Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	filter
CDK11B	984	broad.mit.edu	37	1	1572314	1572314	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1572314G>T	uc001agv.1	-	20	1856	c.1745C>A	c.(1744-1746)ACC>AAC	p.T582N	CDK11B_uc009vkj.2_Missense_Mutation_p.T239N|CDK11B_uc001ags.1_Missense_Mutation_p.T440N|CDK11B_uc001agt.1_Missense_Mutation_p.T365N|CDK11B_uc001aha.1_Missense_Mutation_p.T548N|CDK11B_uc001agw.1_Missense_Mutation_p.T537N|CDK11B_uc001agy.1_Missense_Mutation_p.T580N|CDK11B_uc001agx.1_Missense_Mutation_p.T571N|CDK11B_uc001agz.1_Missense_Mutation_p.T326N	NM_033486	NP_277021	P21127	CD11B_HUMAN	cell division cycle 2-like 1 (PITSLRE proteins)	595	Protein kinase.				apoptosis|cell proliferation|mitosis|regulation of cell growth|regulation of mRNA processing|regulation of transcription, DNA-dependent	cytoplasm|nucleus	ATP binding|cyclin-dependent protein kinase activity|protein binding			skin(1)	1						CACGACCGGGGTGTAGGCCTT	0.687													18	37	---	---	---	---	PASS
MEGF6	1953	broad.mit.edu	37	1	3413693	3413693	+	Intron	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:3413693G>C	uc001akl.2	-						MEGF6_uc001akk.2_Intron	NM_001409	NP_001400	O75095	MEGF6_HUMAN	EGF-like-domain, multiple 3 precursor							extracellular region	calcium ion binding			large_intestine(1)	1	all_cancers(77;0.00681)|all_epithelial(69;0.00301)|Ovarian(185;0.0634)|Lung NSC(156;0.0969)|all_lung(157;0.105)	all_epithelial(116;7.41e-22)|all_lung(118;8.3e-09)|Lung NSC(185;3.55e-06)|Breast(487;0.000659)|Renal(390;0.00121)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Lung SC(97;0.0262)|Ovarian(437;0.0308)|Medulloblastoma(700;0.211)		Epithelial(90;3.78e-37)|OV - Ovarian serous cystadenocarcinoma(86;6.86e-22)|GBM - Glioblastoma multiforme(42;1.96e-12)|Colorectal(212;6.15e-05)|COAD - Colon adenocarcinoma(227;0.000241)|Kidney(185;0.000448)|BRCA - Breast invasive adenocarcinoma(365;0.000779)|KIRC - Kidney renal clear cell carcinoma(229;0.00645)|STAD - Stomach adenocarcinoma(132;0.00669)|Lung(427;0.213)		GCTGGGTGGAGACAGGCAGGG	0.711													3	5	---	---	---	---	PASS
NPHP4	261734	broad.mit.edu	37	1	6007258	6007258	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:6007258C>T	uc001alq.1	-	9	1291	c.1025G>A	c.(1024-1026)CGC>CAC	p.R342H	NPHP4_uc001als.1_RNA|NPHP4_uc009vlt.1_RNA|NPHP4_uc001alt.1_RNA	NM_015102	NP_055917	O75161	NPHP4_HUMAN	nephroretinin	342			R -> C (in NPHP4).		actin cytoskeleton organization|cell-cell adhesion|signal transduction|visual behavior	cell-cell junction|centrosome|cilium|microtubule basal body	protein binding|structural molecule activity			pancreas(1)	1	Ovarian(185;0.0634)	all_cancers(23;7.53e-41)|all_epithelial(116;3.96e-23)|all_lung(118;5.12e-09)|all_hematologic(16;5.45e-07)|Lung NSC(185;5.49e-07)|all_neural(13;3.21e-06)|Acute lymphoblastic leukemia(12;3.44e-05)|Breast(487;0.000601)|Renal(390;0.0007)|Colorectal(325;0.00113)|Hepatocellular(190;0.00213)|Glioma(11;0.00223)|Myeloproliferative disorder(586;0.0256)|Ovarian(437;0.04)|Lung SC(97;0.128)|Medulloblastoma(700;0.213)		Epithelial(90;1.69e-36)|GBM - Glioblastoma multiforme(13;5.07e-29)|OV - Ovarian serous cystadenocarcinoma(86;1.05e-19)|Colorectal(212;4.54e-07)|COAD - Colon adenocarcinoma(227;3.14e-05)|Kidney(185;0.00012)|BRCA - Breast invasive adenocarcinoma(365;0.00102)|KIRC - Kidney renal clear cell carcinoma(229;0.00179)|STAD - Stomach adenocarcinoma(132;0.00472)|READ - Rectum adenocarcinoma(331;0.0649)		GAGGCGGAGGCGGCTTCTCAA	0.587													9	120	---	---	---	---	PASS
CTNNBIP1	56998	broad.mit.edu	37	1	9932074	9932074	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:9932074G>A	uc001aqk.1	-	4	356	c.49C>T	c.(49-51)CAG>TAG	p.Q17*	CTNNBIP1_uc001aql.1_Nonsense_Mutation_p.Q17*	NM_020248	NP_064633	Q9NSA3	CNBP1_HUMAN	catenin, beta interacting protein 1	17					anterior/posterior pattern formation|branching involved in ureteric bud morphogenesis|negative regulation of mesenchymal cell proliferation|negative regulation of protein binding|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of smooth muscle cell proliferation|negative regulation of transcription initiation from RNA polymerase II promoter|negative regulation of Wnt receptor signaling pathway|positive regulation of monocyte differentiation|positive regulation of osteoblast differentiation|regulation of vascular permeability involved in acute inflammatory response|Wnt receptor signaling pathway	Axin-APC-beta-catenin-GSK3B complex|cytosol|nucleus	armadillo repeat domain binding|beta-catenin binding				0		all_lung(284;1.82e-05)|Lung NSC(185;3.08e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00825)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.023)|Colorectal(212;7.32e-08)|COAD - Colon adenocarcinoma(227;1.73e-05)|Kidney(185;4.89e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000912)|KIRC - Kidney renal clear cell carcinoma(229;0.00112)|STAD - Stomach adenocarcinoma(132;0.00644)|READ - Rectum adenocarcinoma(331;0.0419)		ACCTTCTGCTGAATGTACATC	0.627													27	34	---	---	---	---	PASS
PRAMEF12	390999	broad.mit.edu	37	1	12835064	12835064	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12835064G>A	uc001aui.2	+	1	81	c.54G>A	c.(52-54)CTG>CTA	p.L18L		NM_001080830	NP_001074299	O95522	PRA12_HUMAN	PRAME family member 12	18										ovary(3)	3	Ovarian(185;0.249)	Renal(390;0.000469)|Lung NSC(185;0.00143)|all_lung(284;0.00181)|Colorectal(325;0.00215)|Breast(348;0.0042)|Myeloproliferative disorder(586;0.0393)|Hepatocellular(190;0.0623)|Ovarian(437;0.0731)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00818)|Colorectal(212;5.04e-06)|Kidney(185;4.99e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000198)|COAD - Colon adenocarcinoma(227;0.000245)|BRCA - Breast invasive adenocarcinoma(304;0.000295)|STAD - Stomach adenocarcinoma(313;0.0072)|READ - Rectum adenocarcinoma(331;0.0649)		AGAGTCTGCTGAGAGACCGGG	0.567													28	83	---	---	---	---	PASS
TMEM51	55092	broad.mit.edu	37	1	15541908	15541908	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:15541908C>G	uc001avw.3	+	3	844	c.325C>G	c.(325-327)CAC>GAC	p.H109D	TMEM51_uc010obk.1_Missense_Mutation_p.H109D|TMEM51_uc001avz.2_Missense_Mutation_p.H109D|TMEM51_uc001avy.2_Missense_Mutation_p.H109D|TMEM51_uc001avx.2_Missense_Mutation_p.H109D	NM_001136216	NP_001129688	Q9NW97	TMM51_HUMAN	transmembrane protein 51	109						integral to membrane					0		Renal(390;0.00145)|Breast(348;0.00186)|Colorectal(325;0.00215)|all_lung(284;0.00459)|Lung NSC(340;0.0104)|Myeloproliferative disorder(586;0.0393)|Hepatocellular(190;0.0623)|Ovarian(437;0.0798)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0265)|Colorectal(212;2.07e-06)|COAD - Colon adenocarcinoma(227;7.14e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000175)|KIRC - Kidney renal clear cell carcinoma(229;0.00141)|STAD - Stomach adenocarcinoma(313;0.00644)|READ - Rectum adenocarcinoma(331;0.0751)		CGCTGGGCCTCACGCCCAGGA	0.632													10	19	---	---	---	---	PASS
ARHGEF19	128272	broad.mit.edu	37	1	16535286	16535286	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16535286C>T	uc001ayc.1	-	2	401	c.264G>A	c.(262-264)GAG>GAA	p.E88E	ARHGEF19_uc009voo.1_5'Flank|ARHGEF19_uc001ayb.1_5'Flank	NM_153213	NP_694945	Q8IW93	ARHGJ_HUMAN	Rho guanine nucleotide exchange factor (GEF) 19	88					regulation of actin cytoskeleton organization	intracellular	GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			skin(2)|ovary(1)	3		Colorectal(325;0.000147)|Renal(390;0.00145)|Breast(348;0.00224)|Lung NSC(340;0.00566)|all_lung(284;0.00831)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0646)		UCEC - Uterine corpus endometrioid carcinoma (279;0.018)|Colorectal(212;3.48e-07)|COAD - Colon adenocarcinoma(227;2.19e-05)|BRCA - Breast invasive adenocarcinoma(304;9.46e-05)|Kidney(64;0.000171)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(313;0.0117)|READ - Rectum adenocarcinoma(331;0.0649)		CGCTGGTGATCTCTGTATCTG	0.677													21	29	---	---	---	---	PASS
SESN2	83667	broad.mit.edu	37	1	28599131	28599131	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:28599131G>A	uc001bps.2	+	5	930	c.577G>A	c.(577-579)GAG>AAG	p.E193K		NM_031459	NP_113647	P58004	SESN2_HUMAN	sestrin 2	193					cell cycle arrest	cytoplasm|nucleus				skin(3)|ovary(2)|pancreas(1)|lung(1)	7		Colorectal(325;3.46e-05)|Lung NSC(340;4.37e-05)|all_lung(284;4.76e-05)|Renal(390;0.00121)|Breast(348;0.00345)|all_neural(195;0.0208)|Myeloproliferative disorder(586;0.0255)|Ovarian(437;0.0261)		OV - Ovarian serous cystadenocarcinoma(117;2.98e-22)|Colorectal(126;3.04e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.00279)|STAD - Stomach adenocarcinoma(196;0.00303)|BRCA - Breast invasive adenocarcinoma(304;0.00595)|READ - Rectum adenocarcinoma(331;0.0649)		GTCCCTGGCCGAGCTCATTCA	0.642													58	56	---	---	---	---	PASS
ZBTB8A	653121	broad.mit.edu	37	1	33058778	33058778	+	Silent	SNP	C	T	T	rs144529739		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:33058778C>T	uc001bvn.2	+	3	731	c.246C>T	c.(244-246)TTC>TTT	p.F82F	ZBTB8A_uc001bvk.2_RNA|ZBTB8A_uc001bvm.2_Silent_p.F82F	NM_001040441	NP_001035531	Q96BR9	ZBT8A_HUMAN	zinc finger and BTB domain containing 8A	82	BTB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						TCTTGGACTTCGTATATTCTG	0.413													78	136	---	---	---	---	PASS
CSMD2	114784	broad.mit.edu	37	1	34383868	34383868	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:34383868C>A	uc001bxn.1	-	5	656	c.627G>T	c.(625-627)CAG>CAT	p.Q209H	CSMD2_uc001bxm.1_Missense_Mutation_p.Q249H	NM_052896	NP_443128	Q7Z408	CSMD2_HUMAN	CUB and Sushi multiple domains 2	209	CUB 2.|Extracellular (Potential).					integral to membrane|plasma membrane	protein binding			ovary(6)|skin(5)|pancreas(1)	12		Myeloproliferative disorder(586;0.0294)|all_neural(195;0.249)				TGATGCCACTCTGGCCCCGCA	0.592													4	63	---	---	---	---	PASS
POU3F1	5453	broad.mit.edu	37	1	38511656	38511656	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:38511656C>T	uc001ccp.1	-	1	795	c.760G>A	c.(760-762)GAC>AAC	p.D254N		NM_002699	NP_002690	Q03052	PO3F1_HUMAN	POU domain, class 3, transcription factor 1	254	POU-specific.				positive regulation of transcription, DNA-dependent		sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0	Acute lymphoblastic leukemia(166;0.074)|all_hematologic(146;0.197)	Myeloproliferative disorder(586;0.0255)				TGCTCCAGGTCGTCCGAGCTG	0.478													14	17	---	---	---	---	PASS
DMAP1	55929	broad.mit.edu	37	1	44684814	44684814	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44684814G>C	uc001clq.1	+	7	887	c.807G>C	c.(805-807)CAG>CAC	p.Q269H	DMAP1_uc001clr.1_Missense_Mutation_p.Q269H|DMAP1_uc001cls.1_Missense_Mutation_p.Q269H|DMAP1_uc010oku.1_Missense_Mutation_p.Q259H	NM_001034024	NP_001029196	Q9NPF5	DMAP1_HUMAN	DNA methyltransferase 1 associated protein 1	269	Potential.				DNA methylation|histone H2A acetylation|histone H4 acetylation|negative regulation of transcription, DNA-dependent|regulation of growth|transcription, DNA-dependent	NuA4 histone acetyltransferase complex	DNA binding|protein binding				0	Acute lymphoblastic leukemia(166;0.155)					AGGACCTGCAGAAGCTGATCA	0.607													24	47	---	---	---	---	PASS
PTCH2	8643	broad.mit.edu	37	1	45293815	45293815	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:45293815G>A	uc010olf.1	-	14	1770	c.1758C>T	c.(1756-1758)GAC>GAT	p.D586D	PTCH2_uc010olg.1_Silent_p.D284D	NM_003738	NP_003729	Q9Y6C5	PTC2_HUMAN	patched 2	586	Cytoplasmic (Potential).				protein complex assembly|spermatogenesis	integral to plasma membrane	hedgehog receptor activity			lung(6)|breast(6)|central_nervous_system(3)|skin(2)|ovary(1)	18	Acute lymphoblastic leukemia(166;0.155)					GTACTGTCCCGTCCCCCAGCT	0.587									Basal_Cell_Nevus_syndrome				34	108	---	---	---	---	PASS
PDE4B	5142	broad.mit.edu	37	1	66713176	66713176	+	Silent	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:66713176G>C	uc001dcn.2	+	4	506	c.315G>C	c.(313-315)CGG>CGC	p.R105R	PDE4B_uc009war.2_Silent_p.R13R|PDE4B_uc001dco.2_Silent_p.R105R|PDE4B_uc001dcp.2_Silent_p.R90R	NM_001037341	NP_001032418	Q07343	PDE4B_HUMAN	phosphodiesterase 4B isoform 1	105					signal transduction	cytosol|insoluble fraction|soluble fraction	3',5'-cyclic-AMP phosphodiesterase activity|metal ion binding			ovary(2)|central_nervous_system(1)	3					Adenosine monophosphate(DB00131)|Amrinone(DB01427)|Caffeine(DB00201)|Cilostazol(DB01166)|Dyphylline(DB00651)|Enprofylline(DB00824)|Papaverine(DB01113)|Pentoxifylline(DB00806)|Theophylline(DB00277)	CCCCAGGTCGGAGTCCACTGG	0.517													20	391	---	---	---	---	PASS
GNG12	55970	broad.mit.edu	37	1	68173373	68173373	+	5'UTR	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:68173373C>T	uc001dea.1	-	3						NM_018841	NP_061329	Q9UBI6	GBG12_HUMAN	G-protein gamma-12 subunit precursor						cellular response to glucagon stimulus|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|synaptic transmission	heterotrimeric G-protein complex	signal transducer activity				0						TGGACATCTTCAATTATTGTT	0.328													95	219	---	---	---	---	PASS
LRRC7	57554	broad.mit.edu	37	1	70505043	70505043	+	Missense_Mutation	SNP	A	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70505043A>T	uc001dep.2	+	19	3452	c.3422A>T	c.(3421-3423)GAT>GTT	p.D1141V	LRRC7_uc009wbg.2_Missense_Mutation_p.D425V|LRRC7_uc001deq.2_Missense_Mutation_p.D382V	NM_020794	NP_065845	Q96NW7	LRRC7_HUMAN	leucine rich repeat containing 7	1141						centrosome|focal adhesion|nucleolus	protein binding	p.D1141N(1)		ovary(9)|breast(2)|central_nervous_system(2)|liver(1)	14						CCCCCAACTGATAGGTACGGC	0.567													21	152	---	---	---	---	PASS
LRRC40	55631	broad.mit.edu	37	1	70641557	70641557	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70641557G>A	uc001der.1	-	7	965	c.913C>T	c.(913-915)CCA>TCA	p.P305S		NM_017768	NP_060238	Q9H9A6	LRC40_HUMAN	leucine rich repeat containing 40	305	LRR 10.									ovary(1)	1						ATTTCATCTGGAACAGATTTT	0.338													42	64	---	---	---	---	PASS
MCOLN2	255231	broad.mit.edu	37	1	85418224	85418224	+	Intron	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85418224G>C	uc001dkm.2	-						MCOLN2_uc001dkn.2_Intron	NM_153259	NP_694991	Q8IZK6	MCLN2_HUMAN	mucolipin 2							integral to membrane	ion channel activity			ovary(3)|upper_aerodigestive_tract(1)	4				all cancers(265;0.0111)|Epithelial(280;0.0263)|OV - Ovarian serous cystadenocarcinoma(397;0.217)		CTAGGGCAATGAAAGAACAag	0.229													19	42	---	---	---	---	PASS
HFM1	164045	broad.mit.edu	37	1	91851246	91851246	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:91851246G>A	uc001doa.3	-	5	740	c.640C>T	c.(640-642)CAG>TAG	p.Q214*	HFM1_uc010osu.1_Intron|HFM1_uc010osv.1_Intron|HFM1_uc001doc.1_Nonsense_Mutation_p.Q214*	NM_001017975	NP_001017975	A2PYH4	HFM1_HUMAN	HFM1 protein	214							ATP binding|ATP-dependent helicase activity|nucleic acid binding				0		all_lung(203;0.00961)|Lung NSC(277;0.0351)		all cancers(265;0.000481)|Epithelial(280;0.00863)|OV - Ovarian serous cystadenocarcinoma(397;0.126)|KIRC - Kidney renal clear cell carcinoma(1967;0.171)		GCAGAATACTGAAATTTTTGC	0.358													25	52	---	---	---	---	PASS
AKNAD1	254268	broad.mit.edu	37	1	109366000	109366000	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109366000G>C	uc001dwa.2	-	13	2428	c.2159C>G	c.(2158-2160)TCT>TGT	p.S720C	AKNAD1_uc010ovb.1_Missense_Mutation_p.S427C|AKNAD1_uc001dwb.2_RNA	NM_152763	NP_689976	Q5T1N1	AKND1_HUMAN	hypothetical protein LOC254268	720										ovary(3)	3						ACAGGGTGAAGAGTTTTTACT	0.423													36	86	---	---	---	---	PASS
CELSR2	1952	broad.mit.edu	37	1	109794627	109794627	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109794627C>T	uc001dxa.3	+	1	1987	c.1926C>T	c.(1924-1926)GTC>GTT	p.V642V		NM_001408	NP_001399	Q9HCU4	CELR2_HUMAN	cadherin EGF LAG seven-pass G-type receptor 2	642	Cadherin 5.|Extracellular (Potential).				dendrite morphogenesis|homophilic cell adhesion|neural plate anterior/posterior regionalization|neuropeptide signaling pathway|regulation of cell-cell adhesion|regulation of transcription, DNA-dependent|Wnt receptor signaling pathway	cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity|protein binding			ovary(4)|lung(3)|skin(1)	8		all_epithelial(167;0.000114)|all_lung(203;0.000321)|Lung NSC(277;0.000626)|Breast(1374;0.244)		Colorectal(144;0.0296)|Lung(183;0.067)|COAD - Colon adenocarcinoma(174;0.114)|Epithelial(280;0.193)|all cancers(265;0.219)		CTCATAGTGTCATCACCTACC	0.562													75	136	---	---	---	---	PASS
PPIAL4G	644591	broad.mit.edu	37	1	143767853	143767853	+	5'UTR	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:143767853G>A	uc001ejt.2	-	1						NM_001123068	NP_001116540	A2BFH1	PAL4G_HUMAN	peptidylprolyl isomerase A (cyclophilin A)-like						protein folding	cytoplasm	peptidyl-prolyl cis-trans isomerase activity				0						GACCATGGCTGATAGTACAGG	0.358													7	270	---	---	---	---	PASS
MTMR11	10903	broad.mit.edu	37	1	149902287	149902287	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:149902287G>C	uc001etl.3	-	15	1868	c.1617C>G	c.(1615-1617)CAC>CAG	p.H539Q	SF3B4_uc001etj.1_5'Flank|SF3B4_uc001etk.1_5'Flank|SF3B4_uc009wll.1_5'Flank|MTMR11_uc001etm.1_Missense_Mutation_p.H467Q|MTMR11_uc010pbm.1_3'UTR	NM_001145862	NP_001139334	A4FU01	MTMRB_HUMAN	myotubularin related protein 11 isoform a	539	Myotubularin phosphatase.						phosphatase activity			central_nervous_system(1)	1	Breast(34;0.0009)|Ovarian(49;0.0377)|all_hematologic(923;0.0597)|Hepatocellular(266;0.161)|Colorectal(459;0.171)		LUSC - Lung squamous cell carcinoma(543;0.221)|STAD - Stomach adenocarcinoma(528;0.247)			AATCTGGACAGTGTTCTGGGT	0.473													68	185	---	---	---	---	PASS
CTSK	1513	broad.mit.edu	37	1	150772128	150772128	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150772128C>G	uc001evp.1	-	6	800	c.676G>C	c.(676-678)GAG>CAG	p.E226Q	CTSK_uc001evq.1_Missense_Mutation_p.E137Q	NM_000396	NP_000387	P43235	CATK_HUMAN	cathepsin K preproprotein	226					proteolysis	lysosome	cysteine-type endopeptidase activity|protein binding			skin(1)	1	all_cancers(9;2.32e-51)|all_epithelial(9;3.89e-42)|all_lung(15;4.59e-35)|Lung NSC(24;1.7e-31)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Colorectal(459;0.171)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0485)|BRCA - Breast invasive adenocarcinoma(12;0.00606)|LUSC - Lung squamous cell carcinoma(543;0.211)			TCGGGGATCTCTCTGTACCCT	0.502													50	194	---	---	---	---	PASS
ILF2	3608	broad.mit.edu	37	1	153643396	153643396	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153643396C>T	uc001fcr.2	-	1	84	c.3G>A	c.(1-3)ATG>ATA	p.M1I	ILF2_uc010pdy.1_5'UTR|ILF2_uc009wok.2_Missense_Mutation_p.M1I|ILF2_uc009wol.1_5'UTR	NM_004515	NP_004506	Q12905	ILF2_HUMAN	interleukin enhancer binding factor 2	1					immune response|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleolus|ribonucleoprotein complex	ATP binding|DNA binding|double-stranded RNA binding|protein binding|transferase activity				0	all_lung(78;1.84e-32)|Lung NSC(65;6.67e-31)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.171)			CCACTTACCTCATGGCGCCTT	0.522													9	436	---	---	---	---	PASS
FDPS	2224	broad.mit.edu	37	1	155279951	155279951	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155279951G>C	uc001fkc.2	+	3	513	c.294G>C	c.(292-294)GAG>GAC	p.E98D	RAG1AP1_uc010pey.1_Intron|FDPS_uc001fkd.2_Missense_Mutation_p.E32D|FDPS_uc001fke.2_Missense_Mutation_p.E98D|FDPS_uc001fkf.2_Missense_Mutation_p.E32D	NM_002004	NP_001995	P14324	FPPS_HUMAN	farnesyl diphosphate synthase isoform a	98					cholesterol biosynthetic process|interspecies interaction between organisms|isoprenoid biosynthetic process	cytosol|nucleus	dimethylallyltranstransferase activity|geranyltranstransferase activity|metal ion binding				0	Hepatocellular(266;0.0877)|all_hematologic(923;0.145)		Epithelial(20;2.03e-10)|all cancers(21;5.23e-10)|BRCA - Breast invasive adenocarcinoma(34;0.000549)|LUSC - Lung squamous cell carcinoma(543;0.127)		Alendronate(DB00630)|Ibandronate(DB00710)|Pamidronate(DB00282)|Risedronate(DB00884)|Zoledronate(DB00399)	CTGAGGATGAGATGGGGCACC	0.502													36	104	---	---	---	---	PASS
ARHGAP30	257106	broad.mit.edu	37	1	161021240	161021240	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161021240G>A	uc001fxl.2	-	10	1630	c.1284C>T	c.(1282-1284)CTC>CTT	p.L428L	ARHGAP30_uc001fxk.2_Silent_p.L428L|ARHGAP30_uc001fxm.2_Silent_p.L274L|ARHGAP30_uc009wtx.2_Silent_p.L101L|ARHGAP30_uc001fxn.1_Silent_p.L274L	NM_001025598	NP_001020769	Q7Z6I6	RHG30_HUMAN	Rho GTPase activating protein 30 isoform 1	428					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(2)|upper_aerodigestive_tract(1)	3	all_cancers(52;8.05e-20)|Breast(13;0.00188)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00122)			GGGGCACACTGAGGATAGAGG	0.547													86	85	---	---	---	---	PASS
DEDD	9191	broad.mit.edu	37	1	161092117	161092117	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161092117G>A	uc001fxz.2	-	6	950	c.777C>T	c.(775-777)TTC>TTT	p.F259F	NIT1_uc001fxw.2_Intron|DEDD_uc009wty.2_Silent_p.F289F|DEDD_uc001fya.2_Silent_p.F259F|DEDD_uc001fyb.2_Silent_p.F259F|DEDD_uc010pkb.1_Silent_p.F216F|DEDD_uc001fyc.2_Silent_p.F99F	NM_001039712	NP_001034801	O75618	DEDD_HUMAN	death effector domain-containing protein	259					apoptosis|induction of apoptosis via death domain receptors|negative regulation of transcription, DNA-dependent|spermatogenesis|transcription, DNA-dependent	cytoplasm|nucleolus	DNA binding|protein binding				0	all_cancers(52;3.39e-19)|Breast(13;0.000577)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00165)			AGTCACGCCAGAATGCATCGA	0.512													51	129	---	---	---	---	PASS
DEDD	9191	broad.mit.edu	37	1	161092266	161092266	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161092266G>T	uc001fxz.2	-	6	801	c.628C>A	c.(628-630)CTG>ATG	p.L210M	NIT1_uc001fxw.2_Intron|DEDD_uc009wty.2_Missense_Mutation_p.L240M|DEDD_uc001fya.2_Missense_Mutation_p.L210M|DEDD_uc001fyb.2_Missense_Mutation_p.L210M|DEDD_uc010pkb.1_Missense_Mutation_p.L167M|DEDD_uc001fyc.2_Missense_Mutation_p.L50M	NM_001039712	NP_001034801	O75618	DEDD_HUMAN	death effector domain-containing protein	210					apoptosis|induction of apoptosis via death domain receptors|negative regulation of transcription, DNA-dependent|spermatogenesis|transcription, DNA-dependent	cytoplasm|nucleolus	DNA binding|protein binding				0	all_cancers(52;3.39e-19)|Breast(13;0.000577)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00165)			TTGCCCTGCAGAGCAGTCTCA	0.527													62	154	---	---	---	---	PASS
