Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	validation_status	validation_method	validation_tumor_sample	validation_alt_allele
CDK11B	984	broad.mit.edu	37	1	1588535	1588536	+	Intron	INS	-	TAA	TAA	rs138141689	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1588535_1588536insTAA	uc001agv.1	-						CDK11B_uc001ags.1_Intron|CDK11B_uc001agt.1_Intron|CDK11B_uc001aha.1_Intron|CDK11B_uc001agw.1_Intron|CDK11B_uc001agy.1_Intron|CDK11B_uc001agx.1_Intron|CDK11B_uc001agz.1_Intron|uc001ahc.1_Intron	NM_033486	NP_277021			cell division cycle 2-like 1 (PITSLRE proteins)						apoptosis|cell proliferation|mitosis|regulation of cell growth|regulation of mRNA processing|regulation of transcription, DNA-dependent	cytoplasm|nucleus	ATP binding|cyclin-dependent protein kinase activity|protein binding			skin(1)	1																		---	---	---	---
ST3GAL3	6487	broad.mit.edu	37	1	44360317	44360318	+	Intron	INS	-	T	T	rs112814003		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44360317_44360318insT	uc001ckc.2	+						ST3GAL3_uc010okj.1_Intron|ST3GAL3_uc001cjz.2_Intron|ST3GAL3_uc001cka.2_Intron|ST3GAL3_uc001ckb.2_Intron|ST3GAL3_uc001ckd.2_Intron|ST3GAL3_uc001cke.2_Intron|ST3GAL3_uc001ckf.2_Intron|ST3GAL3_uc001ckg.2_Intron|ST3GAL3_uc001ckh.2_Intron|ST3GAL3_uc001cki.2_Intron|ST3GAL3_uc009vwv.2_Intron|ST3GAL3_uc001ckj.2_Intron|ST3GAL3_uc009vww.2_Intron|ST3GAL3_uc001ckk.2_Intron|ST3GAL3_uc009vwy.2_Intron|ST3GAL3_uc009vwx.2_Intron|ST3GAL3_uc001ckm.2_Intron|ST3GAL3_uc001ckl.2_Intron|ST3GAL3_uc009vwz.2_Intron|ST3GAL3_uc001ckn.2_Intron|ST3GAL3_uc001ckp.2_Intron|ST3GAL3_uc001cko.2_Intron|ST3GAL3_uc009vxa.2_Intron|ST3GAL3_uc001ckq.2_Intron|ST3GAL3_uc001ckr.2_Intron|ST3GAL3_uc009vxb.2_Intron	NM_006279	NP_006270			sialyltransferase 6 isoform j						protein glycosylation	extracellular region|Golgi cisterna membrane|integral to Golgi membrane	N-acetyllactosaminide alpha-2,3-sialyltransferase activity			ovary(3)	3	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0518)																---	---	---	---
Unknown	0	broad.mit.edu	37	1	100288483	100288488	+	IGR	DEL	CCTCTA	-	-	rs115122615		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:100288483_100288488delCCTCTA								FRRS1 (57134 upstream) : AGL (27152 downstream)																																			---	---	---	---
PDE4DIP	9659	broad.mit.edu	37	1	144853333	144853334	+	Intron	INS	-	AA	AA	rs149112816		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144853333_144853334insAA	uc001elw.3	-						NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|PDE4DIP_uc001elx.3_Intron|PDE4DIP_uc001elv.3_Intron	NM_014644	NP_055459			phosphodiesterase 4D interacting protein isoform						cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)				T	PDGFRB	MPD								---	---	---	---
Unknown	0	broad.mit.edu	37	1	149039745	149039745	+	IGR	DEL	A	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:149039745delA								LOC645166 (86691 upstream) : LOC388692 (239731 downstream)																																			---	---	---	---
FAM5B	57795	broad.mit.edu	37	1	177242774	177242774	+	Intron	DEL	A	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:177242774delA	uc001glf.2	+						FAM5B_uc010pna.1_Intron|FAM5B_uc001glg.2_Intron	NM_021165	NP_066988			family with sequence similarity 5, member B							extracellular region				skin(3)|ovary(2)|upper_aerodigestive_tract(1)	6																		---	---	---	---
Unknown	0	broad.mit.edu	37	1	232994766	232994767	+	IGR	INS	-	CTTC	CTTC	rs145240666	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:232994766_232994767insCTTC								KIAA1383 (48674 upstream) : C1orf57 (91603 downstream)																																			---	---	---	---
ATAD2B	54454	broad.mit.edu	37	2	24103433	24103433	+	Intron	DEL	A	-	-	rs75314008		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:24103433delA	uc002rek.3	-						ATAD2B_uc010yki.1_Intron|ATAD2B_uc010exx.1_Intron	NM_017552	NP_060022			ATPase family, AAA domain containing 2B								ATP binding|nucleoside-triphosphatase activity			central_nervous_system(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)																	---	---	---	---
Unknown	0	broad.mit.edu	37	2	91899626	91899626	+	IGR	DEL	A	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:91899626delA								LOC654342 (51651 upstream) : GGT8P (63742 downstream)																																			---	---	---	---
TRIM43	129868	broad.mit.edu	37	2	96265407	96265408	+	3'UTR	INS	-	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:96265407_96265408insT	uc002suv.2	+	7						NM_138800	NP_620155			tripartite motif-containing 43							intracellular	zinc ion binding			ovary(1)	1																		---	---	---	---
SLC6A6	6533	broad.mit.edu	37	3	14509843	14509843	+	Intron	DEL	A	-	-	rs142706263	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:14509843delA	uc010heg.2	+						SLC6A6_uc003byq.2_Intron|SLC6A6_uc003byr.2_Intron	NM_001134367	NP_001127839			solute carrier family 6 (neurotransmitter						cellular amino acid metabolic process	integral to plasma membrane	amino acid transmembrane transporter activity|neurotransmitter:sodium symporter activity|taurine:sodium symporter activity			ovary(1)	1																OREG0015421	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PRSS50	29122	broad.mit.edu	37	3	46759228	46759229	+	In_Frame_Ins	INS	-	AGC	AGC	rs143449678	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:46759228_46759229insAGC	uc003cqe.1	-	1	145_146	c.86_87insGCT	c.(85-87)CTT>CTGCTT	p.29_29L>LL	PRSS50_uc003cqf.1_Intron	NM_013270	NP_037402	Q9UI38	TSP50_HUMAN	testes-specific protease 50 precursor	29					proteolysis	endoplasmic reticulum	serine-type endopeptidase activity|threonine-type endopeptidase activity				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	3	110401054	110401054	+	IGR	DEL	T	-	-	rs113398685		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:110401054delT								None (None upstream) : PVRL3 (389811 downstream)																																			---	---	---	---
UBA6	55236	broad.mit.edu	37	4	68566892	68566892	+	5'Flank	DEL	G	-	-	rs66862981		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:68566892delG	uc003hdg.3	-						UBA6_uc003hdi.2_5'Flank|UBA6_uc003hdj.2_5'Flank|LOC550112_uc003hdl.3_5'Flank|LOC550112_uc003hdk.2_5'Flank	NM_018227	NP_060697			ubiquitin-activating enzyme E1-like 2						protein ubiquitination|ubiquitin-dependent protein catabolic process	cytoplasm	ATP binding|FAT10 activating enzyme activity|ligase activity|protein binding				0																OREG0016213	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
Unknown	0	broad.mit.edu	37	4	160415816	160415816	+	IGR	DEL	A	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:160415816delA								RAPGEF2 (134517 upstream) : None (None downstream)																																			---	---	---	---
NEK1	4750	broad.mit.edu	37	4	170429376	170429376	+	Intron	DEL	A	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:170429376delA	uc003isb.1	-						NEK1_uc003isc.1_Intron|NEK1_uc003isd.1_Intron|NEK1_uc003ise.1_Intron|NEK1_uc003isf.1_Intron	NM_012224	NP_036356			NIMA-related kinase 1						cell division|cilium assembly|mitosis	nucleus|pericentriolar material	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			lung(3)|ovary(2)|large_intestine(1)	6		Prostate(90;0.00601)|Renal(120;0.0183)		GBM - Glioblastoma multiforme(119;0.0287)|KIRC - Kidney renal clear cell carcinoma(143;0.0325)|Kidney(143;0.0385)|LUSC - Lung squamous cell carcinoma(193;0.14)														---	---	---	---
Unknown	0	broad.mit.edu	37	4	179208521	179208521	+	IGR	DEL	A	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:179208521delA								LOC285501 (296618 upstream) : None (None downstream)																																			---	---	---	---
Unknown	0	broad.mit.edu	37	5	177398373	177398396	+	IGR	DEL	AGGACGAAGAGCTGGAGAGCGCCA	-	-	rs145131557		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:177398373_177398396delAGGACGAAGAGCTGGAGAGCGCCA								LOC728554 (87106 upstream) : PROP1 (20840 downstream)																																			---	---	---	---
ADAMTS2	9509	broad.mit.edu	37	5	178562110	178562110	+	Intron	DEL	C	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:178562110delC	uc003mjw.2	-							NM_014244	NP_055059			ADAM metallopeptidase with thrombospondin type 1						collagen catabolic process	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			large_intestine(1)|lung(1)|ovary(1)|pancreas(1)	4	all_cancers(89;0.000456)|all_epithelial(37;0.000138)|Renal(175;0.000159)|Lung NSC(126;0.00184)|all_lung(126;0.00326)	all_cancers(40;0.00604)|all_neural(177;0.00411)|Medulloblastoma(196;0.00508)|Lung NSC(249;0.0569)|all_lung(500;0.129)|all_hematologic(541;0.211)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	GBM - Glioblastoma multiforme(465;0.0473)														---	---	---	---
ZFP57	346171	broad.mit.edu	37	6	29642978	29642979	+	Intron	INS	-	AACTTGAA	AACTTGAA	rs143499124	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29642978_29642979insAACTTGAA	uc011dlw.1	-						ZFP57_uc003nnl.3_Intron	NM_001109809	NP_001103279			zinc finger protein 57 homolog						DNA methylation involved in embryo development|regulation of gene expression by genetic imprinting|transcription, DNA-dependent		DNA binding|zinc ion binding			ovary(3)|skin(2)	5																		---	---	---	---
C7orf26	79034	broad.mit.edu	37	7	6646327	6646328	+	Intron	DEL	TT	-	-	rs67788546		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6646327_6646328delTT	uc003sqo.1	+						C7orf26_uc003sqp.1_Intron|C7orf26_uc003sqq.1_Intron	NM_024067	NP_076972			hypothetical protein LOC79034											ovary(1)	1		Ovarian(82;0.232)		UCEC - Uterine corpus endometrioid carcinoma (126;0.0986)														---	---	---	---
DPY19L2P1	554236	broad.mit.edu	37	7	35163808	35163808	+	Intron	DEL	T	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:35163808delT	uc003teq.1	-						DPY19L2P1_uc003tep.1_Intron|DPY19L2P1_uc010kwz.1_Intron					RecName: Full=Protein dpy-19 homolog 2-like 2; AltName: Full=Dpy-19-like protein 2 pseudogene 2;												0																		---	---	---	---
ZNF107	51427	broad.mit.edu	37	7	64152467	64152468	+	Intron	INS	-	T	T	rs35690123	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:64152467_64152468insT	uc003ttd.2	+						ZNF107_uc003tte.2_Intron	NM_016220	NP_057304			zinc finger protein 107						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Lung NSC(55;0.00948)|all_lung(88;0.0249)																---	---	---	---
LHFPL3	375612	broad.mit.edu	37	7	103969195	103969200	+	5'UTR	DEL	AGGAGG	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:103969195_103969200delAGGAGG	uc003vce.2	+	1					LHFPL3_uc003vcf.2_5'UTR	NM_199000	NP_945351			lipoma HMGIC fusion partner-like 3							integral to membrane					0																		---	---	---	---
SLC26A4	5172	broad.mit.edu	37	7	107340373	107340375	+	Intron	DEL	AAA	-	-	rs147331104		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:107340373_107340375delAAA	uc003vep.2	+						SLC26A4_uc011kmb.1_Intron|SLC26A4_uc011kmc.1_Intron|SLC26A4_uc011kmd.1_Intron	NM_000441	NP_000432			pendrin						regulation of pH|regulation of protein localization|sensory perception of sound	apical plasma membrane|integral to membrane	chloride transmembrane transporter activity|inorganic anion exchanger activity|iodide transmembrane transporter activity|secondary active sulfate transmembrane transporter activity			ovary(3)|central_nervous_system(2)|skin(2)	7														Pendred_syndrome				---	---	---	---
LRRN3	54674	broad.mit.edu	37	7	110764988	110764988	+	3'UTR	DEL	C	-	-	rs35553365		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:110764988delC	uc003vft.3	+	4					IMMP2L_uc003vfq.1_Intron|IMMP2L_uc010ljr.1_Intron|IMMP2L_uc003vfr.2_Intron|LRRN3_uc003vfu.3_3'UTR|LRRN3_uc003vfs.3_3'UTR	NM_001099660	NP_001093130			leucine rich repeat neuronal 3 precursor							integral to membrane				skin(3)|ovary(2)|pancreas(2)|central_nervous_system(1)	8				UCEC - Uterine corpus endometrioid carcinoma (4;0.245)|LUSC - Lung squamous cell carcinoma(290;0.0715)|Lung(3;0.0864)|STAD - Stomach adenocarcinoma(3;0.125)														---	---	---	---
ZNF786	136051	broad.mit.edu	37	7	148771739	148771740	+	Intron	INS	-	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:148771739_148771740insA	uc003wfh.2	-						ZNF786_uc011kuk.1_Intron|ZNF786_uc003wfi.2_Intron	NM_152411	NP_689624			zinc finger protein 786						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			breast(3)|skin(1)	4	Melanoma(164;0.15)		OV - Ovarian serous cystadenocarcinoma(82;0.00463)															---	---	---	---
MYBL1	4603	broad.mit.edu	37	8	67485454	67485463	+	Intron	DEL	AAACAAAACA	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:67485454_67485463delAAACAAAACA	uc003xwj.2	-						MYBL1_uc003xwl.2_Intron|MYBL1_uc003xwk.2_Intron	NM_001080416	NP_001073885			v-myb myeloblastosis viral oncogene homolog						positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(2)|pancreas(1)	3			Epithelial(68;0.00211)|all cancers(69;0.00726)|OV - Ovarian serous cystadenocarcinoma(28;0.00989)|BRCA - Breast invasive adenocarcinoma(89;0.0938)															---	---	---	---
GSN	2934	broad.mit.edu	37	9	124074857	124074857	+	Intron	DEL	A	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:124074857delA	uc004blf.1	+						GSN_uc004bld.1_Intron|GSN_uc010mvq.1_Intron|GSN_uc010mvr.1_Intron|GSN_uc010mvu.1_Intron|GSN_uc010mvt.1_Intron|GSN_uc010mvs.1_Intron|GSN_uc004ble.1_Intron|GSN_uc010mvv.1_Intron|GSN_uc011lyh.1_Intron|GSN_uc011lyi.1_Intron|GSN_uc011lyj.1_Intron|GSN_uc004blg.1_Intron	NM_000177	NP_000168			gelsolin isoform a precursor						actin filament polymerization|actin filament severing|barbed-end actin filament capping|cellular component disassembly involved in apoptosis|cilium morphogenesis	actin cytoskeleton|cytosol	actin binding|calcium ion binding|protein binding			breast(2)|ovary(1)	3																		---	---	---	---
CCBL1	883	broad.mit.edu	37	9	131598532	131598533	+	Intron	INS	-	TT	TT			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131598532_131598533insTT	uc004bwh.2	-						CCBL1_uc004bwf.2_Intron|CCBL1_uc004bwg.2_Intron|CCBL1_uc010myn.2_Intron|CCBL1_uc004bwj.2_Intron|CCBL1_uc011mbl.1_Intron|CCBL1_uc004bwi.2_Intron|CCBL1_uc010myo.2_Intron	NM_004059	NP_004050			kynurenine aminotransferase I isoform a						kynurenine metabolic process|L-phenylalanine catabolic process|tryptophan catabolic process	cytosol|nucleus	1-aminocyclopropane-1-carboxylate synthase activity|cysteine-S-conjugate beta-lyase activity|glutamine-phenylpyruvate transaminase activity|kynurenine-oxoglutarate transaminase activity|L-glutamine:pyruvate aminotransferase activity|L-phenylalanine:pyruvate aminotransferase activity|protein homodimerization activity|pyridoxal phosphate binding			ovary(1)	1					L-Glutamine(DB00130)|Pyridoxal Phosphate(DB00114)													---	---	---	---
CDH23	64072	broad.mit.edu	37	10	73553422	73553424	+	Intron	DEL	CCT	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:73553422_73553424delCCT	uc001jrx.3	+						CDH23_uc001jsg.3_5'Flank|CDH23_uc001jsh.3_5'Flank	NM_022124	NP_071407			cadherin-like 23 isoform 1 precursor						calcium ion transport|calcium-dependent cell-cell adhesion|cytosolic calcium ion homeostasis|equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	cytosol|integral to membrane|plasma membrane|stereocilium	calcium ion binding|protein binding			central_nervous_system(5)|large_intestine(4)|ovary(2)	11																		---	---	---	---
DENND5B	160518	broad.mit.edu	37	12	31562360	31562360	+	Intron	DEL	A	-	-	rs111670680		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31562360delA	uc001rki.1	-						DENND5B_uc001rkh.1_Intron|DENND5B_uc009zjq.1_Intron	NM_144973	NP_659410			DENN/MADD domain containing 5B							integral to membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
LOC283392	283392	broad.mit.edu	37	12	72666481	72666483	+	Intron	DEL	AAG	-	-	rs111457826		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:72666481_72666483delAAG	uc010stv.1	-						TRHDE_uc001sxa.2_5'Flank	NR_026836				Homo sapiens thyrotropin-releasing hormone degrading enzyme, mRNA (cDNA clone IMAGE:4992272).												0																		---	---	---	---
HEATR5A	25938	broad.mit.edu	37	14	31819967	31819970	+	Intron	DEL	TTTG	-	-	rs72055697		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31819967_31819970delTTTG	uc001wrf.3	-						HEATR5A_uc010ami.2_Intron|HEATR5A_uc001wrg.1_Intron|HEATR5A_uc010tpk.1_Intron	NM_015473	NP_056288			HEAT repeat containing 5A								binding			ovary(1)	1	Hepatocellular(127;0.0877)|Breast(36;0.137)		LUAD - Lung adenocarcinoma(48;0.00292)|Lung(238;0.0164)|BRCA - Breast invasive adenocarcinoma(188;0.0797)|STAD - Stomach adenocarcinoma(7;0.173)	GBM - Glioblastoma multiforme(265;0.0059)														---	---	---	---
CA12	771	broad.mit.edu	37	15	63668011	63668011	+	Intron	DEL	T	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63668011delT	uc002amc.2	-						CA12_uc002amd.2_Intron|CA12_uc002ame.2_Intron	NM_001218	NP_001209			carbonic anhydrase XII isoform 1 precursor						one-carbon metabolic process	integral to membrane	carbonate dehydratase activity|zinc ion binding			ovary(1)	1					Acetazolamide(DB00819)													---	---	---	---
RBPMS2	348093	broad.mit.edu	37	15	65043534	65043535	+	Intron	INS	-	A	A	rs113044919		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65043534_65043535insA	uc002anq.2	-							NM_194272	NP_919248			RNA binding protein with multiple splicing 2								nucleic acid binding|nucleotide binding				0																		---	---	---	---
Unknown	0	broad.mit.edu	37	16	13966971	13966973	+	IGR	DEL	TGG	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:13966971_13966973delTGG								SHISA9 (632699 upstream) : ERCC4 (47041 downstream)																																			---	---	---	---
VWA3A	146177	broad.mit.edu	37	16	22149612	22149613	+	Intron	INS	-	TG	TG	rs147489812	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:22149612_22149613insTG	uc010vbq.1	+						VWA3A_uc010bxd.2_Intron|VWA3A_uc010bxc.2_Intron	NM_173615	NP_775886			von Willebrand factor A domain containing 3A							extracellular region				skin(1)	1				GBM - Glioblastoma multiforme(48;0.0439)														---	---	---	---
TP53	7157	broad.mit.edu	37	17	7573993	7573994	+	Frame_Shift_Ins	INS	-	TCAGC	TCAGC			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7573993_7573994insTCAGC	uc002gim.2	-	10	1227_1228	c.1033_1034insGCTGA	c.(1033-1035)AATfs	p.N345fs	TP53_uc002gig.1_Intron|TP53_uc002gih.2_Intron|TP53_uc010cne.1_Intron|TP53_uc010cnf.1_3'UTR|TP53_uc010cng.1_3'UTR|TP53_uc002gii.1_Frame_Shift_Ins_p.N213fs|TP53_uc010cnh.1_3'UTR|TP53_uc010cni.1_3'UTR|TP53_uc002gij.2_Frame_Shift_Ins_p.N345fs	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	345	Oligomerization.|Interaction with HIPK1 (By similarity).|Interaction with CARM1.|Nuclear export signal.|Interaction with HIPK2.				activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.0?(7)|p.N345fs*25(3)|p.L344fs*23(2)|p.L344fs*22(1)|p.?(1)|p.R342_N345delRELN(1)|p.I332fs*5(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)			111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			---	---	---	---
POLDIP2	26073	broad.mit.edu	37	17	26684394	26684395	+	Splice_Site	INS	-	G	G	rs113730440		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26684394_26684395insG	uc002haz.2	-	2	210	c.78_splice	c.e2+1	p.W26_splice	POLDIP2_uc010wag.1_RNA|TMEM199_uc002hba.2_5'Flank|SARM1_uc010wah.1_5'Flank	NM_015584	NP_056399			DNA polymerase delta interacting protein 2							mitochondrial nucleoid|nucleus					0	all_lung(13;0.000354)|Lung NSC(42;0.00115)			UCEC - Uterine corpus endometrioid carcinoma (53;0.154)														---	---	---	---
ABI3	51225	broad.mit.edu	37	17	47295005	47295005	+	Intron	DEL	C	-	-	rs113223751		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:47295005delC	uc002iop.1	+						ABI3_uc002ioq.1_Intron	NM_016428	NP_057512			NESH protein isoform 1						cellular component movement|regulation of cell migration	cytoplasm|lamellipodium	protein binding				0			Epithelial(5;6.37e-06)|all cancers(6;6.36e-05)												HNSCC(55;0.14)			---	---	---	---
SNRPD1	6632	broad.mit.edu	37	18	19202891	19202891	+	Intron	DEL	T	-	-	rs111943199		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:19202891delT	uc002ktj.1	+							NM_006938	NP_008869			small nuclear ribonucleoprotein D1 polypeptide						ncRNA metabolic process|spliceosomal snRNP assembly|spliceosome assembly	catalytic step 2 spliceosome|cytosol|nucleoplasm|small nuclear ribonucleoprotein complex|U12-type spliceosomal complex	protein binding|RNA binding				0																		---	---	---	---
HKR1	284459	broad.mit.edu	37	19	37852828	37852828	+	Intron	DEL	A	-	-	rs67608963		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37852828delA	uc002ogb.2	+						HKR1_uc002ofx.2_Intron|HKR1_uc002ofy.2_Intron|HKR1_uc002oga.2_Intron|HKR1_uc010xto.1_Intron|HKR1_uc002ogc.2_Intron|HKR1_uc010xtp.1_Intron|HKR1_uc002ogd.2_Intron	NM_181786	NP_861451			GLI-Kruppel family member HKR1						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2			COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)															---	---	---	---
LSM14B	149986	broad.mit.edu	37	20	60699938	60699939	+	Intron	INS	-	T	T	rs142325994		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:60699938_60699939insT	uc010gjy.1	+						LSM14B_uc002ybt.2_Intron|LSM14B_uc010gjx.1_Intron|LSM14B_uc002ybv.2_Intron|LSM14B_uc010gjz.1_Intron|LSM14B_uc010zzz.1_Intron	NM_144703	NP_653304			LSM14 homolog B						multicellular organismal development|regulation of translation	ribonucleoprotein complex					0	Breast(26;3.97e-09)		BRCA - Breast invasive adenocarcinoma(19;1.28e-07)															---	---	---	---
GTPBP5	26164	broad.mit.edu	37	20	60775592	60775593	+	Intron	INS	-	AAAT	AAAT	rs146828134	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:60775592_60775593insAAAT	uc002yce.3	+						GTPBP5_uc011aab.1_Intron|GTPBP5_uc011aac.1_Intron|GTPBP5_uc011aad.1_Intron|GTPBP5_uc011aae.1_Intron|GTPBP5_uc011aaf.1_Intron	NM_015666	NP_056481			GTP binding protein 5						ribosome biogenesis	mitochondrion	GTP binding|GTPase activity|magnesium ion binding				0	Breast(26;3.52e-09)		BRCA - Breast invasive adenocarcinoma(19;2.5e-08)															---	---	---	---
TMPRSS15	5651	broad.mit.edu	37	21	19701699	19701699	+	Intron	DEL	A	-	-			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:19701699delA	uc002ykw.2	-							NM_002772	NP_002763			enterokinase precursor						proteolysis	brush border|integral to membrane	scavenger receptor activity|serine-type endopeptidase activity			ovary(5)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	8																		---	---	---	---
HUWE1	10075	broad.mit.edu	37	X	53629650	53629651	+	Intron	DEL	AT	-	-	rs35692881		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53629650_53629651delAT	uc004dsp.2	-							NM_031407	NP_113584			HECT, UBA and WWE domain containing 1						base-excision repair|cell differentiation|histone ubiquitination|protein monoubiquitination|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm|nucleus	DNA binding|protein binding|ubiquitin-protein ligase activity			ovary(8)|large_intestine(4)|breast(4)|kidney(1)	17																		---	---	---	---
SLC45A1	50651	broad.mit.edu	37	1	8390428	8390428	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:8390428C>T	uc001apb.2	+	4	875	c.875C>T	c.(874-876)CCG>CTG	p.P292L	SLC45A1_uc001apc.2_5'UTR	NM_001080397	NP_001073866	Q9Y2W3	S45A1_HUMAN	DNB5	292					carbohydrate transport	integral to membrane	symporter activity			central_nervous_system(2)|pancreas(1)|skin(1)	4	Ovarian(185;0.0661)|all_lung(157;0.127)	all_epithelial(116;1.22e-15)|all_lung(118;0.000147)|Lung NSC(185;0.000251)|Renal(390;0.000469)|Colorectal(325;0.00578)|Breast(348;0.00686)|Hepatocellular(190;0.0228)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.11)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|all cancers(8;3.95e-66)|GBM - Glioblastoma multiforme(8;5.93e-33)|Colorectal(212;2.86e-07)|COAD - Colon adenocarcinoma(227;3.11e-05)|Kidney(185;5.33e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000513)|KIRC - Kidney renal clear cell carcinoma(229;0.000979)|STAD - Stomach adenocarcinoma(132;0.00199)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
SLC2A5	6518	broad.mit.edu	37	1	9097965	9097965	+	Silent	SNP	C	T	T	rs111341866	byFrequency	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:9097965C>T	uc001apo.2	-	11	1585	c.1293G>A	c.(1291-1293)CCG>CCA	p.P431P	SLC2A5_uc010nzy.1_Silent_p.P372P|SLC2A5_uc010nzz.1_Silent_p.P316P|SLC2A5_uc010oaa.1_Silent_p.P387P|SLC2A5_uc010oab.1_Silent_p.P431P	NM_003039	NP_003030	P22732	GTR5_HUMAN	solute carrier family 2 (facilitated	431	Helical; Name=11; (Potential).				carbohydrate metabolic process	integral to membrane|plasma membrane	fructose transmembrane transporter activity|glucose transmembrane transporter activity			pancreas(2)|ovary(1)	3	Ovarian(185;0.112)|all_lung(157;0.185)	all_epithelial(116;1.34e-15)|all_lung(118;9.46e-05)|Lung NSC(185;0.000172)|Renal(390;0.000469)|Colorectal(325;0.0062)|Breast(348;0.00715)|Hepatocellular(190;0.0228)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.104)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;7.78e-07)|COAD - Colon adenocarcinoma(227;8.83e-05)|Kidney(185;0.000286)|KIRC - Kidney renal clear cell carcinoma(229;0.00103)|STAD - Stomach adenocarcinoma(132;0.0019)|BRCA - Breast invasive adenocarcinoma(304;0.00199)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
