	c.(1072-1074)GTT>ATT	p.V358I	CYBB_uc011mke.1_RNA|CYBB_uc011mkf.1_Missense_Mutation_p.V326I|CYBB_uc011mkg.1_Missense_Mutation_p.V91I	NM_000397	NP_000388	P04839	CY24B_HUMAN	cytochrome b-245 beta polypeptide	358	Cytoplasmic (Potential).|FAD-binding FR-type.				electron transport chain|inflammatory response|innate immune response|respiratory burst|superoxide anion generation	NADPH oxidase complex	electron carrier activity|flavin adenine dinucleotide binding|heme binding|protein heterodimerization activity|superoxide-generating NADPH oxidase activity|voltage-gated ion channel activity			central_nervous_system(1)|skin(1)	2																		---	---	---	---
SRPX	8406	broad.mit.edu	37	X	38019423	38019423	+	Missense_Mutation	SNP	G	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:38019423G>T	uc004ddy.1	-	7	888	c.802C>A	c.(802-804)CCA>ACA	p.P268T	SRPX_uc004ddz.1_Missense_Mutation_p.P248T|SRPX_uc011mkh.1_Missense_Mutation_p.P209T|SRPX_uc011mki.1_Missense_Mutation_p.P268T	NM_006307	NP_006298	P78539	SRPX_HUMAN	sushi-repeat-containing protein, X-linked	268	Sushi 3.				cell adhesion	cell surface|membrane					0																		---	---	---	---
Unknown	0	broad.mit.edu	37	X	47662764	47662764	+	IGR	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:47662764G>A								LOC100133957 (142988 upstream) : ZNF81 (33537 downstream)																																			---	---	---	---
TRO	7216	broad.mit.edu	37	X	54949811	54949811	+	Silent	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54949811C>T	uc004dtq.2	+	3	953	c.846C>T	c.(844-846)GAC>GAT	p.D282D	TRO_uc011moj.1_Silent_p.D225D|TRO_uc004dts.2_Silent_p.D282D|TRO_uc004dtr.2_Silent_p.D282D|TRO_uc004dtt.2_RNA|TRO_uc004dtu.2_Intron|TRO_uc004dtv.2_Intron|TRO_uc011mok.1_Intron|TRO_uc004dtw.2_Intron|TRO_uc004dtx.2_5'Flank	NM_001039705	NP_001034794	Q12816	TROP_HUMAN	trophinin isoform 5	282					embryo implantation|homophilic cell adhesion	integral to plasma membrane				ovary(1)	1																		---	---	---	---
FAM104B	90736	broad.mit.edu	37	X	55172687	55172687	+	Missense_Mutation	SNP	T	C	C	rs1047037		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:55172687T>C	uc004duh.1	-	3	198	c.178A>G	c.(178-180)AGT>GGT	p.S60G	FAM104B_uc004dug.1_Missense_Mutation_p.S61G|FAM104B_uc004dui.3_Missense_Mutation_p.S61G	NM_138362	NP_612371	Q5XKR9	F104B_HUMAN	hypothetical protein LOC90736	60											0																		---	---	---	---
HEPH	9843	broad.mit.edu	37	X	65392355	65392355	+	Missense_Mutation	SNP	A	G	G			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:65392355A>G	uc011moz.1	+	3	395	c.335A>G	c.(334-336)GAT>GGT	p.D112G	HEPH_uc004dwn.2_Missense_Mutation_p.D112G|HEPH_uc004dwo.2_5'UTR|HEPH_uc010nkr.2_Missense_Mutation_p.D112G|HEPH_uc011mpa.1_Missense_Mutation_p.D112G	NM_138737	NP_620074	Q9BQS7	HEPH_HUMAN	hephaestin isoform a	109	Extracellular (Potential).|Plastocyanin-like 1.				cellular iron ion homeostasis|copper ion transport|transmembrane transport	integral to membrane|plasma membrane	copper ion binding|oxidoreductase activity			lung(5)|ovary(4)	9																		---	---	---	---
AR	367	broad.mit.edu	37	X	66765796	66765796	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:66765796G>A	uc004dwu.1	+	1	1923	c.808G>A	c.(808-810)GCC>ACC	p.A270T	AR_uc011mpd.1_Missense_Mutation_p.A270T|AR_uc011mpe.1_RNA|AR_uc011mpf.1_Missense_Mutation_p.A270T	NM_000044	NP_000035	P10275	ANDR_HUMAN	androgen receptor isoform 1	268	Modulating.				