CACYBP	27101	broad.mit.edu	37	1	174973857	174973857	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:174973857G>A	uc001gkj.1	+	2	548	c.123G>A	c.(121-123)AAG>AAA	p.K41K	CACYBP_uc001gki.1_5'UTR|CACYBP_uc010pmw.1_Silent_p.K41K	NM_014412	NP_055227	Q9HB71	CYBP_HUMAN	calcyclin binding protein isoform 1	41	Interaction with SIAH1.					beta-catenin destruction complex	protein homodimerization activity				0						CAGAAATCAAGAACAAGATGC	0.408													53	54	---	---	---	---	PASS
KIF21B	23046	broad.mit.edu	37	1	200960225	200960225	+	Missense_Mutation	SNP	C	T	T	rs141871941	byFrequency	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200960225C>T	uc001gvs.1	-	18	2824	c.2507G>A	c.(2506-2508)CGT>CAT	p.R836H	KIF21B_uc001gvr.1_Missense_Mutation_p.R836H|KIF21B_uc009wzl.1_Missense_Mutation_p.R836H|KIF21B_uc010ppn.1_Missense_Mutation_p.R836H	NM_017596	NP_060066	O75037	KI21B_HUMAN	kinesin family member 21B	836					microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(3)|skin(3)	6						TAGTCCTGCACGCCCTGCCAC	0.647													45	59	---	---	---	---	PASS
PPP1R12B	4660	broad.mit.edu	37	1	202418211	202418211	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202418211C>T	uc001gya.1	+	13	1906	c.1762C>T	c.(1762-1764)CTT>TTT	p.L588F	PPP1R12B_uc001gxz.1_Missense_Mutation_p.L588F	NM_002481	NP_002472	O60237	MYPT2_HUMAN	protein phosphatase 1, regulatory (inhibitor)	588					regulation of muscle contraction|signal transduction	cytoplasm	enzyme activator activity			ovary(3)	3			BRCA - Breast invasive adenocarcinoma(75;0.166)			CAATCGCCCTCTTCCTAGCAC	0.512													16	54	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202709925	202709925	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202709925C>T	uc001gyf.2	-	20	3077	c.2961G>A	c.(2959-2961)TTG>TTA	p.L987L	KDM5B_uc009xag.2_Silent_p.L1023L|KDM5B_uc001gyg.1_Silent_p.L829L	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	987					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						CAAGGCTATTCAATGAATGTC	0.418													35	103	---	---	---	---	PASS
KDM5B	10765	broad.mit.edu	37	1	202710713	202710713	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202710713C>T	uc001gyf.2	-	19	2843	c.2727G>A	c.(2725-2727)GAG>GAA	p.E909E	KDM5B_uc009xag.2_Silent_p.E945E|KDM5B_uc001gyg.1_Silent_p.E751E	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	909					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						GGATACGCATCTCAGCAAGCT	0.493													27	77	---	---	---	---	PASS
SLC45A3	85414	broad.mit.edu	37	1	205632701	205632701	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205632701G>A	uc001hda.1	-	3	557	c.218C>T	c.(217-219)TCA>TTA	p.S73L	SLC45A3_uc010prn.1_5'Flank|SLC45A3_uc010pro.1_5'UTR|SLC45A3_uc010prp.1_Intron|ELK4_uc010prq.1_Intron	NM_033102	NP_149093	Q96JT2	S45A3_HUMAN	prostein	73					transmembrane transport	integral to membrane			SLC45A3/BRAF(2)	ovary(2)|prostate(2)	4	Breast(84;0.07)		BRCA - Breast invasive adenocarcinoma(75;0.0194)			GTCACTGGCTGAGCCTAGGAG	0.612			T	ETV1|ETV5|ELK4|ERG	prostate 								63	43	---	---	---	---	PASS
YOD1	55432	broad.mit.edu	37	1	207222842	207222842	+	Silent	SNP	T	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207222842T>A	uc001hfe.1	-	2	617	c.570A>T	c.(568-570)GTA>GTT	p.V190V	PFKFB2_uc010psc.1_5'UTR|YOD1_uc001hff.1_Silent_p.V146V	NM_018566	NP_061036	Q5VVQ6	OTU1_HUMAN	YOD1 OTU deubiquinating enzyme 1 homolog	190	OTU.				cellular amino acid metabolic process|endoplasmic reticulum unfolded protein response|ER-associated protein catabolic process|protein K48-linked deubiquitination|protein K63-linked deubiquitination	intracellular	protein binding|ubiquitin-specific protease activity|zinc ion binding			lung(1)	1	Prostate(682;0.19)					GATCGCTTGCTACAATTTGTG	0.458													117	105	---	---	---	---	PASS
TRAF5	7188	broad.mit.edu	37	1	211545904	211545904	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:211545904G>C	uc001hih.2	+	11	1594	c.1534G>C	c.(1534-1536)GAT>CAT	p.D512H	TRAF5_uc001hii.2_Missense_Mutation_p.D512H|TRAF5_uc010psx.1_Missense_Mutation_p.D523H|TRAF5_uc010psy.1_Missense_Mutation_p.D406H|TRAF5_uc001hij.2_Missense_Mutation_p.D512H	NM_004619	NP_004610	O00463	TRAF5_HUMAN	TNF receptor-associated factor 5	512	MATH.				apoptosis|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|regulation of apoptosis	CD40 receptor complex|centrosome|internal side of plasma membrane	protein binding|ubiquitin-protein ligase activity|zinc ion binding			lung(2)|breast(2)|ovary(1)	5				OV - Ovarian serous cystadenocarcinoma(81;0.00946)|all cancers(67;0.0808)|Epithelial(68;0.144)		TAAAAGACCTGATGGGGAGAT	0.478													66	57	---	---	---	---	PASS
GPATCH2	55105	broad.mit.edu	37	1	217787495	217787495	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:217787495C>T	uc001hlf.1	-	3	919	c.823G>A	c.(823-825)GAG>AAG	p.E275K	GPATCH2_uc001hlg.3_Missense_Mutation_p.E275K	NM_018040	NP_060510	Q9NW75	GPTC2_HUMAN	G patch domain containing 2	275						intracellular	nucleic acid binding			ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(81;0.0397)|all cancers(67;0.0744)|GBM - Glioblastoma multiforme(131;0.0872)		TGTCTTCCCTCATCATTGGTA	0.348													25	137	---	---	---	---	PASS
EGLN1	54583	broad.mit.edu	37	1	231556755	231556755	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:231556755C>T	uc001huv.2	-	1	4036	c.880G>A	c.(880-882)GGC>AGC	p.G294S	EGLN1_uc001huu.3_5'Flank	NM_022051	NP_071334	Q9GZT9	EGLN1_HUMAN	egl nine homolog 1	294	Fe2OG dioxygenase.				negative regulation of sequence-specific DNA binding transcription factor activity|oxygen homeostasis|response to hypoxia	cytosol	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|peptidyl-proline dioxygenase activity|protein binding|zinc ion binding				0		Prostate(94;0.194)|Acute lymphoblastic leukemia(190;0.244)			Vitamin C(DB00126)	TTCGTCCGGCCATTGATTTTG	0.602													91	104	---	---	---	---	PASS
RBM34	23029	broad.mit.edu	37	1	235295079	235295079	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:235295079C>G	uc001hwn.2	-	11	1272	c.1242G>C	c.(1240-1242)AAG>AAC	p.K414N	TOMM20_uc001hwl.2_5'Flank|RBM34_uc001hwo.2_RNA|ARID4B_uc001hwp.2_RNA	NM_015014	NP_055829	P42696	RBM34_HUMAN	RNA binding motif protein 34 isoform 1	414						nucleolus	nucleotide binding|RNA binding			central_nervous_system(1)	1	Ovarian(103;0.0398)	all_cancers(173;0.177)|Prostate(94;0.0166)	OV - Ovarian serous cystadenocarcinoma(106;5.43e-05)|Epithelial(3;0.000121)			TCTGTCCTTTCTTCTTCGTTT	0.368													39	145	---	---	---	---	PASS
ZNF238	10472	broad.mit.edu	37	1	244217494	244217494	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:244217494G>A	uc001iae.2	+	1	913	c.391G>A	c.(391-393)GAA>AAA	p.E131K	ZNF238_uc001iad.3_Missense_Mutation_p.E140K|ZNF238_uc001iaf.1_Missense_Mutation_p.E131K	NM_006352	NP_006343	Q99592	ZN238_HUMAN	zinc finger protein 238 isoform 2	131					negative regulation of transcription from RNA polymerase II promoter|skeletal muscle tissue development	nuclear chromosome	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(3)|pancreas(2)	5	all_cancers(71;6.42e-05)|all_epithelial(71;7e-05)|Breast(184;0.0333)|Ovarian(71;0.0619)|all_lung(81;0.089)|all_neural(11;0.101)|Lung NSC(105;0.123)		all cancers(7;1.35e-08)|GBM - Glioblastoma multiforme(7;1e-06)|OV - Ovarian serous cystadenocarcinoma(106;0.00223)			CACCAAAAAGGAAGAAGATGC	0.483													26	40	---	---	---	---	PASS
ZNF238	10472	broad.mit.edu	37	1	244217625	244217625	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:244217625G>A	uc001iae.2	+	1	1044	c.522G>A	c.(520-522)AGG>AGA	p.R174R	ZNF238_uc001iad.3_Silent_p.R183R|ZNF238_uc001iaf.1_Silent_p.R174R	NM_006352	NP_006343	Q99592	ZN238_HUMAN	zinc finger protein 238 isoform 2	174				KLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHAT AAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSS LSGVENLNSSYFSSQ -> IEHPAQQKGLGGRAWEHVDAIA LRLSRHPPGWRRGRATRHSSWKNSSQPLQLNRVFVPE (in Ref. 1; AAA81368).	negative regulation of transcription from RNA polymerase II promoter|skeletal muscle tissue development	nuclear chromosome	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(3)|pancreas(2)	5	all_cancers(71;6.42e-05)|all_epithelial(71;7e-05)|Breast(184;0.0333)|Ovarian(71;0.0619)|all_lung(81;0.089)|all_neural(11;0.101)|Lung NSC(105;0.123)		all cancers(7;1.35e-08)|GBM - Glioblastoma multiforme(7;1e-06)|OV - Ovarian serous cystadenocarcinoma(106;0.00223)			CCAGCAAAAGGGACTTGGCGG	0.577													55	50	---	---	---	---	PASS
KIF26B	55083	broad.mit.edu	37	1	245848929	245848929	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:245848929G>A	uc001ibf.1	+	12	3084	c.2644G>A	c.(2644-2646)GAC>AAC	p.D882N	KIF26B_uc001ibg.1_Missense_Mutation_p.D500N|KIF26B_uc001ibh.1_Missense_Mutation_p.D124N	NM_018012	NP_060482	Q2KJY2	KI26B_HUMAN	kinesin family member 26B	882					microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(3)	3	all_cancers(71;3.86e-05)|all_epithelial(71;0.000121)|Ovarian(71;0.0412)|all_lung(81;0.0498)|Lung NSC(105;0.0708)|Breast(184;0.127)		OV - Ovarian serous cystadenocarcinoma(106;0.022)			GGAGCTCACCGACAACGAGGG	0.672													20	19	---	---	---	---	PASS
MYT1L	23040	broad.mit.edu	37	2	1920970	1920970	+	Intron	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1920970G>C	uc002qxe.2	-						MYT1L_uc002qxd.2_Intron|MYT1L_uc010ewl.1_Intron	NM_015025	NP_055840	Q9UL68	MYT1L_HUMAN	myelin transcription factor 1-like						cell differentiation|nervous system development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(5)|central_nervous_system(1)	6	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.037)|all_epithelial(98;0.241)		OV - Ovarian serous cystadenocarcinoma(76;0.169)|all cancers(51;0.244)		GTGAGACGTGGACTTACTTTC	0.582													81	172	---	---	---	---	PASS
SMC6	79677	broad.mit.edu	37	2	17902454	17902454	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:17902454C>A	uc002rco.2	-	10	1097	c.801G>T	c.(799-801)ATG>ATT	p.M267I	SMC6_uc010exo.2_Missense_Mutation_p.M267I|SMC6_uc002rcn.2_Missense_Mutation_p.M267I|SMC6_uc002rcp.1_Missense_Mutation_p.M293I|SMC6_uc002rcq.2_Missense_Mutation_p.M293I|SMC6_uc002rcr.1_Missense_Mutation_p.M267I	NM_001142286	NP_001135758	Q96SB8	SMC6_HUMAN	SMC6 protein	267	Potential.				DNA recombination|DNA repair	chromosome|nucleus	ATP binding			breast(4)|upper_aerodigestive_tract(1)|kidney(1)	6	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.158)					AATTAGTCTTCATTGTACTTA	0.363													50	82	---	---	---	---	PASS
GEN1	348654	broad.mit.edu	37	2	17941369	17941369	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:17941369C>T	uc002rct.2	+	2	232	c.159C>T	c.(157-159)CTC>CTT	p.L53L	SMC6_uc010exo.2_Intron|GEN1_uc010yjs.1_Silent_p.L53L|GEN1_uc002rcu.2_Silent_p.L53L	NM_182625	NP_872431	Q17RS7	GEN_HUMAN	Gen homolog 1, endonuclease	53	N-domain.				DNA repair	nucleus	DNA binding|endonuclease activity|metal ion binding			breast(5)|kidney(1)|central_nervous_system(1)|skin(1)	8	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.158)					AGCCCCACCTCAGGTATAGTA	0.383								Homologous_recombination					28	58	---	---	---	---	PASS
GDF7	151449	broad.mit.edu	37	2	20871110	20871110	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:20871110C>G	uc002rdz.1	+	2	1854	c.1278C>G	c.(1276-1278)CTC>CTG	p.L426L		NM_182828	NP_878248	Q7Z4P5	GDF7_HUMAN	growth differentiation factor 7 preproprotein	426					activin receptor signaling pathway|BMP signaling pathway|growth|pathway-restricted SMAD protein phosphorylation|positive regulation of pathway-restricted SMAD protein phosphorylation|positive regulation of transcription, DNA-dependent	extracellular space	cytokine activity|growth factor activity				0	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					TCAGCATCCTCTACATCGACG	0.652													17	26	---	---	---	---	PASS
CAD	790	broad.mit.edu	37	2	27459221	27459221	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27459221G>C	uc002rji.2	+	26	4306	c.4144G>C	c.(4144-4146)GAG>CAG	p.E1382Q	CAD_uc010eyw.2_Missense_Mutation_p.E1319Q	NM_004341	NP_004332	P27708	PYR1_HUMAN	carbamoylphosphate synthetase 2/aspartate	1382	CPSase B.|CPSase (Carbamoyl-phosphate synthase).				'de novo' pyrimidine base biosynthetic process|drug metabolic process|glutamine metabolic process|peptidyl-threonine phosphorylation|protein autophosphorylation|pyrimidine nucleoside biosynthetic process|pyrimidine nucleotide biosynthetic process	cytosol|neuronal cell body|nuclear matrix|terminal button	aspartate binding|aspartate carbamoyltransferase activity|ATP binding|carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity|dihydroorotase activity|enzyme binding|identical protein binding|metal ion binding|protein kinase activity			ovary(4)|large_intestine(2)|kidney(2)|lung(1)|pancreas(1)	10	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				L-Aspartic Acid(DB00128)|L-Glutamine(DB00130)	GAGCATCCTGGAGCAGCTAGC	0.582													50	72	---	---	---	---	PASS
ALK	238	broad.mit.edu	37	2	29436847	29436847	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:29436847C>T	uc002rmy.2	-						ALK_uc010ymo.1_Intron	NM_004304	NP_004295	Q9UM73	ALK_HUMAN	anaplastic lymphoma kinase precursor						protein autophosphorylation|transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	ATP binding|protein binding|transmembrane receptor protein tyrosine kinase activity		NPM1/ALK(632)|EML4/ALK(246)|CLTC/ALK(44)|TPM3/ALK(33)|ATIC/ALK(24)|RANBP2/ALK(16)|TPM4/ALK(12)|TFG/ALK(7)|MSN/ALK(6)|CARS/ALK(5)|VCL/ALK(4)|KIF5B/ALK(4)|PPFIBP1/ALK(3)|SEC31A/ALK(3)|SQSTM1/ALK(2)	haematopoietic_and_lymphoid_tissue(726)|lung(262)|autonomic_ganglia(148)|soft_tissue(61)|breast(4)|kidney(4)|large_intestine(3)|skin(3)|ovary(3)|thyroid(2)|central_nervous_system(1)|pancreas(1)	1218	Acute lymphoblastic leukemia(172;0.155)				Adenosine triphosphate(DB00171)	CACTTTGACTCACCGGTGGAT	0.552			T|Mis|A	NPM1|TPM3|TFG|TPM4|ATIC|CLTC|MSN|ALO17|CARS|EML4	ALCL|NSCLC|Neuroblastoma	neuroblastoma			Neuroblastoma_Familial_Clustering_of|Congenital_Central_Hypoventilation_Syndrome				20	50	---	---	---	---	PASS
SRBD1	55133	broad.mit.edu	37	2	45704134	45704134	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:45704134G>A	uc002rus.2	-	16	2123	c.2047C>T	c.(2047-2049)CAG>TAG	p.Q683*	SRBD1_uc010yoc.1_Nonsense_Mutation_p.Q202*	NM_018079	NP_060549	Q8N5C6	SRBD1_HUMAN	S1 RNA binding domain 1	683					nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		hydrolase activity, acting on ester bonds|RNA binding			central_nervous_system(1)	1		all_hematologic(82;0.166)|Acute lymphoblastic leukemia(82;0.17)	LUSC - Lung squamous cell carcinoma(58;0.0917)|Lung(47;0.154)			AGCTTTACCTGATACATTCCA	0.383													20	44	---	---	---	---	PASS
NRXN1	9378	broad.mit.edu	37	2	50765725	50765725	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:50765725C>T	uc010fbq.2	-	10	3406	c.1929G>A	c.(1927-1929)GAG>GAA	p.E643E	NRXN1_uc002rxb.3_Silent_p.E275E|NRXN1_uc002rxe.3_Silent_p.E603E|NRXN1_uc002rxc.1_RNA	NM_001135659	NP_001129131	P58400	NRX1B_HUMAN	neurexin 1 isoform alpha2 precursor	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					angiogenesis|neuron cell-cell adhesion|neuronal signal transduction	cell surface|endocytic vesicle|integral to membrane|presynaptic membrane	cell adhesion molecule binding|receptor binding			ovary(2)	2		all_hematologic(82;0.152)|Acute lymphoblastic leukemia(82;0.192)	Lung(47;0.0813)|LUSC - Lung squamous cell carcinoma(58;0.116)			GAATCTCACTCTCACCAGGAG	0.502													41	74	---	---	---	---	PASS
TSPYL6	388951	broad.mit.edu	37	2	54483044	54483044	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:54483044C>G	uc002rxr.2	-	1	366	c.245G>C	c.(244-246)GGA>GCA	p.G82A	ACYP2_uc002rxq.3_Intron	NM_001003937	NP_001003937	Q8N831	TSYL6_HUMAN	TSPY-like 6	82					nucleosome assembly	nucleus					0						TTTGATGGCTCCATGACTGCG	0.632													34	71	---	---	---	---	PASS
RPS27A	6233	broad.mit.edu	37	2	55459972	55459972	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:55459972C>T	uc010yow.1	+	2	209	c.12C>T	c.(10-12)TTC>TTT	p.F4F	C2orf63_uc002ryh.2_5'Flank|C2orf63_uc002ryi.2_5'Flank|C2orf63_uc002ryj.2_5'Flank|RPS27A_uc002ryk.2_Silent_p.F4F|RPS27A_uc002ryl.2_RNA|RPS27A_uc002rym.2_RNA	NM_001135592	NP_001129064	P62979	RS27A_HUMAN	ubiquitin and ribosomal protein S27a precursor	4	Ubiquitin-like.				activation of MAPK activity|anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|anti-apoptosis|apoptosis|cellular membrane organization|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA repair|endocrine pancreas development|endosome transport|epidermal growth factor receptor signaling pathway|G1/S transition of mitotic cell cycle|I-kappaB kinase/NF-kappaB cascade|induction of apoptosis by extracellular signals|innate immune response|JNK cascade|M/G1 transition of mitotic cell cycle|mRNA metabolic process|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of epidermal growth factor receptor signaling pathway|negative regulation of type I interferon production|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|nerve growth factor receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of NF-kappaB transcription factor activity|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|S phase of mitotic cell cycle|stress-activated MAPK cascade|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway|translational elongation|translational termination|viral transcription	cytosolic small ribosomal subunit|endocytic vesicle membrane|endosome membrane|nucleoplasm|plasma membrane	metal ion binding|structural constituent of ribosome			ovary(1)	1						TGCAGATTTTCGTGAAAACCC	0.537													11	17	---	---	---	---	PASS
USP34	9736	broad.mit.edu	37	2	61493135	61493135	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61493135C>T	uc002sbe.2	-	42	5623	c.5601G>A	c.(5599-5601)ATG>ATA	p.M1867I	USP34_uc002sbf.2_Missense_Mutation_p.M17I	NM_014709	NP_055524	Q70CQ2	UBP34_HUMAN	ubiquitin specific protease 34	1867					positive regulation of canonical Wnt receptor signaling pathway|protein K48-linked deubiquitination|ubiquitin-dependent protein catabolic process|Wnt receptor signaling pathway		cysteine-type endopeptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(8)|breast(5)|skin(3)|lung(2)|prostate(1)	19			Epithelial(17;0.229)			TGTGTTGTGCCATAACCCAGT	0.368													43	82	---	---	---	---	PASS
NAT8B	51471	broad.mit.edu	37	2	73928060	73928060	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73928060G>C	uc002sjk.1	-	2	408	c.373C>G	c.(373-375)CTG>GTG	p.L125V		NM_016347	NP_057431	Q9UHF3	NAT8B_HUMAN	N-acetyltransferase 8B	125	N-acetyltransferase.				gastrulation with mouth forming second	integral to membrane	N-acetyltransferase activity				0						TCAACGGGCAGAGCTCCTACT	0.542													29	59	---	---	---	---	PASS
C2orf78	388960	broad.mit.edu	37	2	74041326	74041326	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74041326C>G	uc002sjr.1	+	2	941	c.820C>G	c.(820-822)CAA>GAA	p.Q274E		NM_001080474	NP_001073943	A6NCI8	CB078_HUMAN	hypothetical protein LOC388960	274										ovary(2)	2						TGTGTCTTCTCAACCCATCAC	0.463													58	163	---	---	---	---	PASS
REG1B	5968	broad.mit.edu	37	2	79313951	79313951	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:79313951C>A	uc002sny.2	-	3	282	c.170G>T	c.(169-171)TGG>TTG	p.W57L	REG1B_uc010ffv.1_Missense_Mutation_p.W57L|REG1B_uc010ffw.2_Missense_Mutation_p.W57L	NM_006507	NP_006498	P48304	REG1B_HUMAN	regenerating islet-derived 1 beta precursor	57	C-type lectin.				cell proliferation	extracellular region	sugar binding			central_nervous_system(1)|skin(1)	2						TGCATCAACCCAGGTCTCAGG	0.527													59	142	---	---	---	---	PASS
ST3GAL5	8869	broad.mit.edu	37	2	86075024	86075024	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:86075024C>T	uc002sqq.1	-	4	751	c.622G>A	c.(622-624)GAA>AAA	p.E208K	ST3GAL5_uc010fgq.1_Missense_Mutation_p.E80K|ST3GAL5_uc002sqp.1_Missense_Mutation_p.E185K	NM_003896	NP_003887	Q9UNP4	SIAT9_HUMAN	ST3 beta-galactoside alpha-2,3-sialyltransferase	208	Lumenal (Potential).				ganglioside biosynthetic process|protein glycosylation	integral to Golgi membrane|integral to plasma membrane	lactosylceramide alpha-2,3-sialyltransferase activity|neolactotetraosylceramide alpha-2,3-sialyltransferase activity				0						TGGCCCAGTTCTAATCCGTGC	0.408													62	122	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	2	90260072	90260072	+	RNA	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:90260072C>T	uc010fhm.2	+	30		c.4055C>T								Parts of antibodies, mostly variable regions.																		AGCCTGGTATCAGCAAAAACC	0.507													46	137	---	---	---	---	PASS
IL1RL2	8808	broad.mit.edu	37	2	102851514	102851514	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:102851514C>G	uc002tbs.2	+	11	1581	c.1455C>G	c.(1453-1455)CTC>CTG	p.L485L	IL1RL2_uc002tbt.2_Silent_p.L367L	NM_003854	NP_003845	Q9HB29	ILRL2_HUMAN	interleukin 1 receptor-like 2 precursor	485	TIR.|Cytoplasmic (Potential).				cellular defense response|innate immune response	integral to plasma membrane	interleukin-1, Type I, activating receptor activity			ovary(2)	2						AGGTTATTCTCATTGAGCTGG	0.517													44	98	---	---	---	---	PASS
SLC9A4	389015	broad.mit.edu	37	2	103095452	103095452	+	Silent	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:103095452C>A	uc002tbz.3	+	2	868	c.411C>A	c.(409-411)CCC>CCA	p.P137P		NM_001011552	NP_001011552	Q6AI14	SL9A4_HUMAN	solute carrier family 9 (sodium/hydrogen	137	Helical; Name=D/M4; (Potential).				regulation of pH	apical plasma membrane|basolateral plasma membrane|integral to membrane	sodium:hydrogen antiporter activity			skin(2)|central_nervous_system(1)	3						TCCTGCCACCCATCGTTCTGG	0.612													27	86	---	---	---	---	PASS
MARCO	8685	broad.mit.edu	37	2	119751959	119751959	+	Intron	SNP	C	T	T	rs148191210	by1000genomes	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:119751959C>T	uc002tln.1	+						MARCO_uc010yyf.1_Intron	NM_006770	NP_006761	Q9UEW3	MARCO_HUMAN	macrophage receptor with collagenous structure						cell surface receptor linked signaling pathway|innate immune response	collagen|integral to plasma membrane	pattern recognition receptor activity|scavenger receptor activity			ovary(3)|skin(2)|central_nervous_system(1)	6						TTCTCTCTATCAAGGCACTGG	0.547													23	56	---	---	---	---	PASS