CLSTN1	22883	broad.mit.edu	37	1	9790620	9790620	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:9790620C>T	uc001aqh.2	-	19	3651	c.2892G>A	c.(2890-2892)CAG>CAA	p.Q964Q	CLSTN1_uc001aqi.2_Silent_p.Q954Q|CLSTN1_uc010oag.1_Silent_p.Q945Q|CLSTN1_uc001aqf.2_Silent_p.Q228Q	NM_001009566	NP_001009566	O94985	CSTN1_HUMAN	calsyntenin 1 isoform 1	964	Cytoplasmic (Potential).				homophilic cell adhesion	cell junction|cell projection|endoplasmic reticulum membrane|Golgi membrane|integral to membrane|nucleus|postsynaptic membrane	calcium ion binding			skin(1)	1	all_lung(157;0.222)	all_lung(284;4.03e-05)|Lung NSC(185;6.93e-05)|Renal(390;0.000147)|Colorectal(325;0.00205)|Breast(348;0.00314)|Hepatocellular(190;0.00825)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0234)|Colorectal(212;8.36e-08)|COAD - Colon adenocarcinoma(227;1.93e-05)|Kidney(185;0.000342)|BRCA - Breast invasive adenocarcinoma(304;0.000949)|KIRC - Kidney renal clear cell carcinoma(229;0.00122)|STAD - Stomach adenocarcinoma(132;0.00644)|READ - Rectum adenocarcinoma(331;0.0419)														---	---	---	---
KIF1B	23095	broad.mit.edu	37	1	10328200	10328200	+	Intron	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:10328200G>T	uc001aqx.3	+						KIF1B_uc001aqv.3_Intron|KIF1B_uc001aqw.3_Intron|KIF1B_uc001aqy.2_Intron|KIF1B_uc001aqz.2_Intron|KIF1B_uc001ara.2_Intron|KIF1B_uc001arb.2_Intron|KIF1B_uc009vmt.2_Intron	NM_015074	NP_055889			kinesin family member 1B isoform b						anterograde axon cargo transport|apoptosis|neuromuscular synaptic transmission|neuron-neuron synaptic transmission	cytoplasmic vesicle membrane|microtubule|microtubule associated complex|mitochondrion	ATP binding|ATPase activity|kinesin binding|microtubule motor activity|protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	Ovarian(185;0.203)	all_lung(284;1.31e-05)|Lung NSC(185;2.2e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0259)|Colorectal(212;9.79e-07)|COAD - Colon adenocarcinoma(227;0.000143)|BRCA - Breast invasive adenocarcinoma(304;0.000413)|Kidney(185;0.00134)|KIRC - Kidney renal clear cell carcinoma(229;0.0037)|STAD - Stomach adenocarcinoma(132;0.0113)|READ - Rectum adenocarcinoma(331;0.0642)														---	---	---	---
PAX7	5081	broad.mit.edu	37	1	18961684	18961684	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:18961684G>T	uc001bay.2	+	3	999	c.401G>T	c.(400-402)CGG>CTG	p.R134L	PAX7_uc001baz.2_Missense_Mutation_p.R134L|PAX7_uc010oct.1_Missense_Mutation_p.R134L	NM_002584	NP_002575	P23759	PAX7_HUMAN	paired box 7 isoform 1	134	Paired.				anti-apoptosis	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity		PAX7/FOXO1(197)	soft_tissue(197)|lung(3)|prostate(1)|ovary(1)|breast(1)	203		Colorectal(325;3.46e-05)|all_lung(284;0.000439)|Renal(390;0.000518)|Lung NSC(340;0.000543)|Breast(348;0.00093)|Ovarian(437;0.00768)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00609)|BRCA - Breast invasive adenocarcinoma(304;4.71e-05)|Kidney(64;0.000279)|KIRC - Kidney renal clear cell carcinoma(64;0.00371)|STAD - Stomach adenocarcinoma(196;0.00658)|READ - Rectum adenocarcinoma(331;0.0576)				T	FOXO1A	alveolar rhabdomyosarcoma								---	---	---	---
LUZP1	7798	broad.mit.edu	37	1	23417805	23417805	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:23417805C>T	uc001bgk.2	-	4	3334	c.2950G>A	c.(2950-2952)GAT>AAT	p.D984N	LUZP1_uc010odv.1_Missense_Mutation_p.D984N|LUZP1_uc001bgl.2_Missense_Mutation_p.D984N|LUZP1_uc001bgm.1_Missense_Mutation_p.D984N	NM_033631	NP_361013	Q86V48	LUZP1_HUMAN	leucine zipper protein 1	984						nucleus					0		Colorectal(325;3.46e-05)|Lung NSC(340;4.15e-05)|all_lung(284;6.64e-05)|Renal(390;0.000219)|Ovarian(437;0.00373)|Breast(348;0.00815)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;4.88e-27)|Colorectal(126;8.36e-08)|COAD - Colon adenocarcinoma(152;4.31e-06)|GBM - Glioblastoma multiforme(114;8.64e-05)|BRCA - Breast invasive adenocarcinoma(304;0.00112)|KIRC - Kidney renal clear cell carcinoma(1967;0.00176)|STAD - Stomach adenocarcinoma(196;0.0146)|READ - Rectum adenocarcinoma(331;0.0686)|Lung(427;0.0967)|LUSC - Lung squamous cell carcinoma(448;0.199)														---	---	---	---
MYOM3	127294	broad.mit.edu	37	1	24416562	24416562	+	Silent	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24416562A>T	uc001bin.3	-	13	1642	c.1479T>A	c.(1477-1479)GCT>GCA	p.A493A	MYOM3_uc001bim.3_Silent_p.A150A|MYOM3_uc001bio.2_Silent_p.A493A|MYOM3_uc001bip.1_Silent_p.A150A	NM_152372	NP_689585	Q5VTT5	MYOM3_HUMAN	myomesin family, member 3	493										skin(2)|ovary(1)	3		Colorectal(325;3.55e-05)|Renal(390;0.000703)|Lung NSC(340;0.001)|all_lung(284;0.0014)|Ovarian(437;0.00351)|Breast(348;0.0126)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;5.31e-24)|Colorectal(126;7.52e-08)|COAD - Colon adenocarcinoma(152;4.01e-06)|GBM - Glioblastoma multiforme(114;4.36e-06)|BRCA - Breast invasive adenocarcinoma(304;0.00108)|KIRC - Kidney renal clear cell carcinoma(1967;0.00404)|STAD - Stomach adenocarcinoma(196;0.00966)|READ - Rectum adenocarcinoma(331;0.0678)|Lung(427;0.153)														---	---	---	---
SLC30A2	7780	broad.mit.edu	37	1	26370885	26370885	+	Intron	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:26370885G>A	uc001blh.1	-						SLC30A2_uc001blg.1_Missense_Mutation_p.L108F	NM_032513	NP_115902			solute carrier family 30, member 2 isoform 2						positive regulation of sequestering of zinc ion|zinc ion transport	integral to membrane|late endosome|lysosomal membrane	cation transmembrane transporter activity				0		Colorectal(325;3.46e-05)|Lung NSC(340;6.18e-05)|all_lung(284;9.43e-05)|Renal(390;0.0007)|Ovarian(437;0.00473)|Breast(348;0.0155)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0298)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|OV - Ovarian serous cystadenocarcinoma(117;7.09e-26)|Colorectal(126;2.96e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.000728)|BRCA - Breast invasive adenocarcinoma(304;0.000969)|STAD - Stomach adenocarcinoma(196;0.00151)|GBM - Glioblastoma multiforme(114;0.00614)|READ - Rectum adenocarcinoma(331;0.0649)														---	---	---	---
BEND5	79656	broad.mit.edu	37	1	49201993	49201993	+	Silent	SNP	G	A	A	rs149855111	by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:49201993G>A	uc001crx.3	-	5	1070	c.1026C>T	c.(1024-1026)AGC>AGT	p.S342S	AGBL4_uc001cru.2_Intron|AGBL4_uc010omw.1_Intron|AGBL4_uc010omx.1_Intron|AGBL4_uc001crv.1_Intron|AGBL4_uc010omy.1_Intron|BEND5_uc001crw.3_Silent_p.S173S	NM_024603	NP_078879	Q7L4P6	BEND5_HUMAN	BEN domain containing 5	342	BEN.									skin(1)	1																		---	---	---	---
WDR78	79819	broad.mit.edu	37	1	67301455	67301455	+	Silent	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:67301455T>C	uc001dcx.2	-	11	1643	c.1587A>G	c.(1585-1587)CCA>CCG	p.P529P	WDR78_uc009waw.2_Silent_p.P275P|WDR78_uc009wax.2_Intron	NM_024763	NP_079039	Q5VTH9	WDR78_HUMAN	WD repeat domain 78 isoform 1	529										ovary(2)	2																		---	---	---	---
DPYD	1806	broad.mit.edu	37	1	97915763	97915763	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:97915763A>C	uc001drv.2	-	14	1894	c.1757T>G	c.(1756-1758)GTT>GGT	p.V586G		NM_000110	NP_000101	Q12882	DPYD_HUMAN	dihydropyrimidine dehydrogenase isoform 1	586					'de novo' pyrimidine base biosynthetic process|purine base catabolic process|thymidine catabolic process|thymine catabolic process|UMP biosynthetic process|uracil catabolic process	cytosol	4 iron, 4 sulfur cluster binding|dihydroorotate oxidase activity|dihydropyrimidine dehydrogenase (NADP+) activity|electron carrier activity|flavin adenine dinucleotide binding|metal ion binding|NADP binding|protein homodimerization activity			ovary(3)|skin(3)|breast(2)	8		all_epithelial(167;0.000185)|all_lung(203;0.00318)|Lung NSC(277;0.00994)		Colorectal(170;0.0165)|Epithelial(280;0.0526)|all cancers(265;0.104)|READ - Rectum adenocarcinoma(84;0.171)|Lung(183;0.216)	Capecitabine(DB01101)|Enfuvirtide(DB00109)													---	---	---	---
KCNA2	3737	broad.mit.edu	37	1	111146041	111146041	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:111146041T>G	uc001dzu.2	-	2	1860	c.1364A>C	c.(1363-1365)AAG>ACG	p.K455T	KCNA2_uc009wfv.1_Intron|KCNA2_uc009wfw.2_Missense_Mutation_p.K455T	NM_004974	NP_004965	P16389	KCNA2_HUMAN	potassium voltage-gated channel, shaker-related	455						juxtaparanode region of axon|voltage-gated potassium channel complex	delayed rectifier potassium channel activity			ovary(1)	1		all_cancers(81;5.55e-06)|all_epithelial(167;1.87e-05)|all_lung(203;0.000199)|Lung NSC(277;0.000398)		Colorectal(144;0.00878)|Lung(183;0.0234)|all cancers(265;0.0492)|Epithelial(280;0.0529)|COAD - Colon adenocarcinoma(174;0.131)|LUSC - Lung squamous cell carcinoma(189;0.133)|READ - Rectum adenocarcinoma(129;0.191)														---	---	---	---
KCNA2	3737	broad.mit.edu	37	1	111147160	111147160	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:111147160C>T	uc001dzu.2	-	2	741	c.245G>A	c.(244-246)CGC>CAC	p.R82H	KCNA2_uc009wfv.1_Missense_Mutation_p.R82H|KCNA2_uc009wfw.2_Missense_Mutation_p.R82H	NM_004974	NP_004965	P16389	KCNA2_HUMAN	potassium voltage-gated channel, shaker-related	82						juxtaparanode region of axon|voltage-gated potassium channel complex	delayed rectifier potassium channel activity			ovary(1)	1		all_cancers(81;5.55e-06)|all_epithelial(167;1.87e-05)|all_lung(203;0.000199)|Lung NSC(277;0.000398)		Colorectal(144;0.00878)|Lung(183;0.0234)|all cancers(265;0.0492)|Epithelial(280;0.0529)|COAD - Colon adenocarcinoma(174;0.131)|LUSC - Lung squamous cell carcinoma(189;0.133)|READ - Rectum adenocarcinoma(129;0.191)														---	---	---	---
SYCP1	6847	broad.mit.edu	37	1	115428890	115428890	+	Missense_Mutation	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:115428890G>C	uc001efr.2	+	14	1359	c.1150G>C	c.(1150-1152)GTC>CTC	p.V384L	SYCP1_uc010owt.1_RNA|SYCP1_uc001efq.2_Missense_Mutation_p.V384L|SYCP1_uc009wgw.2_Missense_Mutation_p.V384L	NM_003176	NP_003167	Q15431	SYCP1_HUMAN	synaptonemal complex protein 1	384	Potential.				cell division|reciprocal meiotic recombination|spermatogenesis|synaptonemal complex assembly		DNA binding			skin(1)	1	Lung SC(450;0.211)	all_cancers(81;8.65e-08)|all_epithelial(167;3.32e-07)|all_lung(203;6.55e-06)|Lung NSC(69;1.11e-05)|Acute lymphoblastic leukemia(138;0.221)		Lung(183;0.0234)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|all cancers(265;0.112)|Epithelial(280;0.124)|LUSC - Lung squamous cell carcinoma(189;0.133)														---	---	---	---
PDE4DIP	9659	broad.mit.edu	37	1	144921933	144921933	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144921933C>T	uc001elw.3	-	9	1387	c.1096G>A	c.(1096-1098)GAG>AAG	p.E366K	NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|PDE4DIP_uc001elx.3_Missense_Mutation_p.E432K|PDE4DIP_uc001emc.1_Missense_Mutation_p.E366K|PDE4DIP_uc001emd.1_Missense_Mutation_p.E366K|PDE4DIP_uc001emb.1_Missense_Mutation_p.E529K|PDE4DIP_uc001eme.1_5'UTR|PDE4DIP_uc001emf.1_Missense_Mutation_p.E153K	NM_014644	NP_055459	Q5VU43	MYOME_HUMAN	phosphodiesterase 4D interacting protein isoform	366	Potential.				cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)				T	PDGFRB	MPD								---	---	---	---
LOC200030	200030	broad.mit.edu	37	1	148017549	148017549	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:148017549A>C	uc001eqf.2	-	12	1789	c.1754T>G	c.(1753-1755)TTT>TGT	p.F585C	LOC200030_uc001eqe.2_Intron|LOC200030_uc001eqg.2_Intron|FLJ39739_uc001eqo.1_Intron|NBPF14_uc010pab.1_Intron|NBPF14_uc010pac.1_Intron|NBPF14_uc001eqx.2_Intron|NBPF14_uc010pae.1_Intron|NBPF14_uc010paf.1_Intron|NBPF14_uc009wkf.1_RNA|NBPF14_uc001eqq.2_Missense_Mutation_p.F245C|NBPF14_uc001eqs.1_Missense_Mutation_p.F124C	NM_017940	NP_060410	Q86T75	NBPFB_HUMAN	hypothetical protein LOC55672	585	NBPF 3.					cytoplasm					0																		---	---	---	---
FLG	2312	broad.mit.edu	37	1	152277559	152277559	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152277559G>T	uc001ezu.1	-	3	9839	c.9803C>A	c.(9802-9804)GCA>GAA	p.A3268E		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	3268	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)											Ichthyosis				---	---	---	---
FLG	2312	broad.mit.edu	37	1	152279828	152279828	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152279828T>C	uc001ezu.1	-	3	7570	c.7534A>G	c.(7534-7536)AGT>GGT	p.S2512G		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	2512	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)											Ichthyosis				---	---	---	---
FLG	2312	broad.mit.edu	37	1	152282729	152282729	+	Silent	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152282729T>G	uc001ezu.1	-	3	4669	c.4633A>C	c.(4633-4635)AGA>CGA	p.R1545R		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	1545	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)											Ichthyosis				---	---	---	---
GBA	2629	broad.mit.edu	37	1	155207192	155207192	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155207192G>A	uc001fjh.2	-	7	1089	c.939C>T	c.(937-939)CAC>CAT	p.H313H	RAG1AP1_uc010pey.1_Intron|GBA_uc010pfw.1_Silent_p.H200H|GBA_uc010pfx.1_Silent_p.H264H|GBA_uc001fji.2_Silent_p.H313H|GBA_uc001fjj.2_Silent_p.H313H|GBA_uc001fjk.2_Silent_p.H313H|GBA_uc001fjl.2_Silent_p.H313H|GBA_uc010pfy.1_Silent_p.H226H|GBA_uc009wqk.1_Silent_p.H226H	NM_000157	NP_000148	P04062	GLCM_HUMAN	glucocerebrosidase precursor	313					carbohydrate metabolic process|cell death|cellular response to tumor necrosis factor|ceramide biosynthetic process|glucosylceramide catabolic process|lysosome organization|negative regulation of interleukin-6 production|negative regulation of MAP kinase activity|positive regulation of protein dephosphorylation|sphingosine biosynthetic process|termination of signal transduction	lysosomal lumen|lysosomal membrane	cation binding|glucosylceramidase activity|receptor binding			ovary(1)|skin(1)	2	all_lung(78;2.32e-23)|Hepatocellular(266;0.0877)|all_hematologic(923;0.088)		Epithelial(20;3.72e-10)|all cancers(21;1.19e-09)|BRCA - Breast invasive adenocarcinoma(34;0.000752)|LUSC - Lung squamous cell carcinoma(543;0.193)		Alglucerase(DB00088)|Imiglucerase(DB00053)									Gaucher_disease_type_I				---	---	---	---
RUSC1	23623	broad.mit.edu	37	1	155295098	155295098	+	Intron	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155295098C>T	uc001fkj.2	+						RAG1AP1_uc010pey.1_Intron|C1orf104_uc001fki.2_5'Flank|RUSC1_uc001fkk.2_Intron|RUSC1_uc009wqn.1_Intron|RUSC1_uc009wqo.1_Intron|RUSC1_uc001fkl.2_Intron|RUSC1_uc001fkp.2_Intron|RUSC1_uc001fkq.2_Intron|RUSC1_uc010pgb.1_Intron|RUSC1_uc009wqp.1_Missense_Mutation_p.H34Y|RUSC1_uc001fkn.2_Intron|RUSC1_uc001fko.2_Intron|RUSC1_uc001fkr.2_Intron|RUSC1_uc001fks.2_5'Flank	NM_001105203	NP_001098673			RUN and SH3 domain containing 1 isoform a							cytoplasm|nucleolus	SH3/SH2 adaptor activity			ovary(2)	2	Hepatocellular(266;0.0877)|all_hematologic(923;0.145)		Epithelial(20;1.55e-10)|all cancers(21;4.15e-10)|BRCA - Breast invasive adenocarcinoma(34;0.000549)|LUSC - Lung squamous cell carcinoma(543;0.127)													OREG0013860	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
GPATCH4	54865	broad.mit.edu	37	1	156568060	156568060	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156568060A>C	uc001fpm.2	-	4	259	c.220T>G	c.(220-222)TTC>GTC	p.F74V	GPATCH4_uc001fpl.2_Missense_Mutation_p.F69V	NM_015590	NP_056405	Q5T3I0	GPTC4_HUMAN	G patch domain containing 4 isoform 1	69						intracellular	nucleic acid binding			ovary(1)	1	all_hematologic(923;0.088)|Hepatocellular(266;0.158)																	---	---	---	---
OR6Y1	391112	broad.mit.edu	37	1	158517000	158517000	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158517000T>G	uc010pil.1	-	1	896	c.896A>C	c.(895-897)AAC>ACC	p.N299T		NM_001005189	NP_001005189	Q8NGX8	OR6Y1_HUMAN	olfactory receptor, family 6, subfamily Y,	299	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_hematologic(112;0.0378)																	---	---	---	---
C1orf129	80133	broad.mit.edu	37	1	170934299	170934299	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:170934299T>C	uc001ghg.2	+	7	513	c.383T>C	c.(382-384)CTC>CCC	p.L128P	C1orf129_uc009wvy.2_5'UTR|C1orf129_uc010plz.1_Missense_Mutation_p.L128P	NM_025063	NP_079339	Q5TGP6	CA129_HUMAN	hypothetical protein LOC80133 isoform 2	128							binding			pancreas(1)	1	all_hematologic(923;0.0922)|Acute lymphoblastic leukemia(37;0.181)																	---	---	---	---
C1orf9	51430	broad.mit.edu	37	1	172501623	172501623	+	5'Flank	SNP	T	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:172501623T>A	uc001giq.3	+						C1orf9_uc010pmm.1_5'Flank|C1orf9_uc009wwd.2_5'Flank|C1orf9_uc010pmn.1_5'Flank|C1orf9_uc010pmo.1_5'Flank	NM_014283	NP_055098			chromosome 1 open reading frame 9 protein						multicellular organismal development|ossification	integral to membrane|rough endoplasmic reticulum membrane				ovary(2)	2		Breast(1374;0.212)		Colorectal(1306;3.98e-05)|KIRC - Kidney renal clear cell carcinoma(1967;0.00544)														---	---	---	---
ASTN1	460	broad.mit.edu	37	1	176927629	176927629	+	Intron	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:176927629A>G	uc001glc.2	-						ASTN1_uc001glb.1_Intron|ASTN1_uc001gld.1_Intron|ASTN1_uc009wwx.1_Intron	NM_004319	NP_004310			astrotactin isoform 1						cell migration|neuron cell-cell adhesion	integral to membrane				ovary(6)|skin(5)|central_nervous_system(2)|large_intestine(1)|lung(1)	15																		---	---	---	---
CACNA1E	777	broad.mit.edu	37	1	181764055	181764055	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:181764055G>A	uc001gow.2	+	45	6119	c.5954G>A	c.(5953-5955)CGT>CAT	p.R1985H	CACNA1E_uc009wxs.2_Missense_Mutation_p.R1873H|CACNA1E_uc009wxt.2_Missense_Mutation_p.R1254H	NM_000721	NP_000712	Q15878	CAC1E_HUMAN	calcium channel, voltage-dependent, R type,	2028	Cytoplasmic (Potential).				energy reserve metabolic process|membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	voltage-gated calcium channel activity			ovary(3)|central_nervous_system(2)|pancreas(1)	6																		---	---	---	---
RNASEL	6041	broad.mit.edu	37	1	182555272	182555272	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:182555272G>A	uc001gpj.1	-	1	837	c.670C>T	c.(670-672)CTG>TTG	p.L224L	RNASEL_uc009wxz.1_Silent_p.L224L|RNASEL_uc001gpk.2_Silent_p.L224L|RNASEL_uc009wya.1_Silent_p.L224L	NM_021133	NP_066956	Q05823	RN5A_HUMAN	ribonuclease L	224	ANK 6.				mRNA processing|response to virus|type I interferon-mediated signaling pathway	mitochondrion	ATP binding|endoribonuclease activity, producing 5'-phosphomonoesters|metal ion binding|protein kinase activity|RNA binding			ovary(4)|stomach(1)	5														Hereditary_Prostate_Cancer				---	---	---	---
RGS21	431704	broad.mit.edu	37	1	192316523	192316523	+	Intron	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:192316523A>C	uc001gsh.2	+							NM_001039152	NP_001034241			regulator of G-protein signaling 21						negative regulation of signal transduction	cytoplasm|plasma membrane	GTPase activator activity|signal transducer activity			ovary(1)|skin(1)	2																		---	---	---	---
SYT2	127833	broad.mit.edu	37	1	202571672	202571672	+	Missense_Mutation	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202571672A>T	uc001gye.2	-	5	660	c.467T>A	c.(466-468)CTT>CAT	p.L156H	SYT2_uc010pqb.1_Missense_Mutation_p.L156H|SYT2_uc009xaf.2_5'UTR	NM_001136504	NP_001129976	Q8N9I0	SYT2_HUMAN	synaptotagmin II	156	Phospholipid binding (By similarity).|C2 1.|Cytoplasmic (Potential).				neurotransmitter secretion	cell junction|chromaffin granule membrane|endocytic vesicle membrane|integral to membrane|synaptic vesicle membrane	protein binding|transporter activity			ovary(2)|skin(1)	3			BRCA - Breast invasive adenocarcinoma(75;0.169)		Botulinum Toxin Type B(DB00042)													---	---	---	---
PLEKHA6	22874	broad.mit.edu	37	1	204197347	204197347	+	Silent	SNP	G	A	A	rs139252016	byFrequency	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:204197347G>A	uc001hau.2	-	21	3212	c.2895C>T	c.(2893-2895)AAC>AAT	p.N965N		NM_014935	NP_055750	Q9Y2H5	PKHA6_HUMAN	phosphoinositol 3-phosphate-binding protein-3	965										ovary(3)|pancreas(1)	4	all_cancers(21;0.0222)|Breast(84;0.179)		KIRC - Kidney renal clear cell carcinoma(13;0.0584)|BRCA - Breast invasive adenocarcinoma(75;0.0833)|Kidney(21;0.0934)|Epithelial(59;0.229)															---	---	---	---
IL10	3586	broad.mit.edu	37	1	206943236	206943236	+	Missense_Mutation	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206943236G>C	uc001hen.1	-	4	441	c.382C>G	c.(382-384)CGA>GGA	p.R128G		NM_000572	NP_000563	P22301	IL10_HUMAN	interleukin 10 precursor	128					anti-apoptosis|B cell differentiation|B cell proliferation|cytoplasmic sequestering of NF-kappaB|inflammatory response|leukocyte chemotaxis|negative regulation of B cell proliferation|negative regulation of cytokine secretion involved in immune response|negative regulation of interferon-alpha biosynthetic process|negative regulation of interleukin-6 production|negative regulation of membrane protein ectodomain proteolysis|negative regulation of MHC class II biosynthetic process|negative regulation of T cell proliferation|positive regulation of B cell apoptosis|positive regulation of cytokine secretion|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription, DNA-dependent|receptor biosynthetic process|regulation of isotype switching|response to glucocorticoid stimulus|type 2 immune response	extracellular space	cytokine activity|growth factor activity|interleukin-10 receptor binding				0	Breast(84;0.183)		BRCA - Breast invasive adenocarcinoma(75;0.211)															---	---	---	---
CENPF	1063	broad.mit.edu	37	1	214815817	214815817	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:214815817T>G	uc001hkm.2	+	12	4310	c.4136T>G	c.(4135-4137)GTG>GGG	p.V1379G		NM_016343	NP_057427	P49454	CENPF_HUMAN	centromere protein F	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					cell differentiation|cell division|cell proliferation|DNA replication|G2 phase of mitotic cell cycle|kinetochore assembly|metaphase plate congression|mitotic cell cycle spindle assembly checkpoint|mitotic prometaphase|muscle organ development|negative regulation of transcription, DNA-dependent|protein transport|regulation of G2/M transition of mitotic cell cycle|regulation of striated muscle tissue development|response to drug	condensed chromosome outer kinetochore|cytosol|midbody|nuclear envelope|nuclear matrix|perinuclear region of cytoplasm|spindle pole	chromatin binding|dynein binding|protein C-terminus binding|protein homodimerization activity|transcription factor binding			ovary(6)|central_nervous_system(4)|large_intestine(2)|skin(1)	13				all cancers(67;0.00836)|OV - Ovarian serous cystadenocarcinoma(81;0.00855)|GBM - Glioblastoma multiforme(131;0.0694)|Epithelial(68;0.0833)														---	---	---	---
ESRRG	2104	broad.mit.edu	37	1	216692702	216692702	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216692702A>C	uc001hkw.1	-	6	1090	c.924T>G	c.(922-924)ATT>ATG	p.I308M	ESRRG_uc001hky.1_Missense_Mutation_p.I285M|ESRRG_uc009xdp.1_Missense_Mutation_p.I285M|ESRRG_uc001hkz.1_Missense_Mutation_p.I246M|ESRRG_uc010puc.1_Missense_Mutation_p.I285M|ESRRG_uc001hla.1_Missense_Mutation_p.I285M|ESRRG_uc001hlb.1_Missense_Mutation_p.I285M|ESRRG_uc010pud.1_Missense_Mutation_p.I116M|ESRRG_uc001hlc.1_Missense_Mutation_p.I285M|ESRRG_uc001hld.1_Missense_Mutation_p.I285M|ESRRG_uc001hkx.1_Missense_Mutation_p.I320M|ESRRG_uc009xdo.1_Missense_Mutation_p.I285M|ESRRG_uc001hle.1_Missense_Mutation_p.I285M	NM_001438	NP_001429	P62508	ERR3_HUMAN	estrogen-related receptor gamma isoform 1	308					positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	AF-2 domain binding|retinoic acid receptor activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)|kidney(1)	2				OV - Ovarian serous cystadenocarcinoma(81;0.0358)|all cancers(67;0.0693)|GBM - Glioblastoma multiforme(131;0.0713)	Diethylstilbestrol(DB00255)													---	---	---	---
ESRRG	2104	broad.mit.edu	37	1	216692733	216692733	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216692733A>C	uc001hkw.1	-	6	1059	c.893T>G	c.(892-894)ATG>AGG	p.M298R	ESRRG_uc001hky.1_Missense_Mutation_p.M275R|ESRRG_uc009xdp.1_Missense_Mutation_p.M275R|ESRRG_uc001hkz.1_Missense_Mutation_p.M236R|ESRRG_uc010puc.1_Missense_Mutation_p.M275R|ESRRG_uc001hla.1_Missense_Mutation_p.M275R|ESRRG_uc001hlb.1_Missense_Mutation_p.M275R|ESRRG_uc010pud.1_Missense_Mutation_p.M106R|ESRRG_uc001hlc.1_Missense_Mutation_p.M275R|ESRRG_uc001hld.1_Missense_Mutation_p.M275R|ESRRG_uc001hkx.1_Missense_Mutation_p.M310R|ESRRG_uc009xdo.1_Missense_Mutation_p.M275R|ESRRG_uc001hle.1_Missense_Mutation_p.M275R	NM_001438	NP_001429	P62508	ERR3_HUMAN	estrogen-related receptor gamma isoform 1	298					positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	AF-2 domain binding|retinoic acid receptor activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)|kidney(1)	2				OV - Ovarian serous cystadenocarcinoma(81;0.0358)|all cancers(67;0.0693)|GBM - Glioblastoma multiforme(131;0.0713)	Diethylstilbestrol(DB00255)													---	---	---	---
NID1	4811	broad.mit.edu	37	1	236212088	236212088	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236212088G>A	uc001hxo.2	-	2	529	c.427C>T	c.(427-429)CCG>TCG	p.P143S	NID1_uc009xgd.2_Missense_Mutation_p.P143S	NM_002508	NP_002499	P14543	NID1_HUMAN	nidogen 1 precursor	143	NIDO.				cell-matrix adhesion	basement membrane	calcium ion binding			large_intestine(1)|pancreas(1)	2	Ovarian(103;0.0544)|Breast(184;0.23)	all_cancers(173;0.00491)|Prostate(94;0.184)|Acute lymphoblastic leukemia(190;0.229)	OV - Ovarian serous cystadenocarcinoma(106;0.00162)		Becaplermin(DB00102)|Urokinase(DB00013)													---	---	---	---