cell death|cell growth|cell proliferation|cell-cell signaling|negative regulation of apoptosis|negative regulation of integrin biosynthetic process|positive regulation of cell proliferation|positive regulation of integrin biosynthetic process|positive regulation of NF-kappaB transcription factor activity|positive regulation of phosphorylation|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase III promoter|regulation of establishment of protein localization in plasma membrane|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|transport	cytoplasm|nuclear chromatin|nucleoplasm	androgen binding|androgen receptor activity|beta-catenin binding|enzyme binding|ligand-regulated transcription factor activity|protein dimerization activity|sequence-specific DNA binding transcription factor activity|transcription factor binding|transcription regulatory region DNA binding|zinc ion binding			ovary(3)|lung(2)|breast(2)|central_nervous_system(1)	8	all_cancers(1;0.173)|Prostate(1;2.27e-16)|all_epithelial(1;0.102)	all_lung(315;1.3e-11)			Bicalutamide(DB01128)|Cyproterone(DB04839)|Dromostanolone(DB00858)|Finasteride(DB01216)|Fluoxymesterone(DB01185)|Flutamide(DB00499)|Nandrolone(DB00984)|Nilutamide(DB00665)|Oxandrolone(DB00621)|Testosterone(DB00624)									Androgen_Insensitivity_Syndrome				---	---	---	---
CYLC1	1538	broad.mit.edu	37	X	83126520	83126520	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:83126520C>T	uc004eei.1	+	3	140	c.119C>T	c.(118-120)CCA>CTA	p.P40L	CYLC1_uc004eeh.1_Missense_Mutation_p.P39L	NM_021118	NP_066941	P35663	CYLC1_HUMAN	cylicin, basic protein of sperm head	40					cell differentiation|multicellular organismal development|spermatogenesis	acrosomal matrix|cytoskeletal calyx	structural molecule activity			ovary(4)|skin(1)	5																		---	---	---	---
DRP2	1821	broad.mit.edu	37	X	100505520	100505520	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:100505520C>T	uc004egz.2	+	15	2018	c.1649C>T	c.(1648-1650)GCC>GTC	p.A550V	DRP2_uc011mrh.1_Missense_Mutation_p.A472V	NM_001939	NP_001930	Q13474	DRP2_HUMAN	dystrophin related protein 2	550					central nervous system development	cytoplasm|cytoskeleton	zinc ion binding			ovary(2)	2																		---	---	---	---
GPRASP1	9737	broad.mit.edu	37	X	101912901	101912901	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:101912901G>A	uc004ejj.3	+	5	4861	c.4060G>A	c.(4060-4062)GTG>ATG	p.V1354M	GPRASP1_uc004eji.3_Missense_Mutation_p.V1354M|GPRASP1_uc010nod.2_Missense_Mutation_p.V1354M	NM_014710	NP_055525	Q5JY77	GASP1_HUMAN	G protein-coupled receptor associated sorting	1354	OPRD1-binding.					cytoplasm	protein binding			ovary(1)|lung(1)	2																		---	---	---	---
IRS4	8471	broad.mit.edu	37	X	107978396	107978396	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107978396C>T	uc004eoc.2	-	1	1212	c.1179G>A	c.(1177-1179)ATG>ATA	p.M393I		NM_003604	NP_003595	O14654	IRS4_HUMAN	insulin receptor substrate 4	393						plasma membrane	insulin receptor binding|SH3/SH2 adaptor activity|signal transducer activity			ovary(4)|large_intestine(2)|lung(1)|breast(1)|skin(1)|pancreas(1)	10																		---	---	---	---
DDX26B	203522	broad.mit.edu	37	X	134679344	134679344	+	Intron	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:134679344G>A	uc004eyw.3	+							NM_182540	NP_872346			DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide												0	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
VGLL1	51442	broad.mit.edu	37	X	135630855	135630855	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135630855G>A	uc004ezy.2	+	3	492	c.322G>A	c.(322-324)GGT>AGT	p.G108S	MIR934_hsa-mir-934|MI0005756_5'Flank	NM_016267	NP_057351	Q99990	VGLL1_HUMAN	vestigial like 1	108					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	transcription coactivator activity				0	Acute lymphoblastic leukemia(192;0.000127)																	---	---	---	---