CLASP1	23332	broad.mit.edu	37	2	122159197	122159197	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:122159197C>T	uc002tnc.2	-	27	3178	c.2788G>A	c.(2788-2790)GAT>AAT	p.D930N	CLASP1_uc010yyv.1_Missense_Mutation_p.D15N|CLASP1_uc002tmz.2_Missense_Mutation_p.D15N|CLASP1_uc002tna.2_Missense_Mutation_p.D15N|CLASP1_uc010yyw.1_RNA|CLASP1_uc002tnb.2_RNA|CLASP1_uc010yyx.1_RNA|CLASP1_uc010yyy.1_RNA|CLASP1_uc010yyz.1_Missense_Mutation_p.D910N|CLASP1_uc010yza.1_Missense_Mutation_p.D902N|CLASP1_uc010yzb.1_RNA|CLASP1_uc010yzc.1_RNA|CLASP1_uc002tng.1_3'UTR	NM_015282	NP_056097	Q7Z460	CLAP1_HUMAN	CLIP-associating protein 1 isoform 1	930					axon guidance|cell division|establishment or maintenance of cell polarity|exit from mitosis|G2/M transition of mitotic cell cycle|microtubule anchoring|microtubule bundle formation|microtubule nucleation|microtubule organizing center organization|mitotic prometaphase|negative regulation of microtubule depolymerization	centrosomal corona|condensed chromosome kinetochore|cortical microtubule cytoskeleton|cytoplasmic microtubule|cytosol|Golgi apparatus|kinetochore microtubule	kinetochore binding|microtubule plus-end binding			ovary(1)|central_nervous_system(1)	2	Renal(3;0.0496)					TGTAAATCATCCTTATGAATT	0.338													69	154	---	---	---	---	PASS
MYO7B	4648	broad.mit.edu	37	2	128340010	128340010	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128340010C>T	uc002top.2	+	12	1385	c.1332C>T	c.(1330-1332)TTC>TTT	p.F444F		NM_001080527	NP_001073996	Q6PIF6	MYO7B_HUMAN	myosin VIIB	444	Myosin head-like.					apical plasma membrane|myosin complex	actin binding|ATP binding|motor activity			ovary(1)|pancreas(1)	2	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.0753)		TTGAAAATTTCGAGAACAATA	0.522													9	19	---	---	---	---	PASS
ACVR2A	92	broad.mit.edu	37	2	148654036	148654036	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:148654036G>A	uc002twg.2	+	3	491	c.222G>A	c.(220-222)GTG>GTA	p.V74V	ACVR2A_uc010zbn.1_5'UTR|ACVR2A_uc002twh.2_Silent_p.V74V	NM_001616	NP_001607	P27037	AVR2A_HUMAN	activin A receptor, type IIA precursor	74	Extracellular (Potential).				activin receptor signaling pathway|BMP signaling pathway|positive regulation of activin receptor signaling pathway|positive regulation of bone mineralization|positive regulation of erythrocyte differentiation|positive regulation of osteoblast differentiation|positive regulation of protein phosphorylation	cytoplasm|inhibin-betaglycan-ActRII complex|integral to plasma membrane	ATP binding|coreceptor activity|inhibin beta-A binding|metal ion binding|receptor signaling protein serine/threonine kinase activity|transforming growth factor beta receptor activity			stomach(8)|large_intestine(2)|lung(1)|breast(1)|kidney(1)	13				BRCA - Breast invasive adenocarcinoma(221;0.0969)		TTGAAATAGTGAAACAAGGTT	0.378													33	72	---	---	---	---	PASS
DPP4	1803	broad.mit.edu	37	2	162903473	162903473	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:162903473G>A	uc002ubz.2	-	4	798	c.237C>T	c.(235-237)TTC>TTT	p.F79F	DPP4_uc010fpb.2_5'UTR|DPP4_uc002uca.1_RNA|DPP4_uc002ucb.1_RNA	NM_001935	NP_001926	P27487	DPP4_HUMAN	dipeptidylpeptidase IV	79	Extracellular (Potential).				cell adhesion|endothelial cell migration|negative regulation of extracellular matrix disassembly|positive regulation of cell proliferation|proteolysis|regulation of cell-cell adhesion mediated by integrin|response to hypoxia|T cell activation|T cell costimulation	apical plasma membrane|cell surface|endocytic vesicle|extracellular region|integral to membrane|invadopodium membrane|lamellipodium membrane|membrane raft	aminopeptidase activity|dipeptidyl-peptidase activity|protease binding|protein homodimerization activity|receptor activity|receptor binding|serine-type endopeptidase activity			ovary(3)	3					Sitagliptin(DB01261)	ATTCAGCATTGAATACCAAGA	0.294													21	45	---	---	---	---	PASS
XIRP2	129446	broad.mit.edu	37	2	168105466	168105466	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:168105466C>T	uc002udx.2	+	8	7582	c.7564C>T	c.(7564-7566)CAT>TAT	p.H2522Y	XIRP2_uc010fpn.2_Intron|XIRP2_uc010fpo.2_Intron|XIRP2_uc010fpp.2_Intron|XIRP2_uc002udy.2_Missense_Mutation_p.H2347Y|XIRP2_uc010fpq.2_Missense_Mutation_p.H2300Y|XIRP2_uc010fpr.2_Intron|XIRP2_uc010fps.1_Intron	NM_152381	NP_689594	A4UGR9	XIRP2_HUMAN	xin actin-binding repeat containing 2 isoform 1	2347					actin cytoskeleton organization	cell junction	actin binding			skin(7)|ovary(6)|pancreas(1)	14						TATAAAATCTCATTCATTTCC	0.343													36	80	---	---	---	---	PASS
B3GALT1	8708	broad.mit.edu	37	2	168725859	168725859	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:168725859G>A	uc002udz.1	+	2	661	c.310G>A	c.(310-312)GAG>AAG	p.E104K		NM_020981	NP_066191	Q9Y5Z6	B3GT1_HUMAN	UDP-Gal:betaGlcNAc beta	104	Lumenal (Potential).				lipid glycosylation|protein glycosylation	Golgi membrane|integral to membrane	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity			ovary(2)|pancreas(1)|skin(1)	4						GTGGGGGGATGAGAACAACTT	0.458													31	60	---	---	---	---	PASS
NFE2L2	4780	broad.mit.edu	37	2	178098960	178098960	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:178098960C>G	uc002ulh.3	-	2	640	c.85G>C	c.(85-87)GAT>CAT	p.D29H	NFE2L2_uc002ulg.3_Missense_Mutation_p.D13H|NFE2L2_uc010zfa.1_Missense_Mutation_p.D13H|NFE2L2_uc002uli.3_Missense_Mutation_p.D13H|NFE2L2_uc010fra.2_Missense_Mutation_p.D13H|NFE2L2_uc010frb.2_Missense_Mutation_p.D13H	NM_006164	NP_006155	Q16236	NF2L2_HUMAN	nuclear factor erythroid 2-like 2 isoform 1	29					transcription from RNA polymerase II promoter	centrosome|cytosol|nucleus|plasma membrane	protein dimerization activity|protein domain specific binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(1)	1			Epithelial(96;0.00442)|OV - Ovarian serous cystadenocarcinoma(117;0.00739)|all cancers(119;0.0195)|LUSC - Lung squamous cell carcinoma(2;0.036)|Lung(16;0.0935)			ACTCCAAGATCTATATCTTGC	0.363			Mis		NSCLC|HNSCC					HNSCC(56;0.16)			27	37	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179427450	179427450	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179427450G>A	uc010zfg.1	-	275	75929	c.75705C>T	c.(75703-75705)GTC>GTT	p.V25235V	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Silent_p.V18930V|TTN_uc010zfi.1_Silent_p.V18863V|TTN_uc010zfj.1_Silent_p.V18738V	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	26162							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			CTCGTTTTTCGACAATGTAGT	0.363													17	62	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179579852	179579852	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179579852C>T	uc010zfg.1	-	87	22553	c.22329G>A	c.(22327-22329)AAG>AAA	p.K7443K	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Silent_p.K4104K	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	8370							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			TCTTGTACTTCTTGCCGCTCC	0.443													92	235	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179638652	179638652	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179638652C>G	uc010zfg.1	-	31	7467	c.7243G>C	c.(7243-7245)GAA>CAA	p.E2415Q	TTN_uc010zfh.1_Missense_Mutation_p.E2369Q|TTN_uc010zfi.1_Missense_Mutation_p.E2369Q|TTN_uc010zfj.1_Missense_Mutation_p.E2369Q|TTN_uc002unb.2_Missense_Mutation_p.E2415Q	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	2415							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			GTCATGTCTTCAATGAGCAGC	0.478													44	109	---	---	---	---	PASS
NCKAP1	10787	broad.mit.edu	37	2	183826922	183826922	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:183826922C>T	uc002upc.2	-	18	2248	c.1846G>A	c.(1846-1848)GAT>AAT	p.D616N	NCKAP1_uc002upb.2_Missense_Mutation_p.D622N	NM_013436	NP_038464	Q9Y2A7	NCKP1_HUMAN	NCK-associated protein 1 isoform 1	616					apoptosis|central nervous system development	integral to membrane|lamellipodium membrane	protein binding			ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.0942)|Epithelial(96;0.209)			GTGCAAATATCAGTGATGAGA	0.383													29	81	---	---	---	---	PASS
COL3A1	1281	broad.mit.edu	37	2	189868143	189868143	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:189868143C>T	uc002uqj.1	+	37	2677	c.2560C>T	c.(2560-2562)CCT>TCT	p.P854S		NM_000090	NP_000081	P02461	CO3A1_HUMAN	collagen type III alpha 1 preproprotein	854	Triple-helical region.				axon guidance|cell-matrix adhesion|collagen biosynthetic process|collagen fibril organization|fibril organization|heart development|integrin-mediated signaling pathway|negative regulation of immune response|peptide cross-linking|platelet activation|response to cytokine stimulus|response to radiation|skin development|transforming growth factor beta receptor signaling pathway	collagen type III|extracellular space	extracellular matrix structural constituent|integrin binding|platelet-derived growth factor binding			central_nervous_system(7)|ovary(4)|large_intestine(2)	13			OV - Ovarian serous cystadenocarcinoma(117;0.0106)|Epithelial(96;0.141)		Collagenase(DB00048)|Palifermin(DB00039)	ATAGGGTCCTCCTGGTCCCCA	0.383													16	52	---	---	---	---	PASS
WDR75	84128	broad.mit.edu	37	2	190329969	190329969	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:190329969G>A	uc002uql.1	+	12	1338	c.1278G>A	c.(1276-1278)AAG>AAA	p.K426K	WDR75_uc002uqm.1_Silent_p.K362K|WDR75_uc002uqn.1_Silent_p.K204K|WDR75_uc002uqo.1_Silent_p.K204K	NM_032168	NP_115544	Q8IWA0	WDR75_HUMAN	WD repeat domain 75	426						nucleolus				ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(117;0.00105)|Epithelial(96;0.0129)|all cancers(119;0.0456)			TGTATAATAAGAAAACACAAG	0.353													13	36	---	---	---	---	PASS
STAT1	6772	broad.mit.edu	37	2	191848378	191848378	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:191848378G>A	uc002usj.2	-	17	1824	c.1436C>T	c.(1435-1437)GCG>GTG	p.A479V	STAT1_uc010fse.1_Missense_Mutation_p.A479V|STAT1_uc002usk.2_Missense_Mutation_p.A479V|STAT1_uc002usl.2_Missense_Mutation_p.A481V|STAT1_uc010fsf.1_Missense_Mutation_p.A291V	NM_007315	NP_009330	P42224	STAT1_HUMAN	signal transducer and activator of transcription	479					activation of caspase activity|I-kappaB kinase/NF-kappaB cascade|interferon-gamma-mediated signaling pathway|interspecies interaction between organisms|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|response to virus|type I interferon-mediated signaling pathway|tyrosine phosphorylation of STAT protein	cytosol|nucleolus|nucleoplasm	calcium ion binding|protein binding|RNA polymerase II core promoter sequence-specific DNA binding|RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity|signal transducer activity			lung(3)|breast(3)|central_nervous_system(2)|upper_aerodigestive_tract(1)|ovary(1)	10			OV - Ovarian serous cystadenocarcinoma(117;0.00434)|Epithelial(96;0.0555)|all cancers(119;0.141)		Fludarabine(DB01073)	CCTGGGTTCCGCCACCAGCAT	0.557													4	221	---	---	---	---	PASS
HECW2	57520	broad.mit.edu	37	2	197208446	197208446	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197208446C>T	uc002utm.1	-	3	518	c.335G>A	c.(334-336)GGT>GAT	p.G112D	HECW2_uc002utl.1_Translation_Start_Site	NM_020760	NP_065811	Q9P2P5	HECW2_HUMAN	HECT, C2 and WW domain containing E3 ubiquitin	112					protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm	ubiquitin-protein ligase activity			skin(5)|ovary(5)|lung(4)|pancreas(2)|central_nervous_system(1)|kidney(1)	18						TCCAGTCACACCCCTGTTCTT	0.378													73	197	---	---	---	---	PASS
BMPR2	659	broad.mit.edu	37	2	203407068	203407068	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:203407068G>A	uc002uzf.3	+	10	2459	c.1311G>A	c.(1309-1311)CAG>CAA	p.Q437Q	BMPR2_uc010ftr.2_Silent_p.Q437Q	NM_001204	NP_001195	Q13873	BMPR2_HUMAN	bone morphogenetic protein receptor type II	437	Protein kinase.|Cytoplasmic (Potential).				anterior/posterior pattern formation|BMP signaling pathway|cellular response to starvation|lung alveolus development|mesoderm formation|negative regulation of cell growth|negative regulation of systemic arterial blood pressure|negative regulation of vasoconstriction|positive regulation of BMP signaling pathway|positive regulation of bone mineralization|positive regulation of endothelial cell migration|positive regulation of endothelial cell proliferation|positive regulation of epithelial cell migration|positive regulation of osteoblast differentiation|positive regulation of pathway-restricted SMAD protein phosphorylation|regulation of lung blood pressure|transcription from RNA polymerase II promoter|vascular endothelial growth factor receptor signaling pathway	integral to plasma membrane	ATP binding|metal ion binding|transforming growth factor beta receptor activity			ovary(4)|breast(2)|large_intestine(1)|stomach(1)|pancreas(1)	9						TGGCTTTTCAGACAGAGGTTG	0.413													29	72	---	---	---	---	PASS
USP37	57695	broad.mit.edu	37	2	219374828	219374828	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219374828C>A	uc002vie.2	-	11	1352	c.899G>T	c.(898-900)AGA>ATA	p.R300I	USP37_uc010fvs.1_Missense_Mutation_p.R300I|USP37_uc010zkf.1_Missense_Mutation_p.R300I|USP37_uc002vif.2_Missense_Mutation_p.R300I|USP37_uc002vig.2_Missense_Mutation_p.R228I	NM_020935	NP_065986	Q86T82	UBP37_HUMAN	ubiquitin specific peptidase 37	300					ubiquitin-dependent protein catabolic process	nucleus	cysteine-type peptidase activity|ubiquitin thiolesterase activity			skin(3)|ovary(1)|prostate(1)	5		Renal(207;0.0915)		Epithelial(149;1.08e-06)|all cancers(144;0.000197)|LUSC - Lung squamous cell carcinoma(224;0.00375)|Lung(261;0.00487)		TCCCAAACTTCTTTTGGCAGA	0.373													6	146	---	---	---	---	PASS
FANCD2	2177	broad.mit.edu	37	3	10142946	10142946	+	Nonstop_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10142946G>C	uc003bux.1	+	44	4434	c.4356G>C	c.(4354-4356)TAG>TAC	p.*1452Y	FANCD2_uc003buy.1_Nonstop_Mutation_p.*1452Y|FANCD2_uc010hcw.1_RNA|C3orf24_uc003buz.2_Intron	NM_001018115	NP_001018125	Q9BXW9	FACD2_HUMAN	Fanconi anemia complementation group D2 isoform	1452					DNA repair|response to gamma radiation	nucleoplasm	protein binding|protein binding			central_nervous_system(2)|ovary(1)|skin(1)	4				OV - Ovarian serous cystadenocarcinoma(96;0.148)		ACTCTGATTAGACCCCAGATA	0.408			D|Mis|N|F			AML|leukemia		Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia				34	15	---	---	---	---	PASS
PLCL2	23228	broad.mit.edu	37	3	17051428	17051428	+	Missense_Mutation	SNP	G	A	A	rs77416948		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:17051428G>A	uc011awc.1	+	5	671	c.566G>A	c.(565-567)GGA>GAA	p.G189E	PLCL2_uc010het.1_Missense_Mutation_p.G71E|PLCL2_uc011awd.1_Missense_Mutation_p.G71E	NM_001144382	NP_001137854	Q9UPR0	PLCL2_HUMAN	phospholipase C-like 2 isoform 1	197	PH.				intracellular signal transduction|lipid metabolic process	cytoplasm	calcium ion binding|phosphatidylinositol phospholipase C activity|signal transducer activity	p.G71E(1)		skin(2)|ovary(1)|lung(1)	4						GTGAGAACAGGAAAAAACACA	0.418													48	38	---	---	---	---	PASS
ARPP21	10777	broad.mit.edu	37	3	35833939	35833939	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:35833939C>A	uc003cgb.2	+	19	2362	c.2098C>A	c.(2098-2100)CAG>AAG	p.Q700K	ARPP21_uc003cga.2_Missense_Mutation_p.Q681K|ARPP21_uc011axy.1_Missense_Mutation_p.Q701K|ARPP21_uc003cgf.2_Missense_Mutation_p.Q536K|ARPP21_uc003cgg.2_Missense_Mutation_p.Q223K	NM_016300	NP_057384	Q9UBL0	ARP21_HUMAN	cyclic AMP-regulated phosphoprotein, 21 kD	700	Gln-rich.					cytoplasm	nucleic acid binding			ovary(2)|skin(1)	3						GCAGCCACCTCAGAGTCAGAA	0.473													70	52	---	---	---	---	PASS
ATRIP	84126	broad.mit.edu	37	3	48488243	48488243	+	5'UTR	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48488243G>A	uc003ctf.1	+	1					ATRIP_uc011bbj.1_Intron|ATRIP_uc003ctg.1_5'UTR	NM_130384	NP_569055	Q8WXE1	ATRIP_HUMAN	ATR interacting protein isoform 1						DNA damage checkpoint|DNA repair|DNA replication	nucleoplasm	protein binding|protein serine/threonine kinase activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.000293)|KIRC - Kidney renal clear cell carcinoma(197;0.00558)|Kidney(197;0.00632)		TGGGGTGAGCGGAAAGCATGG	0.532								Other_conserved_DNA_damage_response_genes					10	13	---	---	---	---	PASS
ATRIP	84126	broad.mit.edu	37	3	48495739	48495739	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48495739G>C	uc003ctf.1	+	4	624	c.592G>C	c.(592-594)GAG>CAG	p.E198Q	ATRIP_uc011bbj.1_Missense_Mutation_p.E71Q|ATRIP_uc003ctg.1_Missense_Mutation_p.E198Q	NM_130384	NP_569055	Q8WXE1	ATRIP_HUMAN	ATR interacting protein isoform 1	198	Potential.				DNA damage checkpoint|DNA repair|DNA replication	nucleoplasm	protein binding|protein serine/threonine kinase activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.000293)|KIRC - Kidney renal clear cell carcinoma(197;0.00558)|Kidney(197;0.00632)		TAAAGATGCAGAGATGAATGA	0.443								Other_conserved_DNA_damage_response_genes					9	124	---	---	---	---	PASS
RNF123	63891	broad.mit.edu	37	3	49737211	49737211	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49737211C>T	uc003cxh.2	+						RNF123_uc010hky.1_Intron|RNF123_uc003cxi.2_Intron	NM_022064	NP_071347	Q5XPI4	RN123_HUMAN	ring finger protein 123							cytoplasm	ligase activity|protein binding|zinc ion binding			kidney(3)|ovary(1)|lung(1)|breast(1)|skin(1)	7				BRCA - Breast invasive adenocarcinoma(193;4.71e-05)|Kidney(197;0.00227)|KIRC - Kidney renal clear cell carcinoma(197;0.00255)		TTCTGGTGAGCGGCATTGGGA	0.632													5	38	---	---	---	---	PASS
CACNA2D2	9254	broad.mit.edu	37	3	50403997	50403997	+	Intron	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:50403997G>C	uc003daq.2	-						CACNA2D2_uc003dap.2_Intron|CACNA2D2_uc003dao.2_5'Flank	NM_006030	NP_006021	Q9NY47	CA2D2_HUMAN	calcium channel, voltage-dependent, alpha						energy reserve metabolic process|regulation of insulin secretion	integral to membrane|plasma membrane	calcium channel activity|metal ion binding|voltage-gated ion channel activity			lung(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.000365)|KIRC - Kidney renal clear cell carcinoma(197;0.00862)|Kidney(197;0.01)	Gabapentin(DB00996)	GGTAGGTTCAGGGCACACACA	0.597													25	23	---	---	---	---	PASS
VPRBP	9730	broad.mit.edu	37	3	51457372	51457372	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:51457372G>A	uc003dbe.1	-	14	3220	c.3052C>T	c.(3052-3054)CGC>TGC	p.R1018C	VPRBP_uc003dbf.1_Missense_Mutation_p.R294C	NM_014703	NP_055518	Q9Y4B6	VPRBP_HUMAN	HIV-1 Vpr binding protein	1018					interspecies interaction between organisms	cytoplasm|nucleus	protein binding			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(193;0.000272)|Kidney(197;0.000729)|KIRC - Kidney renal clear cell carcinoma(197;0.000875)		TTCTTGCAGCGAGCATGTTGT	0.493													90	82	---	---	---	---	PASS
CACNA1D	776	broad.mit.edu	37	3	53808636	53808636	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:53808636G>A	uc003dgv.3	+	34	4296	c.4133G>A	c.(4132-4134)AGA>AAA	p.R1378K	CACNA1D_uc003dgu.3_Missense_Mutation_p.R1398K|CACNA1D_uc003dgy.3_Missense_Mutation_p.R1363K|CACNA1D_uc003dgw.3_Missense_Mutation_p.R1045K|CACNA1D_uc003dgx.1_Missense_Mutation_p.R554K	NM_001128840	NP_001122312	Q01668	CAC1D_HUMAN	calcium channel, voltage-dependent, L type,	1378	IV.|Extracellular (Potential).				axon guidance|energy reserve metabolic process|regulation of insulin secretion	voltage-gated calcium channel complex	voltage-gated calcium channel activity			ovary(6)|upper_aerodigestive_tract(2)|liver(1)|central_nervous_system(1)|skin(1)	11				BRCA - Breast invasive adenocarcinoma(193;0.00029)|KIRC - Kidney renal clear cell carcinoma(284;0.0145)|Kidney(284;0.0175)|OV - Ovarian serous cystadenocarcinoma(275;0.0613)	Verapamil(DB00661)	GTTGCCATGAGAGATAACAAC	0.448													26	32	---	---	---	---	PASS
OR5H6	79295	broad.mit.edu	37	3	97983234	97983234	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97983234C>T	uc003dsi.1	+	1	106	c.106C>T	c.(106-108)CAA>TAA	p.Q36*		NM_001005479	NP_001005479	Q8NGV6	OR5H6_HUMAN	olfactory receptor, family 5, subfamily H,	36	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|large_intestine(1)	3						ATTTTTACATCAACCTGACTG	0.413													98	324	---	---	---	---	PASS
GPR128	84873	broad.mit.edu	37	3	100413635	100413635	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100413635G>A	uc003duc.2	+	16	2452	c.2184G>A	c.(2182-2184)CAG>CAA	p.Q728Q	GPR128_uc011bhc.1_Silent_p.Q429Q|GPR128_uc003dud.2_Silent_p.Q251Q	NM_032787	NP_116176	Q96K78	GP128_HUMAN	G protein-coupled receptor 128 precursor	728	Cytoplasmic (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)|skin(1)	4						AAGTCTTCCAGAGTGAAGCTT	0.408													14	63	---	---	---	---	PASS
SLC9A10	285335	broad.mit.edu	37	3	111936285	111936285	+	Intron	SNP	T	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111936285T>G	uc003dyu.2	-						SLC9A10_uc011bhu.1_Intron|SLC9A10_uc010hqc.2_Intron	NM_183061	NP_898884	Q4G0N8	S9A10_HUMAN	sperm-specific sodium proton exchanger						cell differentiation|multicellular organismal development|sodium ion transport|spermatogenesis	cilium|flagellar membrane|integral to membrane	solute:hydrogen antiporter activity			ovary(3)|breast(2)	5						TCAAAAGCACTTACTTTGATG	0.274													35	130	---	---	---	---	PASS
BTLA	151888	broad.mit.edu	37	3	112198561	112198561	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:112198561G>A	uc003dza.3	-	2	347	c.144C>T	c.(142-144)ATC>ATT	p.I48I	BTLA_uc003dzb.3_Silent_p.I48I	NM_181780	NP_861445	Q7Z6A9	BTLA_HUMAN	B and T lymphocyte associated isoform 1	48	Ig-like V-type.|Extracellular (Potential).				T cell costimulation		receptor activity				0		Acute lymphoblastic leukemia(4;1.34e-07)|all_hematologic(4;0.000361)				CTCCTGCTAAGATGGAGTGTT	0.368													31	108	---	---	---	---	PASS
LSAMP	4045	broad.mit.edu	37	3	115560717	115560717	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:115560717G>A	uc003ebt.2	-	6	1394	c.894C>T	c.(892-894)GTC>GTT	p.V298V	LSAMP_uc011bis.1_Silent_p.V298V	NM_002338	NP_002329	Q13449	LSAMP_HUMAN	limbic system-associated membrane protein	298	Ig-like C2-type 3.				cell adhesion|nervous system development	anchored to membrane|plasma membrane					0		all_cancers(1;0.00189)|all_epithelial(1;0.0366)|Myeloproliferative disorder(1037;0.17)|all_neural(597;0.208)|Lung NSC(201;0.215)		GBM - Glioblastoma multiforme(114;0.00117)|LUSC - Lung squamous cell carcinoma(41;0.0407)|Lung(219;0.152)		TGGCATTGGTGACCCCCAGCT	0.498													33	141	---	---	---	---	PASS