RYR2	6262	broad.mit.edu	37	1	237756796	237756796	+	Silent	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237756796C>A	uc001hyl.1	+	33	4416	c.4296C>A	c.(4294-4296)ATC>ATA	p.I1432I		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	1432	Cytoplasmic (By similarity).|B30.2/SPRY 3.|4 X approximate repeats.				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---
RYR2	6262	broad.mit.edu	37	1	237758906	237758906	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237758906C>A	uc001hyl.1	+	34	4665	c.4545C>A	c.(4543-4545)AGC>AGA	p.S1515R		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	1515	Cytoplasmic (By similarity).|B30.2/SPRY 3.|4 X approximate repeats.				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)															---	---	---	---
ZNF669	79862	broad.mit.edu	37	1	247263752	247263752	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247263752T>C	uc001ice.2	-	4	1492	c.1319A>G	c.(1318-1320)CAT>CGT	p.H440R	ZNF669_uc001icf.2_Missense_Mutation_p.H354R	NM_024804	NP_079080	Q96BR6	ZN669_HUMAN	zinc finger protein 669 isoform 1	440	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(71;4.09e-05)|all_epithelial(71;6.72e-06)|Breast(184;0.0226)|Ovarian(71;0.0283)|all_lung(81;0.0488)|Lung NSC(105;0.053)		OV - Ovarian serous cystadenocarcinoma(106;0.00427)															---	---	---	---
OR2L2	26246	broad.mit.edu	37	1	248202430	248202430	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248202430C>T	uc001idw.2	+	1	957	c.861C>T	c.(859-861)ATC>ATT	p.I287I	OR2L13_uc001ids.2_Intron	NM_001004686	NP_001004686	Q8NH16	OR2L2_HUMAN	olfactory receptor, family 2, subfamily L,	287	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3	all_cancers(71;0.000149)|all_epithelial(71;1.27e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0278)															---	---	---	---
FSHR	2492	broad.mit.edu	37	2	49217713	49217713	+	Missense_Mutation	SNP	T	A	A	rs1126715		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:49217713T>A	uc002rww.2	-	5	512	c.438A>T	c.(436-438)AAA>AAT	p.K146N	FSHR_uc002rwx.2_Missense_Mutation_p.K146N|FSHR_uc010fbn.2_Missense_Mutation_p.K146N|FSHR_uc010fbo.1_RNA	NM_000145	NP_000136	P23945	FSHR_HUMAN	follicle stimulating hormone receptor isoform 1	146	LRR 5.|Extracellular (Potential).				female gamete generation|male gonad development|spermatogenesis	integral to membrane|plasma membrane	follicle-stimulating hormone receptor activity|protein binding			ovary(4)|lung(2)|central_nervous_system(1)|skin(1)	8		all_hematologic(82;0.152)|Acute lymphoblastic leukemia(82;0.181)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)		Choriogonadotropin alfa(DB00097)|Follitropin beta(DB00066)|Menotropins(DB00032)|Urofollitropin(DB00094)									Gonadal_Dysgenesis_46_XX				---	---	---	---
RTN4	57142	broad.mit.edu	37	2	55209688	55209688	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:55209688C>T	uc002rye.2	-	5	3621	c.3323G>A	c.(3322-3324)CGC>CAC	p.R1108H	RTN4_uc002ryc.2_Missense_Mutation_p.R115H|RTN4_uc002ryd.2_Missense_Mutation_p.R902H|RTN4_uc002ryf.2_Missense_Mutation_p.R308H|RTN4_uc002ryg.2_Missense_Mutation_p.R289H	NM_020532	NP_065393	Q9NQC3	RTN4_HUMAN	reticulon 4 isoform A	1108	Lumenal (Potential).|Reticulon.				apoptosis|axonal fasciculation|cerebral cortex radial glia guided migration|endoplasmic reticulum tubular network organization|negative regulation of anti-apoptosis|negative regulation of axon extension|nerve growth factor receptor signaling pathway|regulation of apoptosis|regulation of branching morphogenesis of a nerve|regulation of cell migration	integral to endoplasmic reticulum membrane|nuclear envelope|plasma membrane	protein binding			ovary(2)|large_intestine(1)	3																		---	---	---	---
DYSF	8291	broad.mit.edu	37	2	71795359	71795359	+	Missense_Mutation	SNP	T	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71795359T>A	uc002sie.2	+	26	3077	c.2701T>A	c.(2701-2703)TAC>AAC	p.Y901N	DYSF_uc010feg.2_Missense_Mutation_p.Y932N|DYSF_uc010feh.2_Missense_Mutation_p.Y887N|DYSF_uc002sig.3_Missense_Mutation_p.Y887N|DYSF_uc010yqx.1_RNA|DYSF_uc010fee.2_Missense_Mutation_p.Y901N|DYSF_uc010fef.2_Missense_Mutation_p.Y918N|DYSF_uc010fei.2_Missense_Mutation_p.Y918N|DYSF_uc010fek.2_Missense_Mutation_p.Y919N|DYSF_uc010fej.2_Missense_Mutation_p.Y888N|DYSF_uc010fel.2_Missense_Mutation_p.Y888N|DYSF_uc010feo.2_Missense_Mutation_p.Y933N|DYSF_uc010fem.2_Missense_Mutation_p.Y902N|DYSF_uc010fen.2_Missense_Mutation_p.Y919N|DYSF_uc002sif.2_Missense_Mutation_p.Y902N	NM_003494	NP_003485	O75923	DYSF_HUMAN	dysferlin isoform 8	901	Cytoplasmic (Potential).					cytoplasmic vesicle membrane|integral to membrane|sarcolemma	calcium-dependent phospholipid binding			ovary(3)|breast(2)|pancreas(1)|skin(1)	7																		---	---	---	---
LOXL3	84695	broad.mit.edu	37	2	74777399	74777399	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74777399C>T	uc002smp.1	-	3	462	c.390G>A	c.(388-390)GGG>GGA	p.G130G	LOXL3_uc002smo.1_5'Flank|LOXL3_uc010ffm.1_Silent_p.G130G|LOXL3_uc002smq.1_Silent_p.G130G|LOXL3_uc010ffn.1_Silent_p.G130G|DOK1_uc002smr.2_Intron	NM_032603	NP_115992	P58215	LOXL3_HUMAN	lysyl oxidase-like 3 precursor	130	SRCR 1.					extracellular space|membrane	copper ion binding|protein-lysine 6-oxidase activity|scavenger receptor activity				0																		---	---	---	---
TGFBRAP1	9392	broad.mit.edu	37	2	105889361	105889361	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:105889361C>T	uc002tcq.2	-	10	2007	c.1923G>A	c.(1921-1923)CTG>CTA	p.L641L	TGFBRAP1_uc010fjc.2_Silent_p.L410L|TGFBRAP1_uc002tcr.3_Silent_p.L641L	NM_004257	NP_004248	Q8WUH2	TGFA1_HUMAN	transforming growth factor, beta receptor	641					regulation of transcription, DNA-dependent|transforming growth factor beta receptor signaling pathway	cytoplasm|membrane	SMAD binding|small GTPase regulator activity|transforming growth factor beta receptor binding			central_nervous_system(1)|skin(1)	2																		---	---	---	---
TTL	150465	broad.mit.edu	37	2	113286266	113286266	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:113286266A>G	uc002thu.2	+	7	1207	c.1028A>G	c.(1027-1029)TAT>TGT	p.Y343C	TTL_uc010fkm.1_Intron	NM_153712	NP_714923	Q8NG68	TTL_HUMAN	tubulin tyrosine ligase	343	TTL.				protein modification process		ATP binding|tubulin-tyrosine ligase activity				0		Ovarian(717;0.024)		BRCA - Breast invasive adenocarcinoma(221;6.17e-07)|STAD - Stomach adenocarcinoma(1183;0.00644)				T	ETV6	ALL								---	---	---	---
MARCO	8685	broad.mit.edu	37	2	119739960	119739960	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:119739960G>T	uc002tln.1	+	12	1169	c.1037G>T	c.(1036-1038)GGC>GTC	p.G346V	MARCO_uc010yyf.1_Missense_Mutation_p.G268V	NM_006770	NP_006761	Q9UEW3	MARCO_HUMAN	macrophage receptor with collagenous structure	346	Collagen-like.|Extracellular (Potential).				cell surface receptor linked signaling pathway|innate immune response	collagen|integral to plasma membrane	pattern recognition receptor activity|scavenger receptor activity			ovary(3)|skin(2)|central_nervous_system(1)	6																		---	---	---	---
CNTNAP5	129684	broad.mit.edu	37	2	124783312	124783312	+	Intron	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:124783312G>T	uc002tno.2	+						CNTNAP5_uc010flu.2_Intron	NM_130773	NP_570129			contactin associated protein-like 5 precursor						cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(10)	10				BRCA - Breast invasive adenocarcinoma(221;0.248)														---	---	---	---
ORC4L	5000	broad.mit.edu	37	2	148705692	148705692	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:148705692A>C	uc002twi.2	-	9	825	c.690T>G	c.(688-690)TTT>TTG	p.F230L	ORC4L_uc002twj.2_Missense_Mutation_p.F230L|ORC4L_uc010zbo.1_Missense_Mutation_p.F156L|ORC4L_uc010zbp.1_Missense_Mutation_p.F13L|ORC4L_uc010fnr.2_Missense_Mutation_p.F230L|ORC4L_uc010zbq.1_Missense_Mutation_p.F146L|ORC4L_uc002twk.2_Missense_Mutation_p.F230L|ORC4L_uc010zbr.1_Missense_Mutation_p.F230L	NM_181741	NP_859525	O43929	ORC4_HUMAN	origin recognition complex subunit 4	230					cell cycle checkpoint|DNA-dependent DNA replication initiation|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|S phase of mitotic cell cycle	nuclear origin of replication recognition complex|nucleoplasm	ATP binding|DNA replication origin binding|nucleoside-triphosphatase activity|protein binding				0				BRCA - Breast invasive adenocarcinoma(221;0.0963)|COAD - Colon adenocarcinoma(177;0.203)														---	---	---	---
EPC2	26122	broad.mit.edu	37	2	149526718	149526718	+	Splice_Site	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:149526718A>G	uc010zbt.1	+	8	1168	c.1141_splice	c.e8-2	p.V381_splice		NM_015630	NP_056445			enhancer of polycomb homolog 2						chromatin modification|DNA repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(1)|breast(1)|pancreas(1)	3				BRCA - Breast invasive adenocarcinoma(221;0.0516)														---	---	---	---
SCN3A	6328	broad.mit.edu	37	2	165950892	165950892	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:165950892G>A	uc002ucx.2	-	26	5020	c.4528C>T	c.(4528-4530)CGC>TGC	p.R1510C	SCN3A_uc010zcy.1_5'Flank|SCN3A_uc002ucy.2_Missense_Mutation_p.R1461C|SCN3A_uc002ucz.2_Missense_Mutation_p.R1461C	NM_006922	NP_008853	Q9NY46	SCN3A_HUMAN	sodium channel, voltage-gated, type III, alpha	1510						voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(4)|breast(3)|skin(2)|central_nervous_system(1)	10					Lamotrigine(DB00555)													---	---	---	---
XIRP2	129446	broad.mit.edu	37	2	167760240	167760240	+	Missense_Mutation	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:167760240A>T	uc002udx.2	+	1	266	c.248A>T	c.(247-249)AAG>ATG	p.K83M	XIRP2_uc010fpn.2_Missense_Mutation_p.K83M|XIRP2_uc010fpo.2_Missense_Mutation_p.K83M|XIRP2_uc010fpp.2_Missense_Mutation_p.K83M	NM_152381	NP_689594	A4UGR9	XIRP2_HUMAN	xin actin-binding repeat containing 2 isoform 1	Error:Variant_position_missing_in_A4UGR9_after_alignment					actin cytoskeleton organization	cell junction	actin binding			skin(7)|ovary(6)|pancreas(1)	14																		---	---	---	---
TTN	7273	broad.mit.edu	37	2	179400404	179400404	+	Silent	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179400404G>C	uc010zfg.1	-	307	93458	c.93234C>G	c.(93232-93234)GTC>GTG	p.V31078V	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Silent_p.V24773V|TTN_uc010zfi.1_Silent_p.V24706V|TTN_uc010zfj.1_Silent_p.V24581V	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	32005							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)															---	---	---	---
PGAP1	80055	broad.mit.edu	37	2	197757109	197757109	+	Silent	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197757109A>G	uc002utw.2	-	9	1164	c.1050T>C	c.(1048-1050)GTT>GTC	p.V350V	PGAP1_uc002utx.2_Silent_p.V176V|PGAP1_uc002uty.1_Silent_p.V350V|PGAP1_uc010zgv.1_Intron|PGAP1_uc010fsj.2_Intron	NM_024989	NP_079265	Q75T13	PGAP1_HUMAN	GPI deacylase	350	Lumenal (Potential).				attachment of GPI anchor to protein|C-terminal protein lipidation|intracellular protein transport|myo-inositol transport	integral to membrane|intrinsic to endoplasmic reticulum membrane	nuclease activity|phosphoric ester hydrolase activity			ovary(3)|central_nervous_system(1)	4																		---	---	---	---
MAP2	4133	broad.mit.edu	37	2	210559045	210559045	+	Missense_Mutation	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:210559045C>G	uc002vde.1	+	7	2399	c.2151C>G	c.(2149-2151)AAC>AAG	p.N717K	MAP2_uc002vdc.1_Missense_Mutation_p.N717K|MAP2_uc002vdd.1_Intron|MAP2_uc002vdf.1_Intron|MAP2_uc002vdg.1_Intron|MAP2_uc002vdh.1_Intron|MAP2_uc002vdi.1_Missense_Mutation_p.N713K	NM_002374	NP_002365	P11137	MAP2_HUMAN	microtubule-associated protein 2 isoform 1	717					central nervous system neuron development|dendrite morphogenesis|negative regulation of microtubule depolymerization	cytoplasm|microtubule|microtubule associated complex	beta-dystroglycan binding|calmodulin binding|structural molecule activity			ovary(9)|upper_aerodigestive_tract(2)|large_intestine(2)|pancreas(2)|central_nervous_system(1)|skin(1)	17		Hepatocellular(293;0.137)|Lung NSC(271;0.163)|Renal(323;0.202)		UCEC - Uterine corpus endometrioid carcinoma (47;6.64e-05)|Epithelial(149;3.12e-100)|all cancers(144;6.88e-91)|Lung(261;0.0624)|LUSC - Lung squamous cell carcinoma(261;0.0662)|STAD - Stomach adenocarcinoma(1183;0.18)	Estramustine(DB01196)													---	---	---	---
VIL1	7429	broad.mit.edu	37	2	219297563	219297563	+	Silent	SNP	C	T	T	rs139447471		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219297563C>T	uc002via.2	+	13	1454	c.1389C>T	c.(1387-1389)GCC>GCT	p.A463A	VIL1_uc010zke.1_Silent_p.A152A|VIL1_uc002vib.2_Silent_p.A463A	NM_007127	NP_009058	P09327	VILI_HUMAN	villin 1	463	Core.				actin filament capping|actin filament depolymerization|actin filament polymerization|actin filament severing|apoptosis|cellular response to epidermal growth factor stimulus|cytoplasmic actin-based contraction involved in cell motility|epidermal growth factor receptor signaling pathway|positive regulation of actin filament bundle assembly|positive regulation of epithelial cell migration|regulation of actin nucleation|regulation of cell shape|regulation of lamellipodium morphogenesis|regulation of wound healing|response to bacterium	actin filament bundle|cytoplasm|filopodium tip|intracellular membrane-bounded organelle|lamellipodium|microvillus|ruffle	actin filament binding|calcium ion binding|caspase inhibitor activity|lysophosphatidic acid binding|phosphatidylinositol-4,5-bisphosphate binding|protein homodimerization activity			ovary(1)	1		Renal(207;0.0474)		Epithelial(149;6.88e-07)|all cancers(144;0.00013)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)														---	---	---	---
USP37	57695	broad.mit.edu	37	2	219328100	219328100	+	Intron	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219328100A>C	uc002vie.2	-						USP37_uc010fvs.1_Intron|USP37_uc010zkf.1_Intron|USP37_uc002vif.2_Intron|USP37_uc002vig.2_Intron	NM_020935	NP_065986			ubiquitin specific peptidase 37						ubiquitin-dependent protein catabolic process	nucleus	cysteine-type peptidase activity|ubiquitin thiolesterase activity			skin(3)|ovary(1)|prostate(1)	5		Renal(207;0.0915)		Epithelial(149;1.08e-06)|all cancers(144;0.000197)|LUSC - Lung squamous cell carcinoma(224;0.00375)|Lung(261;0.00487)														---	---	---	---
CHL1	10752	broad.mit.edu	37	3	431150	431150	+	Silent	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:431150A>T	uc003bou.2	+	19	2686	c.2415A>T	c.(2413-2415)GGA>GGT	p.G805G	CHL1_uc003bot.2_Silent_p.G821G|CHL1_uc003bow.1_Silent_p.G805G|CHL1_uc011asi.1_Silent_p.G821G	NM_006614	NP_006605	O00533	CHL1_HUMAN	cell adhesion molecule with homology to L1CAM	805	Extracellular (Potential).				axon guidance|cell adhesion|signal transduction	integral to membrane|plasma membrane|proteinaceous extracellular matrix				skin(5)|central_nervous_system(4)|large_intestine(2)|ovary(1)	12		all_cancers(2;1.14e-06)|all_epithelial(2;0.00367)|all_lung(1;0.061)|Lung NSC(2;0.201)		Epithelial(13;5.36e-06)|all cancers(10;1.4e-05)|OV - Ovarian serous cystadenocarcinoma(96;0.00323)|COAD - Colon adenocarcinoma(1;0.00925)|Colorectal(20;0.0198)														---	---	---	---
CNTN4	152330	broad.mit.edu	37	3	3030113	3030113	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:3030113C>A	uc003bpc.2	+	13	1664	c.1443C>A	c.(1441-1443)AAC>AAA	p.N481K	CNTN4_uc003bpb.1_Missense_Mutation_p.N153K|CNTN4_uc003bpd.1_Missense_Mutation_p.N481K|CNTN4_uc003bpe.2_Missense_Mutation_p.N153K|CNTN4_uc003bpf.2_Missense_Mutation_p.N153K	NM_175607	NP_783200	Q8IWV2	CNTN4_HUMAN	contactin 4 isoform a precursor	481	Ig-like C2-type 5.				axon guidance|axonal fasciculation|brain development|negative regulation of neuron differentiation|neuron cell-cell adhesion|regulation of synaptic plasticity	anchored to membrane|axon|extracellular region|plasma membrane	protein binding			large_intestine(2)|ovary(2)|lung(1)|central_nervous_system(1)|pancreas(1)	7		Ovarian(110;0.156)		Epithelial(13;0.000695)|all cancers(10;0.0047)|OV - Ovarian serous cystadenocarcinoma(96;0.01)														---	---	---	---
ZNF167	55888	broad.mit.edu	37	3	44607107	44607107	+	Silent	SNP	T	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:44607107T>A	uc010hin.2	+	3	940	c.552T>A	c.(550-552)CCT>CCA	p.P184P	ZNF167_uc003cnh.2_RNA|ZNF167_uc003cni.2_Silent_p.P184P|ZNF167_uc010hio.2_Silent_p.P34P|ZNF167_uc003cnj.2_Silent_p.P184P|ZNF167_uc003cnk.2_Silent_p.P184P	NM_018651	NP_061121	Q9P0L1	ZN167_HUMAN	zinc finger protein 167 isoform 1	184					viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2				KIRC - Kidney renal clear cell carcinoma(197;0.0486)|Kidney(197;0.0609)														---	---	---	---
VGLL3	389136	broad.mit.edu	37	3	87027822	87027822	+	Missense_Mutation	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:87027822G>C	uc003dqn.2	-	2	621	c.257C>G	c.(256-258)TCT>TGT	p.S86C		NM_016206	NP_057290	A8MV65	VGLL3_HUMAN	colon carcinoma related protein	86					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus					0	all_cancers(8;0.109)|Lung SC(3;0.184)	Lung NSC(201;0.0777)		LUSC - Lung squamous cell carcinoma(29;0.00241)|Lung(72;0.00712)														---	---	---	---
B4GALT4	8702	broad.mit.edu	37	3	118931416	118931416	+	Missense_Mutation	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:118931416C>G	uc003ecg.2	-	8	1656	c.1015G>C	c.(1015-1017)GAT>CAT	p.D339H	B4GALT4_uc003ece.1_3'UTR|B4GALT4_uc003ecf.2_RNA|B4GALT4_uc003ech.2_Missense_Mutation_p.D339H|B4GALT4_uc003eci.2_Missense_Mutation_p.D339H	NM_212543	NP_997708	O60513	B4GT4_HUMAN	UDP-Gal:betaGlcNAc beta 1,4-	339	Lumenal (Potential).				membrane lipid metabolic process|post-translational protein modification|protein N-linked glycosylation via asparagine	Golgi cisterna membrane|integral to membrane	metal ion binding|N-acetyllactosamine synthase activity				0				GBM - Glioblastoma multiforme(114;0.222)	N-Acetyl-D-glucosamine(DB00141)													---	---	---	---
EAF2	55840	broad.mit.edu	37	3	121554150	121554150	+	Silent	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121554150A>C	uc003een.2	+	1	117	c.18A>C	c.(16-18)GGA>GGC	p.G6G	IQCB1_uc010hre.1_5'Flank|IQCB1_uc003eek.2_5'Flank|IQCB1_uc010hrf.1_5'Flank|EAF2_uc003eem.2_RNA|EAF2_uc003eeo.2_5'UTR	NM_018456	NP_060926	Q96CJ1	EAF2_HUMAN	ELL associated factor 2	6					apoptosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear speck	protein binding				0				GBM - Glioblastoma multiforme(114;0.0972)														---	---	---	---
KALRN	8997	broad.mit.edu	37	3	124165605	124165605	+	Intron	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124165605C>A	uc003ehg.2	+						KALRN_uc010hrv.1_Intron|KALRN_uc003ehf.1_Intron|KALRN_uc011bjy.1_Intron|KALRN_uc003ehh.1_Intron	NM_001024660	NP_001019831			kalirin, RhoGEF kinase isoform 1						apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|nervous system development|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|vesicle-mediated transport	actin cytoskeleton|cytosol	ATP binding|GTPase activator activity|metal ion binding|protein binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(2)|ovary(2)|central_nervous_system(1)|skin(1)	6																		---	---	---	---
STAG1	10274	broad.mit.edu	37	3	136141289	136141289	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:136141289T>C	uc003era.1	-	19	2292	c.2000A>G	c.(1999-2001)GAT>GGT	p.D667G	STAG1_uc003erb.1_Missense_Mutation_p.D667G|STAG1_uc003erc.1_Missense_Mutation_p.D441G|STAG1_uc010hua.1_Missense_Mutation_p.D530G	NM_005862	NP_005853	Q8WVM7	STAG1_HUMAN	stromal antigen 1	667					cell division|chromosome segregation|mitotic metaphase/anaphase transition|mitotic prometaphase	cell junction|chromatin|chromosome, centromeric region|nucleoplasm	protein binding			ovary(2)	2																		---	---	---	---
STAG1	10274	broad.mit.edu	37	3	136141290	136141290	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:136141290C>A	uc003era.1	-	19	2291	c.1999G>T	c.(1999-2001)GAT>TAT	p.D667Y	STAG1_uc003erb.1_Missense_Mutation_p.D667Y|STAG1_uc003erc.1_Missense_Mutation_p.D441Y|STAG1_uc010hua.1_Missense_Mutation_p.D530Y	NM_005862	NP_005853	Q8WVM7	STAG1_HUMAN	stromal antigen 1	667					cell division|chromosome segregation|mitotic metaphase/anaphase transition|mitotic prometaphase	cell junction|chromatin|chromosome, centromeric region|nucleoplasm	protein binding			ovary(2)	2																		---	---	---	---
SI	6476	broad.mit.edu	37	3	164735642	164735642	+	Silent	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164735642A>C	uc003fei.2	-	30	3602	c.3540T>G	c.(3538-3540)ACT>ACG	p.T1180T		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	1180	Sucrase.|Lumenal.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---
SI	6476	broad.mit.edu	37	3	164764774	164764774	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164764774T>G	uc003fei.2	-	16	1804	c.1742A>C	c.(1741-1743)AAG>ACG	p.K581T		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	581	Lumenal.|Isomaltase.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)										HNSCC(35;0.089)			---	---	---	---
ZBBX	79740	broad.mit.edu	37	3	166960393	166960393	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:166960393A>C	uc003fep.2	-	20	2499	c.2176T>G	c.(2176-2178)TTC>GTC	p.F726V	ZBBX_uc011bpc.1_Missense_Mutation_p.F765V|ZBBX_uc003feq.2_Missense_Mutation_p.F697V	NM_024687	NP_078963	A8MT70	ZBBX_HUMAN	zinc finger, B-box domain containing	726						intracellular	zinc ion binding			ovary(2)	2																		---	---	---	---
SERPINI2	5276	broad.mit.edu	37	3	167159899	167159899	+	Nonstop_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:167159899A>G	uc003fer.1	-	8	1274	c.1216T>C	c.(1216-1218)TGA>CGA	p.*406R	SERPINI2_uc003fes.1_Nonstop_Mutation_p.*416R|SERPINI2_uc003fet.1_Nonstop_Mutation_p.*406R	NM_006217	NP_006208	O75830	SPI2_HUMAN	serpin peptidase inhibitor, clade I (pancpin),	406					cellular component movement|regulation of proteolysis	extracellular region	serine-type endopeptidase inhibitor activity			skin(2)|urinary_tract(1)	3																		---	---	---	---
GRK4	2868	broad.mit.edu	37	4	3015511	3015511	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:3015511C>T	uc003ggn.1	+	8	1152	c.697C>T	c.(697-699)CTA>TTA	p.L233L	GRK4_uc003ggo.1_Silent_p.L233L|GRK4_uc003ggp.1_Silent_p.L201L|GRK4_uc003ggq.1_Silent_p.L201L	NM_182982	NP_892027	P32298	GRK4_HUMAN	G protein-coupled receptor kinase 4 isoform	233	Protein kinase.					cell cortex	ATP binding|G-protein coupled receptor kinase activity|signal transducer activity			lung(1)	1				UCEC - Uterine corpus endometrioid carcinoma (64;0.168)														---	---	---	---
TLR10	81793	broad.mit.edu	37	4	38774898	38774898	+	Nonsense_Mutation	SNP	G	A	A	rs145139818	byFrequency;by1000genomes	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:38774898G>A	uc003gti.2	-	2	2693	c.2314C>T	c.(2314-2316)CGA>TGA	p.R772*	TLR10_uc003gtj.2_Nonsense_Mutation_p.R772*|TLR10_uc003gtk.2_Nonsense_Mutation_p.R772*	NM_030956	NP_112218	Q9BXR5	TLR10_HUMAN	toll-like receptor 10 precursor	772	TIR.|Cytoplasmic (Potential).				inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway	integral to membrane|plasma membrane	transmembrane receptor activity			lung(1)|breast(1)	2																		---	---	---	---
ATP8A1	10396	broad.mit.edu	37	4	42524204	42524204	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:42524204G>A	uc003gwr.2	-	22	2152	c.1920C>T	c.(1918-1920)CTC>CTT	p.L640L	ATP8A1_uc003gws.2_Silent_p.L625L	NM_006095	NP_006086	Q9Y2Q0	AT8A1_HUMAN	ATPase, aminophospholipid transporter (APLT),	640	Cytoplasmic (Potential).				ATP biosynthetic process	chromaffin granule membrane|integral to membrane|plasma membrane	aminophospholipid transporter activity|ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|cation-transporting ATPase activity|magnesium ion binding|phospholipid-translocating ATPase activity			skin(2)|central_nervous_system(1)	3					Phosphatidylserine(DB00144)													---	---	---	---
FRYL	285527	broad.mit.edu	37	4	48611786	48611786	+	Missense_Mutation	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:48611786A>T	uc003gyh.1	-	8	1071	c.466T>A	c.(466-468)TTT>ATT	p.F156I	FRYL_uc003gyk.2_Missense_Mutation_p.F156I	NM_015030	NP_055845	O94915	FRYL_HUMAN	furry-like	156					regulation of transcription, DNA-dependent|transcription, DNA-dependent		protein binding			skin(1)	1																		---	---	---	---
LNX1	84708	broad.mit.edu	37	4	54364820	54364820	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:54364820G>T	uc003hag.3	-	5	1222	c.966C>A	c.(964-966)GAC>GAA	p.D322E	PDGFRA_uc003haa.2_Intron|LNX1_uc003haf.3_Missense_Mutation_p.D226E|LNX1_uc003hah.3_Intron	NM_001126328	NP_001119800	Q8TBB1	LNX1_HUMAN	ligand of numb-protein X 1 isoform a	322	PDZ 1.					cytoplasm	zinc ion binding			ovary(2)|central_nervous_system(2)	4	all_neural(26;0.153)		GBM - Glioblastoma multiforme(3;8.2e-46)|LUSC - Lung squamous cell carcinoma(32;0.0134)															---	---	---	---
TECRL	253017	broad.mit.edu	37	4	65275058	65275058	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:65275058C>A	uc003hcv.2	-	1	121	c.12G>T	c.(10-12)AGG>AGT	p.R4S	TECRL_uc003hcw.2_Missense_Mutation_p.R4S	NM_001010874	NP_001010874	Q5HYJ1	TECRL_HUMAN	steroid 5 alpha-reductase 2-like 2	4					lipid metabolic process	cytoplasm|integral to membrane	oxidoreductase activity, acting on the CH-CH group of donors				0																		---	---	---	---