ATP11C	286410	broad.mit.edu	37	X	138856898	138856898	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:138856898G>A	uc004faz.2	-	19	2275	c.2176C>T	c.(2176-2178)CGC>TGC	p.R726C	ATP11C_uc004fay.2_RNA|ATP11C_uc004fba.2_Missense_Mutation_p.R726C	NM_173694	NP_775965	Q8NB49	AT11C_HUMAN	ATPase, class VI, type 11C isoform a	726	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(5)|large_intestine(3)	8	Acute lymphoblastic leukemia(192;0.000127)																	---	---	---	---
MAGEA8	4107	broad.mit.edu	37	X	149013706	149013706	+	Silent	SNP	G	A	A	rs45518135		TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:149013706G>A	uc004fdw.1	+	3	875	c.660G>A	c.(658-660)CCG>CCA	p.P220P		NM_005364	NP_005355	P43361	MAGA8_HUMAN	melanoma antigen family A, 8	220	MAGE.										0	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
ZNF185	7739	broad.mit.edu	37	X	152134007	152134007	+	Missense_Mutation	SNP	G	A	A			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:152134007G>A	uc010ntv.1	+	19	1769	c.1732G>A	c.(1732-1734)GTG>ATG	p.V578M	ZNF185_uc011myg.1_Missense_Mutation_p.V610M|ZNF185_uc011myh.1_Missense_Mutation_p.V581M|ZNF185_uc011myi.1_Missense_Mutation_p.V549M|ZNF185_uc011myj.1_Missense_Mutation_p.V519M|ZNF185_uc011myk.1_Missense_Mutation_p.V579M|ZNF185_uc004fgw.3_Missense_Mutation_p.V357M|ZNF185_uc004fgu.2_Missense_Mutation_p.V207M|ZNF185_uc004fgv.2_Missense_Mutation_p.V275M|ZNF185_uc004fgx.2_Missense_Mutation_p.V216M	NM_007150	NP_009081	O15231	ZN185_HUMAN	zinc finger protein 185	578						cytoplasm|cytoskeleton|focal adhesion	zinc ion binding			ovary(3)	3	Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
MAGEA1	4100	broad.mit.edu	37	X	152482678	152482678	+	Silent	SNP	A	C	C			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:152482678A>C	uc004fhf.2	-	3	553	c.333T>G	c.(331-333)GGT>GGG	p.G111G		NM_004988	NP_004979	P43355	MAGA1_HUMAN	melanoma antigen family A, 1	111	MAGE.					cytoplasm|plasma membrane				central_nervous_system(7)|ovary(1)|lung(1)|breast(1)	10	all_hematologic(71;4.25e-06)|Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
PDZD4	57595	broad.mit.edu	37	X	153069625	153069625	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153069625C>T	uc004fiz.1	-	8	1743	c.1493G>A	c.(1492-1494)GGC>GAC	p.G498D	PDZD4_uc004fiy.1_Missense_Mutation_p.G423D|PDZD4_uc004fix.2_Missense_Mutation_p.G402D|PDZD4_uc004fja.1_Missense_Mutation_p.G504D|PDZD4_uc011mze.1_Missense_Mutation_p.G389D	NM_032512	NP_115901	Q76G19	PDZD4_HUMAN	PDZ domain containing 4	498						cell cortex				breast(1)	1	all_lung(58;3.39e-06)|all_hematologic(71;4.25e-06)|Lung NSC(58;4.7e-06)|Acute lymphoblastic leukemia(192;6.56e-05)																	---	---	---	---
OPN1LW	5956	broad.mit.edu	37	X	153421950	153421950	+	Missense_Mutation	SNP	A	T	T	rs145631912	byFrequency	TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153421950A>T	uc004fjz.3	+	5	959	c.926A>T	c.(925-927)TAC>TTC	p.Y309F		NM_020061	NP_064445	P04000	OPSR_HUMAN	opsin 1 (cone pigments), long-wave-sensitive	309	Helical; Name=7; (Potential).				phototransduction|protein-chromophore linkage|visual perception	integral to plasma membrane	G-protein coupled receptor activity|photoreceptor activity				0	all_cancers(53;1.83e-16)|all_epithelial(53;2.73e-10)|all_lung(58;6.39e-07)|Lung NSC(58;8.37e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)																	---	---	---	---
GAB3	139716	broad.mit.edu	37	X	153944504	153944504	+	Missense_Mutation	SNP	C	T	T			TCGA-CG-5733-01	TCGA-CG-5733-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153944504C>T	uc004fmj.1	-	2	221	c.173G>A	c.(172-174)CGG>CAG	p.R58Q	GAB3_uc004fmk.1_Missense_Mutation_p.R58Q|GAB3_uc010nve.1_Missense_Mutation_p.R58Q|GAB3_uc004fml.1_5'UTR	NM_080612	NP_542179	Q8WWW8	GAB3_HUMAN	Gab3 protein isoform 2	58	PH.									ovary(1)	1	all_cancers(53;8.15e-17)|all_epithelial(53;1.1e-10)|all_lung(58;6.63e-07)|Lung NSC(58;2.08e-06)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)|Renal(33;0.214)																	---	---	---	---