PARP14	54625	broad.mit.edu	37	3	122439176	122439176	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:122439176G>C	uc003efq.3	+	15	4941	c.4882G>C	c.(4882-4884)GAG>CAG	p.E1628Q	PARP14_uc010hrk.2_RNA|PARP14_uc003efr.2_Missense_Mutation_p.E1345Q|PARP14_uc003efs.1_Missense_Mutation_p.E1345Q	NM_017554	NP_060024	Q460N5	PAR14_HUMAN	poly (ADP-ribose) polymerase family, member 14	1628	PARP catalytic.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus|plasma membrane	NAD+ ADP-ribosyltransferase activity			ovary(2)|breast(2)|lung(1)|pancreas(1)	6				GBM - Glioblastoma multiforme(114;0.0531)		TAGTGATCCTGAGTACAACAC	0.473													12	29	---	---	---	---	PASS
NPHP3	27031	broad.mit.edu	37	3	132407910	132407910	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132407910G>A	uc003epe.1	-						NPHP3_uc003epd.1_Intron	NM_153240	NP_694972	Q7Z494	NPHP3_HUMAN	nephrocystin 3						maintenance of organ identity|negative regulation of canonical Wnt receptor signaling pathway|photoreceptor cell maintenance|regulation of Wnt receptor signaling pathway, planar cell polarity pathway|Wnt receptor signaling pathway	cilium	protein binding			ovary(1)	1						TTGATCTGCTGAGCTTACCTG	0.428													40	129	---	---	---	---	PASS
TRIM42	287015	broad.mit.edu	37	3	140401568	140401568	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:140401568G>C	uc003eto.1	+	2	797	c.606G>C	c.(604-606)AAG>AAC	p.K202N		NM_152616	NP_689829	Q8IWZ5	TRI42_HUMAN	tripartite motif-containing 42	202						intracellular	zinc ion binding			lung(2)|skin(2)|upper_aerodigestive_tract(1)|breast(1)|central_nervous_system(1)	7						ACAGCAACAAGATGCAGCTGC	0.627													59	223	---	---	---	---	PASS
RSRC1	51319	broad.mit.edu	37	3	158015851	158015851	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:158015851G>A	uc003fbt.2	+	5	629	c.518G>A	c.(517-519)GGA>GAA	p.G173E	RSRC1_uc011bou.1_Missense_Mutation_p.G115E|RSRC1_uc003fbu.1_Missense_Mutation_p.G173E|RSRC1_uc003fbv.2_Missense_Mutation_p.G115E	NM_016625	NP_057709	Q96IZ7	RSRC1_HUMAN	arginine/serine-rich coiled-coil 1	173					nucleocytoplasmic transport	cytoplasm|nuclear speck	protein binding				0			Lung(72;0.00416)|LUSC - Lung squamous cell carcinoma(72;0.00575)			ATCAAAGCTGGATTAGAACAT	0.308													63	185	---	---	---	---	PASS
SI	6476	broad.mit.edu	37	3	164710130	164710130	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164710130C>T	uc003fei.2	-	42	4959	c.4897G>A	c.(4897-4899)GCA>ACA	p.A1633T		NM_001041	NP_001032	P14410	SUIS_HUMAN	sucrase-isomaltase	1633	Sucrase.|Lumenal.				carbohydrate metabolic process|polysaccharide digestion	apical plasma membrane|brush border|Golgi apparatus|integral to membrane	carbohydrate binding|oligo-1,6-glucosidase activity|sucrose alpha-glucosidase activity			ovary(7)|upper_aerodigestive_tract(4)|skin(2)|pancreas(1)	14		Prostate(884;0.00314)|Melanoma(1037;0.0153)|all_neural(597;0.0199)			Acarbose(DB00284)	ACCATAAATGCTGGACCCCAT	0.308										HNSCC(35;0.089)			34	122	---	---	---	---	PASS
LRRC31	79782	broad.mit.edu	37	3	169566073	169566073	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169566073C>T	uc003fgc.1	-	8	1239	c.1162G>A	c.(1162-1164)GAA>AAA	p.E388K	LRRC31_uc010hwp.1_Missense_Mutation_p.E332K	NM_024727	NP_079003	Q6UY01	LRC31_HUMAN	leucine rich repeat containing 31	388										ovary(2)|skin(1)	3	all_cancers(22;2.76e-22)|all_epithelial(15;4.73e-27)|all_lung(20;9.24e-17)|Lung NSC(18;3.85e-16)|Ovarian(172;0.000223)|Breast(254;0.197)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.00943)			ACAGAGGCTTCAGCTAAAAGT	0.403													13	45	---	---	---	---	PASS
TNIK	23043	broad.mit.edu	37	3	170858220	170858220	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:170858220C>T	uc003fhh.2	-	13	1645	c.1300G>A	c.(1300-1302)GAG>AAG	p.E434K	TNIK_uc003fhi.2_Missense_Mutation_p.E434K|TNIK_uc003fhj.2_Missense_Mutation_p.E434K|TNIK_uc003fhk.2_Missense_Mutation_p.E434K|TNIK_uc003fhl.2_Missense_Mutation_p.E434K|TNIK_uc003fhm.2_Missense_Mutation_p.E434K|TNIK_uc003fhn.2_Missense_Mutation_p.E434K|TNIK_uc003fho.2_Missense_Mutation_p.E434K	NM_015028	NP_055843	Q9UKE5	TNIK_HUMAN	TRAF2 and NCK interacting kinase isoform 1	434	Mediates interaction with NEDD4.				actin cytoskeleton reorganization|activation of JNKK activity|protein autophosphorylation|regulation of dendrite morphogenesis|Wnt receptor signaling pathway	cytoskeleton|nucleus|recycling endosome	ATP binding|protein binding|protein serine/threonine kinase activity|small GTPase regulator activity			ovary(4)|large_intestine(1)	5	all_cancers(22;2.55e-19)|all_lung(20;2.22e-14)|Ovarian(172;0.00197)|Breast(254;0.122)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)			CTCTCCTCCTCCCGGCGCATC	0.652													74	261	---	---	---	---	PASS
NAALADL2	254827	broad.mit.edu	37	3	174814830	174814830	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:174814830G>C	uc003fit.2	+	2	381	c.294G>C	c.(292-294)CAG>CAC	p.Q98H	NAALADL2_uc003fiu.1_Missense_Mutation_p.Q91H	NM_207015	NP_996898	Q58DX5	NADL2_HUMAN	N-acetylated alpha-linked acidic dipeptidase 2	98	Cytoplasmic (Potential).				proteolysis	integral to membrane	peptidase activity			pancreas(1)	1	Ovarian(172;0.0102)	all_cancers(1;0.0272)|all_epithelial(1;0.0553)	OV - Ovarian serous cystadenocarcinoma(80;9.26e-28)	Colorectal(1;1.66e-10)|COAD - Colon adenocarcinoma(1;2.1e-07)|STAD - Stomach adenocarcinoma(1;0.00261)|READ - Rectum adenocarcinoma(3;0.0284)		GAAGGTTCCAGAGACTTCAAG	0.433													23	67	---	---	---	---	PASS
SOX2	6657	broad.mit.edu	37	3	181430620	181430620	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:181430620G>A	uc003fkx.2	+	1	899	c.472G>A	c.(472-474)GAC>AAC	p.D158N	SOX2OT_uc003fkv.2_Intron|SOX2OT_uc003fkw.3_Intron	NM_003106	NP_003097	P48431	SOX2_HUMAN	sex-determining region Y-box 2	158					cell cycle arrest|chromatin organization|eye development|glial cell fate commitment|inner ear development|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of epithelial cell proliferation|negative regulation of neuron differentiation|osteoblast differentiation|pituitary gland development|positive regulation of MAPKKK cascade|positive regulation of transcription from RNA polymerase II promoter|regulation of caspase activity|response to growth factor stimulus|response to wounding|somatic stem cell maintenance	cytosol|transcription factor complex	miRNA binding|protein binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding				0	all_cancers(143;1.22e-16)|Ovarian(172;0.0283)		all cancers(12;1.82e-48)|Epithelial(37;9.85e-40)|OV - Ovarian serous cystadenocarcinoma(80;7.37e-23)|Lung(8;2.01e-21)|GBM - Glioblastoma multiforme(1;2.13e-08)			CCAGCGCATGGACAGTTACGC	0.716			A		NSCLC|oesophageal squamous carcinoma		MICROPHTHALMIA AND ESOPHAGEAL ATRESIA SYNDROME						4	11	---	---	---	---	PASS
LEPREL1	55214	broad.mit.edu	37	3	189711934	189711934	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:189711934C>G	uc011bsk.1	-	3	1160	c.772G>C	c.(772-774)GAA>CAA	p.E258Q	LEPREL1_uc003fsg.2_Missense_Mutation_p.E77Q	NM_018192	NP_060662	Q8IVL5	P3H2_HUMAN	leprecan-like 1 isoform a	258					collagen metabolic process|negative regulation of cell proliferation|peptidyl-proline hydroxylation	basement membrane|endoplasmic reticulum|Golgi apparatus	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|procollagen-proline 3-dioxygenase activity			breast(3)|ovary(1)	4	all_cancers(143;4.01e-10)|Ovarian(172;0.0925)		Lung(62;4.35e-05)	GBM - Glioblastoma multiforme(93;0.02)	L-Proline(DB00172)|Succinic acid(DB00139)|Vitamin C(DB00126)	TCATATTCTTCAAATCTCTGA	0.343													37	107	---	---	---	---	PASS
PAK2	5062	broad.mit.edu	37	3	196532222	196532222	+	Splice_Site	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196532222G>A	uc003fwy.3	+	5	759	c.437_splice	c.e5-1	p.E146_splice		NM_002577	NP_002568	Q13177	PAK2_HUMAN	p21-activated kinase 2						axon guidance|cellular component disassembly involved in apoptosis|interspecies interaction between organisms|negative regulation of protein kinase activity|peptidyl-serine phosphorylation|positive regulation of peptidyl-tyrosine phosphorylation|protein autophosphorylation|regulation of apoptosis|regulation of defense response to virus by virus|regulation of growth|T cell costimulation|T cell receptor signaling pathway|viral reproduction	cytosol|nucleus|perinuclear region of cytoplasm|plasma membrane	ATP binding|identical protein binding|protein kinase binding|protein serine/threonine kinase activity|protein tyrosine kinase activator activity			ovary(1)|lung(1)	2	all_cancers(143;1.8e-08)|Ovarian(172;0.0634)|Breast(254;0.135)		Epithelial(36;1.07e-23)|all cancers(36;6.38e-22)|OV - Ovarian serous cystadenocarcinoma(49;1.5e-18)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.00405)		TTCATATTCAGAGAAAGATGG	0.294													22	101	---	---	---	---	PASS
SORCS2	57537	broad.mit.edu	37	4	7725534	7725534	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:7725534C>T	uc003gkb.3	+	19	2535	c.2535C>T	c.(2533-2535)CCC>CCT	p.P845P	SORCS2_uc011bwi.1_Silent_p.P673P	NM_020777	NP_065828	Q96PQ0	SORC2_HUMAN	VPS10 domain receptor protein SORCS 2 precursor	845	PKD.|Lumenal (Potential).					integral to membrane	neuropeptide receptor activity			ovary(1)|central_nervous_system(1)	2						ACGAGAGCCCCGGCATCTACC	0.542													58	93	---	---	---	---	PASS
BOD1L	259282	broad.mit.edu	37	4	13602587	13602587	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:13602587C>T	uc003gmz.1	-	10	6054	c.5937G>A	c.(5935-5937)ATG>ATA	p.M1979I	BOD1L_uc010idr.1_Missense_Mutation_p.M1316I	NM_148894	NP_683692	Q8NFC6	BOD1L_HUMAN	biorientation of chromosomes in cell division	1979							DNA binding			ovary(5)|breast(1)	6						CAGCACTAGTCATAGGACCCT	0.478													28	53	---	---	---	---	PASS
BOD1L	259282	broad.mit.edu	37	4	13603815	13603815	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:13603815C>T	uc003gmz.1	-	10	4826	c.4709G>A	c.(4708-4710)AGA>AAA	p.R1570K	BOD1L_uc010idr.1_Missense_Mutation_p.R907K	NM_148894	NP_683692	Q8NFC6	BOD1L_HUMAN	biorientation of chromosomes in cell division	1570							DNA binding			ovary(5)|breast(1)	6						AGGATTATTTCTGGAATGTGT	0.473													11	19	---	---	---	---	PASS
NCAPG	64151	broad.mit.edu	37	4	17839398	17839398	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:17839398C>T	uc003gpp.2	+	16	2616	c.2440C>T	c.(2440-2442)CAG>TAG	p.Q814*	NCAPG_uc011bxj.1_Nonsense_Mutation_p.Q323*	NM_022346	NP_071741	Q9BPX3	CND3_HUMAN	chromosome condensation protein G	814					cell division|mitotic chromosome condensation	condensin complex|cytoplasm|nucleus	protein binding			large_intestine(1)	1				STAD - Stomach adenocarcinoma(129;0.18)		ATTAAATCCTCAGGCCAAGAC	0.408													66	149	---	---	---	---	PASS
SLIT2	9353	broad.mit.edu	37	4	20530646	20530646	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:20530646G>A	uc003gpr.1	+	16	1741	c.1537G>A	c.(1537-1539)GAA>AAA	p.E513K	SLIT2_uc003gps.1_Missense_Mutation_p.E505K	NM_004787	NP_004778	O94813	SLIT2_HUMAN	slit homolog 2 precursor	513	LRRNT 3.				apoptosis involved in luteolysis|axon extension involved in axon guidance|branching morphogenesis of a tube|cell migration involved in sprouting angiogenesis|cellular response to heparin|cellular response to hormone stimulus|chemorepulsion involved in postnatal olfactory bulb interneuron migration|corticospinal neuron axon guidance through spinal cord|induction of negative chemotaxis|motor axon guidance|negative regulation of actin filament polymerization|negative regulation of cell growth|negative regulation of cellular response to growth factor stimulus|negative regulation of chemokine-mediated signaling pathway|negative regulation of endothelial cell migration|negative regulation of lamellipodium assembly|negative regulation of mononuclear cell migration|negative regulation of neutrophil chemotaxis|negative regulation of protein phosphorylation|negative regulation of retinal ganglion cell axon guidance|negative regulation of small GTPase mediated signal transduction|negative regulation of smooth muscle cell chemotaxis|negative regulation of vascular permeability|positive regulation of apoptosis|positive regulation of axonogenesis|response to cortisol stimulus|retinal ganglion cell axon guidance|Roundabout signaling pathway|ureteric bud development	cell surface|cytoplasm|extracellular space|plasma membrane	calcium ion binding|GTPase inhibitor activity|heparin binding|laminin-1 binding|protein homodimerization activity|proteoglycan binding|Roundabout binding			central_nervous_system(4)|skin(4)|ovary(3)	11						GTGTCGCTGTGAAGGAACCAC	0.413													51	103	---	---	---	---	PASS
UGDH	7358	broad.mit.edu	37	4	39507311	39507311	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:39507311G>A	uc003guk.1	-	8	1280	c.964C>T	c.(964-966)CTG>TTG	p.L322L	UGDH_uc011byp.1_Silent_p.L225L|UGDH_uc003gul.1_Silent_p.L255L	NM_003359	NP_003350	O60701	UGDH_HUMAN	UDP-glucose dehydrogenase	322					glycosaminoglycan biosynthetic process|UDP-glucose metabolic process|UDP-glucuronate biosynthetic process|xenobiotic metabolic process	cytosol	electron carrier activity|NAD binding|UDP-glucose 6-dehydrogenase activity			large_intestine(1)|ovary(1)|central_nervous_system(1)|skin(1)	4					NADH(DB00157)	GTATTAAACAGACTATCTATG	0.348													43	127	---	---	---	---	PASS
UGDH	7358	broad.mit.edu	37	4	39507371	39507371	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:39507371G>A	uc003guk.1	-						UGDH_uc011byp.1_Intron|UGDH_uc003gul.1_Intron	NM_003359	NP_003350	O60701	UGDH_HUMAN	UDP-glucose dehydrogenase						glycosaminoglycan biosynthetic process|UDP-glucose metabolic process|UDP-glucuronate biosynthetic process|xenobiotic metabolic process	cytosol	electron carrier activity|NAD binding|UDP-glucose 6-dehydrogenase activity			large_intestine(1)|ovary(1)|central_nervous_system(1)|skin(1)	4					NADH(DB00157)	TCTATGACCTGAAATTACATG	0.363													40	86	---	---	---	---	PASS
CORIN	10699	broad.mit.edu	37	4	47746544	47746544	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47746544G>A	uc003gxm.2	-	5	767	c.674C>T	c.(673-675)TCA>TTA	p.S225L	CORIN_uc011bzf.1_Missense_Mutation_p.S86L|CORIN_uc011bzg.1_Missense_Mutation_p.S158L|CORIN_uc011bzh.1_Missense_Mutation_p.S225L|CORIN_uc011bzi.1_Missense_Mutation_p.S225L|CORIN_uc003gxn.3_Missense_Mutation_p.S225L	NM_006587	NP_006578	Q9Y5Q5	CORIN_HUMAN	corin	225	Extracellular (Potential).|FZ 1.				peptide hormone processing|regulation of systemic arterial blood pressure by atrial natriuretic peptide	integral to membrane|plasma membrane	scavenger receptor activity|serine-type endopeptidase activity|serine-type exopeptidase activity			ovary(1)|central_nervous_system(1)	2						CCCCAGGACTGATTCACAGCC	0.438													83	193	---	---	---	---	PASS
SLC4A4	8671	broad.mit.edu	37	4	72413402	72413402	+	Missense_Mutation	SNP	A	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:72413402A>T	uc003hfy.2	+	20	2776	c.2659A>T	c.(2659-2661)ACT>TCT	p.T887S	SLC4A4_uc010iic.2_Missense_Mutation_p.T887S|SLC4A4_uc010iib.2_Intron|SLC4A4_uc003hfz.2_Missense_Mutation_p.T887S|SLC4A4_uc003hgc.3_Missense_Mutation_p.T843S|SLC4A4_uc010iid.2_Missense_Mutation_p.T91S	NM_001098484	NP_001091954	Q9Y6R1	S4A4_HUMAN	solute carrier family 4, sodium bicarbonate	887	Helical; (Potential).					basolateral plasma membrane|integral to plasma membrane	inorganic anion exchanger activity|protein binding|sodium:bicarbonate symporter activity			ovary(3)|kidney(1)|skin(1)	5			Lung(101;0.0739)|LUSC - Lung squamous cell carcinoma(112;0.225)			GTTTATTCTGACTGGTCTGTC	0.383													24	161	---	---	---	---	PASS
ADAMTS3	9508	broad.mit.edu	37	4	73156718	73156718	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73156718G>A	uc003hgk.1	-	20	2822	c.2785C>T	c.(2785-2787)CGC>TGC	p.R929C		NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	929	TSP type-1 3.				collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)			CGTACAGTGCGAAGCTGATAG	0.542													31	58	---	---	---	---	PASS
BTC	685	broad.mit.edu	37	4	75675896	75675896	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:75675896C>G	uc003hig.2	-	4	662	c.315G>C	c.(313-315)GAG>GAC	p.E105D		NM_001729	NP_001720	P35070	BTC_HUMAN	betacellulin precursor	105	Extracellular (Potential).|EGF-like.				positive regulation of cell division|positive regulation of cell proliferation	extracellular space|integral to membrane|plasma membrane|soluble fraction	epidermal growth factor receptor binding|growth factor activity			central_nervous_system(1)|skin(1)	2			Lung(101;0.219)			AGTCAACTCTCTCACACCTTG	0.383													70	163	---	---	---	---	PASS
ENOPH1	58478	broad.mit.edu	37	4	83351996	83351996	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:83351996C>T	uc003hmv.2	+	1	271	c.14C>T	c.(13-15)TCG>TTG	p.S5L	ENOPH1_uc003hmw.2_5'UTR|ENOPH1_uc003hmx.2_5'UTR|HNRPDL_uc003hmq.2_5'Flank|HNRPDL_uc003hmr.2_5'Flank|HNRPDL_uc003hms.2_5'Flank|HNRPDL_uc003hmt.2_5'Flank	NM_021204	NP_067027	Q9UHY7	ENOPH_HUMAN	enolase-phosphatase 1	5					L-methionine salvage from methylthioadenosine	cytoplasm|nucleus	2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity|2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity|acireductone synthase activity|magnesium ion binding|phosphoglycolate phosphatase activity				0						GTCGTGCTTTCGGTCCCCGCC	0.647													5	48	---	---	---	---	PASS
PTPN13	5783	broad.mit.edu	37	4	87643569	87643569	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:87643569G>C	uc003hpz.2	+	10	2070	c.1590G>C	c.(1588-1590)ATG>ATC	p.M530I	PTPN13_uc003hpy.2_Missense_Mutation_p.M530I|PTPN13_uc003hqa.2_Missense_Mutation_p.M530I|PTPN13_uc003hqb.2_Missense_Mutation_p.M530I	NM_080683	NP_542414	Q12923	PTN13_HUMAN	protein tyrosine phosphatase, non-receptor type	530						cytoplasm|cytoskeleton|plasma membrane	protein binding|protein binding|protein tyrosine phosphatase activity			ovary(4)|breast(1)|kidney(1)	6		Hepatocellular(203;0.114)|all_hematologic(202;0.21)|Acute lymphoblastic leukemia(40;0.242)		OV - Ovarian serous cystadenocarcinoma(123;0.00082)		AAACAGCCATGACTCAAAGAA	0.438													43	88	---	---	---	---	PASS
MEPE	56955	broad.mit.edu	37	4	88766894	88766894	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:88766894G>A	uc003hqy.2	+	4	913	c.874G>A	c.(874-876)GAG>AAG	p.E292K	MEPE_uc010ikn.2_Missense_Mutation_p.E179K	NM_020203	NP_064588	Q9NQ76	MEPE_HUMAN	matrix, extracellular phosphoglycoprotein with	292					skeletal system development	proteinaceous extracellular matrix	extracellular matrix structural constituent|protein binding			ovary(1)|lung(1)|skin(1)	3		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;0.000432)		AAGTGAAGCTGAGAGTACTCA	0.443													28	54	---	---	---	---	PASS
NHEDC2	133308	broad.mit.edu	37	4	103979062	103979062	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:103979062C>T	uc003hwx.3	-	4	1210	c.338G>A	c.(337-339)GGA>GAA	p.G113E	NHEDC2_uc010iln.1_5'UTR|NHEDC2_uc003hwy.2_Missense_Mutation_p.G113E|NHEDC2_uc011cew.1_Intron|NHEDC2_uc011cex.1_Intron|NHEDC2_uc011cey.1_Intron	NM_178833	NP_849155	Q86UD5	NHDC2_HUMAN	Na+/H+ exchanger domain containing 2	113					sodium ion transport	integral to membrane|mitochondrial membrane	solute:hydrogen antiporter activity				0				OV - Ovarian serous cystadenocarcinoma(123;2.3e-08)		AAATAGGTTTCCTCCAGGAAG	0.383													61	122	---	---	---	---	PASS
ELOVL6	79071	broad.mit.edu	37	4	111119453	111119453	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:111119453G>A	uc003hzz.2	-	2	165	c.39C>T	c.(37-39)TTC>TTT	p.F13F	ELOVL6_uc003iaa.2_Silent_p.F13F	NM_001130721	NP_001124193	Q9H5J4	ELOV6_HUMAN	elongation of very long chain fatty acids-like	13					fatty acid elongation, saturated fatty acid|long-chain fatty acid biosynthetic process|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process		fatty acid elongase activity|protein binding			haematopoietic_and_lymphoid_tissue(1)	1				OV - Ovarian serous cystadenocarcinoma(123;0.00462)		ACTGCTTTTCGAATTCATATT	0.448													23	179	---	---	---	---	PASS
KIAA1109	84162	broad.mit.edu	37	4	123145798	123145798	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:123145798C>A	uc003ieh.2	+	21	2804	c.2759C>A	c.(2758-2760)GCT>GAT	p.A920D	KIAA1109_uc003iei.1_Missense_Mutation_p.A673D|KIAA1109_uc010ins.1_Missense_Mutation_p.A263D|KIAA1109_uc003iej.1_Missense_Mutation_p.A305D	NM_015312	NP_056127	Q2LD37	K1109_HUMAN	fragile site-associated protein	920					regulation of cell growth|regulation of epithelial cell differentiation	integral to membrane|nucleus				ovary(8)|skin(2)|pancreas(1)|central_nervous_system(1)	12						GATGTGCAGGCTGGAAGTCTT	0.453													32	55	---	---	---	---	PASS
BBS12	166379	broad.mit.edu	37	4	123663127	123663127	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:123663127G>C	uc003ieu.2	+	2	273	c.80G>C	c.(79-81)AGA>ACA	p.R27T		NM_152618	NP_689831	Q6ZW61	BBS12_HUMAN	Bardet-Biedl syndrome 12	27					cellular protein metabolic process	cilium	ATP binding			ovary(2)	2						GAAACAGGAAGAACTTTCCTA	0.368									Bardet-Biedl_syndrome				31	53	---	---	---	---	PASS
EDNRA	1909	broad.mit.edu	37	4	148407187	148407187	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:148407187G>A	uc003iky.2	+	2	1046	c.354G>A	c.(352-354)CTG>CTA	p.L118L	EDNRA_uc011cid.1_Intron|EDNRA_uc010ipe.1_Silent_p.L118L|EDNRA_uc010ipf.1_RNA|EDNRA_uc010ipg.1_Silent_p.L118L	NM_001957	NP_001948	P25101	EDNRA_HUMAN	endothelin receptor type A isoform a precursor	118	Helical; Name=2; (Potential).				activation of adenylate cyclase activity|artery smooth muscle contraction|cell proliferation|glucose transport|respiratory gaseous exchange	integral to plasma membrane	endothelin-A receptor activity|phosphatidylinositol phospholipase C activity			ovary(1)|breast(1)	2	all_hematologic(180;0.151)			GBM - Glioblastoma multiforme(119;0.154)	Bosentan(DB00559)	CCAACGCGCTGATAGCCAGTC	0.413													58	141	---	---	---	---	PASS