EPHA5	2044	broad.mit.edu	37	4	66286191	66286191	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:66286191T>C	uc003hcy.2	-	6	1688	c.1495A>G	c.(1495-1497)ATC>GTC	p.I499V	EPHA5_uc003hcx.2_Missense_Mutation_p.I430V|EPHA5_uc003hcz.2_Missense_Mutation_p.I499V|EPHA5_uc011cah.1_Missense_Mutation_p.I499V|EPHA5_uc011cai.1_Missense_Mutation_p.I499V|EPHA5_uc003hda.2_Missense_Mutation_p.I499V	NM_004439	NP_004430	P54756	EPHA5_HUMAN	ephrin receptor EphA5 isoform a precursor	499	Extracellular (Potential).|Fibronectin type-III 2.				cAMP-mediated signaling|neuron development	dendrite|external side of plasma membrane|integral to plasma membrane|neuronal cell body|perinuclear region of cytoplasm|rough endoplasmic reticulum	ATP binding|transmembrane-ephrin receptor activity			lung(19)|stomach(2)|ovary(2)|central_nervous_system(1)	24															TSP Lung(17;0.13)			---	---	---	---
TMPRSS11B	132724	broad.mit.edu	37	4	69094501	69094501	+	Silent	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:69094501A>G	uc003hdw.3	-	9	1184	c.1048T>C	c.(1048-1050)TTA>CTA	p.L350L		NM_182502	NP_872308	Q86T26	TM11B_HUMAN	transmembrane protease, serine 11B	350	Peptidase S1.|Extracellular (Potential).				proteolysis	extracellular region|integral to plasma membrane	serine-type endopeptidase activity			ovary(1)	1																		---	---	---	---
LIN54	132660	broad.mit.edu	37	4	83852254	83852254	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:83852254C>A	uc003hnx.3	-	12	2268	c.1890G>T	c.(1888-1890)AAG>AAT	p.K630N	LIN54_uc003hnz.3_Missense_Mutation_p.K409N|LIN54_uc003hny.3_Missense_Mutation_p.K229N|LIN54_uc010ijt.2_Missense_Mutation_p.K541N|LIN54_uc010iju.2_Missense_Mutation_p.K229N|LIN54_uc010ijv.2_Missense_Mutation_p.K409N	NM_194282	NP_919258	Q6MZP7	LIN54_HUMAN	lin-54 homolog isoform a	630	CXC 2.				cell cycle|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding				0		Hepatocellular(203;0.114)																---	---	---	---
NDST4	64579	broad.mit.edu	37	4	115891689	115891689	+	Missense_Mutation	SNP	T	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:115891689T>A	uc003ibu.2	-	4	1797	c.1118A>T	c.(1117-1119)GAG>GTG	p.E373V	NDST4_uc010imw.2_RNA	NM_022569	NP_072091	Q9H3R1	NDST4_HUMAN	heparan sulfate N-deacetylase/N-sulfotransferase	373	Lumenal (Potential).|Heparan sulfate N-deacetylase 4.					Golgi membrane|integral to membrane	[heparan sulfate]-glucosamine N-sulfotransferase activity|hydrolase activity			skin(3)|ovary(1)	4		Ovarian(17;0.156)		OV - Ovarian serous cystadenocarcinoma(123;0.000562)														---	---	---	---
C4orf31	79625	broad.mit.edu	37	4	121958441	121958441	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:121958441C>A	uc003idq.1	-	4	1212	c.685G>T	c.(685-687)GCA>TCA	p.A229S		NM_024574	NP_078850	Q8TB73	CD031_HUMAN	hypothetical protein LOC79625 precursor	229											0																		---	---	---	---
BBS7	55212	broad.mit.edu	37	4	122754433	122754433	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:122754433A>C	uc003ied.2	-	15	1803	c.1629T>G	c.(1627-1629)TTT>TTG	p.F543L	BBS7_uc003iee.1_Missense_Mutation_p.F543L	NM_176824	NP_789794	Q8IWZ6	BBS7_HUMAN	Bardet-Biedl syndrome 7 protein isoform a	543					cilium morphogenesis|digestive tract morphogenesis|fat cell differentiation|heart looping|melanosome transport|pigment granule aggregation in cell center|response to stimulus|visual perception	BBSome|centrosome|cilium membrane	protein binding			ovary(1)	1														Bardet-Biedl_syndrome				---	---	---	---
GLRB	2743	broad.mit.edu	37	4	158060078	158060078	+	Missense_Mutation	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:158060078G>C	uc003ipj.2	+	7	930	c.728G>C	c.(727-729)TGT>TCT	p.C243S		NM_000824	NP_000815	P48167	GLRB_HUMAN	glycine receptor, beta isoform A precursor	243	Extracellular (Probable).				nervous system development|neuropeptide signaling pathway|startle response	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	extracellular-glycine-gated chloride channel activity|protein binding|receptor activity			skin(2)	2	all_hematologic(180;0.24)	Renal(120;0.0458)		KIRC - Kidney renal clear cell carcinoma(143;0.0564)|COAD - Colon adenocarcinoma(41;0.0642)|Kidney(143;0.0707)	Glycine(DB00145)													---	---	---	---
GRIA2	2891	broad.mit.edu	37	4	158257859	158257859	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:158257859T>G	uc003ipm.3	+	11	2263	c.1804T>G	c.(1804-1806)TTG>GTG	p.L602V	GRIA2_uc011cit.1_Missense_Mutation_p.L555V|GRIA2_uc003ipl.3_Missense_Mutation_p.L602V|GRIA2_uc003ipk.3_Missense_Mutation_p.L555V|GRIA2_uc010iqh.1_RNA	NM_001083619	NP_001077088	P42262	GRIA2_HUMAN	glutamate receptor, ionotropic, AMPA 2 isoform 2	602	Cytoplasmic (Potential).				synaptic transmission	alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex|cell junction|endocytic vesicle membrane|endoplasmic reticulum membrane|postsynaptic membrane	alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|extracellular-glutamate-gated ion channel activity|kainate selective glutamate receptor activity			central_nervous_system(3)|ovary(1)	4	all_hematologic(180;0.24)	Renal(120;0.0458)		COAD - Colon adenocarcinoma(41;0.0294)	L-Glutamic Acid(DB00142)													---	---	---	---
TRIO	7204	broad.mit.edu	37	5	14291233	14291233	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:14291233C>T	uc003jff.2	+	5	955	c.949C>T	c.(949-951)CGG>TGG	p.R317W	TRIO_uc003jfg.2_RNA|TRIO_uc011cna.1_Missense_Mutation_p.R268W|TRIO_uc003jfh.1_5'Flank	NM_007118	NP_009049	O75962	TRIO_HUMAN	triple functional domain (PTPRF interacting)	317	Spectrin 1.				apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|transmembrane receptor protein tyrosine phosphatase signaling pathway	cytosol	ATP binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			skin(4)|central_nervous_system(3)|ovary(3)|large_intestine(2)|stomach(2)|breast(2)|upper_aerodigestive_tract(1)|kidney(1)	18	Lung NSC(4;0.000742)																	---	---	---	---
PDZD2	23037	broad.mit.edu	37	5	31983689	31983689	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31983689C>A	uc003jhl.2	+	3	1293	c.905C>A	c.(904-906)ACC>AAC	p.T302N	PDZD2_uc003jhm.2_Missense_Mutation_p.T302N|PDZD2_uc011cnx.1_Missense_Mutation_p.T128N	NM_178140	NP_835260	O15018	PDZD2_HUMAN	PDZ domain containing 2	302					cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9																		---	---	---	---
SPEF2	79925	broad.mit.edu	37	5	35646909	35646909	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35646909A>C	uc003jjo.2	+	5	837	c.726A>C	c.(724-726)GAA>GAC	p.E242D	SPEF2_uc003jjn.1_Missense_Mutation_p.E242D|SPEF2_uc003jjq.3_Missense_Mutation_p.E242D	NM_024867	NP_079143	Q9C093	SPEF2_HUMAN	KPL2 protein isoform 1	242	Potential.				nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		ATP binding|nucleobase, nucleoside, nucleotide kinase activity|protein dimerization activity			skin(2)|ovary(1)|central_nervous_system(1)	4	all_lung(31;7.56e-05)		Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---
C5orf33	133686	broad.mit.edu	37	5	36197731	36197731	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:36197731G>T	uc003jkf.3	-	11	1102	c.1102C>A	c.(1102-1104)CCG>ACG	p.P368T	C5orf33_uc003jke.3_RNA|C5orf33_uc010iux.2_Missense_Mutation_p.P173T|C5orf33_uc003jkg.3_Missense_Mutation_p.P205T|C5orf33_uc011cov.1_Missense_Mutation_p.P227T	NM_001085411	NP_001078880	Q4G0N4	NAKD1_HUMAN	hypothetical protein LOC133686 isoform 1	368							NAD+ kinase activity				0	all_lung(31;5.63e-05)		Epithelial(62;0.0254)|all cancers(62;0.0805)|Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)															---	---	---	---
EGFLAM	133584	broad.mit.edu	37	5	38448449	38448449	+	Nonsense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:38448449C>A	uc003jlc.1	+	19	2859	c.2535C>A	c.(2533-2535)TAC>TAA	p.Y845*	EGFLAM_uc003jlb.1_Nonsense_Mutation_p.Y837*|EGFLAM_uc003jle.1_Nonsense_Mutation_p.Y603*|EGFLAM_uc003jlf.1_Nonsense_Mutation_p.Y203*|EGFLAM_uc003jlg.1_5'UTR	NM_152403	NP_689616	Q63HQ2	EGFLA_HUMAN	EGF-like, fibronectin type III and laminin G	845	Laminin G-like 3.					cell junction|proteinaceous extracellular matrix|synapse				pancreas(3)|skin(3)|ovary(1)	7	all_lung(31;0.000385)																	---	---	---	---
EGFLAM	133584	broad.mit.edu	37	5	38458502	38458502	+	Intron	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:38458502T>G	uc003jlc.1	+						EGFLAM_uc003jlb.1_Intron|EGFLAM_uc003jle.1_Intron|EGFLAM_uc003jlf.1_Intron|EGFLAM_uc003jlg.1_Intron	NM_152403	NP_689616			EGF-like, fibronectin type III and laminin G							cell junction|proteinaceous extracellular matrix|synapse				pancreas(3)|skin(3)|ovary(1)	7	all_lung(31;0.000385)																	---	---	---	---
FYB	2533	broad.mit.edu	37	5	39201957	39201957	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:39201957G>A	uc003jls.2	-	1	1173	c.1106C>T	c.(1105-1107)ACG>ATG	p.T369M	FYB_uc003jlt.2_Missense_Mutation_p.T369M|FYB_uc003jlu.2_Missense_Mutation_p.T369M|FYB_uc011cpl.1_Missense_Mutation_p.T379M	NM_199335	NP_955367	O15117	FYB_HUMAN	FYN binding protein (FYB-120/130) isoform 2	369	Interaction with SKAP1.				cell junction assembly|immune response|intracellular protein kinase cascade|NLS-bearing substrate import into nucleus|protein phosphorylation|T cell receptor signaling pathway	cytosol|nucleus	protein binding			ovary(2)	2	all_lung(31;0.000343)		Epithelial(62;0.235)															---	---	---	---
ENC1	8507	broad.mit.edu	37	5	73930697	73930697	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:73930697G>T	uc003kdc.3	-	2	2745	c.1614C>A	c.(1612-1614)AAC>AAA	p.N538K	ENC1_uc011css.1_Missense_Mutation_p.N465K	NM_003633	NP_003624	O14682	ENC1_HUMAN	ectodermal-neural cortex (with BTB-like domain)	538	Kelch 5.			YTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDV TAKRMSCHAVASGNKLYVVGGYFGIQRCKTLDCYDPTLDVW NSITTVPYSLIPTAFVSTWKHLPS -> IHSQASCPGGTQD FLLWGVIQNFSACFCL (in Ref. 1; AAC39532).	nervous system development	cytoplasm|cytoskeleton|nuclear matrix	actin binding			ovary(1)|pancreas(1)|skin(1)	3		all_lung(232;0.0154)|Lung NSC(167;0.0331)|Ovarian(174;0.0798)		OV - Ovarian serous cystadenocarcinoma(47;1.45e-59)														---	---	---	---
IQGAP2	10788	broad.mit.edu	37	5	75932871	75932871	+	Missense_Mutation	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:75932871G>C	uc003kek.2	+	16	2015	c.1793G>C	c.(1792-1794)GGT>GCT	p.G598A	IQGAP2_uc010izv.2_Missense_Mutation_p.G151A|IQGAP2_uc011csv.1_Missense_Mutation_p.G151A|IQGAP2_uc003kel.2_Missense_Mutation_p.G151A	NM_006633	NP_006624	Q13576	IQGA2_HUMAN	IQ motif containing GTPase activating protein 2	598	WW.				small GTPase mediated signal transduction	actin cytoskeleton	actin binding|calmodulin binding|GTPase inhibitor activity|Ras GTPase activator activity			ovary(6)|central_nervous_system(1)	7		all_lung(232;0.000514)|Lung NSC(167;0.00135)|Prostate(461;0.00838)|Ovarian(174;0.0149)		all cancers(79;1.38e-36)														---	---	---	---
VCAN	1462	broad.mit.edu	37	5	82832889	82832889	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:82832889C>A	uc003kii.3	+	8	4423	c.4067C>A	c.(4066-4068)CCT>CAT	p.P1356H	VCAN_uc003kij.3_Missense_Mutation_p.P369H|VCAN_uc010jau.2_Intron|VCAN_uc003kik.3_Intron|VCAN_uc003kil.3_Missense_Mutation_p.P20H	NM_004385	NP_004376	P13611	CSPG2_HUMAN	versican isoform 1 precursor	1356	GAG-beta.				cell adhesion|cell recognition|glial cell migration	extracellular space|proteinaceous extracellular matrix	calcium ion binding|hyaluronic acid binding|sugar binding			ovary(7)|skin(6)|lung(2)|central_nervous_system(1)	16		Lung NSC(167;0.0216)|all_lung(232;0.0251)|Ovarian(174;0.142)		OV - Ovarian serous cystadenocarcinoma(54;2.47e-41)|Epithelial(54;2.51e-34)|all cancers(79;5.19e-29)														---	---	---	---
KIF3A	11127	broad.mit.edu	37	5	132056402	132056402	+	Missense_Mutation	SNP	T	C	C	rs17854353		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:132056402T>C	uc003kxo.2	-	5	669	c.515A>G	c.(514-516)AAA>AGA	p.K172R	KIF3A_uc003kxn.2_Missense_Mutation_p.K131R|KIF3A_uc011cxf.1_Missense_Mutation_p.K172R|KIF3A_uc003kxp.2_Missense_Mutation_p.K172R	NM_007054	NP_008985	Q9Y496	KIF3A_HUMAN	kinesin family member 3A	172	Kinesin-motor.				blood coagulation|organelle organization|plus-end-directed vesicle transport along microtubule	centrosome|cytosol|kinesin II complex|spindle microtubule	ATP binding|plus-end-directed microtubule motor activity|protein binding			pancreas(1)	1		all_cancers(142;0.0751)|Breast(839;0.198)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)															---	---	---	---
FBXL21	26223	broad.mit.edu	37	5	135276293	135276293	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:135276293A>G	uc010jec.1	+	4	626	c.605A>G	c.(604-606)AAT>AGT	p.N202S	FBXL21_uc003lbc.2_RNA	NM_012159	NP_036291	Q9UKT6	FXL21_HUMAN	F-box and leucine-rich repeat protein 21	202	LRR 2.				rhythmic process	ubiquitin ligase complex	ubiquitin-protein ligase activity			lung(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0233)															---	---	---	---
ETF1	2107	broad.mit.edu	37	5	137854434	137854434	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137854434G>A	uc003ldc.3	-	3	374	c.209C>T	c.(208-210)TCA>TTA	p.S70L	ETF1_uc011cyv.1_Missense_Mutation_p.S56L|ETF1_uc010jex.2_RNA|ETF1_uc003ldd.3_Missense_Mutation_p.S37L|ETF1_uc010jey.1_5'Flank	NM_004730	NP_004721	P62495	ERF1_HUMAN	eukaryotic translation termination factor 1	70					nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|protein methylation|regulation of translational termination	cytoplasm	protein binding|ribosome binding|translation release factor activity, codon specific			ovary(2)	2			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00325)															---	---	---	---
DND1	373863	broad.mit.edu	37	5	140051080	140051080	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140051080C>T	uc003lgt.2	-	4	904	c.860G>A	c.(859-861)CGC>CAC	p.R287H		NM_194249	NP_919225	Q8IYX4	DND1_HUMAN	dead end homolog 1	287					multicellular organismal development|negative regulation of gene silencing by miRNA	cytoplasm|nucleus	AU-rich element binding|nucleotide binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
PCDHGA2	56113	broad.mit.edu	37	5	140718600	140718600	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140718600C>T	uc003ljk.1	+	1	247	c.62C>T	c.(61-63)GCG>GTG	p.A21V	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc011dao.1_Missense_Mutation_p.A21V	NM_018915	NP_061738	Q9Y5H1	PCDG2_HUMAN	protocadherin gamma subfamily A, 2 isoform 1	21					homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			skin(2)|ovary(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)													OREG0016854	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PCDHGB4	8641	broad.mit.edu	37	5	140769109	140769109	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140769109G>A	uc003lkc.1	+	1	1658	c.1658G>A	c.(1657-1659)CGC>CAC	p.R553H	PCDHGA1_uc003lji.1_Intron|PCDHGA2_uc003ljk.1_Intron|PCDHGA3_uc003ljm.1_Intron|PCDHGA3_uc010jfx.1_Intron|PCDHGB1_uc003ljo.1_Intron|PCDHGA4_uc003ljq.1_Intron|PCDHGB2_uc003ljs.1_Intron|PCDHGA5_uc003lju.1_Intron|PCDHGB3_uc003ljw.1_Intron|PCDHGA6_uc003ljy.1_Intron|PCDHGA7_uc003lka.1_Intron|PCDHGB4_uc011dav.1_Missense_Mutation_p.R553H	NM_003736	NP_003727	Q9UN71	PCDGG_HUMAN	protocadherin gamma subfamily B, 4 isoform 1	553	Cadherin 5.|Extracellular (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)															---	---	---	---
GLRA1	2741	broad.mit.edu	37	5	151234726	151234726	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:151234726A>G	uc003lut.2	-	6	859	c.572T>C	c.(571-573)ATG>ACG	p.M191T	GLRA1_uc003lur.2_Missense_Mutation_p.M191T|GLRA1_uc003lus.2_Missense_Mutation_p.M108T	NM_001146040	NP_001139512	P23415	GLRA1_HUMAN	glycine receptor, alpha 1 isoform 1 precursor	191	Extracellular (Probable).				muscle contraction|negative regulation of transmission of nerve impulse|neuropeptide signaling pathway|positive regulation of acrosome reaction|regulation of membrane potential|startle response	cell junction|chloride channel complex|integral to plasma membrane|intracellular membrane-bounded organelle|postsynaptic membrane	extracellular-glycine-gated chloride channel activity|glycine binding|protein binding|receptor activity|taurine binding|transmitter-gated ion channel activity			ovary(1)|central_nervous_system(1)	2		all_hematologic(541;0.0341)|Medulloblastoma(196;0.0912)	Kidney(363;0.000171)|KIRC - Kidney renal clear cell carcinoma(527;0.000785)		Desflurane(DB01189)|Enflurane(DB00228)|Ethanol(DB00898)|Glycine(DB00145)|Halothane(DB01159)|Isoflurane(DB00753)|Methoxyflurane(DB01028)|Sevoflurane(DB01236)													---	---	---	---
FAM71B	153745	broad.mit.edu	37	5	156590152	156590152	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156590152G>A	uc003lwn.2	-	2	1224	c.1124C>T	c.(1123-1125)GCG>GTG	p.A375V		NM_130899	NP_570969	Q8TC56	FA71B_HUMAN	family with sequence similarity 71, member B	375						nucleus				ovary(4)|pancreas(1)|skin(1)	6	Renal(175;0.00212)	Medulloblastoma(196;0.0523)|all_neural(177;0.21)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)															---	---	---	---
ITK	3702	broad.mit.edu	37	5	156635914	156635914	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156635914G>A	uc003lwo.1	+	2	235	c.153G>A	c.(151-153)CTG>CTA	p.L51L		NM_005546	NP_005537	Q08881	ITK_HUMAN	IL2-inducible T-cell kinase	51	PH.				cellular defense response|intracellular signal transduction|T cell receptor signaling pathway	cytosol|plasma membrane	ATP binding|metal ion binding|non-membrane spanning protein tyrosine kinase activity|protein binding	p.L51Q(1)		lung(12)|ovary(8)|skin(4)|stomach(1)|central_nervous_system(1)	26	Renal(175;0.00212)	Medulloblastoma(196;0.0354)|all_neural(177;0.1)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)					T	SYK	peripheral T-cell lymphoma								---	---	---	---
OR2B2	81697	broad.mit.edu	37	6	27879098	27879098	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27879098A>C	uc011dkw.1	-	1	1000	c.1000T>G	c.(1000-1002)TTC>GTC	p.F334V		NM_033057	NP_149046	Q9GZK3	OR2B2_HUMAN	olfactory receptor, family 2, subfamily B,	334	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0																		---	---	---	---
MDC1	9656	broad.mit.edu	37	6	30680770	30680770	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30680770G>A	uc003nrg.3	-	5	1389	c.949C>T	c.(949-951)CAT>TAT	p.H317Y	MDC1_uc003nrf.3_5'UTR|MDC1_uc011dmp.1_Missense_Mutation_p.H189Y|MDC1_uc003nrh.1_Missense_Mutation_p.H189Y|MDC1_uc003nri.2_Missense_Mutation_p.H317Y	NM_014641	NP_055456	Q14676	MDC1_HUMAN	mediator of DNA-damage checkpoint 1	317	Required for nuclear localization (NLS1).				cell cycle|double-strand break repair via homologous recombination|intra-S DNA damage checkpoint	focal adhesion|nucleoplasm	FHA domain binding|protein C-terminus binding			breast(2)|ovary(1)|kidney(1)	4													Other_conserved_DNA_damage_response_genes					---	---	---	---
DNAH8	1769	broad.mit.edu	37	6	38758061	38758061	+	Intron	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38758061C>T	uc003ooe.1	+							NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21																		---	---	---	---
USP49	25862	broad.mit.edu	37	6	41774582	41774582	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41774582C>A	uc003ori.2	-	4	362	c.140G>T	c.(139-141)GGC>GTC	p.G47V		NM_018561	NP_061031	Q70CQ1	UBP49_HUMAN	ubiquitin thioesterase 49	47	UBP-type.				ubiquitin-dependent protein catabolic process		cysteine-type peptidase activity|ubiquitin thiolesterase activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2	Ovarian(28;0.0919)|Colorectal(47;0.121)		STAD - Stomach adenocarcinoma(11;0.000204)|Epithelial(12;0.000309)|Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)															---	---	---	---
KLHDC3	116138	broad.mit.edu	37	6	42987057	42987057	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:42987057C>T	uc003otl.2	+	10	1204	c.1035C>T	c.(1033-1035)GCC>GCT	p.A345A	C6orf153_uc003otp.1_5'Flank|KLHDC3_uc003otm.2_RNA|KLHDC3_uc010jyf.2_Silent_p.A321A|KLHDC3_uc003otn.2_Silent_p.A229A|KLHDC3_uc003oto.2_Silent_p.A286A	NM_057161	NP_476502	Q9BQ90	KLDC3_HUMAN	kelch domain containing 3	345					reciprocal meiotic recombination	cytoplasm|nuclear chromatin	chromatin binding|protein binding			upper_aerodigestive_tract(1)	1			Colorectal(64;0.00237)|all cancers(41;0.0034)|COAD - Colon adenocarcinoma(64;0.00473)|OV - Ovarian serous cystadenocarcinoma(102;0.0539)|KIRC - Kidney renal clear cell carcinoma(15;0.133)|Kidney(15;0.188)															---	---	---	---
FILIP1	27145	broad.mit.edu	37	6	76072590	76072590	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76072590T>G	uc003pia.2	-	3	693	c.320A>C	c.(319-321)AAG>ACG	p.K107T	FILIP1_uc003phy.1_Missense_Mutation_p.K107T|FILIP1_uc003phz.2_Missense_Mutation_p.K8T|FILIP1_uc010kbe.2_Missense_Mutation_p.K110T	NM_015687	NP_056502	Q7Z7B0	FLIP1_HUMAN	filamin A interacting protein 1	107										skin(3)|ovary(1)	4																		---	---	---	---
LAMA4	3910	broad.mit.edu	37	6	112460964	112460964	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112460964G>A	uc003pvu.2	-	23	3409	c.3100C>T	c.(3100-3102)CCA>TCA	p.P1034S	LAMA4_uc003pvv.2_Missense_Mutation_p.P1027S|LAMA4_uc003pvt.2_Missense_Mutation_p.P1027S	NM_001105206	NP_001098676	Q16363	LAMA4_HUMAN	laminin, alpha 4 isoform 1 precursor	1034	Laminin G-like 1.				cell adhesion|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	extracellular matrix structural constituent|receptor binding			ovary(4)|breast(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	9		all_cancers(87;0.000196)|all_hematologic(75;0.000114)|all_epithelial(87;0.00542)|Colorectal(196;0.0209)		all cancers(137;0.0335)|OV - Ovarian serous cystadenocarcinoma(136;0.0578)|Epithelial(106;0.0748)|BRCA - Breast invasive adenocarcinoma(108;0.242)														---	---	---	---
ROS1	6098	broad.mit.edu	37	6	117632273	117632273	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:117632273C>T	uc003pxp.1	-	39	6342	c.6143G>A	c.(6142-6144)GGT>GAT	p.G2048D	ROS1_uc011ebi.1_RNA	NM_002944	NP_002935	P08922	ROS_HUMAN	proto-oncogene c-ros-1 protein precursor	2048	Protein kinase.|Cytoplasmic (Potential).				transmembrane receptor protein tyrosine kinase signaling pathway	membrane fraction|sodium:potassium-exchanging ATPase complex	ATP binding|transmembrane receptor protein tyrosine kinase activity			lung(8)|ovary(6)|central_nervous_system(3)|skin(3)|stomach(2)|breast(2)|large_intestine(1)	25		all_cancers(87;0.00846)|all_epithelial(87;0.0242)		GBM - Glioblastoma multiforme(226;0.0387)|OV - Ovarian serous cystadenocarcinoma(136;0.0954)|all cancers(137;0.137)				T	GOPC|ROS1	glioblastoma|NSCLC								---	---	---	---
MED23	9439	broad.mit.edu	37	6	131941039	131941039	+	Intron	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:131941039A>G	uc003qcs.1	-						MED23_uc003qcq.2_Intron|MED23_uc003qct.1_Intron|MED23_uc011ecb.1_Intron	NM_004830	NP_004821			mediator complex subunit 23 isoform a						regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	transcription factor complex	protein binding|transcription coactivator activity			ovary(1)|kidney(1)|central_nervous_system(1)	3	Breast(56;0.0753)			GBM - Glioblastoma multiforme(226;0.0115)|OV - Ovarian serous cystadenocarcinoma(155;0.0608)														---	---	---	---
BCLAF1	9774	broad.mit.edu	37	6	136597399	136597399	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:136597399T>G	uc003qgx.1	-	5	1517	c.1264A>C	c.(1264-1266)AGT>CGT	p.S422R	BCLAF1_uc003qgw.1_Intron|BCLAF1_uc003qgy.1_Missense_Mutation_p.S420R|BCLAF1_uc011edc.1_Intron|BCLAF1_uc011edd.1_RNA|BCLAF1_uc011ede.1_Missense_Mutation_p.S420R	NM_014739	NP_055554	Q9NYF8	BCLF1_HUMAN	BCL2-associated transcription factor 1 isoform	422					induction of apoptosis|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleolus	DNA binding|protein binding			ovary(1)	1	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00226)|OV - Ovarian serous cystadenocarcinoma(155;0.00331)														---	---	---	---
UTRN	7402	broad.mit.edu	37	6	145073047	145073047	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:145073047C>T	uc003qkt.2	+	55	8406	c.8314C>T	c.(8314-8316)CGC>TGC	p.R2772C		NM_007124	NP_009055	P46939	UTRO_HUMAN	utrophin	2772	Spectrin 20.				muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)														---	---	---	---
GRM1	2911	broad.mit.edu	37	6	146350944	146350944	+	Silent	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:146350944C>A	uc010khw.1	+	2	761	c.291C>A	c.(289-291)CCC>CCA	p.P97P	GRM1_uc010khu.1_Silent_p.P97P|GRM1_uc010khv.1_Silent_p.P97P|GRM1_uc003qll.2_Silent_p.P97P|GRM1_uc011edz.1_Silent_p.P97P|GRM1_uc011eea.1_Silent_p.P97P	NM_000838	NP_000829	Q13255	GRM1_HUMAN	glutamate receptor, metabotropic 1 isoform alpha	97	Extracellular (Potential).				synaptic transmission	integral to plasma membrane	G-protein coupled receptor activity|glutamate receptor activity			lung(8)|ovary(4)|central_nervous_system(3)|large_intestine(2)|breast(2)	19		Ovarian(120;0.0387)		OV - Ovarian serous cystadenocarcinoma(155;5.35e-08)|GBM - Glioblastoma multiforme(68;0.00762)	Acamprosate(DB00659)|L-Glutamic Acid(DB00142)													---	---	---	---
SYNE1	23345	broad.mit.edu	37	6	152804313	152804313	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152804313G>A	uc010kiw.2	-	14	1859	c.1257C>T	c.(1255-1257)TAC>TAT	p.Y419Y	SYNE1_uc003qot.3_Silent_p.Y426Y|SYNE1_uc003qou.3_Silent_p.Y419Y|SYNE1_uc010kjb.1_Silent_p.Y402Y|SYNE1_uc003qpa.1_Silent_p.Y419Y|SYNE1_uc003qox.1_5'UTR	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	419	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)											HNSCC(10;0.0054)			---	---	---	---
SNX9	51429	broad.mit.edu	37	6	158322918	158322918	+	Intron	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:158322918T>G	uc003qqv.1	+							NM_016224	NP_057308			sorting nexin 9						cell communication|intracellular protein transport|lipid tube assembly|positive regulation of GTPase activity|positive regulation of protein oligomerization|receptor-mediated endocytosis	clathrin-coated vesicle|cytoplasmic vesicle membrane|extrinsic to internal side of plasma membrane|ruffle|trans-Golgi network	1-phosphatidylinositol binding|protein homodimerization activity|ubiquitin protein ligase binding				0		Breast(66;0.000776)|Ovarian(120;0.0303)|Prostate(117;0.167)		OV - Ovarian serous cystadenocarcinoma(65;8.06e-18)|BRCA - Breast invasive adenocarcinoma(81;4.48e-05)														---	---	---	---
TAGAP	117289	broad.mit.edu	37	6	159457507	159457507	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:159457507G>T	uc003qrz.2	-	10	1880	c.1548C>A	c.(1546-1548)CAC>CAA	p.H516Q	TAGAP_uc011eft.1_Missense_Mutation_p.H453Q|TAGAP_uc003qsa.2_Missense_Mutation_p.H338Q	NM_054114	NP_473455	Q8N103	TAGAP_HUMAN	T-cell activation Rho GTPase-activating protein	516					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity|guanyl-nucleotide exchange factor activity			ovary(1)	1		Breast(66;0.000776)|Ovarian(120;0.0303)		OV - Ovarian serous cystadenocarcinoma(65;2.16e-16)|BRCA - Breast invasive adenocarcinoma(81;5.87e-06)														---	---	---	---
SLC22A2	6582	broad.mit.edu	37	6	160679467	160679467	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:160679467G>T	uc003qtf.2	-	1	493	c.323C>A	c.(322-324)GCC>GAC	p.A108D	SLC22A2_uc003qte.1_Missense_Mutation_p.A108D|SLC22A2_uc003qth.1_Missense_Mutation_p.A108D	NM_003058	NP_003049	O15244	S22A2_HUMAN	solute carrier family 22 member 2	108	Extracellular (Potential).				body fluid secretion|neurotransmitter biosynthetic process|neurotransmitter secretion	integral to plasma membrane|membrane fraction	neurotransmitter transporter activity|organic cation transmembrane transporter activity			breast(1)|skin(1)	2		Breast(66;0.000776)|Ovarian(120;0.0303)		OV - Ovarian serous cystadenocarcinoma(65;2.28e-17)|BRCA - Breast invasive adenocarcinoma(81;6.29e-06)														---	---	---	---
INTS1	26173	broad.mit.edu	37	7	1521127	1521127	+	Intron	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:1521127G>C	uc003skn.2	-							NM_001080453	NP_001073922			integrator complex subunit 1						snRNA processing	integral to membrane|integrator complex|nuclear membrane					0		Ovarian(82;0.0253)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0181)|OV - Ovarian serous cystadenocarcinoma(56;6.99e-15)														---	---	---	---
COL28A1	340267	broad.mit.edu	37	7	7572474	7572474	+	Silent	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:7572474C>G	uc003src.1	-	2	150	c.33G>C	c.(31-33)CTG>CTC	p.L11L	COL28A1_uc011jxe.1_5'UTR	NM_001037763	NP_001032852	Q2UY09	COSA1_HUMAN	collagen, type XXVIII precursor	11					cell adhesion	basement membrane|collagen	serine-type endopeptidase inhibitor activity			skin(3)	3		Ovarian(82;0.0789)		UCEC - Uterine corpus endometrioid carcinoma (126;0.228)														---	---	---	---
STAG3L4	64940	broad.mit.edu	37	7	66773946	66773946	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:66773946G>T	uc003tvt.3	+	3	379	c.112G>T	c.(112-114)GCT>TCT	p.A38S	STAG3L4_uc010laj.2_RNA	NM_022906	NP_075057	Q8TBR4	STG34_HUMAN	stromal antigen 3-like 4	38											0		Lung NSC(55;0.0839)|all_lung(88;0.181)																---	---	---	---
ANKIB1	54467	broad.mit.edu	37	7	91972459	91972459	+	Silent	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:91972459A>T	uc003ulw.2	+	6	1285	c.909A>T	c.(907-909)CCA>CCT	p.P303P		NM_019004	NP_061877	Q9P2G1	AKIB1_HUMAN	ankyrin repeat and IBR domain containing 1	303							protein binding|zinc ion binding			lung(1)	1	all_cancers(62;2.06e-09)|all_epithelial(64;9.24e-09)|Breast(17;0.0034)|all_lung(186;0.0509)|Lung NSC(181;0.0692)		STAD - Stomach adenocarcinoma(171;6.16e-05)|all cancers(6;0.00183)|Lung(22;0.123)|LUSC - Lung squamous cell carcinoma(200;0.225)															---	---	---	---
DLX5	1749	broad.mit.edu	37	7	96650380	96650380	+	Intron	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:96650380G>A	uc003uon.2	-							NM_005221	NP_005212			distal-less homeobox 5						cell proliferation|endochondral ossification|osteoblast differentiation|positive regulation of transcription, DNA-dependent	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			ovary(1)	1	all_cancers(62;9.56e-09)|all_epithelial(64;7.38e-09)|Esophageal squamous(72;0.0125)|all_lung(186;0.0855)|Lung NSC(181;0.0858)																	---	---	---	---
NAMPT	10135	broad.mit.edu	37	7	105893567	105893567	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:105893567G>T	uc003vdq.2	-	10	1569	c.1261C>A	c.(1261-1263)CCC>ACC	p.P421T		NM_005746	NP_005737	P43490	NAMPT_HUMAN	nicotinamide phosphoribosyltransferase	421					cell-cell signaling|NAD biosynthetic process|nicotinamide metabolic process|positive regulation of cell proliferation|positive regulation of nitric-oxide synthase biosynthetic process|signal transduction|water-soluble vitamin metabolic process	cytosol	cytokine activity|nicotinamide phosphoribosyltransferase activity|nicotinate phosphoribosyltransferase activity|nicotinate-nucleotide diphosphorylase (carboxylating) activity			large_intestine(1)	1																		---	---	---	---
DLD	1738	broad.mit.edu	37	7	107542829	107542829	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:107542829T>G	uc003vet.2	+	4	368	c.258T>G	c.(256-258)ATT>ATG	p.I86M	DLD_uc010ljm.1_RNA|DLD_uc011kmg.1_Missense_Mutation_p.I86M|DLD_uc011kmh.1_Intron|DLD_uc011kmi.1_Intron	NM_000108	NP_000099	P09622	DLDH_HUMAN	dihydrolipoamide dehydrogenase precursor	86					branched chain family amino acid catabolic process|cell redox homeostasis|lysine catabolic process|regulation of acetyl-CoA biosynthetic process from pyruvate|tricarboxylic acid cycle	mitochondrial matrix	dihydrolipoyl dehydrogenase activity			central_nervous_system(1)	1					NADH(DB00157)													---	---	---	---
PNPLA8	50640	broad.mit.edu	37	7	108154736	108154736	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:108154736A>C	uc003vff.1	-	5	1465	c.1058T>G	c.(1057-1059)ATT>AGT	p.I353S	PNPLA8_uc003vfg.1_RNA|PNPLA8_uc003vfh.1_Missense_Mutation_p.I353S|PNPLA8_uc003vfi.1_Missense_Mutation_p.I253S|PNPLA8_uc003vfj.1_Missense_Mutation_p.I353S|PNPLA8_uc003vfk.1_Missense_Mutation_p.I253S	NM_015723	NP_056538	Q9NP80	PLPL8_HUMAN	patatin-like phospholipase domain containing 8	353					fatty acid metabolic process|lipid catabolic process	endoplasmic reticulum membrane|Golgi membrane|integral to membrane|membrane fraction|perinuclear region of cytoplasm|peroxisomal membrane	ATP binding|calcium-independent phospholipase A2 activity|lysophospholipase activity			breast(2)	2																		---	---	---	---
DOCK4	9732	broad.mit.edu	37	7	111375153	111375153	+	Silent	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:111375153C>A	uc003vfx.2	-	50	5618	c.5349G>T	c.(5347-5349)GGG>GGT	p.G1783G	DOCK4_uc011kml.1_Silent_p.G664G|DOCK4_uc011kmm.1_Intron|DOCK4_uc003vfw.2_Intron|DOCK4_uc003vfy.2_Silent_p.G1828G|DOCK4_uc003vfv.2_Silent_p.G96G	NM_014705	NP_055520	Q8N1I0	DOCK4_HUMAN	dedicator of cytokinesis 4	1783	Ser-rich.				cell chemotaxis	cytosol|endomembrane system|membrane|stereocilium	GTP binding|guanyl-nucleotide exchange factor activity|PDZ domain binding|Rac GTPase activator activity|Rac GTPase binding|receptor tyrosine kinase binding|SH3 domain binding			ovary(2)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)	4		Acute lymphoblastic leukemia(1;0.0441)																---	---	---	---
GRM8	2918	broad.mit.edu	37	7	126086390	126086390	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:126086390T>C	uc003vlr.2	-	9	2778	c.2467A>G	c.(2467-2469)AGT>GGT	p.S823G	GRM8_uc003vls.2_RNA|GRM8_uc011kof.1_RNA|GRM8_uc003vlt.2_Missense_Mutation_p.S823G|GRM8_uc010lkz.1_RNA	NM_000845	NP_000836	O00222	GRM8_HUMAN	glutamate receptor, metabotropic 8 isoform a	823	Helical; Name=7; (Potential).				negative regulation of cAMP biosynthetic process|sensory perception of smell|visual perception	integral to plasma membrane				lung(15)|ovary(5)|pancreas(1)|breast(1)|skin(1)	23		Prostate(267;0.186)			L-Glutamic Acid(DB00142)										HNSCC(24;0.065)			---	---	---	---
SSBP1	6742	broad.mit.edu	37	7	141438996	141438996	+	Intron	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141438996C>G	uc003vwo.1	+						FLJ40852_uc011krh.1_5'Flank|FLJ40852_uc010lnm.2_5'Flank|FLJ40852_uc010lnn.2_5'Flank|FLJ40852_uc003vwm.3_5'Flank|FLJ40852_uc010lno.2_5'Flank|SSBP1_uc011kri.1_Intron|SSBP1_uc010lnp.1_Intron	NM_003143	NP_003134			single-stranded DNA binding protein 1 precursor						DNA replication|positive regulation of helicase activity	mitochondrial nucleoid	single-stranded DNA binding			ovary(1)	1	Melanoma(164;0.0171)																	---	---	---	---
OR2F2	135948	broad.mit.edu	37	7	143632632	143632632	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143632632T>G	uc011ktv.1	+	1	307	c.307T>G	c.(307-309)TTC>GTC	p.F103V		NM_001004685	NP_001004685	O95006	OR2F2_HUMAN	olfactory receptor, family 2, subfamily F,	103	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity	p.F103F(1)		ovary(3)|skin(1)	4	Melanoma(164;0.0903)																	---	---	---	---
OR2A2	442361	broad.mit.edu	37	7	143807484	143807484	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143807484A>C	uc011ktz.1	+	1	809	c.809A>C	c.(808-810)GAG>GCG	p.E270A		NM_001005480	NP_001005480	Q6IF42	OR2A2_HUMAN	olfactory receptor, family 2, subfamily A,	270	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2	Melanoma(164;0.0783)																	---	---	---	---
SSPO	23145	broad.mit.edu	37	7	149480254	149480254	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149480254C>T	uc010lpk.2	+	16	2136	c.2136C>T	c.(2134-2136)GCC>GCT	p.A712A	SSPO_uc010lpl.1_Silent_p.A47A	NM_198455	NP_940857	A2VEC9	SSPO_HUMAN	SCO-spondin precursor	712	VWFD 2.				cell adhesion	extracellular space	peptidase inhibitor activity				0	Melanoma(164;0.165)|Ovarian(565;0.177)		OV - Ovarian serous cystadenocarcinoma(82;0.00625)															---	---	---	---
DNAJB6	10049	broad.mit.edu	37	7	157177590	157177590	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:157177590G>A	uc003wnk.2	+	7	662	c.508G>A	c.(508-510)GGG>AGG	p.G170R	DNAJB6_uc003wnj.2_Missense_Mutation_p.G170R|DNAJB6_uc003wnl.2_Missense_Mutation_p.G157R|DNAJB6_uc011kvy.1_Missense_Mutation_p.G121R|DNAJB6_uc011kvz.1_Intron|DNAJB6_uc010lqt.2_Missense_Mutation_p.G170R	NM_058246	NP_490647	O75190	DNJB6_HUMAN	DnaJ (Hsp40) homolog, subfamily B, member 6	170	Gly/Phe-rich.|Interaction with KRT18.				intermediate filament organization|negative regulation of caspase activity|protein folding|response to unfolded protein	nucleus|perinuclear region of cytoplasm	ATPase activator activity|chaperone binding|heat shock protein binding|unfolded protein binding			ovary(2)	2	all_neural(206;0.181)	all_epithelial(9;0.000606)|all_hematologic(28;0.00287)|Acute lymphoblastic leukemia(9;0.0647)|Ovarian(593;0.196)	OV - Ovarian serous cystadenocarcinoma(82;0.00399)	UCEC - Uterine corpus endometrioid carcinoma (81;0.172)														---	---	---	---
POTEA	340441	broad.mit.edu	37	8	43171053	43171053	+	Silent	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:43171053A>G	uc003xpz.1	+	7	967	c.924A>G	c.(922-924)ACA>ACG	p.T308T	POTEA_uc003xqa.1_Silent_p.T262T	NM_001005365	NP_001005365	Q6S8J7	POTEA_HUMAN	POTE ankyrin domain family, member A isoform 2	308										ovary(1)	1																		---	---	---	---
RP1	6101	broad.mit.edu	37	8	55540286	55540286	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:55540286C>T	uc003xsd.1	+	4	3992	c.3844C>T	c.(3844-3846)CCT>TCT	p.P1282S	RP1_uc011ldy.1_Intron	NM_006269	NP_006260	P56715	RP1_HUMAN	retinitis pigmentosa RP1 protein	1282					axoneme assembly|intracellular signal transduction|photoreceptor cell maintenance|photoreceptor cell outer segment organization|phototransduction, visible light|retinal cone cell development|retinal rod cell development	cilium axoneme|cytoplasm|microtubule|microtubule associated complex|photoreceptor connecting cilium|photoreceptor inner segment|photoreceptor outer segment	microtubule binding			skin(7)|ovary(4)|pancreas(1)	12		all_lung(136;0.0831)|Lung NSC(129;0.109)|all_epithelial(80;0.123)	OV - Ovarian serous cystadenocarcinoma(7;4.4e-07)|Epithelial(17;3.37e-05)|all cancers(17;0.000285)															---	---	---	---
MATN2	4147	broad.mit.edu	37	8	99006715	99006715	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:99006715C>A	uc003yic.2	+	7	1320	c.1089C>A	c.(1087-1089)GAC>GAA	p.D363E	MATN2_uc003yib.1_Missense_Mutation_p.D363E|MATN2_uc010mbh.1_Intron|MATN2_uc003yid.2_Missense_Mutation_p.D363E|MATN2_uc003yie.1_Missense_Mutation_p.D363E|MATN2_uc010mbi.1_Missense_Mutation_p.D196E	NM_002380	NP_002371	O00339	MATN2_HUMAN	matrilin 2 isoform a precursor	363	EGF-like 4.					proteinaceous extracellular matrix	calcium ion binding			ovary(2)	2	Breast(36;1.43e-06)		OV - Ovarian serous cystadenocarcinoma(57;0.244)															---	---	---	---
ZFPM2	23414	broad.mit.edu	37	8	106573610	106573610	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:106573610G>A	uc003ymd.2	+	4	344	c.321G>A	c.(319-321)CAG>CAA	p.Q107Q		NM_012082	NP_036214	Q8WW38	FOG2_HUMAN	zinc finger protein, multitype 2	107					blood coagulation|negative regulation of fat cell differentiation|outflow tract septum morphogenesis|right ventricular cardiac muscle tissue morphogenesis|ventricular septum morphogenesis	nucleoplasm	DNA binding|RNA polymerase II transcription coactivator activity|transcription corepressor activity|transcription factor binding|zinc ion binding			ovary(4)|large_intestine(1)	5			OV - Ovarian serous cystadenocarcinoma(57;8.28e-08)															---	---	---	---
TMEM74	157753	broad.mit.edu	37	8	109796429	109796429	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:109796429G>A	uc003ymy.1	-	2	1004	c.899C>T	c.(898-900)GCG>GTG	p.A300V	TMEM74_uc003ymx.2_Intron	NM_153015	NP_694560	Q96NL1	TMM74_HUMAN	transmembrane protein 74	300					autophagy	autophagic vacuole membrane|cytoplasmic vesicle|integral to membrane|lysosomal membrane				ovary(1)|lung(1)|kidney(1)|skin(1)	4			OV - Ovarian serous cystadenocarcinoma(57;3.08e-10)															---	---	---	---
KCNV1	27012	broad.mit.edu	37	8	110986286	110986286	+	Missense_Mutation	SNP	C	T	T	rs143547134		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110986286C>T	uc003ynr.3	-	1	674	c.332G>A	c.(331-333)CGA>CAA	p.R111Q	KCNV1_uc010mcw.2_Missense_Mutation_p.R111Q	NM_014379	NP_055194	Q6PIU1	KCNV1_HUMAN	potassium channel, subfamily V, member 1	111	Cytoplasmic (Potential).					voltage-gated potassium channel complex	ion channel inhibitor activity|potassium channel regulator activity|voltage-gated potassium channel activity			lung(1)|kidney(1)	2	all_neural(195;0.219)		OV - Ovarian serous cystadenocarcinoma(57;5.35e-13)															---	---	---	---
CSMD3	114788	broad.mit.edu	37	8	113249424	113249424	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113249424A>G	uc003ynu.2	-	67	10781	c.10622T>C	c.(10621-10623)CTT>CCT	p.L3541P	CSMD3_uc003yns.2_Missense_Mutation_p.L2743P|CSMD3_uc003ynt.2_Missense_Mutation_p.L3501P|CSMD3_uc011lhx.1_Missense_Mutation_p.L3372P	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	3541	Extracellular (Potential).					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---
CSMD3	114788	broad.mit.edu	37	8	113349775	113349775	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113349775C>T	uc003ynu.2	-	43	6997	c.6838G>A	c.(6838-6840)GAA>AAA	p.E2280K	CSMD3_uc003yns.2_Missense_Mutation_p.E1482K|CSMD3_uc003ynt.2_Missense_Mutation_p.E2240K|CSMD3_uc011lhx.1_Missense_Mutation_p.E2176K|CSMD3_uc003ynw.1_5'UTR	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	2280	Extracellular (Potential).|Sushi 12.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63															HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			---	---	---	---
TEK	7010	broad.mit.edu	37	9	27203086	27203086	+	Silent	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:27203086T>C	uc003zqi.3	+	13	2620	c.2178T>C	c.(2176-2178)TCT>TCC	p.S726S	TEK_uc011lno.1_Silent_p.S683S|TEK_uc011lnp.1_Silent_p.S579S|TEK_uc003zqj.1_Silent_p.S660S	NM_000459	NP_000450	Q02763	TIE2_HUMAN	TEK tyrosine kinase, endothelial precursor	726	Extracellular (Potential).|Fibronectin type-III 3.				angiogenesis|blood coagulation|cell-cell signaling|leukocyte migration|positive regulation of ERK1 and ERK2 cascade|positive regulation of protein kinase B signaling cascade|protein oligomerization|transmembrane receptor protein tyrosine kinase signaling pathway	apical plasma membrane|basolateral plasma membrane|cell surface|integral to plasma membrane|membrane raft|microvillus	ATP binding|protein binding|transmembrane receptor protein tyrosine kinase activity			ovary(3)|central_nervous_system(3)|breast(3)|lung(2)|kidney(1)	12		all_neural(11;7.57e-10)|Myeloproliferative disorder(762;0.0255)		Lung(218;4.08e-05)|LUSC - Lung squamous cell carcinoma(38;0.00027)														---	---	---	---
SPINK4	27290	broad.mit.edu	37	9	33246723	33246723	+	Missense_Mutation	SNP	G	A	A	rs140712741		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33246723G>A	uc003zsh.2	+	3	223	c.212G>A	c.(211-213)CGG>CAG	p.R71Q	SUGT1P1_uc010mjq.1_Intron	NM_014471	NP_055286	O60575	ISK4_HUMAN	serine peptidase inhibitor, Kazal type 4	71	Kazal-like.					extracellular region	serine-type endopeptidase inhibitor activity				0			LUSC - Lung squamous cell carcinoma(29;0.00506)															---	---	---	---
CA9	768	broad.mit.edu	37	9	35675761	35675761	+	Missense_Mutation	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35675761A>T	uc003zxo.3	+	3	479	c.437A>T	c.(436-438)GAC>GTC	p.D146V	C9orf100_uc003zxl.2_RNA|CA9_uc003zxp.3_Missense_Mutation_p.D146V	NM_001216	NP_001207	Q16790	CAH9_HUMAN	carbonic anhydrase IX precursor	146	Extracellular.|Catalytic.				one-carbon metabolic process	integral to membrane|microvillus membrane|nucleolus	carbonate dehydratase activity|zinc ion binding			ovary(4)|skin(1)	5	all_epithelial(49;0.217)		Lung(28;0.00276)|LUSC - Lung squamous cell carcinoma(32;0.00418)|STAD - Stomach adenocarcinoma(86;0.194)															---	---	---	---
MAMDC2	256691	broad.mit.edu	37	9	72785543	72785543	+	Silent	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:72785543G>C	uc004ahm.2	+	11	2264	c.1647G>C	c.(1645-1647)GGG>GGC	p.G549G	MAMDC2_uc004ahn.2_RNA|uc004aho.1_Intron|uc004ahp.1_RNA	NM_153267	NP_694999	Q7Z304	MAMC2_HUMAN	MAM domain containing 2 precursor	549	MAM 4.					endoplasmic reticulum|membrane				central_nervous_system(1)|pancreas(1)	2																		---	---	---	---
FLJ46321	389763	broad.mit.edu	37	9	84605815	84605815	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:84605815C>A	uc004amn.2	+	4	477	c.430C>A	c.(430-432)CTG>ATG	p.L144M		NM_001001670	NP_001001670	Q6ZQQ2	F75D1_HUMAN	hypothetical protein LOC389763	144						integral to membrane					0																		---	---	---	---
SECISBP2	79048	broad.mit.edu	37	9	91954828	91954828	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:91954828G>A	uc004aqj.1	+	9	1342	c.1262G>A	c.(1261-1263)AGA>AAA	p.R421K	SECISBP2_uc011ltk.1_Missense_Mutation_p.R420K|SECISBP2_uc004aqk.1_Missense_Mutation_p.R348K|SECISBP2_uc010mqo.1_Missense_Mutation_p.R126K|SECISBP2_uc011ltl.1_Missense_Mutation_p.R353K	NM_024077	NP_076982	Q96T21	SEBP2_HUMAN	SECIS binding protein 2	421					translation	nucleus	mRNA 3'-UTR binding			ovary(2)|skin(1)	3																		---	---	---	---
PTCH1	5727	broad.mit.edu	37	9	98268846	98268846	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:98268846C>T	uc004avk.3	-	2	425	c.237G>A	c.(235-237)CTG>CTA	p.L79L	PTCH1_uc010mro.2_5'UTR|PTCH1_uc010mrp.2_5'UTR|PTCH1_uc010mrq.2_5'UTR|PTCH1_uc004avl.3_5'UTR|PTCH1_uc010mrr.2_Silent_p.L13L|PTCH1_uc004avm.3_Silent_p.L78L|PTCH1_uc010mrt.1_RNA|PTCH1_uc010mru.1_RNA|PTCH1_uc004avo.2_Silent_p.L13L|PTCH1_uc010mrv.1_Intron|PTCH1_uc010mrw.1_Intron	NM_000264	NP_000255	Q13635	PTC1_HUMAN	patched isoform L	79	Cytoplasmic (Potential).				embryonic limb morphogenesis|negative regulation of multicellular organism growth|protein processing|regulation of smoothened signaling pathway|smoothened signaling pathway	integral to plasma membrane	hedgehog receptor activity			skin(242)|central_nervous_system(72)|bone(33)|upper_aerodigestive_tract(11)|lung(6)|large_intestine(4)|breast(4)|oesophagus(3)|ovary(3)|vulva(1)	379		Medulloblastoma(1;7.87e-06)|all_neural(1;0.000555)|Acute lymphoblastic leukemia(62;0.136)												Basal_Cell_Nevus_syndrome				---	---	---	---
TLR4	7099	broad.mit.edu	37	9	120474710	120474710	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:120474710A>G	uc004bjz.2	+	3	595	c.304A>G	c.(304-306)AGC>GGC	p.S102G	TLR4_uc004bka.2_Missense_Mutation_p.S62G|TLR4_uc004bkb.2_5'UTR	NM_138554	NP_612564	O00206	TLR4_HUMAN	toll-like receptor 4 precursor	102	Extracellular (Potential).				activation of MAPK activity|cellular response to mechanical stimulus|detection of fungus|detection of lipopolysaccharide|I-kappaB phosphorylation|innate immune response|intestinal epithelial structure maintenance|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of ERK1 and ERK2 cascade|negative regulation of interferon-gamma production|negative regulation of interleukin-17 production|negative regulation of interleukin-23 production|negative regulation of interleukin-6 production|negative regulation of osteoclast differentiation|negative regulation of tumor necrosis factor production|positive regulation of chemokine production|positive regulation of interferon-alpha production|positive regulation of interferon-beta production|positive regulation of interferon-gamma production|positive regulation of interleukin-1 production|positive regulation of interleukin-10 production|positive regulation of interleukin-12 biosynthetic process|positive regulation of interleukin-12 production|positive regulation of interleukin-6 production|positive regulation of interleukin-8 biosynthetic process|positive regulation of interleukin-8 production|positive regulation of NF-kappaB import into nucleus|positive regulation of NF-kappaB transcription factor activity|positive regulation of nitric-oxide synthase biosynthetic process|positive regulation of platelet activation|positive regulation of transcription from RNA polymerase II promoter|positive regulation of tumor necrosis factor biosynthetic process|positive regulation of tumor necrosis factor production|T-helper 1 type immune response|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 4 signaling pathway	external side of plasma membrane|integral to plasma membrane|lipopolysaccharide receptor complex|perinuclear region of cytoplasm	lipopolysaccharide receptor activity|transmembrane receptor activity			lung(10)|ovary(4)|breast(1)|skin(1)	16																		---	---	---	---
DBC1	1620	broad.mit.edu	37	9	122011416	122011416	+	Silent	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:122011416A>T	uc004bkc.2	-	3	687	c.231T>A	c.(229-231)CGT>CGA	p.R77R	DBC1_uc004bkd.2_Silent_p.R77R	NM_014618	NP_055433	O60477	DBC1_HUMAN	deleted in bladder cancer 1 precursor	77	MACPF.				cell cycle arrest|cell death	cytoplasm	protein binding			skin(3)|ovary(2)|central_nervous_system(2)|large_intestine(1)	8																		---	---	---	---
CEL	1056	broad.mit.edu	37	9	135942255	135942255	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135942255C>T	uc010naa.1	+	6	725	c.709C>T	c.(709-711)CGG>TGG	p.R237W		NM_001807	NP_001798	P19835	CEL_HUMAN	carboxyl ester lipase precursor	234					cholesterol catabolic process|fatty acid catabolic process|intestinal cholesterol absorption|intestinal lipid catabolic process|pancreatic juice secretion|protein esterification	cytosol|extracellular space	acylglycerol lipase activity|carboxylesterase activity|heparin binding|sterol esterase activity|triglyceride lipase activity			pancreas(1)	1				OV - Ovarian serous cystadenocarcinoma(145;1.03e-40)|Epithelial(140;3.58e-37)|GBM - Glioblastoma multiforme(294;0.00164)|READ - Rectum adenocarcinoma(205;0.196)														---	---	---	---
PHPT1	29085	broad.mit.edu	37	9	139744542	139744542	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139744542T>C	uc004cjp.2	+	3	860	c.238T>C	c.(238-240)TCC>CCC	p.S80P	PHPT1_uc011mei.1_Missense_Mutation_p.S80P|PHPT1_uc004cjq.3_Missense_Mutation_p.S80P|MAMDC4_uc004cjs.2_5'Flank|MAMDC4_uc011mej.1_5'Flank	NM_014172	NP_054891	Q9NRX4	PHP14_HUMAN	phosphohistidine phosphatase 1 isoform 3	80						cytosol	phosphohistidine phosphatase activity|phosphoprotein phosphatase activity				0	all_cancers(76;0.0763)|all_epithelial(76;0.198)	Myeloproliferative disorder(178;0.0821)		OV - Ovarian serous cystadenocarcinoma(145;1.52e-05)|Epithelial(140;0.000171)														---	---	---	---
ABCA2	20	broad.mit.edu	37	9	139903860	139903860	+	Silent	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139903860G>T	uc011mem.1	-	44	6934	c.6786C>A	c.(6784-6786)CGC>CGA	p.R2262R	ABCA2_uc011mel.1_Silent_p.R2263R|ABCA2_uc004ckl.1_Silent_p.R2193R|ABCA2_uc004ckm.1_Silent_p.R2293R	NM_001606	NP_001597	Q9BZC7	ABCA2_HUMAN	ATP-binding cassette, sub-family A, member 2	2262	ABC transporter 2.				cholesterol homeostasis|lipid metabolic process|regulation of intracellular cholesterol transport|regulation of transcription from RNA polymerase II promoter|response to drug|response to steroid hormone stimulus	ATP-binding cassette (ABC) transporter complex|cytoplasmic membrane-bounded vesicle|endosome|integral to membrane|microtubule organizing center	ATP binding|ATPase activity, coupled to transmembrane movement of substances				0	all_cancers(76;0.16)	Myeloproliferative disorder(178;0.0511)	STAD - Stomach adenocarcinoma(284;0.123)	OV - Ovarian serous cystadenocarcinoma(145;2.94e-05)|Epithelial(140;0.00048)														---	---	---	---