LRBA	987	broad.mit.edu	37	4	151752977	151752977	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:151752977G>A	uc010ipj.2	-	29	5195	c.4721C>T	c.(4720-4722)TCA>TTA	p.S1574L	LRBA_uc003ilt.3_Missense_Mutation_p.S233L|LRBA_uc003ilu.3_Missense_Mutation_p.S1574L	NM_006726	NP_006717	P50851	LRBA_HUMAN	LPS-responsive vesicle trafficking, beach and	1574						endoplasmic reticulum|Golgi apparatus|integral to membrane|lysosome|plasma membrane	protein binding			ovary(3)|breast(3)|skin(1)	7	all_hematologic(180;0.151)					ACCAGAGAGTGATACATTCTC	0.338													38	85	---	---	---	---	PASS
DCHS2	54798	broad.mit.edu	37	4	155157687	155157687	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:155157687G>C	uc003inw.2	-	25	6752	c.6752C>G	c.(6751-6753)TCT>TGT	p.S2251C		NM_017639	NP_060109	Q6V1P9	PCD23_HUMAN	dachsous 2 isoform 1	2251	Cadherin 20.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|pancreas(1)	4	all_hematologic(180;0.208)	Renal(120;0.0854)		LUSC - Lung squamous cell carcinoma(193;0.107)		CTCATTTCCAGAGATGATGTT	0.393													63	83	---	---	---	---	PASS
CTSO	1519	broad.mit.edu	37	4	156850795	156850795	+	Missense_Mutation	SNP	T	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:156850795T>A	uc003ipg.2	-	6	786	c.737A>T	c.(736-738)GAT>GTT	p.D246V		NM_001334	NP_001325	P43234	CATO_HUMAN	cathepsin O preproprotein	246					proteolysis	lysosome	cysteine-type endopeptidase activity				0	all_hematologic(180;0.24)	Renal(120;0.0458)		KIRC - Kidney renal clear cell carcinoma(143;0.05)|Kidney(143;0.0627)|COAD - Colon adenocarcinoma(41;0.148)		GCTCACTGCATCTACTATGAC	0.393													36	103	---	---	---	---	PASS
SPATA4	132851	broad.mit.edu	37	4	177113837	177113837	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:177113837G>A	uc003iuo.1	-	4	738	c.629C>T	c.(628-630)GCG>GTG	p.A210V		NM_144644	NP_653245	Q8NEY3	SPAT4_HUMAN	spermatogenesis associated 4	210					apoptosis|spermatogenesis						0		Breast(14;0.0011)|Prostate(90;0.0129)|Melanoma(52;0.0133)|Renal(120;0.0376)|all_hematologic(60;0.124)		all cancers(43;2.9e-20)|Epithelial(43;1.99e-17)|OV - Ovarian serous cystadenocarcinoma(60;2.58e-09)|GBM - Glioblastoma multiforme(59;0.000162)|STAD - Stomach adenocarcinoma(60;0.000543)|LUSC - Lung squamous cell carcinoma(193;0.096)		GAGGAACTCCGCTTTAAGTTC	0.378													55	59	---	---	---	---	PASS
CLDN22	53842	broad.mit.edu	37	4	184240979	184240979	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:184240979G>A	uc010isa.1	-	1	949	c.393C>T	c.(391-393)GTC>GTT	p.V131V	WWC2_uc010irx.2_3'UTR|WWC2_uc003ivk.3_3'UTR|WWC2_uc003ivl.3_RNA|WWC2_uc010iry.2_3'UTR|WWC2_uc003ivn.3_3'UTR|WWC2_uc010irz.2_3'UTR|WWC2_uc003ivo.3_3'UTR	NM_001111319	NP_001104789	Q8N7P3	CLD22_HUMAN	claudin 22	131	Helical; (Potential).				calcium-independent cell-cell adhesion|tight junction assembly	integral to membrane|tight junction	identical protein binding|structural molecule activity				0		all_lung(41;6.9e-12)|Lung NSC(41;1.28e-11)|Colorectal(36;0.0172)|Renal(120;0.0246)|Hepatocellular(41;0.0268)|Prostate(90;0.0283)|all_hematologic(60;0.0749)|Esophageal squamous(56;0.176)		all cancers(43;4.1e-26)|Epithelial(43;6.45e-22)|OV - Ovarian serous cystadenocarcinoma(60;7.64e-10)|Colorectal(24;5.87e-06)|GBM - Glioblastoma multiforme(59;6.5e-06)|STAD - Stomach adenocarcinoma(60;2.09e-05)|COAD - Colon adenocarcinoma(29;5.15e-05)|LUSC - Lung squamous cell carcinoma(40;0.00902)|READ - Rectum adenocarcinoma(43;0.155)		CCAGGGCTGTGACTCCCGAGG	0.572													69	43	---	---	---	---	PASS
ACSL1	2180	broad.mit.edu	37	4	185683650	185683650	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:185683650G>A	uc003iww.2	-	17	1843	c.1549C>T	c.(1549-1551)CAG>TAG	p.Q517*	ACSL1_uc011ckm.1_Nonsense_Mutation_p.Q346*|ACSL1_uc003iwt.1_Nonsense_Mutation_p.Q517*|ACSL1_uc003iwu.1_Nonsense_Mutation_p.Q517*|ACSL1_uc011ckn.1_Nonsense_Mutation_p.Q483*|ACSL1_uc003iws.1_Intron	NM_001995	NP_001986	P33121	ACSL1_HUMAN	acyl-CoA synthetase long-chain family member 1	517	Cytoplasmic (Potential).				digestion|fatty acid metabolic process|long-chain fatty-acyl-CoA biosynthetic process|regulation of fatty acid oxidation|triglyceride biosynthetic process	endoplasmic reticulum membrane|integral to membrane|microsome|mitochondrial outer membrane|peroxisomal membrane	ATP binding|long-chain fatty acid-CoA ligase activity			ovary(2)	2		all_lung(41;7.57e-14)|Lung NSC(41;1.81e-13)|Colorectal(36;0.00172)|Hepatocellular(41;0.00826)|Renal(120;0.00988)|Prostate(90;0.0235)|all_hematologic(60;0.0315)|all_neural(102;0.107)|Medulloblastoma(177;0.146)		all cancers(43;1.33e-28)|Epithelial(43;5.3e-25)|OV - Ovarian serous cystadenocarcinoma(60;4.88e-11)|Colorectal(24;3.59e-06)|STAD - Stomach adenocarcinoma(60;2.72e-05)|GBM - Glioblastoma multiforme(59;2.83e-05)|BRCA - Breast invasive adenocarcinoma(30;7.66e-05)|COAD - Colon adenocarcinoma(29;0.000538)|LUSC - Lung squamous cell carcinoma(40;0.008)|READ - Rectum adenocarcinoma(43;0.0419)	Adenosine monophosphate(DB00131)|Adenosine triphosphate(DB00171)	AAGTAGCCCTGAAATACATTT	0.453													66	62	---	---	---	---	PASS
CDH10	1008	broad.mit.edu	37	5	24509805	24509805	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:24509805C>T	uc003jgr.1	-	7	1458	c.1126G>A	c.(1126-1128)GAA>AAA	p.E376K	CDH10_uc011cnu.1_RNA	NM_006727	NP_006718	Q9Y6N8	CAD10_HUMAN	cadherin 10, type 2 preproprotein	376	Cadherin 3.|Extracellular (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|pancreas(4)|breast(2)	12				STAD - Stomach adenocarcinoma(35;0.0556)		TCCACATCTTCTATAGAGATT	0.378										HNSCC(23;0.051)			29	28	---	---	---	---	PASS
PDZD2	23037	broad.mit.edu	37	5	32088583	32088583	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:32088583G>A	uc003jhl.2	+	20	5417	c.5029G>A	c.(5029-5031)GAA>AAA	p.E1677K	PDZD2_uc003jhm.2_Missense_Mutation_p.E1677K	NM_178140	NP_835260	O15018	PDZD2_HUMAN	PDZ domain containing 2	1677					cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9						TCAGGAGCATGAAACTCATGC	0.552													78	99	---	---	---	---	PASS
UGT3A2	167127	broad.mit.edu	37	5	36038116	36038116	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:36038116G>A	uc003jjz.1	-	6	1171	c.1078C>T	c.(1078-1080)CAC>TAC	p.H360Y	UGT3A2_uc011cos.1_Missense_Mutation_p.H326Y|UGT3A2_uc011cot.1_Missense_Mutation_p.H58Y	NM_174914	NP_777574	Q3SY77	UD3A2_HUMAN	UDP glycosyltransferase 3 family, polypeptide A2	360	Extracellular (Potential).					integral to membrane	glucuronosyltransferase activity			ovary(2)|skin(2)|large_intestine(1)|pancreas(1)	6	all_lung(31;0.000179)		Lung(74;0.111)|Epithelial(62;0.113)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			ATGCTTGGGTGAGCTGTTGTA	0.498													40	51	---	---	---	---	PASS
MRPS30	10884	broad.mit.edu	37	5	44813303	44813303	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:44813303G>A	uc003joh.2	+	4	987	c.949G>A	c.(949-951)GCT>ACT	p.A317T		NM_016640	NP_057724	Q9NP92	RT30_HUMAN	mitochondrial ribosomal protein S30	317					apoptosis|translation	mitochondrion|ribosome	structural constituent of ribosome				0	Lung NSC(6;8.08e-07)					ACAAAACTGTGCTGATCAGAT	0.383													43	47	---	---	---	---	PASS
MAST4	375449	broad.mit.edu	37	5	66445421	66445421	+	Intron	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:66445421G>C	uc003jut.1	+						MAST4_uc003juw.2_Intron	NM_015183	NP_055998	O15021	MAST4_HUMAN	microtubule associated serine/threonine kinase							cytoplasm	ATP binding|magnesium ion binding|protein serine/threonine kinase activity			lung(6)|ovary(2)|kidney(2)|breast(2)|central_nervous_system(1)	13		Lung NSC(167;8.56e-06)|Prostate(74;0.00637)|Ovarian(174;0.0563)|Breast(144;0.0586)|Colorectal(97;0.245)		Lung(70;0.011)		CCAGGAGGTAGAGAGATACTA	0.458													12	5	---	---	---	---	PASS
CMYA5	202333	broad.mit.edu	37	5	79025923	79025923	+	Silent	SNP	A	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79025923A>G	uc003kgc.2	+	2	1407	c.1335A>G	c.(1333-1335)GCA>GCG	p.A445A		NM_153610	NP_705838	Q8N3K9	CMYA5_HUMAN	cardiomyopathy associated 5	445				A -> V (in Ref. 2; CAH10406).		perinuclear region of cytoplasm				ovary(6)|pancreas(2)|lung(1)	9		Lung NSC(167;0.00296)|all_lung(232;0.00327)|Ovarian(174;0.0262)		OV - Ovarian serous cystadenocarcinoma(54;9.85e-46)|Epithelial(54;3.38e-40)|all cancers(79;3.43e-35)		GTCTGGCAGCATCTACCCAGG	0.507													49	46	---	---	---	---	PASS
RASA1	5921	broad.mit.edu	37	5	86564633	86564633	+	Nonsense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:86564633C>A	uc003kiw.2	+	1	483	c.365C>A	c.(364-366)TCG>TAG	p.S122*	RASA1_uc010jav.2_RNA|RASA1_uc003kix.2_5'Flank|RASA1_uc011ctv.1_5'Flank|RASA1_uc011ctw.1_5'Flank|RASA1_uc010jaw.2_5'Flank|RASA1_uc011ctu.1_Nonsense_Mutation_p.S122*	NM_002890	NP_002881	P20936	RASA1_HUMAN	RAS p21 protein activator 1 isoform 1	122					cytokinesis|embryo development|intracellular signal transduction|negative regulation of cell-matrix adhesion|negative regulation of neuron apoptosis|negative regulation of Ras protein signal transduction|positive regulation of anti-apoptosis|regulation of actin filament polymerization|regulation of cell shape|regulation of RNA metabolic process|vasculogenesis	cytosol|intrinsic to internal side of plasma membrane	glycoprotein binding|GTPase binding|potassium channel inhibitor activity|Ras GTPase activator activity|receptor binding			upper_aerodigestive_tract(3)|ovary(1)|lung(1)	5		all_cancers(142;8.25e-07)|Lung NSC(167;0.000185)|all_lung(232;0.000222)|Colorectal(57;0.00542)|Ovarian(174;0.0423)		OV - Ovarian serous cystadenocarcinoma(54;4.72e-41)|Epithelial(54;1.51e-36)|all cancers(79;3.76e-31)		CTGCCCACTTCGTTGCTTGCT	0.473													38	19	---	---	---	---	PASS
PCDHA13	56136	broad.mit.edu	37	5	140263386	140263386	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140263386C>T	uc003lif.2	+	1	1533	c.1533C>T	c.(1531-1533)CAC>CAT	p.H511H	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Intron|PCDHA5_uc003lhl.2_Intron|PCDHA6_uc003lhn.2_Intron|PCDHA6_uc003lho.2_Intron|PCDHA7_uc003lhq.2_Intron|PCDHA8_uc003lhs.2_Intron|PCDHA9_uc003lhu.2_Intron|PCDHA10_uc003lhw.2_Intron|PCDHA10_uc003lhx.2_Intron|PCDHA11_uc003lia.2_Intron|PCDHA12_uc003lic.2_Intron|PCDHA13_uc003lie.1_Silent_p.H511H|PCDHA13_uc003lid.2_Silent_p.H511H	NM_018904	NP_061727	Q9Y5I0	PCDAD_HUMAN	protocadherin alpha 13 isoform 1 precursor	511	Cadherin 5.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|skin(2)|central_nervous_system(1)	6			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			TGTCGGTGCACGCGGAGAGCG	0.692													5	97	---	---	---	---	PASS
GABRG2	2566	broad.mit.edu	37	5	161520913	161520913	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:161520913G>A	uc003lyz.3	+	2	545	c.187G>A	c.(187-189)GAG>AAG	p.E63K	GABRG2_uc010jjc.2_Missense_Mutation_p.E63K|GABRG2_uc003lyy.3_Missense_Mutation_p.E63K|GABRG2_uc011dej.1_5'UTR	NM_000816	NP_000807	P18507	GBRG2_HUMAN	gamma-aminobutyric acid A receptor, gamma 2	63	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	benzodiazepine receptor activity|chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity|protein binding			ovary(4)|skin(1)	5	Renal(175;0.000319)	Medulloblastoma(196;0.0208)|all_neural(177;0.0672)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.0734)|OV - Ovarian serous cystadenocarcinoma(192;0.135)|Epithelial(171;0.136)		AAAAGTTCCTGAGGGTGATGT	0.388													71	46	---	---	---	---	PASS
DOCK2	1794	broad.mit.edu	37	5	169494639	169494639	+	Silent	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:169494639G>C	uc003maf.2	+	45	4673	c.4593G>C	c.(4591-4593)CTG>CTC	p.L1531L	DOCK2_uc011der.1_RNA|DOCK2_uc010jjm.2_Silent_p.L1023L|DOCK2_uc003mah.2_Silent_p.L87L	NM_004946	NP_004937	Q92608	DOCK2_HUMAN	dedicator of cytokinesis 2	1531	DHR-2.				actin cytoskeleton organization|regulation of defense response to virus by virus|viral reproduction	cytoskeleton|cytosol|endomembrane system|membrane	electron carrier activity|GTP binding|GTPase binding|heme binding|Rac guanyl-nucleotide exchange factor activity|T cell receptor binding			ovary(5)|pancreas(2)	7	Renal(175;0.000159)|Lung NSC(126;0.0221)|all_lung(126;0.0337)	Medulloblastoma(196;0.0399)|all_neural(177;0.0966)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)			CCATGCTCCTGAACGGGATTG	0.527													4	91	---	---	---	---	PASS
STK10	6793	broad.mit.edu	37	5	171481675	171481675	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:171481675C>A	uc003mbo.1	-	17	2850	c.2550G>T	c.(2548-2550)AGG>AGT	p.R850S		NM_005990	NP_005981	O94804	STK10_HUMAN	serine/threonine kinase 10	850	Gln-rich.|Potential.						ATP binding|protein serine/threonine kinase activity			ovary(3)|lung(2)|testis(1)|breast(1)|pancreas(1)	8	Renal(175;0.000159)|Lung NSC(126;0.0056)|all_lung(126;0.0094)	Medulloblastoma(196;0.00868)|all_neural(177;0.026)	Kidney(164;7.24e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000516)			CCGACTTCTGCCTCTTCTCCT	0.637													102	74	---	---	---	---	PASS
HNRNPH1	3187	broad.mit.edu	37	5	179050119	179050119	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:179050119C>T	uc003mkf.3	-	2	122	c.16G>A	c.(16-18)GAA>AAA	p.E6K	HNRNPH1_uc003mkg.3_5'UTR|HNRNPH1_uc003mke.3_Missense_Mutation_p.E6K|HNRNPH1_uc003mkh.3_Missense_Mutation_p.E6K	NM_005520	NP_005511	P31943	HNRH1_HUMAN	heterogeneous nuclear ribonucleoprotein H1	6					regulation of RNA splicing	actin cytoskeleton|catalytic step 2 spliceosome|cytoplasm|heterogeneous nuclear ribonucleoprotein complex|nucleoplasm	nucleotide binding|poly(U) RNA binding|protein binding				0						TCTCCACCTTCCGTGCCCAAC	0.562													27	17	---	---	---	---	PASS
MAML1	9794	broad.mit.edu	37	5	179201031	179201031	+	Nonsense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:179201031C>G	uc003mkm.2	+	5	2467	c.2204C>G	c.(2203-2205)TCA>TGA	p.S735*	MAML1_uc003mkn.1_Intron	NM_014757	NP_055572	Q92585	MAML1_HUMAN	mastermind-like 1	735					Notch signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nuclear speck	peptide antigen binding|protein kinase binding|transcription coactivator activity			lung(4)|ovary(2)	6	all_cancers(89;0.000197)|all_epithelial(37;6.7e-05)|Renal(175;0.000159)|Lung NSC(126;0.00121)|all_lung(126;0.00218)	all_cancers(40;0.0308)|Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)			CCCACAAACTCAGGCCAACAG	0.572													37	27	---	---	---	---	PASS
MAML1	9794	broad.mit.edu	37	5	179201368	179201368	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:179201368C>T	uc003mkm.2	+	5	2804	c.2541C>T	c.(2539-2541)CTC>CTT	p.L847L	MAML1_uc003mkn.1_Intron	NM_014757	NP_055572	Q92585	MAML1_HUMAN	mastermind-like 1	847					Notch signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nuclear speck	peptide antigen binding|protein kinase binding|transcription coactivator activity			lung(4)|ovary(2)	6	all_cancers(89;0.000197)|all_epithelial(37;6.7e-05)|Renal(175;0.000159)|Lung NSC(126;0.00121)|all_lung(126;0.00218)	all_cancers(40;0.0308)|Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)			TGCCGAACCTCAGTGGCCAGA	0.587													30	20	---	---	---	---	PASS
C6orf146	222826	broad.mit.edu	37	6	4077651	4077651	+	5'UTR	SNP	T	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:4077651T>A	uc003mvx.2	-	2					C6orf146_uc010jnq.1_Intron|C6orf146_uc003mvy.2_Intron|C6orf201_uc003mwa.3_5'Flank|C6orf201_uc003mvz.3_5'Flank	NM_173563	NP_775834	Q8IXS0	CF146_HUMAN	hypothetical protein LOC222826											ovary(1)	1	Ovarian(93;0.0925)	all_hematologic(90;0.108)				CTCCCCATTTTGTTGTAGCTG	0.433													69	75	---	---	---	---	PASS
GCM2	9247	broad.mit.edu	37	6	10876766	10876766	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:10876766G>T	uc003mzn.3	-	3	440	c.368C>A	c.(367-369)TCT>TAT	p.S123Y	SYCP2L_uc011dim.1_Intron	NM_004752	NP_004743	O75603	GCM2_HUMAN	glial cells missing homolog 2	123	GCM.				cellular calcium ion homeostasis|cellular phosphate ion homeostasis|parathyroid gland development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	metal ion binding|sequence-specific DNA binding			ovary(2)|central_nervous_system(1)	3	Breast(50;0.0838)|Ovarian(93;0.107)	all_hematologic(90;0.135)				CTCCAAAGCAGAATGACAGTT	0.507													16	25	---	---	---	---	PASS
HIST1H3B	8358	broad.mit.edu	37	6	26031939	26031939	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26031939C>G	uc003nfs.1	-	1	350	c.350G>C	c.(349-351)CGA>CCA	p.R117P		NM_003537	NP_003528	P68431	H31_HUMAN	histone cluster 1, H3b	117					blood coagulation|nucleosome assembly|regulation of gene silencing|S phase	nucleoplasm|nucleosome	DNA binding|protein binding	p.R117Q(1)		ovary(2)	2						AATAGTCACTCGCTTAGCATG	0.517													7	135	---	---	---	---	PASS
OR2B2	81697	broad.mit.edu	37	6	27879219	27879219	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:27879219C>G	uc011dkw.1	-	1	879	c.879G>C	c.(877-879)AGG>AGC	p.R293S		NM_033057	NP_149046	Q9GZK3	OR2B2_HUMAN	olfactory receptor, family 2, subfamily B,	293	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						CCTCTTTGTTCCTAAGTGTAT	0.403													115	37	---	---	---	---	PASS
HLA-F	3134	broad.mit.edu	37	6	29691698	29691698	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29691698G>A	uc010jrl.2	+	2	452	c.328G>A	c.(328-330)GAG>AAG	p.E110K	HLA-F_uc003nnm.3_Missense_Mutation_p.E110K|HLA-F_uc003nno.3_Missense_Mutation_p.E110K|HLA-F_uc011dlx.1_Missense_Mutation_p.E110K|HLA-F_uc011dly.1_RNA	NM_018950	NP_061823	P30511	HLAF_HUMAN	major histocompatibility complex, class I, F	110	Alpha-1.|Extracellular (Potential).				antigen processing and presentation of peptide antigen via MHC class I|interferon-gamma-mediated signaling pathway|regulation of immune response|type I interferon-mediated signaling pathway	integral to membrane|MHC class I protein complex	MHC class I receptor activity				0						CAACCAGAGCGAGGCTGGTGA	0.677													3	5	---	---	---	---	PASS
C6orf26	401251	broad.mit.edu	37	6	31732268	31732268	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31732268G>A	uc003nxa.3	+	5	556	c.497G>A	c.(496-498)CGG>CAG	p.R166Q	MSH5_uc003nwz.3_RNA	NM_001039651	NP_001034740	Q5SSQ6	G7D_HUMAN	hypothetical protein LOC401251	136											0						ATGGCTCAGCGGGGCTGCACC	0.597													38	79	---	---	---	---	PASS
CYP21A2	1589	broad.mit.edu	37	6	32007219	32007219	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32007219C>T	uc003nze.1	+	4	652	c.534C>T	c.(532-534)TTC>TTT	p.F178F	CYP21A2_uc003nzf.1_Silent_p.F148F	NM_000500	NP_000491	P08686	CP21A_HUMAN	cytochrome P450, family 21, subfamily A,	177					glucocorticoid biosynthetic process|mineralocorticoid biosynthetic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	electron carrier activity|heme binding|steroid 21-monooxygenase activity|steroid binding				0						ACCTCACCTTCGGAGACAAGA	0.587													9	29	---	---	---	---	PASS
SLC25A27	9481	broad.mit.edu	37	6	46626687	46626687	+	Intron	SNP	T	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:46626687T>A	uc003oyh.2	+						SLC25A27_uc011dwb.1_Intron|SLC25A27_uc003oyg.2_Intron|SLC25A27_uc011dwc.1_Intron|SLC25A27_uc003oyi.2_Missense_Mutation_p.L26H	NM_004277	NP_004268	O95847	UCP4_HUMAN	solute carrier family 25, member 27						generation of precursor metabolites and energy|transport	integral to membrane|mitochondrial inner membrane					0			Lung(136;0.192)			TTTAATGATCTTTTTTACCCA	0.378													11	279	---	---	---	---	PASS
BMP5	653	broad.mit.edu	37	6	55625297	55625297	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:55625297C>T	uc003pcq.2	-	5	1774	c.1062G>A	c.(1060-1062)AAG>AAA	p.K354K	BMP5_uc011dxf.1_Silent_p.K354K	NM_021073	NP_066551	P22003	BMP5_HUMAN	bone morphogenetic protein 5 preproprotein	354					cartilage development|cell differentiation|growth|ossification	extracellular space	BMP receptor binding|cytokine activity|growth factor activity			ovary(2)	2	Lung NSC(77;0.0462)		LUSC - Lung squamous cell carcinoma(124;0.181)			GTTCGTGCTTCTTACAGGCTT	0.353													17	91	---	---	---	---	PASS
DST	667	broad.mit.edu	37	6	56506864	56506864	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56506864C>T	uc003pdf.2	-	16	1837	c.1809G>A	c.(1807-1809)CAG>CAA	p.Q603Q	DST_uc003pcz.3_Silent_p.Q425Q|DST_uc011dxj.1_Silent_p.Q454Q|DST_uc011dxk.1_Silent_p.Q465Q|DST_uc011dxl.1_Silent_p.Q454Q|DST_uc003pcy.3_Silent_p.Q99Q|DST_uc003pdb.2_Silent_p.Q99Q|DST_uc003pdc.3_Silent_p.Q99Q|DST_uc003pdd.3_Silent_p.Q99Q|DST_uc003pde.2_Silent_p.Q541Q	NM_001144769	NP_001138241	Q03001	DYST_HUMAN	dystonin isoform 2	425					cell adhesion|cell cycle arrest|cell motility|hemidesmosome assembly|integrin-mediated signaling pathway|intermediate filament cytoskeleton organization|maintenance of cell polarity|microtubule cytoskeleton organization|response to wounding	actin cytoskeleton|axon|axon part|basement membrane|cell cortex|cell leading edge|cytoplasmic membrane-bounded vesicle|endoplasmic reticulum membrane|hemidesmosome|hemidesmosome|integral to membrane|intermediate filament|intermediate filament cytoskeleton|microtubule cytoskeleton|microtubule plus end|nuclear envelope|sarcomere|Z disc	actin binding|calcium ion binding|integrin binding|microtubule plus-end binding|protein binding|protein C-terminus binding|protein homodimerization activity			ovary(7)|central_nervous_system(6)|upper_aerodigestive_tract(1)	14	Lung NSC(77;0.103)		LUSC - Lung squamous cell carcinoma(124;0.0485)|Lung(124;0.0956)			CTGCTTCATTCTGAAACTGCA	0.323													65	26	---	---	---	---	PASS
SENP6	26054	broad.mit.edu	37	6	76380320	76380320	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76380320C>G	uc003pid.3	+	11	1895	c.1276C>G	c.(1276-1278)CAA>GAA	p.Q426E	SENP6_uc003pie.3_Missense_Mutation_p.Q419E|SENP6_uc010kbf.2_RNA|SENP6_uc003pic.2_Missense_Mutation_p.Q419E|SENP6_uc003pif.1_Missense_Mutation_p.Q317E	NM_015571	NP_056386	Q9GZR1	SENP6_HUMAN	SUMO1/sentrin specific peptidase 6 isoform 1	426					proteolysis	cytoplasm|nucleus	cysteine-type peptidase activity			breast(2)|urinary_tract(1)|ovary(1)|lung(1)|skin(1)	6		all_hematologic(105;0.189)				AGTGTTTTCTCAAGAACCTCC	0.358													31	52	---	---	---	---	PASS
IMPG1	3617	broad.mit.edu	37	6	76660509	76660509	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76660509C>T	uc003pik.1	-	13	1724	c.1594G>A	c.(1594-1596)GAG>AAG	p.E532K		NM_001563	NP_001554	Q17R60	IMPG1_HUMAN	interphotoreceptor matrix proteoglycan 1	532					visual perception	proteinaceous extracellular matrix	extracellular matrix structural constituent|receptor activity			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(125;0.0418)|all_hematologic(105;0.222)				TCTGGTACCTCAGATGGGGCA	0.478													15	43	---	---	---	---	PASS
ELOVL4	6785	broad.mit.edu	37	6	80656984	80656984	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:80656984C>T	uc003pja.3	-	1	332	c.13G>A	c.(13-15)GAC>AAC	p.D5N	ELOVL4_uc011dyt.1_RNA	NM_022726	NP_073563	Q9GZR5	ELOV4_HUMAN	elongation of very long chain fatty acids-like	5					fatty acid elongation, saturated fatty acid|long-chain fatty-acyl-CoA biosynthetic process|triglyceride biosynthetic process|very long-chain fatty acid biosynthetic process	integral to endoplasmic reticulum membrane	G-protein coupled photoreceptor activity|protein binding|transferase activity, transferring acyl groups other than amino-acyl groups			ovary(1)|skin(1)	2		all_cancers(76;1.83e-05)|Acute lymphoblastic leukemia(125;1.1e-05)|all_hematologic(105;0.00117)|all_epithelial(107;0.011)		BRCA - Breast invasive adenocarcinoma(397;0.0168)	Alpha-Linolenic Acid(DB00132)	GGCTCCGAGTCCAGGAGCCCC	0.667													3	15	---	---	---	---	PASS
MDN1	23195	broad.mit.edu	37	6	90484342	90484342	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90484342C>G	uc003pnn.1	-	13	2048	c.1932G>C	c.(1930-1932)CAG>CAC	p.Q644H	MDN1_uc003pno.1_Missense_Mutation_p.Q62H	NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	644					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)		CTACTTACCTCTGTAGGTGAA	0.443													32	78	---	---	---	---	PASS
NKAIN2	154215	broad.mit.edu	37	6	124979388	124979388	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:124979388G>A	uc003pzo.2	+	4	607	c.330G>A	c.(328-330)GAG>GAA	p.E110E	NKAIN2_uc003pzn.1_Silent_p.E110E|NKAIN2_uc003pzp.2_Silent_p.E109E|NKAIN2_uc010keq.2_Intron|NKAIN2_uc010ker.2_Silent_p.E20E	NM_001040214	NP_001035304	Q5VXU1	NKAI2_HUMAN	T-cell lymphoma breakpoint-associated target 1	110						integral to membrane|plasma membrane					0				GBM - Glioblastoma multiforme(226;0.104)		GGTGGATGGAGAATGGACCAG	0.473													28	63	---	---	---	---	PASS
PTPRK	5796	broad.mit.edu	37	6	128643434	128643434	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:128643434G>C	uc003qbk.2	-	3	612	c.245C>G	c.(244-246)TCT>TGT	p.S82C	PTPRK_uc003qbj.2_Missense_Mutation_p.S82C|PTPRK_uc010kfc.2_Missense_Mutation_p.S82C|PTPRK_uc011ebu.1_Missense_Mutation_p.S82C|PTPRK_uc003qbl.1_Intron|PTPRK_uc011ebv.1_Missense_Mutation_p.S82C|PTPRK_uc003qbm.3_Missense_Mutation_p.S11C	NM_002844	NP_002835	Q15262	PTPRK_HUMAN	protein tyrosine phosphatase, receptor type, K	82	Extracellular (Potential).|MAM.				cell migration|cellular response to reactive oxygen species|cellular response to UV|focal adhesion assembly|negative regulation of cell cycle|negative regulation of cell migration|negative regulation of keratinocyte proliferation|negative regulation of transcription, DNA-dependent|protein localization at cell surface|transforming growth factor beta receptor signaling pathway	adherens junction|cell surface|cell-cell junction|integral to plasma membrane|leading edge membrane	beta-catenin binding|gamma-catenin binding|protein kinase binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(3)|skin(2)|pancreas(1)|kidney(1)|central_nervous_system(1)	8				all cancers(137;0.0118)|GBM - Glioblastoma multiforme(226;0.0372)|OV - Ovarian serous cystadenocarcinoma(136;0.24)		GTGATCTGAAGAGTCCACTAT	0.363													66	181	---	---	---	---	PASS
ENPP3	5169	broad.mit.edu	37	6	132067987	132067987	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132067987G>A	uc003qcu.3	+	26	2866	c.2519G>A	c.(2518-2520)CGT>CAT	p.R840H	ENPP3_uc010kfq.2_RNA|ENPP3_uc003qcv.2_Missense_Mutation_p.R840H	NM_005021	NP_005012	O14638	ENPP3_HUMAN	ectonucleotide pyrophosphatase/phosphodiesterase	840	Extracellular (Potential).|Nuclease.				immune response|nucleoside triphosphate catabolic process|phosphate metabolic process	extracellular region|integral to plasma membrane|perinuclear region of cytoplasm	metal ion binding|nucleic acid binding|nucleoside-triphosphate diphosphatase activity|nucleotide diphosphatase activity|phosphodiesterase I activity|polysaccharide binding|scavenger receptor activity			ovary(3)|skin(1)	4	Breast(56;0.0753)			GBM - Glioblastoma multiforme(226;0.0252)|OV - Ovarian serous cystadenocarcinoma(155;0.0511)		GCCCGGGTCCGTGATGTAGAA	0.403													54	90	---	---	---	---	PASS
TCF21	6943	broad.mit.edu	37	6	134210908	134210908	+	Missense_Mutation	SNP	T	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:134210908T>A	uc003qei.3	+	1	649	c.373T>A	c.(373-375)TCC>ACC	p.S125T	uc003qeg.1_5'Flank|TCF21_uc003qej.2_Missense_Mutation_p.S125T	NM_003206	NP_003197	O43680	TCF21_HUMAN	transcription factor 21	125	Helix-loop-helix motif.				branching involved in ureteric bud morphogenesis|mesoderm development|negative regulation of androgen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent	nucleus	androgen receptor binding|E-box binding|protein dimerization activity|sequence-specific DNA binding transcription factor activity				0	Colorectal(23;0.221)|Breast(56;0.247)			GBM - Glioblastoma multiforme(68;0.00518)|OV - Ovarian serous cystadenocarcinoma(155;0.00783)		CAGGCTGGCGTCCAGCTACAT	0.617													63	135	---	---	---	---	PASS
IL20RA	53832	broad.mit.edu	37	6	137323176	137323176	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:137323176G>A	uc003qhj.2	-	7	1614	c.1181C>T	c.(1180-1182)CCG>CTG	p.P394L	IL20RA_uc011edl.1_Missense_Mutation_p.P345L|IL20RA_uc003qhk.2_Missense_Mutation_p.P283L|IL20RA_uc003qhi.2_Missense_Mutation_p.P126L	NM_014432	NP_055247	Q9UHF4	I20RA_HUMAN	interleukin 20 receptor, alpha precursor	394	Cytoplasmic (Potential).					integral to membrane	receptor activity			ovary(2)|skin(2)	4	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.000351)|OV - Ovarian serous cystadenocarcinoma(155;0.00459)		TGTTTTATCCGGGGGTATTGT	0.468													27	71	---	---	---	---	PASS
KIF25	3834	broad.mit.edu	37	6	168443353	168443353	+	Silent	SNP	G	A	A	rs147561163		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:168443353G>A	uc003qwk.1	+	8	1204	c.942G>A	c.(940-942)CCG>CCA	p.P314P	KIF25_uc003qwl.1_Intron	NM_030615	NP_085118	Q9UIL4	KIF25_HUMAN	kinesin family member 25 isoform 1	314					microtubule-based movement|mitotic sister chromatid segregation	cytoplasm|kinesin complex|microtubule	ATP binding|microtubule motor activity			ovary(1)|pancreas(1)	2		Breast(66;1.07e-05)|Ovarian(120;0.0728)		Epithelial(4;7.7e-30)|OV - Ovarian serous cystadenocarcinoma(33;5.82e-22)|BRCA - Breast invasive adenocarcinoma(4;1.38e-10)|GBM - Glioblastoma multiforme(31;0.000756)		GCCATGCCCCGTACCGGAACA	0.652													44	43	---	---	---	---	PASS
CARD11	84433	broad.mit.edu	37	7	2963931	2963931	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2963931C>T	uc003smv.2	-	15	2280	c.1876G>A	c.(1876-1878)GAG>AAG	p.E626K		NM_032415	NP_115791	Q9BXL7	CAR11_HUMAN	caspase recruitment domain family, member 11	626					positive regulation of cytokine production|positive regulation of NF-kappaB transcription factor activity|regulation of apoptosis|T cell costimulation|T cell receptor signaling pathway	cytosol|membrane raft|plasma membrane	CARD domain binding|guanylate kinase activity			haematopoietic_and_lymphoid_tissue(43)|ovary(2)|kidney(2)|skin(2)|central_nervous_system(1)	50		Ovarian(82;0.0115)		OV - Ovarian serous cystadenocarcinoma(56;8.44e-14)		TCCAGGCCCTCGGATTGGTGG	0.602			Mis		DLBCL								24	35	---	---	---	---	PASS
RNF216	54476	broad.mit.edu	37	7	5780921	5780921	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:5780921G>A	uc003soy.1	-	4	746	c.556C>T	c.(556-558)CGT>TGT	p.R186C	RNF216_uc010ksz.1_5'UTR|RNF216_uc010kta.1_Intron|RNF216_uc011jwj.1_Intron|RNF216_uc003sox.1_Missense_Mutation_p.R243C	NM_207116	NP_996999	Q9NWF9	RN216_HUMAN	ring finger protein 216 isoform b	186					apoptosis|interspecies interaction between organisms|proteasomal ubiquitin-dependent protein catabolic process|protein K48-linked ubiquitination|regulation of defense response to virus by host|regulation of interferon-beta production	cytoplasm|nucleus|nucleus	ligase activity|protein binding|protein binding|zinc ion binding			ovary(3)|breast(2)	5		Ovarian(82;0.07)		UCEC - Uterine corpus endometrioid carcinoma (126;0.135)|OV - Ovarian serous cystadenocarcinoma(56;2.69e-13)		GTTATTTCACGGGGCTGTTGG	0.507													7	194	---	---	---	---	PASS
DNAH11	8701	broad.mit.edu	37	7	21789930	21789930	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:21789930C>A	uc003svc.2	+	55	8940	c.8909C>A	c.(8908-8910)TCC>TAC	p.S2970Y		NM_003777	NP_003768	Q96DT5	DYH11_HUMAN	dynein, axonemal, heavy chain 11	2970	AAA 4 (By similarity).				microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			ovary(8)|large_intestine(3)|pancreas(3)|central_nervous_system(1)	15						ATGGTAGACTCCAGGGAAAAC	0.413									Kartagener_syndrome				7	5	---	---	---	---	PASS
CCDC129	223075	broad.mit.edu	37	7	31682837	31682837	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:31682837G>T	uc003tcj.1	+	11	2846	c.1853G>T	c.(1852-1854)CGA>CTA	p.R618L	CCDC129_uc011kad.1_Missense_Mutation_p.R628L|CCDC129_uc003tci.1_Missense_Mutation_p.R469L|CCDC129_uc011kae.1_Missense_Mutation_p.R644L|CCDC129_uc003tck.1_Missense_Mutation_p.R526L	NM_194300	NP_919276	Q6ZRS4	CC129_HUMAN	coiled-coil domain containing 129	618											0						GAGGCCCCACGAGAAGAGGAA	0.488													38	80	---	---	---	---	PASS
AOAH	313	broad.mit.edu	37	7	36616224	36616224	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:36616224C>G	uc003tfh.3	-	13	1378	c.977G>C	c.(976-978)AGA>ACA	p.R326T	AOAH_uc010kxf.2_Missense_Mutation_p.R326T|AOAH_uc011kba.1_Missense_Mutation_p.R294T	NM_001637	NP_001628	P28039	AOAH_HUMAN	acyloxyacyl hydrolase precursor	326					inflammatory response|lipid metabolic process	extracellular region	acyloxyacyl hydrolase activity|lipoprotein lipase activity			skin(1)	1						ACAGTGGTTTCTTTTCCATAA	0.294													54	90	---	---	---	---	PASS
TBRG4	9238	broad.mit.edu	37	7	45141676	45141676	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:45141676G>A	uc003tmv.2	-						TBRG4_uc003tmu.2_Intron|TBRG4_uc003tmw.2_Intron|TBRG4_uc003tmx.2_Intron|TBRG4_uc011kcd.1_Intron	NM_004749	NP_004740	Q969Z0	TBRG4_HUMAN	cell cycle progression 2 protein isoform 1						apoptosis|cell cycle arrest|cellular respiration|G1 phase of mitotic cell cycle|positive regulation of cell proliferation	mitochondrion	ATP binding|protein binding|protein kinase activity				0						CCCCCTAGGAGACAAGGAGAA	0.597													33	73	---	---	---	---	PASS
PSPH	5723	broad.mit.edu	37	7	56082739	56082739	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:56082739C>T	uc003trg.2	-	6	910	c.547G>A	c.(547-549)GAT>AAT	p.D183N	PSPH_uc003trh.2_Missense_Mutation_p.D183N|PSPH_uc003tri.2_Missense_Mutation_p.D183N|PSPH_uc003trj.2_Missense_Mutation_p.D212N	NM_004577	NP_004568	P78330	SERB_HUMAN	phosphoserine phosphatase	183					L-serine biosynthetic process	cytoplasm	calcium ion binding|magnesium ion binding|phosphoserine phosphatase activity|protein homodimerization activity			ovary(1)|skin(1)	2	Breast(14;0.214)		Lung(13;0.00024)|LUSC - Lung squamous cell carcinoma(13;0.00099)			GCTTCCATATCTGTGGCACCA	0.299													27	64	---	---	---	---	PASS
CRCP	27297	broad.mit.edu	37	7	65599341	65599341	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:65599341G>A	uc003tus.2	+	4	364	c.219G>A	c.(217-219)TTG>TTA	p.L73L	CRCP_uc003tuv.2_RNA|CRCP_uc011kdw.1_Silent_p.L66L|CRCP_uc003tut.2_Silent_p.L40L|CRCP_uc003tuu.2_Intron	NM_014478	NP_055293	O75575	RPC9_HUMAN	calcitonin gene-related peptide-receptor	73					acrosome reaction|innate immune response|response to virus|transcription from RNA polymerase III promoter	DNA polymerase III complex|nucleus|plasma membrane	calcitonin receptor activity|DNA-directed RNA polymerase activity|nucleotide binding				0						TCACAGCATTGAAAAGCCACA	0.363													83	39	---	---	---	---	PASS
FGL2	10875	broad.mit.edu	37	7	76829017	76829017	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:76829017C>T	uc003ugb.2	-	1	134	c.94G>A	c.(94-96)GAT>AAT	p.D32N	CCDC146_uc003ufz.1_Intron|CCDC146_uc003uga.2_Intron	NM_006682	NP_006673	Q14314	FGL2_HUMAN	fibrinogen-like 2 precursor	32					signal transduction	fibrinogen complex	receptor binding			skin(2)	2						GCTCTTTCATCTTTAATTTCC	0.493													4	223	---	---	---	---	PASS
PION	54103	broad.mit.edu	37	7	77010632	77010632	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:77010632C>A	uc003ugf.2	-	8	645	c.566G>T	c.(565-567)GGA>GTA	p.G189V	PION_uc003ugg.1_5'UTR	NM_017439	NP_059135	A4D1B5	GSAP_HUMAN	pigeon homolog	189					beta-amyloid formation|regulation of proteolysis	trans-Golgi network	beta-amyloid binding			central_nervous_system(1)	1						CACTCTATTTCCATCTTCTTG	0.284													30	58	---	---	---	---	PASS
SEMA3D	223117	broad.mit.edu	37	7	84642132	84642132	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:84642132G>A	uc003uic.2	-	15	1774	c.1734C>T	c.(1732-1734)GGC>GGT	p.G578G	SEMA3D_uc010led.2_Silent_p.G578G|SEMA3D_uc003uib.2_Silent_p.G217G	NM_152754	NP_689967	O95025	SEM3D_HUMAN	semaphorin 3D precursor	578	PSI.				cell differentiation|nervous system development	extracellular region|membrane	receptor activity			ovary(3)|large_intestine(2)	5						TGATTGGGTCGCCATATTTTA	0.403													6	115	---	---	---	---	PASS
PPP1R3A	5506	broad.mit.edu	37	7	113558804	113558804	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:113558804C>T	uc010ljy.1	-	1	279	c.248G>A	c.(247-249)TGG>TAG	p.W83*		NM_002711	NP_002702	Q16821	PPR3A_HUMAN	protein phosphatase 1, regulatory (inhibitor)	83					glycogen metabolic process	integral to membrane				lung(9)|ovary(9)|pancreas(7)|skin(6)|breast(2)|prostate(1)	34						CGGTAATTCCCAGCAATCAAA	0.398													23	109	---	---	---	---	PASS
ZNF398	57541	broad.mit.edu	37	7	148863947	148863947	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:148863947C>G	uc003wfl.2	+	4	861	c.586C>G	c.(586-588)CAA>GAA	p.Q196E	ZNF398_uc011kul.1_Missense_Mutation_p.Q25E|ZNF398_uc011kum.1_Missense_Mutation_p.Q201E	NM_170686	NP_733787	Q8TD17	ZN398_HUMAN	zinc finger 398 isoform a	196	KRAB.				positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1	Melanoma(164;0.15)		OV - Ovarian serous cystadenocarcinoma(82;0.00143)			ATCTCAGATTCAACCAGAAGG	0.423													6	40	---	---	---	---	PASS
MLL3	58508	broad.mit.edu	37	7	151917764	151917764	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151917764G>A	uc003wla.2	-	23	3775	c.3556C>T	c.(3556-3558)CAG>TAG	p.Q1186*	MLL3_uc003wkz.2_Nonsense_Mutation_p.Q247*	NM_170606	NP_733751	Q8NEZ4	MLL3_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 3	1186					intracellular signal transduction|regulation of transcription, DNA-dependent|transcription, DNA-dependent		DNA binding|protein binding|zinc ion binding			large_intestine(27)|pancreas(13)|ovary(9)|central_nervous_system(8)|breast(3)|upper_aerodigestive_tract(1)|urinary_tract(1)|skin(1)	63	all_neural(206;0.187)	all_hematologic(28;0.0592)|Prostate(32;0.0906)	OV - Ovarian serous cystadenocarcinoma(82;0.00715)	UCEC - Uterine corpus endometrioid carcinoma (81;0.0597)|BRCA - Breast invasive adenocarcinoma(188;0.0462)		CTCTGTAACTGAGTCATCCCT	0.383			N		medulloblastoma								60	32	---	---	---	---	PASS
C8orf42	157695	broad.mit.edu	37	8	442413	442413	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:442413C>T	uc003wpd.2	-	3	1118	c.544G>A	c.(544-546)GAG>AAG	p.E182K	C8orf42_uc011kwg.1_Intron	NM_175075	NP_778250	Q86YL5	CH042_HUMAN	hypothetical protein LOC157695	182											0		Ovarian(12;0.0481)|Colorectal(14;0.0815)|Hepatocellular(245;0.0968)|Myeloproliferative disorder(644;0.116)|all_neural(12;0.122)		Epithelial(5;5.16e-14)|OV - Ovarian serous cystadenocarcinoma(5;7.35e-07)|BRCA - Breast invasive adenocarcinoma(11;4.17e-06)|COAD - Colon adenocarcinoma(149;0.0255)		TCCGCCTCCTCCGGGCTATCT	0.607													4	9	---	---	---	---	PASS
EPHX2	2053	broad.mit.edu	37	8	27398141	27398141	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27398141C>G	uc003xfu.2	+	15	1428	c.1347C>G	c.(1345-1347)TTC>TTG	p.F449L	EPHX2_uc010luu.2_Missense_Mutation_p.F417L|EPHX2_uc010luv.2_Missense_Mutation_p.F383L|EPHX2_uc003xfv.2_Missense_Mutation_p.F396L|EPHX2_uc010luw.2_Missense_Mutation_p.F383L	NM_001979	NP_001970	P34913	HYES_HUMAN	epoxide hydrolase 2, cytoplasmic	449	Epoxide hydrolase.				aromatic compound catabolic process|cellular calcium ion homeostasis|drug metabolic process|inflammatory response|positive regulation of vasodilation|reactive oxygen species metabolic process|regulation of blood pressure|response to toxin|xenobiotic metabolic process	cytosol|focal adhesion|Golgi apparatus|nucleolus|peroxisome|soluble fraction	epoxide hydrolase activity|metal ion binding|protein homodimerization activity			ovary(1)	1		Ovarian(32;2.61e-05)|all_epithelial(46;0.207)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0226)|Epithelial(17;1.12e-09)|Colorectal(74;0.157)	Tamoxifen(DB00675)	AAATCCAGTTCTATGTGCAGC	0.493													27	75	---	---	---	---	PASS
ERLIN2	11160	broad.mit.edu	37	8	37611643	37611643	+	3'UTR	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:37611643G>C	uc003xke.3	+	12						NM_007175	NP_009106	O94905	ERLN2_HUMAN	ER lipid raft associated 2 isoform 1						ER-associated protein catabolic process	endoplasmic reticulum membrane|integral to membrane|plasma membrane	protein binding				0		Lung NSC(58;0.174)	BRCA - Breast invasive adenocarcinoma(5;6.14e-24)|LUSC - Lung squamous cell carcinoma(8;3.5e-10)			AAAAAAACTTGATATGACTGC	0.423													13	26	---	---	---	---	PASS
HGSNAT	138050	broad.mit.edu	37	8	43047580	43047580	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:43047580G>A	uc003xpx.3	+							NM_152419	NP_689632	Q68CP4	HGNAT_HUMAN	heparan-alpha-glucosaminide N-acetyltransferase						lysosomal transport|protein oligomerization	integral to membrane|lysosomal membrane	heparan-alpha-glucosaminide N-acetyltransferase activity				0	Prostate(17;0.0119)|Ovarian(28;0.0172)|Lung SC(25;0.184)	all_cancers(86;0.000223)|all_epithelial(80;1.61e-07)|all_lung(54;0.00021)|Lung NSC(58;0.000778)|Hepatocellular(245;0.0524)|Renal(179;0.0822)|Esophageal squamous(32;0.129)	Lung(22;0.0777)|LUSC - Lung squamous cell carcinoma(45;0.17)			TGCTGTGAGTGAGACTCGAGT	0.493													18	26	---	---	---	---	PASS
GDF6	392255	broad.mit.edu	37	8	97157727	97157727	+	Silent	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:97157727C>A	uc003yhp.2	-	2	532	c.432G>T	c.(430-432)CGG>CGT	p.R144R		NM_001001557	NP_001001557	Q6KF10	GDF6_HUMAN	growth differentiation factor 6 precursor	144					activin receptor signaling pathway|BMP signaling pathway|growth|pathway-restricted SMAD protein phosphorylation|positive regulation of pathway-restricted SMAD protein phosphorylation|positive regulation of transcription, DNA-dependent	extracellular space	cytokine activity|growth factor activity			ovary(1)|breast(1)|pancreas(1)	3	Breast(36;2.67e-05)					ACTTCTGTCTCCGGAGAGGAG	0.572													15	30	---	---	---	---	PASS
SDC2	6383	broad.mit.edu	37	8	97621688	97621688	+	Missense_Mutation	SNP	A	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:97621688A>G	uc003yhv.1	+	5	1136	c.518A>G	c.(517-519)AAG>AGG	p.K173R	SDC2_uc011lgu.1_Missense_Mutation_p.K144R	NM_002998	NP_002989	P34741	SDC2_HUMAN	syndecan 2 precursor	173	Cytoplasmic (Potential).					integral to plasma membrane	cytoskeletal protein binding|PDZ domain binding			ovary(2)	2	Breast(36;3.41e-05)				Sargramostim(DB00020)	CGCATGAGAAAGAAGGATGAA	0.418													6	222	---	---	---	---	PASS
TSPYL5	85453	broad.mit.edu	37	8	98289988	98289988	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:98289988G>C	uc003yhy.2	-	1	189	c.85C>G	c.(85-87)CCG>GCG	p.P29A		NM_033512	NP_277047	Q86VY4	TSYL5_HUMAN	TSPY-like 5	29					cellular response to gamma radiation|nucleosome assembly|positive regulation of cell proliferation|positive regulation of protein kinase B signaling cascade|positive regulation of protein ubiquitination|regulation of growth	nucleus	protein binding			large_intestine(1)|ovary(1)	2	Breast(36;2.56e-06)					GCGTCGTCCGGAGCAGGGCGG	0.716													12	32	---	---	---	---	PASS
VPS13B	157680	broad.mit.edu	37	8	100589801	100589801	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:100589801C>G	uc003yiv.2	+	33	5346	c.5235C>G	c.(5233-5235)CTC>CTG	p.L1745L	VPS13B_uc003yiw.2_Silent_p.L1720L	NM_017890	NP_060360	Q7Z7G8	VP13B_HUMAN	vacuolar protein sorting 13B isoform 5	1745					protein transport					ovary(7)|skin(4)|lung(3)|central_nervous_system(2)|pancreas(2)|breast(1)|kidney(1)	20	Breast(36;3.73e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.00636)			AAGTTCAACTCTTACATCAGT	0.403													16	240	---	---	---	---	PASS
VPS13B	157680	broad.mit.edu	37	8	100654154	100654154	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:100654154G>C	uc003yiv.2	+	34	5522	c.5411G>C	c.(5410-5412)AGA>ACA	p.R1804T	VPS13B_uc003yiw.2_Missense_Mutation_p.R1779T	NM_017890	NP_060360	Q7Z7G8	VP13B_HUMAN	vacuolar protein sorting 13B isoform 5	1804					protein transport					ovary(7)|skin(4)|lung(3)|central_nervous_system(2)|pancreas(2)|breast(1)|kidney(1)	20	Breast(36;3.73e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.00636)			GTTAAAATCAGAATAGTGCAA	0.433													62	107	---	---	---	---	PASS
SPAG1	6674	broad.mit.edu	37	8	101252621	101252621	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101252621C>T	uc003yjh.1	+						SPAG1_uc003yji.1_Intron	NM_172218	NP_757367	Q07617	SPAG1_HUMAN	sperm associated antigen 1						single fertilization	cytoplasm	GTP binding|hydrolase activity			ovary(2)|central_nervous_system(1)	3	all_cancers(14;2.35e-05)|all_epithelial(15;5.2e-08)|Lung NSC(17;0.000283)|all_lung(17;0.000823)	Breast(495;0.195)	Epithelial(11;1.12e-09)|all cancers(13;1.26e-07)|OV - Ovarian serous cystadenocarcinoma(57;4.37e-05)|STAD - Stomach adenocarcinoma(118;0.0525)	KIRC - Kidney renal clear cell carcinoma(542;0.00178)|READ - Rectum adenocarcinoma(644;0.236)		TTTTTCTTTTCTTCATGAAGG	0.458													59	256	---	---	---	---	PASS
PKHD1L1	93035	broad.mit.edu	37	8	110393634	110393634	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110393634G>A	uc003yne.2	+	3	303	c.199G>A	c.(199-201)GAT>AAT	p.D67N		NM_177531	NP_803875	Q86WI1	PKHL1_HUMAN	fibrocystin L precursor	67	Extracellular (Potential).|IPT/TIG 1.				immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)			CTATGGAGTTGATAACGCTGA	0.328										HNSCC(38;0.096)			5	14	---	---	---	---	PASS