PRKCQ	5588	broad.mit.edu	37	10	6470192	6470192	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:6470192C>T	uc001ijj.1	-	18	2173	c.2098G>A	c.(2098-2100)GGG>AGG	p.G700R	PRKCQ_uc009xim.1_Missense_Mutation_p.G637R|PRKCQ_uc001iji.1_Missense_Mutation_p.G733R|PRKCQ_uc009xin.1_Missense_Mutation_p.G664R|PRKCQ_uc010qax.1_Missense_Mutation_p.G575R	NM_006257	NP_006248	Q04759	KPCT_HUMAN	protein kinase C, theta	700	AGC-kinase C-terminal.			G -> R (in Ref. 1; AAA75571 and 4; AAU29340).	axon guidance|cellular component disassembly involved in apoptosis|intracellular signal transduction|membrane protein ectodomain proteolysis|platelet activation|regulation of cell growth|T cell receptor signaling pathway	cytosol	ATP binding|metal ion binding|protein binding|protein kinase C activity			ovary(3)|lung(2)|large_intestine(1)	6																		---	---	---	---
MLLT10	8028	broad.mit.edu	37	10	21962549	21962549	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:21962549G>A	uc001iqs.2	+	11	1670	c.1322G>A	c.(1321-1323)GGT>GAT	p.G441D	MLLT10_uc001iqt.2_Missense_Mutation_p.G441D|MLLT10_uc001iqv.2_RNA|MLLT10_uc001iqy.2_Missense_Mutation_p.G441D|MLLT10_uc001ira.2_Intron|MLLT10_uc001irb.2_5'Flank|MLLT10_uc001iqz.2_Missense_Mutation_p.G196D	NM_004641	NP_004632	P55197	AF10_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	441	DNA-binding.				positive regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(1)|skin(1)	2								T	MLL|PICALM|CDK6	AL								---	---	---	---
ITGB1	3688	broad.mit.edu	37	10	33197334	33197334	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:33197334T>C	uc001iws.3	-	15	2429	c.2293A>G	c.(2293-2295)AAA>GAA	p.K765E	ITGB1_uc001iwp.3_Missense_Mutation_p.K765E|ITGB1_uc001iwq.3_Missense_Mutation_p.K765E|ITGB1_uc001iwr.3_Missense_Mutation_p.K765E|ITGB1_uc001iwt.3_Missense_Mutation_p.K765E|ITGB1_uc001iwu.1_Missense_Mutation_p.K765E	NM_133376	NP_596867	P05556	ITB1_HUMAN	integrin beta 1 isoform 1A precursor	765	Cytoplasmic (Potential).				axon guidance|blood coagulation|cell-cell adhesion mediated by integrin|cell-matrix adhesion|cellular defense response|homophilic cell adhesion|integrin-mediated signaling pathway|interspecies interaction between organisms|leukocyte cell-cell adhesion|leukocyte migration|positive regulation of apoptosis|regulation of immune response	cell surface|cleavage furrow|focal adhesion|melanosome|neuromuscular junction|ruffle|sarcolemma	identical protein binding|protein heterodimerization activity|receptor activity			upper_aerodigestive_tract(1)|ovary(1)	2		Ovarian(717;1.34e-05)|Breast(68;0.0634)																---	---	---	---
ANKRD30A	91074	broad.mit.edu	37	10	37508073	37508073	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:37508073G>A	uc001iza.1	+	34	3364	c.3265G>A	c.(3265-3267)GAA>AAA	p.E1089K		NM_052997	NP_443723	Q9BXX3	AN30A_HUMAN	ankyrin repeat domain 30A	1145	Potential.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(7)|breast(1)|skin(1)	9																		---	---	---	---
PCDH15	65217	broad.mit.edu	37	10	55566448	55566448	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55566448T>G	uc010qhq.1	-	36	5335	c.4940A>C	c.(4939-4941)AAG>ACG	p.K1647T	PCDH15_uc010qhr.1_Missense_Mutation_p.K1642T	NM_001142771	NP_001136243	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD3-1 precursor	Error:Variant_position_missing_in_Q96QU1_after_alignment					equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)													HNSCC(58;0.16)			---	---	---	---
EGR2	1959	broad.mit.edu	37	10	64573486	64573486	+	Silent	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64573486G>T	uc010qim.1	-	3	1066	c.912C>A	c.(910-912)GCC>GCA	p.A304A	EGR2_uc010qin.1_Silent_p.A254A|EGR2_uc001jmi.2_Silent_p.A304A|EGR2_uc010qio.1_Silent_p.A317A|EGR2_uc009xph.2_Silent_p.A304A	NM_001136177	NP_001129649	P11161	EGR2_HUMAN	early growth response 2 protein isoform a	304	Poly-Ala.				fat cell differentiation|protein export from nucleus|transcription from RNA polymerase II promoter	cytoplasm|nucleus	chromatin binding|RNA polymerase II activating transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|ubiquitin protein ligase binding|zinc ion binding			ovary(2)	2	Prostate(12;0.0297)|all_hematologic(501;0.228)																	---	---	---	---
CTNNA3	29119	broad.mit.edu	37	10	68526056	68526056	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:68526056G>A	uc009xpn.1	-	9	1370	c.1247C>T	c.(1246-1248)GCG>GTG	p.A416V	CTNNA3_uc001jmw.2_Missense_Mutation_p.A416V|CTNNA3_uc001jmx.3_Missense_Mutation_p.A416V	NM_001127384	NP_001120856	Q9UI47	CTNA3_HUMAN	catenin, alpha 3	416					cell-cell adhesion	actin cytoskeleton|cytoplasm|fascia adherens	cadherin binding|structural molecule activity			skin(3)|ovary(2)|pancreas(1)|lung(1)|central_nervous_system(1)	8																		---	---	---	---
CTNNA3	29119	broad.mit.edu	37	10	68535278	68535278	+	Missense_Mutation	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:68535278C>G	uc009xpn.1	-	8	1175	c.1052G>C	c.(1051-1053)GGA>GCA	p.G351A	CTNNA3_uc001jmw.2_Missense_Mutation_p.G351A|CTNNA3_uc001jmx.3_Missense_Mutation_p.G351A	NM_001127384	NP_001120856	Q9UI47	CTNA3_HUMAN	catenin, alpha 3	351	Potential.				cell-cell adhesion	actin cytoskeleton|cytoplasm|fascia adherens	cadherin binding|structural molecule activity			skin(3)|ovary(2)|pancreas(1)|lung(1)|central_nervous_system(1)	8																		---	---	---	---
NRG3	10718	broad.mit.edu	37	10	84738701	84738701	+	Intron	SNP	A	G	G	rs75365933		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:84738701A>G	uc001kco.2	+						NRG3_uc010qlz.1_Intron|NRG3_uc001kcp.2_Intron|NRG3_uc001kcq.2_Intron|NRG3_uc001kcr.2_Intron	NM_001010848	NP_001010848			neuregulin 3 isoform 1						regulation of cell growth	extracellular region|integral to plasma membrane	growth factor activity|receptor tyrosine kinase binding|transmembrane receptor protein tyrosine kinase activator activity			lung(5)|breast(1)	6				GBM - Glioblastoma multiforme(1;2.5e-18)|all cancers(1;2.85e-09)														---	---	---	---
SMC3	9126	broad.mit.edu	37	10	112360880	112360880	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:112360880G>A	uc001kze.2	+	23	2762	c.2636G>A	c.(2635-2637)CGA>CAA	p.R879Q		NM_005445	NP_005436	Q9UQE7	SMC3_HUMAN	structural maintenance of chromosomes 3	879	Potential.				cell division|DNA mediated transformation|DNA repair|meiosis|mitotic metaphase/anaphase transition|mitotic prometaphase|mitotic spindle organization|negative regulation of DNA endoreduplication|signal transduction|sister chromatid cohesion	basement membrane|chromatin|chromosome, centromeric region|cytoplasm|meiotic cohesin complex|nuclear matrix|nucleoplasm|spindle pole	ATP binding|dynein binding|microtubule motor activity|protein heterodimerization activity			ovary(1)|central_nervous_system(1)|skin(1)	3		Breast(234;0.0848)|Lung NSC(174;0.238)		Epithelial(162;0.00206)|all cancers(201;0.0227)|BRCA - Breast invasive adenocarcinoma(275;0.127)														---	---	---	---
PPAPDC1A	196051	broad.mit.edu	37	10	122280611	122280611	+	Intron	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:122280611A>G	uc001lev.1	+						PPAPDC1A_uc010qtd.1_Intron|PPAPDC1A_uc009xzl.1_Intron|PPAPDC1A_uc001lew.1_Intron|PPAPDC1A_uc001lex.1_Intron|PPAPDC1A_uc001ley.1_Intron	NM_001030059	NP_001025230			phosphatidic acid phosphatase type 2 domain						phospholipid dephosphorylation	integral to membrane	phosphatidate phosphatase activity			breast(1)	1		Lung NSC(174;0.1)|all_lung(145;0.132)		all cancers(201;0.0117)														---	---	---	---
TACC2	10579	broad.mit.edu	37	10	124008317	124008317	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124008317A>G	uc001lfv.2	+	20	8912	c.8552A>G	c.(8551-8553)AAG>AGG	p.K2851R	TACC2_uc001lfw.2_Missense_Mutation_p.K997R|TACC2_uc009xzx.2_Missense_Mutation_p.K2729R|TACC2_uc010qtv.1_Missense_Mutation_p.K2778R|TACC2_uc001lfx.2_Missense_Mutation_p.K478R|TACC2_uc001lfy.2_Missense_Mutation_p.K474R|TACC2_uc001lfz.2_Missense_Mutation_p.K929R|TACC2_uc001lga.2_Missense_Mutation_p.K899R|TACC2_uc009xzy.2_Missense_Mutation_p.K911R|TACC2_uc001lgb.2_Missense_Mutation_p.K809R	NM_206862	NP_996744	O95359	TACC2_HUMAN	transforming, acidic coiled-coil containing	2851	Potential.					microtubule organizing center|nucleus	nuclear hormone receptor binding			ovary(4)|breast(3)|skin(2)|central_nervous_system(1)	10		all_neural(114;0.0656)|Lung NSC(174;0.136)|all_lung(145;0.17)|Breast(234;0.197)																---	---	---	---
PNPLA2	57104	broad.mit.edu	37	11	821985	821985	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:821985G>A	uc001lrt.2	+	4	650	c.448G>A	c.(448-450)GTG>ATG	p.V150M	PNPLA2_uc009ycl.2_5'Flank	NM_020376	NP_065109	Q96AD5	PLPL2_HUMAN	patatin-like phospholipase domain containing 2	150	Lumenal (Potential).|Patatin.				negative regulation of sequestering of triglyceride|positive regulation of triglyceride catabolic process	integral to membrane|lipid particle|plasma membrane	triglyceride lipase activity				0		all_cancers(49;4.75e-06)|all_epithelial(84;0.00204)|Breast(177;0.00234)|Ovarian(85;0.0228)|Medulloblastoma(188;0.0321)|all_neural(188;0.0762)		all cancers(45;1.63e-25)|Epithelial(43;1.28e-24)|OV - Ovarian serous cystadenocarcinoma(40;7.09e-19)|BRCA - Breast invasive adenocarcinoma(625;4.23e-05)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)														---	---	---	---
OR51I1	390063	broad.mit.edu	37	11	5462125	5462125	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5462125A>C	uc010qze.1	-	1	620	c.620T>G	c.(619-621)TTT>TGT	p.F207C	HBG2_uc001mak.1_Intron|HBE1_uc001mam.1_Intron|OR51B5_uc001maq.1_Intron	NM_001005288	NP_001005288	Q9H343	O51I1_HUMAN	olfactory receptor, family 51, subfamily I,	207	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Medulloblastoma(188;0.0075)|all_neural(188;0.0572)|Breast(177;0.0675)		Epithelial(150;1.92e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)														---	---	---	---
ALX4	60529	broad.mit.edu	37	11	44297059	44297059	+	Missense_Mutation	SNP	C	T	T	rs140457891		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:44297059C>T	uc001myb.2	-	2	720	c.616G>A	c.(616-618)GAC>AAC	p.D206N		NM_021926	NP_068745	Q9H161	ALX4_HUMAN	aristaless-like homeobox 4	206					hair follicle development						0																		---	---	---	---
LRP4	4038	broad.mit.edu	37	11	46884284	46884284	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46884284T>C	uc001ndn.3	-	37	5404	c.5258A>G	c.(5257-5259)AAG>AGG	p.K1753R	uc001ndl.2_Intron|LRP4_uc001ndm.3_5'UTR	NM_002334	NP_002325	O75096	LRP4_HUMAN	low density lipoprotein receptor-related protein	1753	Cytoplasmic (Potential).				endocytosis|negative regulation of canonical Wnt receptor signaling pathway|Wnt receptor signaling pathway	integral to membrane	calcium ion binding|receptor activity			skin(2)|upper_aerodigestive_tract(1)|ovary(1)	4				Lung(87;0.159)														---	---	---	---
OR8J3	81168	broad.mit.edu	37	11	55904650	55904650	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55904650G>T	uc010riz.1	-	1	545	c.545C>A	c.(544-546)GCA>GAA	p.A182E		NM_001004064	NP_001004064	Q8NGG0	OR8J3_HUMAN	olfactory receptor, family 8, subfamily J,	182	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2	Esophageal squamous(21;0.00693)																	---	---	---	---
OR5T2	219464	broad.mit.edu	37	11	56000013	56000013	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56000013A>G	uc010rjc.1	-	1	649	c.649T>C	c.(649-651)TTT>CTT	p.F217L		NM_001004746	NP_001004746	Q8NGG2	OR5T2_HUMAN	olfactory receptor, family 5, subfamily T,	217	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00448)																	---	---	---	---
OR5M3	219482	broad.mit.edu	37	11	56237885	56237885	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56237885A>G	uc010rjk.1	-	1	89	c.89T>C	c.(88-90)CTT>CCT	p.L30P		NM_001004742	NP_001004742	Q8NGP4	OR5M3_HUMAN	olfactory receptor, family 5, subfamily M,	30	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00448)																	---	---	---	---
ZFP91	80829	broad.mit.edu	37	11	58379103	58379103	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58379103C>T	uc001nmx.3	+	6	917	c.749C>T	c.(748-750)TCA>TTA	p.S250L	ZFP91_uc001nmy.3_Missense_Mutation_p.S249L|ZFP91-CNTF_uc010rkm.1_RNA	NM_053023	NP_444251	Q96JP5	ZFP91_HUMAN	zinc finger protein 91	250	Glu-rich.				activation of NF-kappaB-inducing kinase activity|protein K63-linked ubiquitination	nucleus	nucleic acid binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)	1		Breast(21;0.00725)|all_epithelial(135;0.0101)|all_lung(304;0.24)																---	---	---	---
C11orf66	220004	broad.mit.edu	37	11	61257335	61257335	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61257335C>T	uc001nru.1	+	12	1250	c.1125C>T	c.(1123-1125)TAC>TAT	p.Y375Y	C11orf66_uc009ynq.1_Silent_p.Y355Y	NM_145017	NP_659454	Q7Z5V6	CK066_HUMAN	IIIG9 protein	375										ovary(1)	1																		---	---	---	---
FKBP2	2286	broad.mit.edu	37	11	64009967	64009967	+	Missense_Mutation	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64009967G>C	uc001nyy.2	+	2	304	c.108G>C	c.(106-108)AAG>AAC	p.K36N	FKBP2_uc010rnh.1_Missense_Mutation_p.K36N|FKBP2_uc001nyz.2_Missense_Mutation_p.K36N	NM_004470	NP_004461	P26885	FKBP2_HUMAN	FK506 binding protein 2, 13kDa precursor	36					protein folding	endoplasmic reticulum membrane	FK506 binding|peptidyl-prolyl cis-trans isomerase activity|protein binding				0																		---	---	---	---
SPDYC	387778	broad.mit.edu	37	11	64940349	64940349	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64940349C>T	uc010rnz.1	+	6	711	c.711C>T	c.(709-711)TGC>TGT	p.C237C		NM_001008778	NP_001008778	Q5MJ68	SPDYC_HUMAN	speedy C	237					cell cycle	nucleus	protein kinase binding				0																		---	---	---	---
PELI3	246330	broad.mit.edu	37	11	66238702	66238702	+	Intron	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66238702G>A	uc001oic.3	+						PELI3_uc001oib.2_Intron|PELI3_uc001oid.3_Intron|PELI3_uc001oie.3_Intron|PELI3_uc010rpd.1_5'Flank	NM_145065	NP_659502			pellino 3 alpha isoform 1							cytosol	protein binding			ovary(1)	1																		---	---	---	---
RBM4B	83759	broad.mit.edu	37	11	66444414	66444414	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66444414G>T	uc001oja.2	-	1	806	c.137C>A	c.(136-138)ACG>AAG	p.T46K	RBM4B_uc001ojb.2_Missense_Mutation_p.T46K	NM_031492	NP_113680	Q9BQ04	RBM4B_HUMAN	RNA binding motif protein 4B	46	RRM 1.				circadian regulation of gene expression|entrainment of circadian clock by photoperiod|mRNA processing|RNA splicing	nucleolus	nucleotide binding|RNA binding|zinc ion binding				0																		---	---	---	---
ARRB1	408	broad.mit.edu	37	11	74992137	74992137	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:74992137T>C	uc001owe.1	-	7	686	c.464A>G	c.(463-465)GAG>GGG	p.E155G	ARRB1_uc001owf.1_Missense_Mutation_p.E155G	NM_004041	NP_004032	P49407	ARRB1_HUMAN	arrestin beta 1 isoform A	155	Interaction with SRC (By similarity).				G-protein coupled receptor internalization|histone H4 acetylation|negative regulation of interleukin-6 production|negative regulation of interleukin-8 production|negative regulation of NF-kappaB transcription factor activity|negative regulation of protein ubiquitination|platelet activation|positive regulation of ERK1 and ERK2 cascade|positive regulation of histone acetylation|positive regulation of Rho protein signal transduction|positive regulation of transcription from RNA polymerase II promoter|post-Golgi vesicle-mediated transport|proteasomal ubiquitin-dependent protein catabolic process|protein transport|protein ubiquitination|signal transduction|stress fiber assembly|transcription from RNA polymerase II promoter	chromatin|coated pit|cytoplasmic vesicle membrane|cytosol|Golgi membrane|lysosomal membrane|membrane fraction|nucleus|plasma membrane|pseudopodium|soluble fraction	angiotensin receptor binding|enzyme inhibitor activity|GTPase activator activity|insulin-like growth factor receptor binding|transcription factor binding|transcription regulatory region DNA binding|ubiquitin protein ligase binding			breast(2)	2																		---	---	---	---
PGR	5241	broad.mit.edu	37	11	100920672	100920672	+	Missense_Mutation	SNP	G	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:100920672G>C	uc001pgh.2	-	6	3219	c.2476C>G	c.(2476-2478)CTT>GTT	p.L826V	PGR_uc001pgg.2_Missense_Mutation_p.L207V|PGR_uc001pgi.2_Missense_Mutation_p.L724V|PGR_uc009yww.1_Intron|PGR_uc001pgj.2_RNA|PGR_uc009ywx.1_RNA	NM_000926	NP_000917	P06401	PRGR_HUMAN	progesterone receptor	826	Steroid-binding.				cell-cell signaling|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	cytoplasm|nucleoplasm	enzyme binding|receptor binding|sequence-specific DNA binding transcription factor activity|steroid binding|steroid hormone receptor activity|zinc ion binding			lung(1)|liver(1)|central_nervous_system(1)|pancreas(1)	4		Acute lymphoblastic leukemia(157;0.000885)|all_hematologic(158;0.014)		LUSC - Lung squamous cell carcinoma(1;0.0387)|BRCA - Breast invasive adenocarcinoma(274;0.124)|OV - Ovarian serous cystadenocarcinoma(223;0.148)|Lung(307;0.164)	Desogestrel(DB00304)|Drospirenone(DB01395)|Dydrogesterone(DB00378)|Ethynodiol Diacetate(DB00823)|Etonogestrel(DB00294)|Levonorgestrel(DB00367)|Medroxyprogesterone(DB00603)|Megestrol(DB00351)|Mifepristone(DB00834)|Norethindrone(DB00717)|Norgestimate(DB00957)|Norgestrel(DB00506)|Progesterone(DB00396)													---	---	---	---
DYNC2H1	79659	broad.mit.edu	37	11	103306730	103306730	+	Silent	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:103306730A>G	uc001pho.2	+	85	12570	c.12426A>G	c.(12424-12426)AGA>AGG	p.R4142R	DYNC2H1_uc001phn.1_Silent_p.R4149R|DYNC2H1_uc009yxe.1_Silent_p.R755R	NM_001080463	NP_001073932	Q8NCM8	DYHC2_HUMAN	dynein, cytoplasmic 2, heavy chain 1	4142					cell projection organization|Golgi organization|microtubule-based movement|multicellular organismal development	cilium axoneme|dynein complex|Golgi apparatus|microtubule|plasma membrane	ATP binding|ATPase activity|microtubule motor activity				0		Acute lymphoblastic leukemia(157;0.000966)|all_hematologic(158;0.00348)		BRCA - Breast invasive adenocarcinoma(274;0.000177)|Epithelial(105;0.0785)														---	---	---	---
ARHGAP20	57569	broad.mit.edu	37	11	110451527	110451527	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:110451527G>T	uc001pkz.1	-	16	2428	c.2143C>A	c.(2143-2145)CTT>ATT	p.L715I	ARHGAP20_uc001pky.1_Missense_Mutation_p.L692I|ARHGAP20_uc009yyb.1_Missense_Mutation_p.L679I|ARHGAP20_uc001pla.1_Missense_Mutation_p.L679I|ARHGAP20_uc001plb.2_Missense_Mutation_p.L258I	NM_020809	NP_065860	Q9P2F6	RHG20_HUMAN	Rho GTPase activating protein 20	715					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(3)|kidney(2)	5		all_cancers(61;3.26e-12)|all_epithelial(67;6.09e-07)|Melanoma(852;1.46e-05)|all_hematologic(158;0.000484)|Acute lymphoblastic leukemia(157;0.000967)|all_neural(223;0.0199)|Medulloblastoma(222;0.0425)|Breast(348;0.0544)		Epithelial(105;3.05e-06)|BRCA - Breast invasive adenocarcinoma(274;1.24e-05)|all cancers(92;0.000147)|OV - Ovarian serous cystadenocarcinoma(223;0.0475)														---	---	---	---
PHLDB1	23187	broad.mit.edu	37	11	118498963	118498963	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118498963G>A	uc001ptr.1	+	7	1777	c.1424G>A	c.(1423-1425)CGG>CAG	p.R475Q	PHLDB1_uc001pts.2_Missense_Mutation_p.R475Q|PHLDB1_uc001ptt.2_Missense_Mutation_p.R475Q|PHLDB1_uc001ptu.1_Intron|PHLDB1_uc001ptv.1_Missense_Mutation_p.R275Q|PHLDB1_uc001ptw.1_5'Flank	NM_015157	NP_055972	Q86UU1	PHLB1_HUMAN	pleckstrin homology-like domain, family B,	475											0	all_hematologic(175;0.0839)	Medulloblastoma(222;0.0523)|all_hematologic(192;0.0735)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;3.4e-05)														---	---	---	---
ADAMTS8	11095	broad.mit.edu	37	11	130288995	130288995	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:130288995C>T	uc001qgg.3	-	2	1271	c.913G>A	c.(913-915)GAC>AAC	p.D305N		NM_007037	NP_008968	Q9UP79	ATS8_HUMAN	ADAM metallopeptidase with thrombospondin type 1	305	Peptidase M12B.				negative regulation of cell proliferation|proteolysis	proteinaceous extracellular matrix	heparin binding|integrin binding|low affinity phosphate transmembrane transporter activity|metalloendopeptidase activity|zinc ion binding			central_nervous_system(1)	1	all_hematologic(175;0.0429)	Lung NSC(97;0.000601)|Breast(109;0.000962)|all_lung(97;0.00125)|Medulloblastoma(222;0.0425)|all_neural(223;0.0837)		OV - Ovarian serous cystadenocarcinoma(99;0.039)|Lung(977;0.213)														---	---	---	---
JAM3	83700	broad.mit.edu	37	11	134014823	134014823	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:134014823G>A	uc001qhb.1	+	5	705	c.681G>A	c.(679-681)ACG>ACA	p.T227T	JAM3_uc009zcz.1_Silent_p.T176T	NM_032801	NP_116190	Q9BX67	JAM3_HUMAN	junctional adhesion molecule 3 precursor	182	Extracellular (Potential).|Ig-like C2-type.				angiogenesis|blood coagulation|regulation of neutrophil chemotaxis	cell-cell contact zone|desmosome|extracellular space|integral to membrane	integrin binding			ovary(1)	1	all_hematologic(175;0.127)	all_cancers(12;1.06e-21)|all_epithelial(12;3.37e-16)|all_lung(97;7.03e-06)|Lung NSC(97;1.67e-05)|Breast(109;0.000182)|Medulloblastoma(222;0.0245)|all_neural(223;0.0506)|Esophageal squamous(93;0.0566)		Epithelial(10;1.55e-09)|BRCA - Breast invasive adenocarcinoma(10;1.35e-08)|all cancers(11;2.81e-08)|OV - Ovarian serous cystadenocarcinoma(99;0.00402)|Lung(977;0.245)														---	---	---	---
COPS7A	50813	broad.mit.edu	37	12	6839676	6839676	+	Intron	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6839676G>T	uc001qqj.2	+						COPS7A_uc009zex.2_Intron|COPS7A_uc001qqk.2_Intron|COPS7A_uc001qql.2_Intron|COPS7A_uc001qqh.2_Intron|COPS7A_uc001qqi.2_Intron|COPS7A_uc001qqm.2_Intron|COPS7A_uc001qqn.3_Intron|COPS7A_uc001qqo.2_Intron	NM_001164094	NP_001157566			COP9 complex subunit 7a						cullin deneddylation	cytoplasm|signalosome				ovary(1)	1																		---	---	---	---
RECQL	5965	broad.mit.edu	37	12	21626568	21626568	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21626568C>A	uc001rex.2	-	13	1712	c.1364G>T	c.(1363-1365)CGT>CTT	p.R455L	RECQL_uc001rey.2_Missense_Mutation_p.R455L	NM_032941	NP_116559	P46063	RECQ1_HUMAN	RecQ protein-like	455					DNA recombination|DNA repair|DNA replication	nucleus	ATP binding|ATP-dependent 3'-5' DNA helicase activity|DNA strand annealing activity|protein binding			ovary(1)|lung(1)	2													Direct_reversal_of_damage|Other_identified_genes_with_known_or_suspected_DNA_repair_function					---	---	---	---
DENND5B	160518	broad.mit.edu	37	12	31586168	31586168	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:31586168C>T	uc001rki.1	-	8	2213	c.2027G>A	c.(2026-2028)CGG>CAG	p.R676Q	DENND5B_uc001rkh.1_Missense_Mutation_p.R711Q|DENND5B_uc009zjq.1_Intron|DENND5B_uc001rkj.2_Missense_Mutation_p.R698Q	NM_144973	NP_659410	Q6ZUT9	DEN5B_HUMAN	DENN/MADD domain containing 5B	676						integral to membrane				ovary(1)|central_nervous_system(1)	2																		---	---	---	---
YARS2	51067	broad.mit.edu	37	12	32908614	32908614	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32908614G>A	uc001rli.2	-	1	261	c.195C>T	c.(193-195)TTC>TTT	p.F65F		NM_001040436	NP_001035526	Q9Y2Z4	SYYM_HUMAN	tyrosyl-tRNA synthetase 2, mitochondrial	65					tyrosyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|protein binding|RNA binding|tyrosine-tRNA ligase activity				0	Lung NSC(5;2.43e-07)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.239)				L-Tyrosine(DB00135)											OREG0021729	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
PKP2	5318	broad.mit.edu	37	12	32994053	32994053	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32994053T>C	uc001rlj.3	-	7	1712	c.1597A>G	c.(1597-1599)ATC>GTC	p.I533V	PKP2_uc001rlk.3_Missense_Mutation_p.I489V|PKP2_uc010skj.1_Missense_Mutation_p.I489V	NM_004572	NP_004563	Q99959	PKP2_HUMAN	plakophilin 2 isoform 2b	533					cell-cell adhesion	desmosome|integral to membrane|nucleus	binding			ovary(1)|pancreas(1)	2	Lung NSC(5;9.35e-07)|Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.239)																	---	---	---	---
LRRK2	120892	broad.mit.edu	37	12	40728856	40728856	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:40728856T>G	uc001rmg.3	+	40	5966	c.5845T>G	c.(5845-5847)TTA>GTA	p.L1949V	LRRK2_uc009zjw.2_Missense_Mutation_p.L787V|LRRK2_uc001rmi.2_Missense_Mutation_p.L782V	NM_198578	NP_940980	Q5S007	LRRK2_HUMAN	leucine-rich repeat kinase 2	1949	Protein kinase.				activation of MAPKK activity|determination of adult lifespan|exploration behavior|intracellular distribution of mitochondria|negative regulation of branching morphogenesis of a nerve|negative regulation of dendritic spine morphogenesis|negative regulation of neuroblast proliferation|negative regulation of neuron maturation|neuromuscular junction development|neuron death|peptidyl-serine phosphorylation|positive regulation of autophagy|positive regulation of dopamine receptor signaling pathway|positive regulation of programmed cell death|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein phosphorylation|positive regulation of protein ubiquitination|protein autophosphorylation|regulation of kidney size|regulation of locomotion|regulation of membrane potential|response to oxidative stress|small GTPase mediated signal transduction|tangential migration from the subventricular zone to the olfactory bulb	external side of mitochondrial outer membrane	ATP binding|GTP binding|GTP-dependent protein kinase activity|GTPase activator activity|MAP kinase kinase activity|protein homodimerization activity|tubulin binding			ovary(12)|stomach(5)|upper_aerodigestive_tract(2)|lung(2)|large_intestine(1)|urinary_tract(1)|pancreas(1)	24	all_cancers(12;0.00108)|Breast(8;0.218)	Lung NSC(34;0.0942)|all_lung(34;0.11)																---	---	---	---