EBAG9	9166	broad.mit.edu	37	8	110569206	110569206	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110569206G>C	uc003ynf.2	+	5	599	c.364G>C	c.(364-366)GAT>CAT	p.D122H	EBAG9_uc010mcn.1_RNA|EBAG9_uc003yng.2_Missense_Mutation_p.D122H	NM_198120	NP_936056	O00559	RCAS1_HUMAN	estrogen receptor binding site associated	122	Cytoplasmic (Potential).				apoptosis|regulation of cell growth	focal adhesion|Golgi membrane|integral to membrane|soluble fraction	apoptotic protease activator activity				0			OV - Ovarian serous cystadenocarcinoma(57;1.39e-14)			TGGCATCCCAGATGGGAGCAC	0.338													15	99	---	---	---	---	PASS
ATAD2	29028	broad.mit.edu	37	8	124408481	124408481	+	Silent	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124408481G>C	uc003yqh.3	-	1	225	c.117C>G	c.(115-117)CTC>CTG	p.L39L	ATAD2_uc011lii.1_5'UTR|ATAD2_uc003yqi.3_Intron|ATAD2_uc003yqj.2_Silent_p.L39L	NM_014109	NP_054828	Q6PL18	ATAD2_HUMAN	ATPase family, AAA domain containing 2	39					regulation of transcription, DNA-dependent|transcription, DNA-dependent	mitochondrion|nucleus	ATP binding|ATPase activity			ovary(2)	2	Lung NSC(37;1.25e-09)|Ovarian(258;0.00838)		STAD - Stomach adenocarcinoma(47;0.00288)			CGGCCGAGCGGAGCCGCCTCC	0.716													19	31	---	---	---	---	PASS
CYP11B2	1585	broad.mit.edu	37	8	143995805	143995805	+	Nonsense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:143995805C>A	uc003yxk.1	-	5	832	c.829G>T	c.(829-831)GAA>TAA	p.E277*		NM_000498	NP_000489	P19099	C11B2_HUMAN	cytochrome P450, family 11, subfamily B,	277					aldosterone biosynthetic process|cellular response to hormone stimulus|cellular response to potassium ion|cortisol biosynthetic process|potassium ion homeostasis|regulation of blood volume by renal aldosterone|sodium ion homeostasis|xenobiotic metabolic process		corticosterone 18-monooxygenase activity|electron carrier activity|steroid 11-beta-monooxygenase activity				0	all_cancers(97;5.56e-11)|all_epithelial(106;2.49e-08)|Lung NSC(106;0.000228)|all_lung(105;0.000633)|Medulloblastoma(13;0.00276)|all_neural(13;0.00559)|Ovarian(258;0.0254)|Acute lymphoblastic leukemia(118;0.155)				Candesartan(DB00796)|Metyrapone(DB01011)	AAGGCCAGTTCCTGGTAGATT	0.557									Familial_Hyperaldosteronism_type_I				33	38	---	---	---	---	PASS
GPR172A	79581	broad.mit.edu	37	8	145584267	145584267	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145584267G>A	uc003zcc.1	+	4	1176	c.1019G>A	c.(1018-1020)GGC>GAC	p.G340D	FBXL6_uc003zbz.2_5'Flank|FBXL6_uc003zca.2_5'Flank|FBXL6_uc003zcb.2_5'Flank|FBXL6_uc010mfx.2_5'Flank|GPR172A_uc003zcd.1_Missense_Mutation_p.G340D|GPR172A_uc003zce.1_Missense_Mutation_p.G340D|GPR172A_uc010mfy.1_Missense_Mutation_p.G340D|GPR172A_uc003zcf.1_Missense_Mutation_p.G340D|GPR172A_uc011llc.1_Missense_Mutation_p.G252D	NM_024531	NP_078807	Q9HAB3	RFT3_HUMAN	G protein-coupled receptor 172A precursor	340	Helical; (Potential).					integral to plasma membrane	receptor activity|riboflavin transporter activity				0	all_cancers(97;6.64e-12)|all_epithelial(106;2.89e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;4.43e-40)|Epithelial(56;1.48e-39)|all cancers(56;1.49e-34)|BRCA - Breast invasive adenocarcinoma(115;0.0441)|Colorectal(110;0.055)			GCAGGGCTGGGCGGCCTCTCT	0.706													107	117	---	---	---	---	PASS
IL33	90865	broad.mit.edu	37	9	6251261	6251261	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:6251261C>T	uc003zjt.2	+	4	396	c.339C>T	c.(337-339)ATC>ATT	p.I113I	IL33_uc011lmg.1_Silent_p.I113I|IL33_uc011lmh.1_Intron|IL33_uc003zju.1_Silent_p.I113I	NM_033439	NP_254274	O95760	IL33_HUMAN	interleukin 33 precursor	113					positive regulation of chemokine secretion|positive regulation of inflammatory response|positive regulation of macrophage activation|positive regulation of transcription from RNA polymerase II promoter	extracellular space	cytokine activity				0		Acute lymphoblastic leukemia(23;0.158)|Prostate(43;0.167)		GBM - Glioblastoma multiforme(50;0.0161)|Lung(218;0.105)		ATTCAAGTATCACAGGTATGA	0.502													15	895	---	---	---	---	PASS
KDM4C	23081	broad.mit.edu	37	9	6814699	6814699	+	Missense_Mutation	SNP	T	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:6814699T>C	uc003zkh.2	+	4	969	c.389T>C	c.(388-390)GTG>GCG	p.V130A	KDM4C_uc010mhu.2_Missense_Mutation_p.V152A|KDM4C_uc010mhw.2_Missense_Mutation_p.V130A|KDM4C_uc011lmi.1_Missense_Mutation_p.V130A|KDM4C_uc011lmj.1_Intron|KDM4C_uc003zkg.2_Missense_Mutation_p.V130A|KDM4C_uc011lmk.1_5'UTR|KDM4C_uc010mhv.2_Missense_Mutation_p.V130A	NM_015061	NP_055876	Q9H3R0	KDM4C_HUMAN	jumonji domain containing 2C isoform 1	130					positive regulation of cell proliferation|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|transcription, DNA-dependent	nuclear chromatin	androgen receptor binding|enzyme binding|histone demethylase activity (H3-K9 specific)|nucleic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|zinc ion binding			ovary(1)	1						TTAACTTTTGTGGCACCTATC	0.353													46	762	---	---	---	---	PASS
TLE4	7091	broad.mit.edu	37	9	82308552	82308552	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:82308552G>A	uc004ald.2	+						TLE4_uc004alc.2_Intron|TLE4_uc010mpr.2_Intron|TLE4_uc004ale.2_Intron|TLE4_uc011lsq.1_Intron|TLE4_uc010mps.2_Intron|TLE4_uc004alf.2_Intron	NM_007005	NP_008936	O60756	BCE1_HUMAN	transducin-like enhancer protein 4											lung(2)|ovary(1)|breast(1)|skin(1)	5						TGGAAAGAGAGAGACAAACTC	0.433													19	59	---	---	---	---	PASS
ERP44	23071	broad.mit.edu	37	9	102782991	102782991	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:102782991C>G	uc004bam.2	-	6	702	c.494G>C	c.(493-495)GGA>GCA	p.G165A	ERP44_uc010msy.2_RNA|ERP44_uc010msz.2_Missense_Mutation_p.G165A	NM_015051	NP_055866	Q9BS26	ERP44_HUMAN	thioredoxin domain containing 4 (endoplasmic	165					cell redox homeostasis|glycoprotein metabolic process|protein folding|response to unfolded protein	endoplasmic reticulum lumen|endoplasmic reticulum membrane|ER-Golgi intermediate compartment	protein binding|protein disulfide isomerase activity				0						CTCAAAATATCCAATGATATT	0.318													18	48	---	---	---	---	PASS
NR6A1	2649	broad.mit.edu	37	9	127300382	127300382	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:127300382C>G	uc004bor.1	-	6	991	c.813G>C	c.(811-813)TTG>TTC	p.L271F	NR6A1_uc004boq.1_Missense_Mutation_p.L266F|NR6A1_uc010mwq.1_Missense_Mutation_p.L267F	NM_033334	NP_201591	Q15406	NR6A1_HUMAN	nuclear receptor subfamily 6, group A, member 1	271					cell proliferation|negative regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|spermatogenesis	transcription factor complex	protein homodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(3)	3						CATCTTCAATCAACATGGGCG	0.582													25	49	---	---	---	---	PASS
SLC2A8	29988	broad.mit.edu	37	9	130167187	130167187	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130167187C>T	uc004bqu.2	+	8	1112	c.1067C>T	c.(1066-1068)TCG>TTG	p.S356L	SLC2A8_uc010mxj.2_Missense_Mutation_p.S356L|SLC2A8_uc004bqv.2_Missense_Mutation_p.S28L	NM_014580	NP_055395	Q9NY64	GTR8_HUMAN	solute carrier family 2 (facilitated glucose	356	Extracellular (Potential).					cytoplasmic vesicle membrane|integral to plasma membrane	D-glucose transmembrane transporter activity			ovary(1)|haematopoietic_and_lymphoid_tissue(1)	2						GTGGCCATCTCGGCGCCTGTC	0.667													44	80	---	---	---	---	PASS
LRSAM1	90678	broad.mit.edu	37	9	130259564	130259564	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130259564G>C	uc004brb.1	+	24	2208	c.1863G>C	c.(1861-1863)GAG>GAC	p.E621D	LRSAM1_uc010mxk.1_Missense_Mutation_p.E594D|LRSAM1_uc004brc.1_Missense_Mutation_p.E621D|LRSAM1_uc004brd.1_Missense_Mutation_p.E621D|LRSAM1_uc004bre.1_Missense_Mutation_p.E201D|uc004brf.1_5'Flank|LRSAM1_uc004brg.1_Missense_Mutation_p.E52D	NM_001005373	NP_001005373	Q6UWE0	LRSM1_HUMAN	leucine rich repeat and sterile alpha motif	621	SAM.				negative regulation of endocytosis|non-lytic virus budding|protein autoubiquitination|protein catabolic process|protein polyubiquitination|protein transport|ubiquitin-dependent endocytosis	cytoplasm|extracellular region|membrane part	hormone activity|ubiquitin-protein ligase activity|zinc ion binding				0						TGCAGCACGAGATCCTCCGGA	0.617													25	50	---	---	---	---	PASS
NUP214	8021	broad.mit.edu	37	9	134105185	134105185	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134105185G>A	uc004cag.2	+						NUP214_uc004cah.2_Intron|NUP214_uc004cai.2_Intron|NUP214_uc010mzg.2_RNA|NUP214_uc011mcg.1_Intron	NM_005085	NP_005076	P35658	NU214_HUMAN	nucleoporin 214kDa						carbohydrate metabolic process|glucose transport|mRNA metabolic process|protein export from nucleus|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|nuclear pore|nucleoplasm	protein binding			breast(7)|lung(3)|skin(3)|ovary(2)|central_nervous_system(1)	16	all_hematologic(7;0.0028)	Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;3.42e-05)|Epithelial(140;0.000256)		ACCTTTGTATGGAAAGAGCCT	0.517			T	DEK|SET|ABL1	AML|T-ALL								14	38	---	---	---	---	PASS
RPL7A	6130	broad.mit.edu	37	9	136217463	136217463	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136217463C>G	uc004cde.1	+	6	537	c.507C>G	c.(505-507)TTC>TTG	p.F169L	MED22_uc004cdc.2_5'Flank|MED22_uc004cdd.2_5'Flank|RPL7A_uc004cdf.1_5'UTR|SNORD36C_uc010nak.2_5'Flank	NM_000972	NP_000963	P62424	RL7A_HUMAN	ribosomal protein L7a	169					endocrine pancreas development|ribosome biogenesis|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit|membrane fraction|polysomal ribosome	RNA binding|structural constituent of ribosome				0				OV - Ovarian serous cystadenocarcinoma(145;4.93e-07)|Epithelial(140;4.09e-06)|all cancers(34;3.78e-05)		TGGTTGTCTTCTTGCCTGCCC	0.463													22	27	---	---	---	---	PASS
COL5A1	1289	broad.mit.edu	37	9	137734054	137734054	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:137734054G>A	uc004cfe.2	+	66	5804	c.5422G>A	c.(5422-5424)GAG>AAG	p.E1808K	uc004cff.2_Intron	NM_000093	NP_000084	P20908	CO5A1_HUMAN	alpha 1 type V collagen preproprotein	1808	Fibrillar collagen NC1.				axon guidance|cell adhesion|collagen biosynthetic process|collagen fibril organization|eye morphogenesis|fibril organization|integrin biosynthetic process|skin development|wound healing, spreading of epidermal cells	collagen type V	heparin binding|integrin binding|platelet-derived growth factor binding|proteoglycan binding			skin(4)|ovary(3)|pancreas(2)|central_nervous_system(1)|kidney(1)	11		Myeloproliferative disorder(178;0.0341)		all cancers(34;2.28e-08)|OV - Ovarian serous cystadenocarcinoma(145;6.03e-08)|Epithelial(140;6.4e-08)|GBM - Glioblastoma multiforme(294;0.131)		CCCCAAAGTGGAGCAGGTGCC	0.547													26	56	---	---	---	---	PASS
DCLRE1C	64421	broad.mit.edu	37	10	14978589	14978589	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:14978589C>T	uc001inn.2	-	5	395	c.310G>A	c.(310-312)GAA>AAA	p.E104K	DCLRE1C_uc010qbx.1_Missense_Mutation_p.E104K|DCLRE1C_uc001inl.2_5'UTR|DCLRE1C_uc009xji.2_Intron|DCLRE1C_uc001inm.2_5'UTR|DCLRE1C_uc001ino.2_Intron|DCLRE1C_uc009xjh.2_RNA|DCLRE1C_uc001inp.2_5'UTR|DCLRE1C_uc001inq.2_5'UTR|DCLRE1C_uc001inr.2_Intron|DCLRE1C_uc009xjj.1_5'Flank	NM_001033855	NP_001029027	Q96SD1	DCR1C_HUMAN	artemis protein isoform a	104					DNA recombination	nucleus	5'-3' exonuclease activity|single-stranded DNA specific endodeoxyribonuclease activity			ovary(1)	1						ACAATCTCTTCCTTCTAAAAA	0.353								Involved_in_tolerance_or_repair_of_DNA_crosslinks|NHEJ					13	32	---	---	---	---	PASS
CCDC7	221016	broad.mit.edu	37	10	32854533	32854533	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:32854533G>A	uc001iwj.2	+	15	1752	c.1182G>A	c.(1180-1182)TTG>TTA	p.L394L	CCDC7_uc001iwk.2_Silent_p.L394L|CCDC7_uc009xlv.2_RNA|C10orf68_uc001iwl.1_5'Flank|C10orf68_uc001iwm.1_5'Flank|C10orf68_uc001iwn.3_5'Flank	NM_145023	NP_659460	Q96M83	CCDC7_HUMAN	coiled-coil domain containing 7	394	Potential.										0		Breast(68;0.000207)|Prostate(175;0.0107)				AGGAGCAATTGAAACAGGCTT	0.303													15	41	---	---	---	---	PASS
RASGEF1A	221002	broad.mit.edu	37	10	43696186	43696186	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43696186C>T	uc001jap.1	-	5	691	c.610G>A	c.(610-612)GCC>ACC	p.A204T	RASGEF1A_uc001jao.1_Missense_Mutation_p.A212T	NM_145313	NP_660356	Q8N9B8	RGF1A_HUMAN	RasGEF domain family, member 1A	204					cell migration|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	intracellular	Ras guanyl-nucleotide exchange factor activity				0						TCCTTCTGGGCGGCTGGTGGC	0.652													30	61	---	---	---	---	PASS
ALOX5	240	broad.mit.edu	37	10	45878011	45878011	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:45878011G>A	uc001jce.2	+	2	330	c.231G>A	c.(229-231)CTG>CTA	p.L77L	ALOX5_uc009xmt.2_Silent_p.L77L|ALOX5_uc010qfg.1_Silent_p.L77L	NM_000698	NP_000689	P09917	LOX5_HUMAN	arachidonate 5-lipoxygenase	77	PLAT.				hormone biosynthetic process|leukotriene biosynthetic process|prostanoid metabolic process	cytosol|nuclear envelope lumen|nuclear matrix|nuclear membrane	arachidonate 5-lipoxygenase activity|iron ion binding|lipoxygenase activity|protein binding			ovary(1)|pancreas(1)	2		Lung SC(717;0.0257)			Diethylcarbamazine(DB00711)|Hydrocortisone(DB00741)|Leflunomide(DB01097)|Masoprocol(DB00179)|Meclofenamic acid(DB00939)|Minocycline(DB01017)|Montelukast(DB00471)|Quinacrine(DB01103)|Vitamin E(DB00163)|Zileuton(DB00744)	AGTACTGGCTGAATGACGACT	0.567													28	56	---	---	---	---	PASS
CCAR1	55749	broad.mit.edu	37	10	70547683	70547683	+	Splice_Site	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70547683G>A	uc001joo.2	+	22	3000	c.2881_splice	c.e22-1	p.V961_splice	CCAR1_uc010qiz.1_Splice_Site_p.V946_splice|CCAR1_uc010qjb.1_Splice_Site	NM_018237	NP_060707	Q8IX12	CCAR1_HUMAN	cell-cycle and apoptosis regulatory protein 1						apoptosis|cell cycle|nuclear mRNA splicing, via spliceosome|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm|perinuclear region of cytoplasm	calcium ion binding|nucleic acid binding|protein binding			ovary(6)|large_intestine(1)	7						ATGCATAACAGGTAAAGAAGC	0.299													23	53	---	---	---	---	PASS
SGPL1	8879	broad.mit.edu	37	10	72633330	72633330	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72633330C>T	uc001jrm.2	+	12	1504	c.1282C>T	c.(1282-1284)CGC>TGC	p.R428C	SGPL1_uc009xqk.2_Intron	NM_003901	NP_003892	O95470	SGPL1_HUMAN	sphingosine-1-phosphate lyase 1	428	Cytoplasmic (Potential).				apoptosis|carboxylic acid metabolic process|ceramide metabolic process|sphingolipid catabolic process	integral to endoplasmic reticulum membrane	carboxy-lyase activity|pyridoxal phosphate binding|sphinganine-1-phosphate aldolase activity				0					Pyridoxal Phosphate(DB00114)	CAAAACTGCTCGCTTCCTCAA	0.512													64	139	---	---	---	---	PASS
PANK1	53354	broad.mit.edu	37	10	91348401	91348401	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:91348401C>T	uc001kgp.1	-						PANK1_uc001kgn.1_Intron|PANK1_uc001kgo.1_Intron|PANK1_uc009xtu.1_Intron	NM_148977	NP_683878	Q8TE04	PANK1_HUMAN	pantothenate kinase 1 isoform alpha						coenzyme A biosynthetic process|pantothenate metabolic process	cytosol|nucleus	ATP binding|pantothenate kinase activity				0					Bezafibrate(DB01393)	TATGCAAGCTCAACCTACCTC	0.398													36	91	---	---	---	---	PASS
GBF1	8729	broad.mit.edu	37	10	104139678	104139678	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:104139678G>A	uc001kux.1	+	36	5082	c.4842G>A	c.(4840-4842)GAG>GAA	p.E1614E	GBF1_uc001kuy.1_Silent_p.E1610E|GBF1_uc001kuz.1_Silent_p.E1611E	NM_004193	NP_004184	Q92538	GBF1_HUMAN	golgi-specific brefeldin A resistant guanine	1614					COPI coating of Golgi vesicle|post-Golgi vesicle-mediated transport|regulation of ARF protein signal transduction|retrograde vesicle-mediated transport, Golgi to ER	Golgi membrane	ARF guanyl-nucleotide exchange factor activity|protein binding			ovary(1)|central_nervous_system(1)	2		Colorectal(252;0.0236)		Epithelial(162;5.16e-08)|all cancers(201;1.19e-06)		GGATGGAGGAGACCCGGATGA	0.552													14	31	---	---	---	---	PASS
COL17A1	1308	broad.mit.edu	37	10	105810396	105810396	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105810396C>G	uc001kxr.2	-	27	2280	c.2111G>C	c.(2110-2112)GGA>GCA	p.G704A	MIR936_hsa-mir-936|MI0005758_5'Flank	NM_000494	NP_000485	Q9UMD9	COHA1_HUMAN	alpha 1 type XVII collagen	704	Extracellular (Potential).|Triple-helical region.				cell-matrix adhesion|epidermis development|hemidesmosome assembly	basement membrane|cell-cell junction|collagen|hemidesmosome|integral to plasma membrane	protein binding			ovary(4)|pancreas(1)	5		Colorectal(252;0.103)|Breast(234;0.122)		Epithelial(162;2.5e-09)|all cancers(201;7.94e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0165)		TCCTGGTGGTCCCATTGGTCC	0.542													7	208	---	---	---	---	PASS
C10orf79	80217	broad.mit.edu	37	10	105924061	105924061	+	Intron	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105924061G>C	uc001kxw.2	-						C10orf79_uc009xxq.2_Intron	NM_025145	NP_079421	Q8NDM7	WDR96_HUMAN	hypothetical protein LOC80217												0		Colorectal(252;0.178)		Epithelial(162;4.83e-10)|all cancers(201;2.26e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0194)		ATGATATCCTGAAATATTAAC	0.299													7	14	---	---	---	---	PASS
DCLRE1A	9937	broad.mit.edu	37	10	115602142	115602142	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:115602142G>A	uc001law.2	-	6	3543	c.2625C>T	c.(2623-2625)GTC>GTT	p.V875V		NM_014881	NP_055696	Q6PJP8	DCR1A_HUMAN	DNA cross-link repair 1A	875					cell division|mitosis	nucleus	hydrolase activity			skin(2)	2				Epithelial(162;0.0157)|all cancers(201;0.0171)		AAGTGCCACAGACAACAAGAG	0.393								Direct_reversal_of_damage|Other_identified_genes_with_known_or_suspected_DNA_repair_function					65	164	---	---	---	---	PASS
ATRNL1	26033	broad.mit.edu	37	10	117093788	117093788	+	Intron	SNP	T	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:117093788T>C	uc001lcg.2	+						ATRNL1_uc010qsm.1_Intron|ATRNL1_uc010qsn.1_Intron	NM_207303	NP_997186	Q5VV63	ATRN1_HUMAN	attractin-like 1 precursor							integral to membrane	sugar binding			ovary(5)|lung(1)|central_nervous_system(1)	7		all_lung(145;0.0686)|Breast(234;0.0969)|Lung NSC(174;0.17)|Colorectal(252;0.234)		Epithelial(162;0.00031)|all cancers(201;0.000753)|LUSC - Lung squamous cell carcinoma(1;0.0515)|Lung(30;0.0827)		ACTGTTTCCTTTAGCTTGCCA	0.338													4	59	---	---	---	---	PASS
DMBT1	1755	broad.mit.edu	37	10	124345695	124345695	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124345695G>T	uc001lgk.1	+	16	1685	c.1579G>T	c.(1579-1581)GAT>TAT	p.D527Y	DMBT1_uc001lgl.1_Missense_Mutation_p.D517Y|DMBT1_uc001lgm.1_Intron|DMBT1_uc009xzz.1_Missense_Mutation_p.D527Y|DMBT1_uc010qtx.1_Intron|DMBT1_uc009yaa.1_Intron	NM_007329	NP_015568	Q9UGM3	DMBT1_HUMAN	deleted in malignant brain tumors 1 isoform b	527	SRCR 4.				epithelial cell differentiation|induction of bacterial agglutination|innate immune response|interspecies interaction between organisms|protein transport|response to virus	extrinsic to membrane|phagocytic vesicle membrane|zymogen granule membrane	calcium-dependent protein binding|Gram-negative bacterial cell surface binding|Gram-positive bacterial cell surface binding|pattern recognition receptor activity|scavenger receptor activity|zymogen binding			central_nervous_system(7)	7		all_neural(114;0.0765)|Lung NSC(174;0.132)|all_lung(145;0.163)|Breast(234;0.238)				GGACACCAATGATGCCAATGT	0.612													189	115	---	---	---	---	PASS
TCERG1L	256536	broad.mit.edu	37	10	133106525	133106525	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:133106525G>A	uc001lkp.2	-	3	705	c.619C>T	c.(619-621)CCT>TCT	p.P207S		NM_174937	NP_777597	Q5VWI1	TCRGL_HUMAN	transcription elongation regulator 1-like	207										large_intestine(2)|ovary(2)	4		all_cancers(35;1.22e-10)|all_epithelial(44;2.65e-09)|Lung NSC(174;0.00188)|all_lung(145;0.00307)|Melanoma(40;0.0179)|all_neural(114;0.0424)|Breast(234;0.0743)|Colorectal(57;0.09)		all cancers(32;0.000899)|OV - Ovarian serous cystadenocarcinoma(35;0.0021)|Epithelial(32;0.00276)		CTGGAGGCAGGAGCCGGCCTG	0.517													13	21	---	---	---	---	PASS
ZNF511	118472	broad.mit.edu	37	10	135125334	135125334	+	Silent	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:135125334C>A	uc001lml.1	+	5	694	c.669C>A	c.(667-669)ATC>ATA	p.I223I	TUBGCP2_uc001lmg.1_5'Flank|TUBGCP2_uc010qvc.1_5'Flank|TUBGCP2_uc009ybk.1_5'Flank|TUBGCP2_uc010qvd.1_5'Flank|TUBGCP2_uc001lmh.1_RNA|ZNF511_uc001lmj.1_Silent_p.I223I|ZNF511_uc001lmk.1_3'UTR|ZNF511_uc001lmm.1_RNA			Q8NB15	ZN511_HUMAN	SubName: Full=cDNA FLJ78327; SubName: Full=Zinc finger protein 511, isoform CRA_d;	223					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(35;7.01e-07)|all_epithelial(44;1.45e-05)|Lung NSC(174;0.027)|all_lung(145;0.0384)|all_neural(114;0.0726)|Glioma(114;0.172)|Melanoma(40;0.175)		all cancers(32;7.56e-06)|OV - Ovarian serous cystadenocarcinoma(35;8.15e-06)|Epithelial(32;9.99e-06)		AGAGGCGGATCTACAGACATA	0.592													39	92	---	---	---	---	PASS
MUC5B	727897	broad.mit.edu	37	11	1270773	1270773	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1270773C>G	uc009ycr.1	+	51	14208	c.14082C>G	c.(14080-14082)TTC>TTG	p.F4694L	MUC5B_uc001ltb.2_Missense_Mutation_p.F4224L	NM_017511	NP_059981	Q9HC84	MUC5B_HUMAN	SubName: Full=Mucin 5AC, oligomeric mucus/gel-forming;	4221	7 X Cys-rich subdomain repeats.|Thr-rich.|Cys-rich subdomain 7.				cell adhesion	extracellular region	extracellular matrix structural constituent|protein binding				0		all_cancers(49;6.97e-08)|all_epithelial(84;3.45e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		BRCA - Breast invasive adenocarcinoma(625;0.00141)|Lung(200;0.0853)|LUSC - Lung squamous cell carcinoma(625;0.1)		TCCGTGTGTTCTGCTGCAACT	0.607													9	107	---	---	---	---	PASS
LMO1	4004	broad.mit.edu	37	11	8246193	8246193	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:8246193G>A	uc001mgg.1	-	4	938	c.441C>T	c.(439-441)CTC>CTT	p.L147L	LMO1_uc009yfo.1_RNA|LMO1_uc001mgh.1_Silent_p.L146L	NM_002315	NP_002306	P25800	RBTN1_HUMAN	LIM domain only 1	147	LIM zinc-binding 2.				cell proliferation|multicellular organismal development|positive regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding transcription factor activity|zinc ion binding				0				Epithelial(150;1.59e-07)|BRCA - Breast invasive adenocarcinoma(625;0.203)		AGGTGCCATTGAGCTGCCCTT	0.368			T|A	TRD@	T-ALL|neuroblastoma	neuroblastoma							6	8	---	---	---	---	PASS