MLL2	8085	broad.mit.edu	37	12	49443503	49443503	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49443503G>A	uc001rta.3	-	11	3868	c.3868C>T	c.(3868-3870)CGG>TGG	p.R1290W		NM_003482	NP_003473	O14686	MLL2_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 2	1290	Arg-rich.				chromatin silencing|histone H3-K4 methylation|oocyte growth|positive regulation of cell proliferation|positive regulation of estrogen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|response to estrogen stimulus|transcription, DNA-dependent	histone methyltransferase complex	histone-lysine N-methyltransferase activity|protein binding|transcription regulatory region DNA binding|zinc ion binding			kidney(16)|central_nervous_system(12)|lung(4)|skin(4)|ovary(3)|pancreas(2)	41								N|F|Mis		medulloblastoma|renal					HNSCC(34;0.089)			---	---	---	---
KRT71	112802	broad.mit.edu	37	12	52943836	52943836	+	Silent	SNP	G	A	A	rs113716134		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52943836G>A	uc001sao.2	-	2	703	c.633C>T	c.(631-633)GAC>GAT	p.D211D		NM_033448	NP_258259	Q3SY84	K2C71_HUMAN	keratin 71	211	Coil 1B.|Rod.						structural molecule activity			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(357;0.194)														---	---	---	---
TENC1	23371	broad.mit.edu	37	12	53454673	53454673	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53454673C>T	uc001sbp.2	+	20	3118	c.2983C>T	c.(2983-2985)CAC>TAC	p.H995Y	TENC1_uc001sbl.2_Missense_Mutation_p.H871Y|TENC1_uc001sbn.2_Missense_Mutation_p.H1005Y|TENC1_uc001sbq.2_Missense_Mutation_p.H393Y|TENC1_uc001sbr.2_RNA|TENC1_uc009zmr.2_Missense_Mutation_p.H490Y|TENC1_uc001sbs.2_5'Flank	NM_170754	NP_736610	Q63HR2	TENC1_HUMAN	tensin like C1 domain containing phosphatase	995	Pro-rich.				intracellular signal transduction|negative regulation of cell proliferation	focal adhesion	metal ion binding|phosphoprotein phosphatase activity|protein binding			ovary(1)|pancreas(1)	2																		---	---	---	---
LRP1	4035	broad.mit.edu	37	12	57605723	57605723	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57605723C>T	uc001snd.2	+	87	13738	c.13272C>T	c.(13270-13272)ATC>ATT	p.I4424I		NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	4424	Helical; (Potential).				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)													---	---	---	---
C12orf12	196477	broad.mit.edu	37	12	91348076	91348076	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:91348076G>A	uc001tbj.2	-	1	878	c.444C>T	c.(442-444)CGC>CGT	p.R148R		NM_152638	NP_689851	Q8TC90	CL012_HUMAN	hypothetical protein LOC196477	148										central_nervous_system(1)|pancreas(1)	2																		---	---	---	---
LUM	4060	broad.mit.edu	37	12	91502123	91502123	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:91502123A>C	uc001tbm.2	-	2	1023	c.634T>G	c.(634-636)TTA>GTA	p.L212V	LUM_uc001tbn.2_Intron	NM_002345	NP_002336	P51884	LUM_HUMAN	lumican precursor	212	LRR 7.				collagen fibril organization|visual perception	extracellular space|fibrillar collagen	collagen binding|extracellular matrix structural constituent			central_nervous_system(2)	2																		---	---	---	---
GAS2L3	283431	broad.mit.edu	37	12	100995421	100995421	+	Nonsense_Mutation	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100995421A>T	uc001thu.2	+	5	419	c.193A>T	c.(193-195)AAA>TAA	p.K65*	GAS2L3_uc009zty.2_Nonsense_Mutation_p.K65*|GAS2L3_uc001thv.2_5'UTR	NM_174942	NP_777602	Q86XJ1	GA2L3_HUMAN	growth arrest-specific 2 like 3	65	CH.				cell cycle arrest					skin(1)	1																		---	---	---	---
GNPTAB	79158	broad.mit.edu	37	12	102155373	102155373	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:102155373C>T	uc001tit.2	-	14	3063	c.2884G>A	c.(2884-2886)GAC>AAC	p.D962N		NM_024312	NP_077288	Q3T906	GNPTA_HUMAN	N-acetylglucosamine-1-phosphate transferase	962					cell differentiation	Golgi membrane|integral to membrane|nucleus	metal ion binding|transcription factor binding|UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase activity			ovary(1)|skin(1)	2																		---	---	---	---
RBM19	9904	broad.mit.edu	37	12	114390388	114390388	+	Missense_Mutation	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:114390388A>T	uc009zwi.2	-	8	1073	c.929T>A	c.(928-930)GTT>GAT	p.V310D	RBM19_uc001tvn.3_Missense_Mutation_p.V310D|RBM19_uc001tvm.2_Missense_Mutation_p.V310D	NM_001146699	NP_001140171	Q9Y4C8	RBM19_HUMAN	RNA binding motif protein 19	310	RRM 2.				multicellular organismal development|positive regulation of embryonic development	chromosome|cytoplasm|nucleolus|nucleoplasm	nucleotide binding|RNA binding			skin(3)|ovary(1)|liver(1)|central_nervous_system(1)	6	Medulloblastoma(191;0.163)|all_neural(191;0.178)																	---	---	---	---
PCDH17	27253	broad.mit.edu	37	13	58299162	58299162	+	Silent	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:58299162T>C	uc001vhq.1	+	4	4106	c.3214T>C	c.(3214-3216)TTG>CTG	p.L1072L	PCDH17_uc010aec.1_Silent_p.L1071L|PCDH17_uc001vhr.1_Silent_p.L161L	NM_001040429	NP_001035519	O14917	PCD17_HUMAN	protocadherin 17 precursor	1072	Cytoplasmic (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding|protein binding			ovary(3)|pancreas(2)|upper_aerodigestive_tract(1)|skin(1)	7		Lung NSC(96;0.027)|Prostate(109;0.0453)|Breast(118;0.128)|Hepatocellular(98;0.132)		GBM - Glioblastoma multiforme(99;1.06e-05)														---	---	---	---
NALCN	259232	broad.mit.edu	37	13	102030913	102030913	+	Intron	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:102030913T>G	uc001vox.1	-						NALCN_uc001voy.2_Intron|NALCN_uc001voz.2_Intron|NALCN_uc001vpa.2_Intron	NM_052867	NP_443099			voltage gated channel like 1							integral to membrane	sodium channel activity|voltage-gated ion channel activity			ovary(8)|breast(4)|skin(2)|pancreas(1)|central_nervous_system(1)	16	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---
TPP2	7174	broad.mit.edu	37	13	103299702	103299702	+	Intron	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:103299702A>G	uc001vpi.3	+							NM_003291	NP_003282			tripeptidyl peptidase II						proteolysis	cytoplasm|nucleus	aminopeptidase activity|serine-type endopeptidase activity|tripeptidyl-peptidase activity			upper_aerodigestive_tract(1)|ovary(1)	2	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)																	---	---	---	---
MYO16	23026	broad.mit.edu	37	13	109793645	109793645	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:109793645C>T	uc001vqt.1	+	32	5145	c.5019C>T	c.(5017-5019)GAC>GAT	p.D1673D	MYO16_uc010agk.1_Silent_p.D1695D	NM_015011	NP_055826	Q9Y6X6	MYO16_HUMAN	myosin heavy chain Myr 8	1673					cerebellum development|negative regulation of cell proliferation|negative regulation of S phase of mitotic cell cycle	myosin complex|nucleoplasm|perinuclear region of cytoplasm|plasma membrane	actin filament binding|ATP binding|motor activity			ovary(6)|large_intestine(1)|kidney(1)|breast(1)|central_nervous_system(1)	10	all_lung(23;0.000332)|all_neural(89;0.00294)|Medulloblastoma(90;0.00596)|Lung NSC(43;0.00751)|Lung SC(71;0.104)		BRCA - Breast invasive adenocarcinoma(86;0.19)|all cancers(43;0.201)															---	---	---	---
ATP4B	496	broad.mit.edu	37	13	114304735	114304735	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:114304735C>T	uc001vtz.2	-	6	742	c.700G>A	c.(700-702)GGG>AGG	p.G234R		NM_000705	NP_000696	P51164	ATP4B_HUMAN	hydrogen/potassium-exchanging ATPase 4B	234	Extracellular (Potential).				ATP biosynthetic process	integral to membrane|plasma membrane	hydrogen:potassium-exchanging ATPase activity|sodium:potassium-exchanging ATPase activity			ovary(1)	1	Lung NSC(43;0.0113)|all_neural(89;0.0337)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)|Lung SC(71;0.218)	all_cancers(25;0.00696)|all_epithelial(44;0.00347)|all_lung(25;0.0221)|Breast(118;0.0411)|Lung NSC(25;0.0839)	all cancers(43;0.171)		Rabeprazole(DB01129)													---	---	---	---
OR4K2	390431	broad.mit.edu	37	14	20344477	20344477	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20344477C>T	uc001vwh.1	+	1	51	c.51C>T	c.(49-51)CTC>CTT	p.L17L		NM_001005501	NP_001005501	Q8NGD2	OR4K2_HUMAN	olfactory receptor, family 4, subfamily K,	17	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(2)	4	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;2.95e-06)	GBM - Glioblastoma multiforme(265;0.00327)														---	---	---	---
OR4N5	390437	broad.mit.edu	37	14	20612797	20612797	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20612797G>T	uc010tla.1	+	1	903	c.903G>T	c.(901-903)TTG>TTT	p.L301F		NM_001004724	NP_001004724	Q8IXE1	OR4N5_HUMAN	olfactory receptor, family 4, subfamily N,	301	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_cancers(95;0.00108)		Epithelial(56;7.58e-07)|all cancers(55;3.84e-06)	GBM - Glioblastoma multiforme(265;0.0143)														---	---	---	---
Unknown	0	broad.mit.edu	37	14	22314952	22314952	+	Intron	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:22314952G>A	uc010tmf.1	+						uc001wbw.2_Intron|uc010tmg.1_Intron|uc001wby.2_Intron|uc010ait.1_Silent_p.L3L|uc001wbz.1_Silent_p.L3L					SubName: Full=Putative uncharacterized protein ENSP00000374943;																												OREG0022570	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	---	---	---	---
SLC7A8	23428	broad.mit.edu	37	14	23635621	23635621	+	Missense_Mutation	SNP	C	T	T	rs139927895	byFrequency	TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23635621C>T	uc001wiz.2	-	2	1006	c.280G>A	c.(280-282)GCT>ACT	p.A94T	SLC7A8_uc010akj.2_Missense_Mutation_p.A94T	NM_012244	NP_036376	Q9UHI5	LAT2_HUMAN	solute carrier family 7 (cationic amino acid	94					blood coagulation|cellular amino acid metabolic process|leukocyte migration|metal ion homeostasis|response to toxin	basolateral plasma membrane|cytoplasm|integral to plasma membrane	neutral amino acid transmembrane transporter activity|organic cation transmembrane transporter activity|peptide antigen binding|protein binding|toxin transporter activity			ovary(1)	1	all_cancers(95;4.6e-05)			GBM - Glioblastoma multiforme(265;0.00809)	L-Alanine(DB00160)|L-Glutamine(DB00130)|L-Phenylalanine(DB00120)													---	---	---	---
C14orf39	317761	broad.mit.edu	37	14	60903742	60903742	+	Nonsense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:60903742C>A	uc001xez.3	-	18	1695	c.1585G>T	c.(1585-1587)GGA>TGA	p.G529*	C14orf39_uc010apo.2_Nonsense_Mutation_p.G240*	NM_174978	NP_777638	Q08AQ4	Q08AQ4_HUMAN	hypothetical protein LOC317761	529										ovary(2)|haematopoietic_and_lymphoid_tissue(1)|skin(1)	4				OV - Ovarian serous cystadenocarcinoma(108;0.0448)														---	---	---	---
SYNE2	23224	broad.mit.edu	37	14	64492143	64492143	+	Intron	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64492143T>C	uc001xgm.2	+						SYNE2_uc001xgl.2_Intron	NM_015180	NP_055995			spectrin repeat containing, nuclear envelope 2						centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)														---	---	---	---
OR4N4	283694	broad.mit.edu	37	15	22382668	22382668	+	Silent	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22382668T>C	uc001yuc.1	+	7	1177	c.196T>C	c.(196-198)TTG>CTG	p.L66L	LOC727924_uc001yub.1_RNA|OR4N4_uc010tzv.1_Silent_p.L66L	NM_001005241	NP_001005241	Q8N0Y3	OR4N4_HUMAN	olfactory receptor, family 4, subfamily N,	66	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(4)|skin(1)	5		all_cancers(20;1.94e-20)|all_epithelial(15;3.94e-18)|Lung NSC(15;8.53e-15)|all_lung(15;2.87e-14)|Breast(32;0.00519)|Colorectal(260;0.101)	GBM - Glioblastoma multiforme(6;0.124)	all cancers(64;1.64e-11)|Epithelial(43;5.81e-10)|BRCA - Breast invasive adenocarcinoma(123;0.000255)|Kidney(6;0.00736)|KIRC - Kidney renal clear cell carcinoma(6;0.0135)|GBM - Glioblastoma multiforme(186;0.0963)														---	---	---	---
VPS39	23339	broad.mit.edu	37	15	42479994	42479994	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42479994G>A	uc001zpd.2	-	7	587	c.436C>T	c.(436-438)CTC>TTC	p.L146F	VPS39_uc001zpc.2_Missense_Mutation_p.L135F	NM_015289	NP_056104	Q96JC1	VPS39_HUMAN	vacuolar protein sorting 39	146	CNH.				protein transport	HOPS complex|late endosome membrane|lysosomal membrane	small GTPase regulator activity			ovary(1)|pancreas(1)|skin(1)	3		all_cancers(109;6.78e-16)|all_epithelial(112;1.81e-14)|Lung NSC(122;5.01e-09)|all_lung(180;2.24e-08)|Melanoma(134;0.0574)|Colorectal(260;0.152)		GBM - Glioblastoma multiforme(94;3.05e-06)														---	---	---	---
TGM5	9333	broad.mit.edu	37	15	43552280	43552280	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43552280A>C	uc001zrd.1	-	3	414	c.406T>G	c.(406-408)TTC>GTC	p.F136V	TGM5_uc001zre.1_Intron	NM_201631	NP_963925	O43548	TGM5_HUMAN	transglutaminase 5 isoform 1	136					epidermis development|peptide cross-linking	cytoplasm	acyltransferase activity|metal ion binding|protein-glutamine gamma-glutamyltransferase activity			central_nervous_system(1)	1		all_cancers(109;1.37e-14)|all_epithelial(112;1.26e-12)|Lung NSC(122;2.46e-08)|all_lung(180;2.75e-07)|Melanoma(134;0.0476)|Colorectal(260;0.216)		GBM - Glioblastoma multiforme(94;4e-07)	L-Glutamine(DB00130)													---	---	---	---
SLTM	79811	broad.mit.edu	37	15	59192084	59192084	+	Silent	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:59192084T>C	uc002afp.2	-	7	730	c.642A>G	c.(640-642)TCA>TCG	p.S214S	SLTM_uc002afo.2_Splice_Site_p.E197_splice|SLTM_uc002afq.2_Intron|SLTM_uc010bgd.2_Intron|SLTM_uc002afr.1_Intron	NM_024755	NP_079031	Q9NWH9	SLTM_HUMAN	modulator of estrogen induced transcription	214	Glu-rich.				apoptosis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	nucleotide binding|RNA binding			ovary(1)	1																		---	---	---	---
RORA	6095	broad.mit.edu	37	15	60806883	60806883	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:60806883C>T	uc002agv.2	-	5	611	c.455G>A	c.(454-456)CGA>CAA	p.R152Q	uc002ags.1_Intron|RORA_uc002agt.3_Missense_Mutation_p.R64Q|RORA_uc002agw.2_Missense_Mutation_p.R144Q|RORA_uc002agx.2_Missense_Mutation_p.R119Q	NM_134260	NP_599022	P35398	RORA_HUMAN	RAR-related orphan receptor A isoform b	152	NR C4-type.|Nuclear receptor.				positive regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			large_intestine(1)|ovary(1)	2																		---	---	---	---
TMEM8A	58986	broad.mit.edu	37	16	427758	427758	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:427758C>T	uc002cgu.3	-	2	341	c.212G>A	c.(211-213)CGC>CAC	p.R71H	TMEM8A_uc002cgv.3_5'UTR	NM_021259	NP_067082	Q9HCN3	TMM8A_HUMAN	transmembrane protein 8 (five membrane-spanning	71	Extracellular (Potential).				cell adhesion	integral to plasma membrane				central_nervous_system(2)|pancreas(1)	3																		---	---	---	---
A2BP1	54715	broad.mit.edu	37	16	7703854	7703854	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:7703854C>T	uc002cys.2	+	12	1783	c.795C>T	c.(793-795)GCC>GCT	p.A265A	A2BP1_uc010buf.1_Silent_p.A265A|A2BP1_uc002cyr.1_Silent_p.A264A|A2BP1_uc002cyt.2_Silent_p.A238A|A2BP1_uc010uxz.1_Silent_p.A308A|A2BP1_uc010uya.1_Silent_p.A222A|A2BP1_uc002cyv.1_Silent_p.A265A|A2BP1_uc010uyb.1_Silent_p.A265A|A2BP1_uc002cyw.2_Silent_p.A285A|A2BP1_uc002cyy.2_Silent_p.A285A|A2BP1_uc002cyx.2_Silent_p.A285A|A2BP1_uc010uyc.1_Silent_p.A258A	NM_018723	NP_061193	Q9NWB1	RFOX1_HUMAN	ataxin 2-binding protein 1 isoform 4	265					mRNA processing|RNA splicing|RNA transport	nucleus|trans-Golgi network	nucleotide binding|protein C-terminus binding|RNA binding				0		all_cancers(2;4.54e-52)|Colorectal(2;6.95e-44)|all_epithelial(2;1.15e-37)|Lung NSC(2;0.000289)|all_lung(2;0.00148)|Myeloproliferative disorder(2;0.0122)|Medulloblastoma(2;0.0354)|all_neural(2;0.0381)|all_hematologic(2;0.0749)|Renal(2;0.0758)|Melanoma(2;0.211)		Colorectal(1;3.55e-51)|COAD - Colon adenocarcinoma(2;1.92e-46)|all cancers(1;5.36e-16)|Epithelial(1;3.98e-15)|READ - Rectum adenocarcinoma(2;3.71e-05)|GBM - Glioblastoma multiforme(1;0.0499)														---	---	---	---
DNAH3	55567	broad.mit.edu	37	16	21080793	21080793	+	Missense_Mutation	SNP	T	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21080793T>A	uc010vbe.1	-	23	3324	c.3324A>T	c.(3322-3324)GAA>GAT	p.E1108D		NM_017539	NP_060009	Q8TD57	DYH3_HUMAN	dynein, axonemal, heavy chain 3	1108	Stem (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(10)|skin(3)|large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)	18				GBM - Glioblastoma multiforme(48;0.207)														---	---	---	---
COG7	91949	broad.mit.edu	37	16	23421679	23421679	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23421679A>C	uc002dlo.2	-	11	1600	c.1412T>G	c.(1411-1413)ATA>AGA	p.I471R		NM_153603	NP_705831	P83436	COG7_HUMAN	component of oligomeric golgi complex 7	471					intracellular protein transport|protein glycosylation|protein localization in Golgi apparatus|protein stabilization|retrograde vesicle-mediated transport, Golgi to ER	Golgi membrane|Golgi transport complex	protein binding				0				GBM - Glioblastoma multiforme(48;0.0401)														---	---	---	---
ASPHD1	253982	broad.mit.edu	37	16	29913170	29913170	+	Missense_Mutation	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29913170C>G	uc002dut.2	+	1	1024	c.878C>G	c.(877-879)TCC>TGC	p.S293C	uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|SEZ6L2_uc002dup.3_5'Flank|SEZ6L2_uc002dur.3_5'Flank|SEZ6L2_uc002duq.3_5'Flank|SEZ6L2_uc002dus.3_5'Flank|SEZ6L2_uc010vec.1_5'Flank|SEZ6L2_uc010ved.1_5'Flank|ASPHD1_uc002duu.3_RNA|ASPHD1_uc010bzi.2_RNA	NM_181718	NP_859069	Q5U4P2	ASPH1_HUMAN	aspartate beta-hydroxylase domain containing 1	293	Lumenal (Potential).				peptidyl-amino acid modification	integral to endoplasmic reticulum membrane	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|peptide-aspartate beta-dioxygenase activity				0																		---	---	---	---
TRIM72	493829	broad.mit.edu	37	16	31232220	31232220	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:31232220T>C	uc002ebn.1	+	5	950	c.721T>C	c.(721-723)TAC>CAC	p.Y241H		NM_001008274	NP_001008275	Q6ZMU5	TRI72_HUMAN	tripartite motif-containing 72	241					exocytosis|muscle organ development|muscle system process|plasma membrane repair|protein homooligomerization	cytoplasmic vesicle membrane|sarcolemma	phosphatidylserine binding|zinc ion binding				0																		---	---	---	---
CNGB1	1258	broad.mit.edu	37	16	57953078	57953078	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57953078C>T	uc002emt.2	-	20	1947	c.1882G>A	c.(1882-1884)GAC>AAC	p.D628N	CNGB1_uc010cdh.2_Missense_Mutation_p.D622N	NM_001297	NP_001288	Q14028	CNGB1_HUMAN	cyclic nucleotide gated channel beta 1 isoform	628	Cytoplasmic (Potential).				sensory perception of smell	intracellular cyclic nucleotide activated cation channel complex	cAMP binding|intracellular cAMP activated cation channel activity			breast(3)|pancreas(1)	4																		---	---	---	---
FTSJD1	55783	broad.mit.edu	37	16	71318662	71318662	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71318662C>A	uc010cga.2	-	3	1568	c.1162G>T	c.(1162-1164)GCG>TCG	p.A388S	FTSJD1_uc002ezy.3_Missense_Mutation_p.A388S|FTSJD1_uc002ezz.3_Missense_Mutation_p.A388S	NM_001099642	NP_001093112	Q8IYT2	FTSJ1_HUMAN	FtsJ methyltransferase domain containing 1	388						integral to membrane	methyltransferase activity|nucleic acid binding			skin(1)	1																		---	---	---	---
PLCG2	5336	broad.mit.edu	37	16	81953086	81953086	+	Intron	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:81953086C>T	uc002fgt.2	+						PLCG2_uc010chg.1_Intron	NM_002661	NP_002652			phospholipase C, gamma 2						intracellular signal transduction|phospholipid catabolic process|platelet activation	plasma membrane	phosphatidylinositol phospholipase C activity|protein binding|signal transducer activity			large_intestine(4)|lung(2)|ovary(1)|skin(1)	8																		---	---	---	---
PRPF8	10594	broad.mit.edu	37	17	1562830	1562830	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1562830G>A	uc002fte.2	-	32	5073	c.4959C>T	c.(4957-4959)GAC>GAT	p.D1653D		NM_006445	NP_006436	Q6P2Q9	PRP8_HUMAN	U5 snRNP-specific protein	1653						catalytic step 2 spliceosome|nuclear speck|U5 snRNP	protein binding|RNA binding			lung(4)|ovary(2)	6				UCEC - Uterine corpus endometrioid carcinoma (25;0.0855)														---	---	---	---
KIAA0100	9703	broad.mit.edu	37	17	26961094	26961094	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26961094C>T	uc002hbu.2	-	17	3180	c.3081G>A	c.(3079-3081)AGG>AGA	p.R1027R		NM_014680	NP_055495	Q14667	K0100_HUMAN	hypothetical protein LOC9703 precursor	1027						extracellular region				ovary(2)|breast(1)|skin(1)	4	Lung NSC(42;0.00431)																	---	---	---	---
SYNRG	11276	broad.mit.edu	37	17	35945511	35945511	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:35945511G>A	uc002hoa.2	-	5	482	c.399C>T	c.(397-399)CTC>CTT	p.L133L	SYNRG_uc010wde.1_Silent_p.L133L|SYNRG_uc010wdf.1_Silent_p.L133L|SYNRG_uc002hoc.2_Silent_p.L132L|SYNRG_uc002hoe.2_Silent_p.L133L|SYNRG_uc002hod.2_Silent_p.L133L|SYNRG_uc010wdg.1_Silent_p.L133L|SYNRG_uc002hob.2_Silent_p.L133L|SYNRG_uc002hog.1_Silent_p.L166L|SYNRG_uc010wdh.1_Silent_p.L133L	NM_007247	NP_009178	Q9UMZ2	SYNRG_HUMAN	synergin, gamma isoform 1	133	Potential.				endocytosis|intracellular protein transport	AP-1 adaptor complex	calcium ion binding			ovary(2)	2																		---	---	---	---
CWC25	54883	broad.mit.edu	37	17	36977249	36977249	+	Silent	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:36977249A>C	uc002hqu.2	-	2	249	c.96T>G	c.(94-96)GCT>GCG	p.A32A	CWC25_uc010wdv.1_5'UTR|CWC25_uc010wdx.1_RNA	NM_017748	NP_060218	Q9NXE8	CWC25_HUMAN	coiled-coil domain containing 49	32	Potential.										0																		---	---	---	---
EPN3	55040	broad.mit.edu	37	17	48618642	48618642	+	Silent	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48618642C>A	uc002ira.3	+	8	1737	c.1302C>A	c.(1300-1302)ACC>ACA	p.T434T	SPATA20_uc002irc.2_5'Flank|EPN3_uc010wms.1_Silent_p.T462T|EPN3_uc010wmt.1_RNA|EPN3_uc010wmu.1_Silent_p.T407T	NM_017957	NP_060427	Q9H201	EPN3_HUMAN	epsin 3	434						clathrin-coated vesicle|nucleus|perinuclear region of cytoplasm	lipid binding			ovary(1)	1	Breast(11;1.23e-18)		BRCA - Breast invasive adenocarcinoma(22;2.88e-09)															---	---	---	---
TANC2	26115	broad.mit.edu	37	17	61489051	61489051	+	Intron	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61489051A>C	uc002jal.3	+						TANC2_uc010wpe.1_Intron|TANC2_uc002jao.3_Intron	NM_025185	NP_079461			tetratricopeptide repeat, ankyrin repeat and								binding			ovary(2)	2																		---	---	---	---
EPB41L3	23136	broad.mit.edu	37	18	5489118	5489118	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:5489118G>A	uc002kmt.1	-	2	151	c.65C>T	c.(64-66)GCG>GTG	p.A22V	EPB41L3_uc010wzh.1_Missense_Mutation_p.A22V|EPB41L3_uc002kmu.1_Missense_Mutation_p.A22V|EPB41L3_uc010dkq.1_5'UTR|EPB41L3_uc010dks.1_Missense_Mutation_p.A44V|EPB41L3_uc002kmv.1_5'UTR	NM_012307	NP_036439	Q9Y2J2	E41L3_HUMAN	erythrocyte membrane protein band 4.1-like 3	22					cortical actin cytoskeleton organization	cell-cell junction|cytoplasm|cytoskeleton|extrinsic to membrane	actin binding|structural molecule activity			ovary(5)	5																		---	---	---	---
LAMA1	284217	broad.mit.edu	37	18	7017344	7017344	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:7017344C>T	uc002knm.2	-	20	2835	c.2741G>A	c.(2740-2742)TGC>TAC	p.C914Y	LAMA1_uc010wzj.1_Missense_Mutation_p.C390Y	NM_005559	NP_005550	P25391	LAMA1_HUMAN	laminin, alpha 1 precursor	914	Laminin EGF-like 9.				axon guidance|cell adhesion|cell surface receptor linked signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	extracellular space|laminin-1 complex|laminin-3 complex	extracellular matrix structural constituent|receptor binding			ovary(8)|large_intestine(4)|upper_aerodigestive_tract(2)|breast(2)|skin(2)|pancreas(2)|central_nervous_system(1)	21		Colorectal(10;0.172)			Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)													---	---	---	---
ASXL3	80816	broad.mit.edu	37	18	31323104	31323104	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:31323104A>C	uc010dmg.1	+	12	3347	c.3292A>C	c.(3292-3294)ACT>CCT	p.T1098P	ASXL3_uc002kxq.2_Missense_Mutation_p.T805P	NM_030632	NP_085135	Q9C0F0	ASXL3_HUMAN	additional sex combs like 3	1098					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	metal ion binding			ovary(2)|pancreas(1)	3																		---	---	---	---
CBLN2	147381	broad.mit.edu	37	18	70209211	70209211	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:70209211C>T	uc002lku.2	-	2	420	c.185G>A	c.(184-186)GGC>GAC	p.G62D	CBLN2_uc002lkv.2_Missense_Mutation_p.G62D	NM_182511	NP_872317	Q8IUK8	CBLN2_HUMAN	cerebellin 2 precursor	62						integral to membrane					0		Esophageal squamous(42;0.131)																---	---	---	---
ZNF98	148198	broad.mit.edu	37	19	22585671	22585671	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22585671T>C	uc002nqt.2	-	3	295	c.173A>G	c.(172-174)AAG>AGG	p.K58R		NM_001098626	NP_001092096	A6NK75	ZNF98_HUMAN	zinc finger protein 98	58	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|skin(1)	2		all_cancers(12;0.0536)|all_lung(12;0.00187)|Lung NSC(12;0.0019)|all_epithelial(12;0.00542)|Hepatocellular(1079;0.244)																---	---	---	---
ZNF536	9745	broad.mit.edu	37	19	30935982	30935982	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:30935982C>T	uc002nsu.1	+	2	1651	c.1513C>T	c.(1513-1515)CGG>TGG	p.R505W	ZNF536_uc010edd.1_Missense_Mutation_p.R505W	NM_014717	NP_055532	O15090	ZN536_HUMAN	zinc finger protein 536	505					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	zinc ion binding			ovary(7)|large_intestine(2)|skin(2)	11	Esophageal squamous(110;0.0834)																	---	---	---	---
FFAR3	2865	broad.mit.edu	37	19	35850657	35850657	+	Nonsense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35850657G>T	uc002nzd.2	+	2	940	c.865G>T	c.(865-867)GAG>TAG	p.E289*	FFAR3_uc010xsu.1_Intron	NM_005304	NP_005295	O14843	FFAR3_HUMAN	free fatty acid receptor 3	289	Cytoplasmic (Potential).					integral to plasma membrane	G-protein coupled receptor activity|lipid binding				0	all_lung(56;9.78e-09)|Lung NSC(56;1.46e-08)|Esophageal squamous(110;0.162)		Epithelial(14;1.29e-19)|OV - Ovarian serous cystadenocarcinoma(14;4.63e-18)|all cancers(14;5.19e-17)|LUSC - Lung squamous cell carcinoma(66;0.0221)															---	---	---	---
FFAR2	2867	broad.mit.edu	37	19	35941123	35941123	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35941123C>T	uc002nzg.2	+	2	587	c.507C>T	c.(505-507)ACC>ACT	p.T169T	FFAR2_uc010eea.2_Silent_p.T169T	NM_005306	NP_005297	O15552	FFAR2_HUMAN	free fatty acid receptor 2	169	Extracellular (Potential).					integral to plasma membrane	G-protein coupled receptor activity|lipid binding			central_nervous_system(1)	1	all_lung(56;1.89e-08)|Lung NSC(56;2.9e-08)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.0724)															---	---	---	---
CLIP3	25999	broad.mit.edu	37	19	36515540	36515540	+	Intron	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36515540G>A	uc010eeq.1	-						uc002ocy.2_Intron|CLIP3_uc002ocz.1_Intron	NM_015526	NP_056341			CAP-GLY domain containing linker protein 3						chaperone-mediated protein transport|fat cell differentiation|membrane biogenesis|negative regulation of microtubule polymerization|peptidyl-L-cysteine S-palmitoylation|positive regulation of apoptosis|positive regulation of endocytosis|positive regulation of establishment of protein localization in plasma membrane|positive regulation of glucose transport|positive regulation of protein phosphorylation	early endosome membrane|Golgi stack|membrane raft|microsome|plasma membrane|recycling endosome membrane|trans-Golgi network membrane	ganglioside binding|microtubule binding			ovary(2)|pancreas(1)|skin(1)	4	Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.06)															---	---	---	---
ZNF568	374900	broad.mit.edu	37	19	37441191	37441191	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:37441191T>C	uc002ofc.2	+	7	1651	c.1136T>C	c.(1135-1137)CTA>CCA	p.L379P	ZNF568_uc010efg.2_Intron|ZNF568_uc010xtn.1_Intron|ZNF568_uc002ofd.2_Missense_Mutation_p.L303P|ZNF568_uc010efe.2_Missense_Mutation_p.L303P|ZNF568_uc010eff.1_Intron	NM_198539	NP_940941	Q3ZCX4	ZN568_HUMAN	zinc finger protein 568	379	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			large_intestine(1)|ovary(1)	2	Esophageal squamous(110;0.183)		COAD - Colon adenocarcinoma(19;0.114)|Colorectal(19;0.177)															---	---	---	---
SNRPA	6626	broad.mit.edu	37	19	41263268	41263268	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41263268C>T	uc002ooz.2	+	2	640	c.105C>T	c.(103-105)TCC>TCT	p.S35S	SNRPA_uc002opa.2_5'UTR	NM_004596	NP_004587	P09012	SNRPA_HUMAN	small nuclear ribonucleoprotein polypeptide A	35	RRM 1.					nucleoplasm|spliceosomal complex	nucleotide binding|protein binding|RNA binding			skin(2)|ovary(1)|central_nervous_system(1)	4			LUSC - Lung squamous cell carcinoma(20;0.000219)|Lung(22;0.000959)															---	---	---	---
RTN2	6253	broad.mit.edu	37	19	45992707	45992707	+	Missense_Mutation	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45992707C>A	uc002pcb.2	-	6	1366	c.1138G>T	c.(1138-1140)GCC>TCC	p.A380S	RTN2_uc002pcc.2_Missense_Mutation_p.A307S|RTN2_uc002pcd.2_RNA	NM_005619	NP_005610	O75298	RTN2_HUMAN	reticulon 2 isoform A	380	Reticulon.|Helical; (Potential).					integral to endoplasmic reticulum membrane	signal transducer activity			ovary(3)	3		Ovarian(192;0.051)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.00829)|Epithelial(262;0.184)|GBM - Glioblastoma multiforme(486;0.246)														---	---	---	---
FTL	2512	broad.mit.edu	37	19	49469092	49469092	+	Silent	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49469092C>G	uc002plo.2	+	2	367	c.168C>G	c.(166-168)GCC>GCG	p.A56A	FTL_uc002pln.1_Silent_p.A56A	NM_000146	NP_000137	P02792	FRIL_HUMAN	ferritin, light polypeptide	56	Ferritin-like diiron.|Catalytic site for iron oxidation.				cell death|cellular iron ion homeostasis|cellular membrane organization|iron ion transport|post-Golgi vesicle-mediated transport	cytosol|intracellular ferritin complex	ferric iron binding|identical protein binding|oxidoreductase activity				0		all_epithelial(76;5.29e-07)|all_lung(116;1.7e-06)|Lung NSC(112;3.55e-06)|all_neural(266;0.0189)|Ovarian(192;0.0261)		OV - Ovarian serous cystadenocarcinoma(262;0.000152)|all cancers(93;0.000435)|GBM - Glioblastoma multiforme(486;0.0171)|Epithelial(262;0.0267)	Iron Dextran(DB00893)													---	---	---	---
ZNF614	80110	broad.mit.edu	37	19	52519689	52519689	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52519689C>T	uc002pyj.2	-	5	1564	c.1162G>A	c.(1162-1164)GTA>ATA	p.V388I	ZNF614_uc002pyi.3_Intron|ZNF614_uc010epj.2_Missense_Mutation_p.V91I	NM_025040	NP_079316	Q8N883	ZN614_HUMAN	zinc finger protein 614	388	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|upper_aerodigestive_tract(1)|pancreas(1)|skin(1)	5		all_neural(266;0.0505)		GBM - Glioblastoma multiforme(134;0.00513)|OV - Ovarian serous cystadenocarcinoma(262;0.0177)														---	---	---	---
ZNF320	162967	broad.mit.edu	37	19	53384221	53384221	+	Silent	SNP	T	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53384221T>A	uc002qag.2	-	4	1349	c.1158A>T	c.(1156-1158)ACA>ACT	p.T386T	ZNF320_uc010eqh.1_5'Flank|ZNF320_uc010eqi.1_Intron|ZNF320_uc002qah.2_Silent_p.T332T|ZNF320_uc002qai.2_Silent_p.T386T	NM_207333	NP_997216	A2RRD8	ZN320_HUMAN	zinc finger protein 320	386	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.0534)														---	---	---	---
ZNF665	79788	broad.mit.edu	37	19	53668541	53668541	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53668541G>A	uc010eqm.1	-	4	1302	c.1202C>T	c.(1201-1203)CCT>CTT	p.P401L		NM_024733	NP_079009	Q9H7R5	ZN665_HUMAN	zinc finger protein 665	336					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2				GBM - Glioblastoma multiforme(134;0.0196)														---	---	---	---
CACNG8	59283	broad.mit.edu	37	19	54483128	54483128	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54483128C>T	uc002qcs.1	+	3	478	c.372C>T	c.(370-372)GTC>GTT	p.V124V	MIR935_hsa-mir-935|MI0005757_5'Flank	NM_031895	NP_114101	Q8WXS5	CCG8_HUMAN	voltage-dependent calcium channel gamma-8	125					regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|synaptic transmission	alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex|cell junction|endocytic vesicle membrane|postsynaptic density|postsynaptic membrane|voltage-gated calcium channel complex	voltage-gated calcium channel activity				0	all_cancers(19;0.0385)|all_epithelial(19;0.0207)|all_lung(19;0.145)|Lung NSC(19;0.168)|Ovarian(34;0.19)			GBM - Glioblastoma multiforme(134;0.162)														---	---	---	---
PEG3	5178	broad.mit.edu	37	19	57325987	57325987	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57325987T>C	uc002qnu.2	-	7	4174	c.3823A>G	c.(3823-3825)AGT>GGT	p.S1275G	ZIM2_uc010ygq.1_Intron|ZIM2_uc010ygr.1_Intron|ZIM2_uc002qnr.2_Intron|ZIM2_uc002qnq.2_Intron|ZIM2_uc010etp.2_Intron|ZIM2_uc010ygs.1_Intron|PEG3_uc002qnt.2_Missense_Mutation_p.S1246G|PEG3_uc002qnv.2_Missense_Mutation_p.S1275G|PEG3_uc002qnw.2_Missense_Mutation_p.S1151G|PEG3_uc002qnx.2_Missense_Mutation_p.S1149G|PEG3_uc010etr.2_Missense_Mutation_p.S1275G	NM_001146186	NP_001139658	Q9GZU2	PEG3_HUMAN	paternally expressed 3 isoform 1	1275					apoptosis|viral reproduction	cytoplasm|nucleus	nucleic acid binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(7)|skin(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	12		Colorectal(82;0.000256)|all_neural(62;0.103)|Ovarian(87;0.243)		GBM - Glioblastoma multiforme(193;0.0269)														---	---	---	---
ZNF549	256051	broad.mit.edu	37	19	58048765	58048765	+	Silent	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58048765T>G	uc002qpb.1	+	4	642	c.393T>G	c.(391-393)CCT>CCG	p.P131P	ZNF547_uc002qpm.3_Intron|ZNF549_uc010eud.1_Intron|ZNF549_uc002qpa.1_Silent_p.P118P	NM_153263	NP_694995	Q6P9A3	ZN549_HUMAN	zinc finger protein 549	131	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.221)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---
ZNF549	256051	broad.mit.edu	37	19	58048993	58048993	+	Missense_Mutation	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58048993A>T	uc002qpb.1	+	4	870	c.621A>T	c.(619-621)CAA>CAT	p.Q207H	ZNF547_uc002qpm.3_Intron|ZNF549_uc010eud.1_Intron|ZNF549_uc002qpa.1_Missense_Mutation_p.Q194H	NM_153263	NP_694995	Q6P9A3	ZN549_HUMAN	zinc finger protein 549	207					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Ovarian(87;0.221)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.026)														---	---	---	---
PLCB1	23236	broad.mit.edu	37	20	8719977	8719977	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:8719977C>T	uc002wnb.2	+	21	2281	c.2278C>T	c.(2278-2280)CGT>TGT	p.R760C	PLCB1_uc010zrb.1_Missense_Mutation_p.R659C|PLCB1_uc002wna.2_Missense_Mutation_p.R760C|PLCB1_uc002wnc.1_Missense_Mutation_p.R659C|PLCB1_uc002wnd.1_Missense_Mutation_p.R337C	NM_015192	NP_056007	Q9NQ66	PLCB1_HUMAN	phosphoinositide-specific phospholipase C beta 1	760	C2.				activation of meiosis involved in egg activation|CD24 biosynthetic process|cerebral cortex development|G1 phase|G2/M transition of mitotic cell cycle|glutamate signaling pathway|insulin-like growth factor receptor signaling pathway|interleukin-1-mediated signaling pathway|interleukin-12-mediated signaling pathway|interleukin-15-mediated signaling pathway|intracellular signal transduction|lipid catabolic process|memory|muscarinic acetylcholine receptor signaling pathway|negative regulation of monocyte extravasation|negative regulation of transcription, DNA-dependent|phosphatidylinositol metabolic process|positive regulation of acrosome reaction|positive regulation of developmental growth|positive regulation of embryonic development|positive regulation of interleukin-12 production|positive regulation of JNK cascade|positive regulation of myoblast differentiation|positive regulation of transcription, DNA-dependent|regulation of fertilization|regulation of G-protein coupled receptor protein signaling pathway|synaptic transmission	cytosol|nuclear chromatin|nuclear speck	calcium ion binding|calmodulin binding|enzyme binding|GTPase activator activity|phosphatidylinositol phospholipase C activity|phosphatidylinositol-4,5-bisphosphate binding|protein homodimerization activity|signal transducer activity			ovary(4)|breast(3)|upper_aerodigestive_tract(2)|skin(2)|lung(1)	12																		---	---	---	---
C20orf26	26074	broad.mit.edu	37	20	20054980	20054980	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:20054980C>T	uc002wru.2	+	4	405	c.329C>T	c.(328-330)GCC>GTC	p.A110V	C20orf26_uc010gcw.1_Missense_Mutation_p.A64V|C20orf26_uc010zse.1_Missense_Mutation_p.A110V|C20orf26_uc010zsf.1_Missense_Mutation_p.A110V	NM_015585	NP_056400	Q8NHU2	CT026_HUMAN	hypothetical protein LOC26074	110										ovary(3)|pancreas(1)	4				READ - Rectum adenocarcinoma(2;0.171)														---	---	---	---
SLC35C2	51006	broad.mit.edu	37	20	44983860	44983860	+	Silent	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44983860C>G	uc002xro.2	-	6	970	c.429G>C	c.(427-429)GTG>GTC	p.V143V	SLC35C2_uc002xrp.2_Intron|SLC35C2_uc002xrq.2_Silent_p.V143V|SLC35C2_uc002xrr.2_Silent_p.V143V|SLC35C2_uc010zxn.1_Intron|SLC35C2_uc010zxo.1_Silent_p.V29V|SLC35C2_uc010zxp.1_Silent_p.V172V	NM_173179	NP_775271	Q9NQQ7	S35C2_HUMAN	solute carrier family 35, member C2 isoform a	143	Helical; (Potential).				transport	integral to membrane				ovary(1)	1		Myeloproliferative disorder(115;0.0122)																---	---	---	---
CBLN4	140689	broad.mit.edu	37	20	54573661	54573661	+	Silent	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:54573661T>C	uc002xxa.2	-	3	1343	c.558A>G	c.(556-558)GGA>GGG	p.G186G		NM_080617	NP_542184	Q9NTU7	CBLN4_HUMAN	cerebellin 4 precursor	186	C1q.					cell junction|extracellular region|synapse				ovary(3)|pancreas(1)	4			Colorectal(105;0.202)															---	---	---	---
Unknown	0	broad.mit.edu	37	21	10862949	10862949	+	IGR	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:10862949A>C								None (None upstream) : TPTE (43794 downstream)																																			---	---	---	---
KRTAP10-5	386680	broad.mit.edu	37	21	45999976	45999976	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45999976C>T	uc002zfl.1	-	1	506	c.480G>A	c.(478-480)CCG>CCA	p.P160P	C21orf29_uc002zfe.1_Intron|C21orf29_uc010gpv.1_Intron	NM_198694	NP_941967	P60370	KR105_HUMAN	keratin associated protein 10-5	160	22 X 5 AA repeats of C-C-X(3).					keratin filament					0																		---	---	---	---
GAB4	128954	broad.mit.edu	37	22	17473066	17473066	+	Missense_Mutation	SNP	C	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:17473066C>G	uc002zlw.2	-	2	283	c.175G>C	c.(175-177)GCC>CCC	p.A59P	GAB4_uc010gqs.1_Missense_Mutation_p.A59P	NM_001037814	NP_001032903	Q2WGN9	GAB4_HUMAN	GRB2-associated binding protein family, member	59	PH.									large_intestine(1)|ovary(1)	2		all_epithelial(15;0.112)|Lung NSC(13;0.248)																---	---	---	---
AIFM3	150209	broad.mit.edu	37	22	21328990	21328990	+	Intron	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21328990C>T	uc002ztj.2	+						AIFM3_uc002ztk.2_Intron|AIFM3_uc002ztl.2_Intron|AIFM3_uc011ahx.1_Intron|AIFM3_uc002ztm.1_Intron	NM_144704	NP_653305			apoptosis-inducing factor,						activation of caspase activity by cytochrome c|cell redox homeostasis|electron transport chain|induction of apoptosis|mitochondrial depolarization|transport	endoplasmic reticulum|mitochondrial inner membrane	2 iron, 2 sulfur cluster binding|caspase activator activity|flavin adenine dinucleotide binding|metal ion binding|oxidoreductase activity|protein binding			ovary(2)|lung(2)	4	all_cancers(11;3.71e-26)|all_epithelial(7;1.59e-23)|Lung NSC(8;3.06e-15)|all_lung(8;5.05e-14)|Melanoma(16;0.000465)|Ovarian(15;0.0028)|Colorectal(54;0.0332)|all_neural(72;0.142)	Lung SC(17;0.0367)	LUSC - Lung squamous cell carcinoma(15;0.000204)|Lung(15;0.00494)|Epithelial(17;0.195)															---	---	---	---
LOC96610	96610	broad.mit.edu	37	22	22550502	22550502	+	RNA	SNP	C	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:22550502C>A	uc011aim.1	+	11		c.996C>A								Parts of antibodies, mostly variable regions.												0																		---	---	---	---
KCNJ4	3761	broad.mit.edu	37	22	38823832	38823832	+	Silent	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:38823832A>C	uc003avs.1	-	2	403	c.306T>G	c.(304-306)GGT>GGG	p.G102G	KCNJ4_uc003avt.1_Silent_p.G102G	NM_004981	NP_004972	P48050	IRK4_HUMAN	potassium inwardly-rectifying channel J4	102	Poly-Gly.|Val/Gly/Ala/Pro stretch.|Extracellular (By similarity).				synaptic transmission	basolateral plasma membrane|voltage-gated potassium channel complex	inward rectifier potassium channel activity|PDZ domain binding				0	Melanoma(58;0.0286)																	---	---	---	---
FBLN1	2192	broad.mit.edu	37	22	45928994	45928994	+	Missense_Mutation	SNP	G	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:45928994G>T	uc003bgj.1	+	6	743	c.596G>T	c.(595-597)TGC>TTC	p.C199F	FBLN1_uc003bgg.1_Missense_Mutation_p.C199F|FBLN1_uc003bgh.2_Missense_Mutation_p.C199F|FBLN1_uc010gzz.2_Missense_Mutation_p.C237F|FBLN1_uc003bgi.1_Missense_Mutation_p.C199F	NM_006486	NP_006477	P23142	FBLN1_HUMAN	fibulin 1 isoform D	199	EGF-like 1.				interspecies interaction between organisms	extracellular space|soluble fraction	calcium ion binding|extracellular matrix structural constituent|protein binding			ovary(1)|central_nervous_system(1)	2		Ovarian(80;0.00965)|all_neural(38;0.0416)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0182)														---	---	---	---
FTHL17	53940	broad.mit.edu	37	X	31089731	31089731	+	Missense_Mutation	SNP	T	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:31089731T>C	uc004dcl.1	-	1	443	c.340A>G	c.(340-342)AGC>GGC	p.S114G		NM_031894	NP_114100	Q9BXU8	FHL17_HUMAN	ferritin, heavy polypeptide-like 17	114	Ferritin-like diiron.				cellular iron ion homeostasis|iron ion transport		ferric iron binding|oxidoreductase activity				0																		---	---	---	---
MED14	9282	broad.mit.edu	37	X	40511086	40511086	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:40511086A>C	uc004dex.3	-	31	4477	c.4337T>G	c.(4336-4338)CTT>CGT	p.L1446R		NM_004229	NP_004220	O60244	MED14_HUMAN	mediator complex subunit 14	1446					androgen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			breast(2)|kidney(1)|skin(1)	4																		---	---	---	---
PRICKLE3	4007	broad.mit.edu	37	X	49032441	49032441	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:49032441G>A	uc004dmy.1	-	9	1455	c.1429C>T	c.(1429-1431)CGC>TGC	p.R477C	PRICKLE3_uc011mmv.1_Missense_Mutation_p.R409C|PRICKLE3_uc011mmw.1_Missense_Mutation_p.R396C|PRICKLE3_uc011mmx.1_Missense_Mutation_p.R439C	NM_006150	NP_006141	O43900	PRIC3_HUMAN	LIM domain only 6	477				Missing (in Ref. 5; AAB92357).			protein binding|zinc ion binding			breast(1)	1																		---	---	---	---
NLGN3	54413	broad.mit.edu	37	X	70389196	70389196	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70389196G>A	uc004dzb.2	+	7	2040	c.1736G>A	c.(1735-1737)CGA>CAA	p.R579Q	NLGN3_uc004dzc.2_Missense_Mutation_p.R462Q|NLGN3_uc011mps.1_Missense_Mutation_p.R559Q|NLGN3_uc004dze.2_Missense_Mutation_p.R397Q	NM_018977	NP_061850	Q9NZ94	NLGN3_HUMAN	neuroligin 3	599	Extracellular (Potential).				neuron cell-cell adhesion|positive regulation of synaptogenesis|receptor-mediated endocytosis|social behavior|synapse assembly	cell surface|endocytic vesicle|integral to plasma membrane|synapse	neurexin binding|receptor activity			ovary(1)	1	Renal(35;0.156)																	---	---	---	---
TSIX	9383	broad.mit.edu	37	X	73046140	73046140	+	RNA	SNP	A	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:73046140A>T	uc004ebn.2	+	1		c.34101A>T			XIST_uc004ebm.1_RNA	NR_003255				Homo sapiens XIST antisense RNA (non-protein coding) (TSIX), non-coding RNA.												0																		---	---	---	---
SLC16A2	6567	broad.mit.edu	37	X	73740839	73740839	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:73740839C>T	uc004ebt.2	+	2	833	c.667C>T	c.(667-669)CTC>TTC	p.L223F		NM_006517	NP_006508	P36021	MOT8_HUMAN	solute carrier family 16, member 2	149	Helical; (Potential).					integral to plasma membrane|membrane fraction	monocarboxylic acid transmembrane transporter activity|symporter activity			breast(2)|ovary(1)	3					Pyruvic acid(DB00119)													---	---	---	---
MAGEE1	57692	broad.mit.edu	37	X	75650661	75650661	+	Missense_Mutation	SNP	A	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:75650661A>G	uc004ecm.1	+	1	2545	c.2338A>G	c.(2338-2340)AGC>GGC	p.S780G		NM_020932	NP_065983	Q9HCI5	MAGE1_HUMAN	melanoma antigen family E, 1	780	Interaction with DTNA (By similarity).|MAGE 2.					dendrite|nucleus|perinuclear region of cytoplasm|postsynaptic membrane				breast(3)|ovary(1)|pancreas(1)|skin(1)	6																		---	---	---	---
PCDH11X	27328	broad.mit.edu	37	X	91456413	91456413	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:91456413G>A	uc004efk.1	+	3	3918	c.3073G>A	c.(3073-3075)GAG>AAG	p.E1025K	PCDH11X_uc004efl.1_Missense_Mutation_p.E1025K|PCDH11X_uc004efo.1_Intron|PCDH11X_uc010nmv.1_Missense_Mutation_p.E1025K|PCDH11X_uc004efm.1_Missense_Mutation_p.E1025K|PCDH11X_uc004efn.1_Missense_Mutation_p.E1025K	NM_032968	NP_116750	Q9BZA7	PC11X_HUMAN	protocadherin 11 X-linked isoform c	1025	Cytoplasmic (Potential).				homophilic cell adhesion	integral to plasma membrane	calcium ion binding			large_intestine(2)	2																		---	---	---	---
CSTF2	1478	broad.mit.edu	37	X	100075404	100075404	+	5'UTR	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:100075404C>T	uc004egh.2	+	1					CSTF2_uc010nnd.2_5'UTR|CSTF2_uc004egi.2_5'UTR	NM_001325	NP_001316			cleavage stimulation factor subunit 2						mRNA cleavage|mRNA polyadenylation|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	cleavage body|mRNA cleavage and polyadenylation specificity factor complex	nucleotide binding|protein binding|protein binding|RNA binding			skin(1)	1																		---	---	---	---
ZMAT1	84460	broad.mit.edu	37	X	101138598	101138598	+	Missense_Mutation	SNP	T	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:101138598T>A	uc004eim.2	-	2	4786	c.1288A>T	c.(1288-1290)AGC>TGC	p.S430C	ZMAT1_uc011mrl.1_Missense_Mutation_p.S601C|ZMAT1_uc004ein.2_Missense_Mutation_p.S430C|ZMAT1_uc011mrm.1_Missense_Mutation_p.S430C	NM_032441	NP_115817	Q5H9K5	ZMAT1_HUMAN	zinc finger, matrin type 1 isoform 3	430						nucleus	zinc ion binding			ovary(1)	1																		---	---	---	---
IRS4	8471	broad.mit.edu	37	X	107978448	107978448	+	Missense_Mutation	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107978448C>T	uc004eoc.2	-	1	1160	c.1127G>A	c.(1126-1128)CGC>CAC	p.R376H		NM_003604	NP_003595	O14654	IRS4_HUMAN	insulin receptor substrate 4	376						plasma membrane	insulin receptor binding|SH3/SH2 adaptor activity|signal transducer activity			ovary(4)|large_intestine(2)|lung(1)|breast(1)|skin(1)|pancreas(1)	10																		---	---	---	---
GUCY2F	2986	broad.mit.edu	37	X	108638688	108638688	+	Missense_Mutation	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:108638688G>A	uc004eod.3	-	12	2582	c.2306C>T	c.(2305-2307)CCT>CTT	p.P769L	GUCY2F_uc011msq.1_RNA	NM_001522	NP_001513	P51841	GUC2F_HUMAN	guanylate cyclase 2F precursor	769	Protein kinase.|Cytoplasmic (Potential).				intracellular signal transduction|receptor guanylyl cyclase signaling pathway|visual perception	integral to plasma membrane|nuclear outer membrane	ATP binding|GTP binding|guanylate cyclase activity|protein kinase activity|receptor activity			lung(4)|breast(3)|central_nervous_system(1)	8																		---	---	---	---
AMMECR1	9949	broad.mit.edu	37	X	109444244	109444244	+	Silent	SNP	C	T	T			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:109444244C>T	uc004eoo.2	-	5	906	c.825G>A	c.(823-825)TTG>TTA	p.L275L	AMMECR1_uc004eop.2_Silent_p.L238L|AMMECR1_uc004eoq.2_Silent_p.L152L	NM_015365	NP_056180	Q9Y4X0	AMER1_HUMAN	AMMECR1 protein isoform 1	275	AMMECR1.										0																		---	---	---	---
DCX	1641	broad.mit.edu	37	X	110644397	110644397	+	Missense_Mutation	SNP	A	C	C			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:110644397A>C	uc004epd.2	-	3	941	c.769T>G	c.(769-771)TTT>GTT	p.F257V	DCX_uc011msv.1_Missense_Mutation_p.F257V|DCX_uc004epe.2_Missense_Mutation_p.F176V|DCX_uc004epf.2_Missense_Mutation_p.F176V|DCX_uc004epg.2_Missense_Mutation_p.F176V	NM_000555	NP_000546	O43602	DCX_HUMAN	doublecortin isoform a	257					axon guidance|central nervous system development|intracellular signal transduction	cytosol|microtubule associated complex	microtubule binding			central_nervous_system(2)|lung(1)|skin(1)	4																		---	---	---	---
IL13RA2	3598	broad.mit.edu	37	X	114249023	114249023	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:114249023T>G	uc004epx.2	-	4	486	c.361A>C	c.(361-363)AGT>CGT	p.S121R	IL13RA2_uc010nqd.1_Missense_Mutation_p.S121R	NM_000640	NP_000631	Q14627	I13R2_HUMAN	interleukin 13 receptor, alpha 2 precursor	121	Extracellular (Potential).|Fibronectin type-III 1.					extracellular space|integral to membrane|soluble fraction	cytokine receptor activity			upper_aerodigestive_tract(1)|ovary(1)|lung(1)	3																		---	---	---	---
FAM45B	55855	broad.mit.edu	37	X	129629816	129629816	+	Silent	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:129629816G>A	uc010nrh.2	+	1	902	c.684G>A	c.(682-684)CAG>CAA	p.Q228Q	uc004evu.2_Intron	NM_207009	NP_996892			hypothetical protein LOC404636											skin(1)	1				all cancers(201;0.0293)														---	---	---	---
GPR112	139378	broad.mit.edu	37	X	135427615	135427615	+	Missense_Mutation	SNP	T	G	G			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135427615T>G	uc004ezu.1	+	6	2041	c.1750T>G	c.(1750-1752)TTA>GTA	p.L584V	GPR112_uc010nsb.1_Missense_Mutation_p.L379V|GPR112_uc010nsc.1_Missense_Mutation_p.L351V	NM_153834	NP_722576	Q8IZF6	GP112_HUMAN	G-protein coupled receptor 112	584	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(5)|large_intestine(2)|skin(2)|lung(1)|breast(1)|pancreas(1)	12	Acute lymphoblastic leukemia(192;0.000127)																	---	---	---	---
CD40LG	959	broad.mit.edu	37	X	135738537	135738537	+	Silent	SNP	G	A	A	rs148581967		TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135738537G>A	uc004faa.2	+	4	441	c.369G>A	c.(367-369)GCG>GCA	p.A123A	CD40LG_uc010nsd.2_Intron|CD40LG_uc010nse.1_RNA	NM_000074	NP_000065	P29965	CD40L_HUMAN	CD40 ligand	123	Extracellular (Potential).		A -> E (in HIGM1).		anti-apoptosis|B cell proliferation|inflammatory response|isotype switching|leukocyte cell-cell adhesion|platelet activation|positive regulation of endothelial cell apoptosis|positive regulation of interleukin-12 production	extracellular space|integral to plasma membrane|soluble fraction	CD40 receptor binding|cytokine activity|tumor necrosis factor receptor binding			skin(1)	1	Acute lymphoblastic leukemia(192;0.000127)				Atorvastatin(DB01076)									Immune_Deficiency_with_Hyper-IgM				---	---	---	---
MIR509-2	100126301	broad.mit.edu	37	X	146340278	146340278	+	RNA	SNP	G	A	A			TCGA-D7-6526-01	TCGA-D7-6526-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:146340278G>A	hsa-mir-509-2|MI0005530	-			c.91G>A																				0																		---	---	---	---