IGSF22	283284	broad.mit.edu	37	11	18736049	18736049	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:18736049C>G	uc009yht.2	-	12	1844	c.1654G>C	c.(1654-1656)GAG>CAG	p.E552Q	IGSF22_uc001mpa.2_RNA	NM_173588	NP_775859	Q8N9C0	IGS22_HUMAN	immunoglobulin superfamily, member 22	552										ovary(4)|large_intestine(2)|kidney(1)	7						CTTCAGACCTCCTTGCCATCC	0.622													97	48	---	---	---	---	PASS
C11orf46	120534	broad.mit.edu	37	11	30352607	30352607	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:30352607G>C	uc001mso.1	+	2	276	c.112G>C	c.(112-114)GAT>CAT	p.D38H		NM_152316	NP_689529	Q8N8R7	CK046_HUMAN	hypothetical protein LOC120534	38											0						GTCATCAAATGATATGCTTTT	0.343													62	30	---	---	---	---	PASS
CKAP5	9793	broad.mit.edu	37	11	46780913	46780913	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46780913C>G	uc001ndi.1	-	34	4584	c.4474G>C	c.(4474-4476)GAG>CAG	p.E1492Q	CKAP5_uc009ylg.1_Missense_Mutation_p.E1378Q|CKAP5_uc001ndj.1_Missense_Mutation_p.E1492Q|CKAP5_uc001ndh.1_Missense_Mutation_p.E421Q	NM_001008938	NP_001008938	Q14008	CKAP5_HUMAN	colonic and hepatic tumor over-expressed protein	1492					cell division|centrosome organization|establishment or maintenance of microtubule cytoskeleton polarity|G2/M transition of mitotic cell cycle|mitotic prometaphase|RNA transport|spindle organization	centrosome|cytosol	protein binding|protein binding			ovary(1)|skin(1)	2						TTGTCATTCTCAATCTCATCT	0.498													52	132	---	---	---	---	PASS
CKAP5	9793	broad.mit.edu	37	11	46783966	46783966	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46783966G>A	uc001ndi.1	-						CKAP5_uc009ylg.1_Intron|CKAP5_uc001ndj.1_Intron|CKAP5_uc001ndh.1_Intron|SNORD67_uc001ndk.2_RNA	NM_001008938	NP_001008938	Q14008	CKAP5_HUMAN	colonic and hepatic tumor over-expressed protein						cell division|centrosome organization|establishment or maintenance of microtubule cytoskeleton polarity|G2/M transition of mitotic cell cycle|mitotic prometaphase|RNA transport|spindle organization	centrosome|cytosol	protein binding|protein binding			ovary(1)|skin(1)	2						CTGTGCACTTGATTTTGTCAC	0.453													120	238	---	---	---	---	PASS
CKAP5	9793	broad.mit.edu	37	11	46784554	46784554	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46784554G>C	uc001ndi.1	-	30	3973	c.3863C>G	c.(3862-3864)TCT>TGT	p.S1288C	CKAP5_uc009ylg.1_Missense_Mutation_p.S1174C|CKAP5_uc001ndj.1_Missense_Mutation_p.S1288C|CKAP5_uc001ndh.1_Missense_Mutation_p.S217C|SNORD67_uc001ndk.2_5'Flank	NM_001008938	NP_001008938	Q14008	CKAP5_HUMAN	colonic and hepatic tumor over-expressed protein	1288	HEAT 8.				cell division|centrosome organization|establishment or maintenance of microtubule cytoskeleton polarity|G2/M transition of mitotic cell cycle|mitotic prometaphase|RNA transport|spindle organization	centrosome|cytosol	protein binding|protein binding			ovary(1)|skin(1)	2						GATGAAGGAAGATGCTTCATT	0.408													43	63	---	---	---	---	PASS
CKAP5	9793	broad.mit.edu	37	11	46784576	46784576	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:46784576G>A	uc001ndi.1	-	30	3951	c.3841C>T	c.(3841-3843)CAT>TAT	p.H1281Y	CKAP5_uc009ylg.1_Missense_Mutation_p.H1167Y|CKAP5_uc001ndj.1_Missense_Mutation_p.H1281Y|CKAP5_uc001ndh.1_Missense_Mutation_p.H210Y|SNORD67_uc001ndk.2_5'Flank	NM_001008938	NP_001008938	Q14008	CKAP5_HUMAN	colonic and hepatic tumor over-expressed protein	1281					cell division|centrosome organization|establishment or maintenance of microtubule cytoskeleton polarity|G2/M transition of mitotic cell cycle|mitotic prometaphase|RNA transport|spindle organization	centrosome|cytosol	protein binding|protein binding			ovary(1)|skin(1)	2						TCAGTAAGATGATATTCTTCT	0.423													59	87	---	---	---	---	PASS
OR4C16	219428	broad.mit.edu	37	11	55340452	55340452	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55340452G>A	uc010rih.1	+	1	849	c.849G>A	c.(847-849)GTG>GTA	p.V283V		NM_001004701	NP_001004701	Q8NGL9	OR4CG_HUMAN	olfactory receptor, family 4, subfamily C,	283	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2		all_epithelial(135;0.0748)				TCAACCCTGTGATTTACACGC	0.378													19	55	---	---	---	---	PASS
OR4C6	219432	broad.mit.edu	37	11	55432918	55432918	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55432918C>T	uc001nht.3	+	3	541	c.276C>T	c.(274-276)CTC>CTT	p.L92L	OR4C6_uc010rik.1_Silent_p.L92L	NM_001004704	NP_001004704	Q8NH72	OR4C6_HUMAN	olfactory receptor, family 4, subfamily C,	92	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2						CCATCTCTCTCAAAGGCTGCC	0.502													50	95	---	---	---	---	PASS
SSRP1	6749	broad.mit.edu	37	11	57095214	57095214	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57095214C>A	uc001njt.2	-	14	2021	c.1754G>T	c.(1753-1755)TGG>TTG	p.W585L	TNKS1BP1_uc001njs.2_5'Flank|TNKS1BP1_uc009ymd.1_5'Flank	NM_003146	NP_003137	Q08945	SSRP1_HUMAN	structure specific recognition protein 1	585	HMG box.				DNA repair|DNA replication|positive regulation of viral transcription|regulation of transcription, DNA-dependent|transcription elongation from RNA polymerase II promoter|viral reproduction	chromosome|cytoplasm|nucleoplasm	DNA binding|protein binding			ovary(2)	2						CATTCCCTTCCAGATCTCGCC	0.547													5	186	---	---	---	---	PASS
OR9Q1	219956	broad.mit.edu	37	11	57947066	57947066	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57947066C>T	uc001nmj.2	+	3	466	c.150C>T	c.(148-150)CTC>CTT	p.L50L		NM_001005212	NP_001005212	Q8NGQ5	OR9Q1_HUMAN	olfactory receptor, family 9, subfamily Q,	50	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(21;0.222)				TTCTGATCCTCATGGATCACC	0.458													97	209	---	---	---	---	PASS
KRTAP5-8	57830	broad.mit.edu	37	11	71249659	71249659	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:71249659G>C	uc001oqr.1	+	1	589	c.558G>C	c.(556-558)AAG>AAC	p.K186N		NM_021046	NP_066384	O75690	KRA58_HUMAN	keratin associated protein 5-8	186						extracellular region|keratin filament	structural constituent of epidermis				0						GCCAGTGCAAGATCTGAGGCT	0.557													94	161	---	---	---	---	PASS
INTS4	92105	broad.mit.edu	37	11	77590061	77590061	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:77590061G>A	uc001oys.2	-	23	2854	c.2826C>T	c.(2824-2826)ATC>ATT	p.I942I	C11orf67_uc001oyp.2_Intron|C11orf67_uc001oyr.1_Intron|INTS4_uc001oyt.2_RNA	NM_033547	NP_291025	Q96HW7	INT4_HUMAN	integrator complex subunit 4	942					snRNA processing	integrator complex	protein binding			ovary(2)	2	all_cancers(14;4.53e-19)|all_epithelial(13;1.73e-21)|Breast(9;2.71e-16)|Ovarian(111;0.152)		Epithelial(5;1.13e-46)|all cancers(3;8.92e-44)|BRCA - Breast invasive adenocarcinoma(5;8.4e-26)|OV - Ovarian serous cystadenocarcinoma(8;1.05e-23)			TGGTGCCCTCGATGCTGGTTT	0.537													77	144	---	---	---	---	PASS
INTS4	92105	broad.mit.edu	37	11	77614602	77614602	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:77614602G>A	uc001oys.2	-	17	2109	c.2081C>T	c.(2080-2082)TCA>TTA	p.S694L	C11orf67_uc001oyp.2_Intron|INTS4_uc001oyt.2_RNA	NM_033547	NP_291025	Q96HW7	INT4_HUMAN	integrator complex subunit 4	694					snRNA processing	integrator complex	protein binding			ovary(2)	2	all_cancers(14;4.53e-19)|all_epithelial(13;1.73e-21)|Breast(9;2.71e-16)|Ovarian(111;0.152)		Epithelial(5;1.13e-46)|all cancers(3;8.92e-44)|BRCA - Breast invasive adenocarcinoma(5;8.4e-26)|OV - Ovarian serous cystadenocarcinoma(8;1.05e-23)			CGCTGCTGCTGAGGCCAAATC	0.483													15	37	---	---	---	---	PASS
PCF11	51585	broad.mit.edu	37	11	82880510	82880510	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:82880510C>T	uc001ozx.3	+	8	3478	c.3133C>T	c.(3133-3135)CAG>TAG	p.Q1045*	PCF11_uc010rsu.1_Nonsense_Mutation_p.Q1176*	NM_015885	NP_056969	O94913	PCF11_HUMAN	pre-mRNA cleavage complex II protein Pcf11	1045	Gly-rich.				mRNA 3'-end processing|mRNA cleavage|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	mRNA cleavage factor complex				ovary(1)	1						GCAGCCAGGTCAGCCGTCACT	0.517													18	34	---	---	---	---	PASS
MRE11A	4361	broad.mit.edu	37	11	94192676	94192676	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:94192676C>T	uc001peu.2	-	13	1587	c.1398G>A	c.(1396-1398)GAG>GAA	p.E466E	MRE11A_uc001pev.2_Silent_p.E466E|MRE11A_uc009ywj.2_Silent_p.E469E	NM_005591	NP_005582	P49959	MRE11_HUMAN	meiotic recombination 11 homolog A isoform 1	466					DNA duplex unwinding|double-strand break repair via homologous recombination|double-strand break repair via nonhomologous end joining|negative regulation of DNA endoreduplication|positive regulation of kinase activity|positive regulation of protein autophosphorylation|reciprocal meiotic recombination|regulation of mitotic recombination|sister chromatid cohesion|telomere maintenance via telomerase	Mre11 complex|nucleoplasm	3'-5' exonuclease activity|double-stranded DNA binding|manganese ion binding|protein C-terminus binding|single-stranded DNA specific endodeoxyribonuclease activity			breast(4)|lung(1)	5		Acute lymphoblastic leukemia(157;2.37e-05)|all_hematologic(158;0.00824)				TGGCATCTTTCTCCTCCTTGT	0.413								Homologous_recombination	Ataxia-Telangiectasia-Like_Disorder				63	89	---	---	---	---	PASS
DYNC2H1	79659	broad.mit.edu	37	11	103026188	103026188	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:103026188C>G	uc001pho.2	+	25	3846	c.3702C>G	c.(3700-3702)CTC>CTG	p.L1234L	DYNC2H1_uc001phn.1_Silent_p.L1234L|DYNC2H1_uc009yxe.1_Intron	NM_001080463	NP_001073932	Q8NCM8	DYHC2_HUMAN	dynein, cytoplasmic 2, heavy chain 1	1234	Stem (By similarity).				cell projection organization|Golgi organization|microtubule-based movement|multicellular organismal development	cilium axoneme|dynein complex|Golgi apparatus|microtubule|plasma membrane	ATP binding|ATPase activity|microtubule motor activity				0		Acute lymphoblastic leukemia(157;0.000966)|all_hematologic(158;0.00348)		BRCA - Breast invasive adenocarcinoma(274;0.000177)|Epithelial(105;0.0785)		GTGATTTGCTCAGAGTAGCTG	0.408													14	41	---	---	---	---	PASS
USP28	57646	broad.mit.edu	37	11	113698046	113698046	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113698046C>T	uc001poh.2	-	11	1129	c.1096G>A	c.(1096-1098)GAA>AAA	p.E366K	USP28_uc001pog.2_Missense_Mutation_p.E74K|USP28_uc010rwy.1_Missense_Mutation_p.E241K|USP28_uc001poi.2_5'UTR|USP28_uc001poj.3_Missense_Mutation_p.E366K	NM_020886	NP_065937	Q96RU2	UBP28_HUMAN	ubiquitin specific protease 28	366					cell proliferation|DNA damage checkpoint|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA repair|protein deubiquitination|response to ionizing radiation|ubiquitin-dependent protein catabolic process	nucleolus|nucleoplasm	protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			lung(2)|breast(2)|ovary(1)|large_intestine(1)|kidney(1)	7		all_cancers(61;3.74e-18)|all_epithelial(67;3.75e-11)|Melanoma(852;1.46e-05)|all_hematologic(158;4.65e-05)|Acute lymphoblastic leukemia(157;0.000967)|Breast(348;0.0101)|Prostate(24;0.0153)|all_neural(223;0.0281)|Medulloblastoma(222;0.0425)		BRCA - Breast invasive adenocarcinoma(274;3.93e-06)|Epithelial(105;0.000122)|all cancers(92;0.00104)		CTTGAGAGTTCAAAGGTCAAC	0.363													22	58	---	---	---	---	PASS
SORL1	6653	broad.mit.edu	37	11	121491799	121491799	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:121491799C>G	uc001pxx.2	+	44	5996	c.5916C>G	c.(5914-5916)CTC>CTG	p.L1972L	SORL1_uc010rzp.1_Silent_p.L818L|SORL1_uc010rzq.1_Silent_p.L587L	NM_003105	NP_003096	Q92673	SORL_HUMAN	sortilin-related receptor containing LDLR class	1972	Extracellular (Potential).|Fibronectin type-III 5.		L -> V (in a colorectal cancer sample; somatic mutation).		cholesterol metabolic process|lipid transport|receptor-mediated endocytosis	integral to plasma membrane|low-density lipoprotein particle	low-density lipoprotein particle binding|transmembrane receptor activity	p.L1972V(1)		ovary(5)|breast(4)|large_intestine(2)|skin(2)|central_nervous_system(1)|pancreas(1)	15		Breast(109;0.00119)|Medulloblastoma(222;0.0429)|all_neural(223;0.113)		BRCA - Breast invasive adenocarcinoma(274;3.34e-05)|OV - Ovarian serous cystadenocarcinoma(223;0.108)		TCAAAGATCTCATAAGAAAGA	0.398													23	47	---	---	---	---	PASS
FLI1	2313	broad.mit.edu	37	11	128642778	128642778	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:128642778G>A	uc010sbu.1	+	4	828	c.487G>A	c.(487-489)GAT>AAT	p.D163N	FLI1_uc010sbt.1_Intron|FLI1_uc010sbv.1_Missense_Mutation_p.D130N|FLI1_uc009zci.2_Missense_Mutation_p.D97N	NM_002017	NP_002008	Q01543	FLI1_HUMAN	Friend leukemia virus integration 1	163	PNT.				hemostasis|organ morphogenesis	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity		EWSR1/FLI1(2266)	bone(2210)|soft_tissue(48)|autonomic_ganglia(4)|central_nervous_system(4)|lung(3)|ovary(2)|pancreas(2)	2273	all_hematologic(175;0.0641)	Lung NSC(97;0.00588)|all_lung(97;0.00764)|Breast(109;0.0115)|Medulloblastoma(222;0.0523)|all_neural(223;0.0862)|all_hematologic(192;0.182)		OV - Ovarian serous cystadenocarcinoma(99;0.01)|LUSC - Lung squamous cell carcinoma(976;0.0324)|Lung(977;0.0327)		CCAGAACATGGATGGCAAGGA	0.522			T	EWSR1	Ewing sarcoma								5	247	---	---	---	---	PASS
LEPREL2	10536	broad.mit.edu	37	12	6948234	6948234	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6948234G>A	uc001qra.1	+	16	2010	c.1976G>A	c.(1975-1977)TGG>TAG	p.W659*	LEPREL2_uc001qqz.1_Nonsense_Mutation_p.W466*|LEPREL2_uc001qrb.1_Nonsense_Mutation_p.W466*|GNB3_uc001qrc.2_5'Flank|GNB3_uc001qrd.2_5'Flank|GNB3_uc009zfe.2_5'Flank	NM_014262	NP_055077	Q8IVL6	P3H3_HUMAN	leprecan-like 2 precursor	659	Fe2OG dioxygenase.				negative regulation of cell proliferation	endoplasmic reticulum	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|procollagen-proline 3-dioxygenase activity				0					L-Proline(DB00172)|Succinic acid(DB00139)|Vitamin C(DB00126)	CATGGGGTGTGGGCCGTGACT	0.667													19	32	---	---	---	---	PASS
CD163	9332	broad.mit.edu	37	12	7637945	7637945	+	Silent	SNP	A	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7637945A>G	uc001qsz.3	-	11	2654	c.2526T>C	c.(2524-2526)TTT>TTC	p.F842F	CD163_uc001qta.3_Silent_p.F842F|CD163_uc009zfw.2_Silent_p.F875F	NM_004244	NP_004235	Q86VB7	C163A_HUMAN	CD163 antigen isoform a	842	SRCR 8.|Extracellular (Potential).				acute-phase response	extracellular region|integral to plasma membrane	protein binding|scavenger receptor activity			ovary(6)|pancreas(1)|skin(1)	8						CTCCATTGTAAAAAACTTCCA	0.498													49	103	---	---	---	---	PASS
NECAP1	25977	broad.mit.edu	37	12	8242798	8242798	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:8242798C>G	uc001qtx.2	+	3	282	c.204C>G	c.(202-204)CTC>CTG	p.L68L	NECAP1_uc001qty.2_5'UTR	NM_015509	NP_056324	Q8NC96	NECP1_HUMAN	NECAP endocytosis associated 1	68					endocytosis|protein transport	clathrin coated vesicle membrane|plasma membrane				ovary(1)	1				Kidney(36;0.0915)		CAGGGGAGCTCTTTGCTCAGG	0.443													3	172	---	---	---	---	PASS
A2M	2	broad.mit.edu	37	12	9229347	9229347	+	Intron	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9229347C>G	uc001qvk.1	-						A2M_uc001qvj.1_Intron|A2M_uc009zgk.1_Intron	NM_000014	NP_000005	P01023	A2MG_HUMAN	alpha-2-macroglobulin precursor						blood coagulation, intrinsic pathway|negative regulation of complement activation, lectin pathway|platelet activation|platelet degranulation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|extracellular space|platelet alpha granule lumen	enzyme binding|GTPase activator activity|interleukin-1 binding|interleukin-8 binding|serine-type endopeptidase inhibitor activity|tumor necrosis factor binding			central_nervous_system(4)|skin(1)	5					Bacitracin(DB00626)|Becaplermin(DB00102)	CAGGTGTGCTCTCACCTTTCT	0.507													23	39	---	---	---	---	PASS
KLRC1	3821	broad.mit.edu	37	12	10601865	10601865	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10601865G>A	uc001qyl.2	-	5	624	c.460C>T	c.(460-462)CTG>TTG	p.L154L	KLRC1_uc009zhm.1_Silent_p.L154L|KLRC1_uc001qym.2_Silent_p.L136L|KLRC1_uc001qyn.2_Silent_p.L154L|KLRC1_uc001qyo.2_Silent_p.L136L	NM_002259	NP_002250	P26715	NKG2A_HUMAN	killer cell lectin-like receptor subfamily C,	154	C-type lectin.|Extracellular (Potential).				cell surface receptor linked signaling pathway|regulation of immune response	integral to plasma membrane	sugar binding|transmembrane receptor activity				0						ATAGAAAGCAGACTGGAGTTC	0.289													96	214	---	---	---	---	PASS
LRP6	4040	broad.mit.edu	37	12	12274181	12274181	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12274181C>A	uc001rah.3	-	23	4863	c.4721G>T	c.(4720-4722)CGA>CTA	p.R1574L	BCL2L14_uc001raf.1_Intron|LRP6_uc010shl.1_Missense_Mutation_p.R1529L	NM_002336	NP_002327	O75581	LRP6_HUMAN	low density lipoprotein receptor-related protein	1574	PPPSP motif C.|Cytoplasmic (Potential).				cellular response to cholesterol|negative regulation of protein phosphorylation|negative regulation of protein serine/threonine kinase activity|negative regulation of smooth muscle cell apoptosis|neural crest formation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of cell cycle|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|positive regulation of Wnt receptor signaling pathway involved in dorsal/ventral axis specification|Wnt receptor signaling pathway involved in dorsal/ventral axis specification	cell surface|cytoplasmic vesicle|endoplasmic reticulum|integral to membrane|plasma membrane	coreceptor activity|frizzled binding|kinase inhibitor activity|low-density lipoprotein receptor activity|protein homodimerization activity|toxin transporter activity|Wnt-protein binding			lung(4)|skin(4)|ovary(2)|kidney(1)|central_nervous_system(1)	12		Prostate(47;0.0865)				GTATTGGCTTCGGGGTGTGGG	0.527													4	223	---	---	---	---	PASS
PLBD1	79887	broad.mit.edu	37	12	14659187	14659187	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14659187G>T	uc001rcc.1	-	10	1549	c.1388C>A	c.(1387-1389)CCT>CAT	p.P463H		NM_024829	NP_079105	Q6P4A8	PLBL1_HUMAN	phospholipase B domain containing 1	463					lipid catabolic process	extracellular region	hydrolase activity				0						TCTACTGTAAGGATCCTTCTT	0.448													20	36	---	---	---	---	PASS
FGD4	121512	broad.mit.edu	37	12	32735220	32735220	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32735220C>T	uc001rkz.2	+	4	896	c.419C>T	c.(418-420)GCA>GTA	p.A140V	FGD4_uc001rlc.2_Missense_Mutation_p.A225V|FGD4_uc001rky.2_5'UTR|FGD4_uc001rla.2_5'UTR|FGD4_uc010ske.1_Missense_Mutation_p.A252V|FGD4_uc001rlb.1_RNA|FGD4_uc001rkx.3_Missense_Mutation_p.A140V	NM_139241	NP_640334	Q96M96	FGD4_HUMAN	FYVE, RhoGEF and PH domain containing 4	140	Actin filament-binding (By similarity).				actin cytoskeleton organization|apoptosis|filopodium assembly|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Cdc42 GTPase activity|regulation of cell shape|small GTPase mediated signal transduction	cytoskeleton|cytosol|filopodium|Golgi apparatus|lamellipodium|ruffle	metal ion binding|Rho guanyl-nucleotide exchange factor activity|small GTPase binding			ovary(2)|central_nervous_system(1)	3	Acute lymphoblastic leukemia(23;0.0122)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.204)					ACAGCTCCTGCATCACCCACA	0.498													40	89	---	---	---	---	PASS
LRRK2	120892	broad.mit.edu	37	12	40728939	40728939	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:40728939C>G	uc001rmg.3	+	40	6049	c.5928C>G	c.(5926-5928)CTC>CTG	p.L1976L	LRRK2_uc009zjw.2_Silent_p.L814L|LRRK2_uc001rmi.2_Silent_p.L809L	NM_198578	NP_940980	Q5S007	LRRK2_HUMAN	leucine-rich repeat kinase 2	1976	Protein kinase.				activation of MAPKK activity|determination of adult lifespan|exploration behavior|intracellular distribution of mitochondria|negative regulation of branching morphogenesis of a nerve|negative regulation of dendritic spine morphogenesis|negative regulation of neuroblast proliferation|negative regulation of neuron maturation|neuromuscular junction development|neuron death|peptidyl-serine phosphorylation|positive regulation of autophagy|positive regulation of dopamine receptor signaling pathway|positive regulation of programmed cell death|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein phosphorylation|positive regulation of protein ubiquitination|protein autophosphorylation|regulation of kidney size|regulation of locomotion|regulation of membrane potential|response to oxidative stress|small GTPase mediated signal transduction|tangential migration from the subventricular zone to the olfactory bulb	external side of mitochondrial outer membrane	ATP binding|GTP binding|GTP-dependent protein kinase activity|GTPase activator activity|MAP kinase kinase activity|protein homodimerization activity|tubulin binding			ovary(12)|stomach(5)|upper_aerodigestive_tract(2)|lung(2)|large_intestine(1)|urinary_tract(1)|pancreas(1)	24	all_cancers(12;0.00108)|Breast(8;0.218)	Lung NSC(34;0.0942)|all_lung(34;0.11)				GGATTGCACTCCACGTAGCTG	0.498													30	57	---	---	---	---	PASS
SCN8A	6334	broad.mit.edu	37	12	52159725	52159725	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52159725G>C	uc001ryw.2	+	16	2993	c.2815G>C	c.(2815-2817)GAG>CAG	p.E939Q	SCN8A_uc010snl.1_Missense_Mutation_p.E804Q|SCN8A_uc001ryy.2_Missense_Mutation_p.E804Q	NM_014191	NP_055006	Q9UQD0	SCN8A_HUMAN	sodium channel, voltage gated, type VIII, alpha	939	II.				axon guidance|myelination|peripheral nervous system development	cytoplasmic membrane-bounded vesicle|node of Ranvier	ATP binding|voltage-gated sodium channel activity			ovary(7)	7				BRCA - Breast invasive adenocarcinoma(357;0.181)	Lamotrigine(DB00555)	GGAGTGGATTGAGACCATGTG	0.488													96	260	---	---	---	---	PASS
SP7	121340	broad.mit.edu	37	12	53722969	53722969	+	Nonsense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53722969G>C	uc001sct.2	-	2	364	c.257C>G	c.(256-258)TCA>TGA	p.S86*	SP7_uc001scu.2_Nonsense_Mutation_p.S68*|SP7_uc001scv.2_Nonsense_Mutation_p.S86*	NM_152860	NP_690599	Q8TDD2	SP7_HUMAN	osterix	86					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						AGCATAGCCTGAGGTGGGTGC	0.572													87	166	---	---	---	---	PASS
SP7	121340	broad.mit.edu	37	12	53723062	53723062	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53723062G>A	uc001sct.2	-	2	271	c.164C>T	c.(163-165)TCA>TTA	p.S55L	SP7_uc001scu.2_Missense_Mutation_p.S37L|SP7_uc001scv.2_Missense_Mutation_p.S55L	NM_152860	NP_690599	Q8TDD2	SP7_HUMAN	osterix	55					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						TTTGGAGGCTGAAAGGTCACT	0.562													97	174	---	---	---	---	PASS
AMHR2	269	broad.mit.edu	37	12	53823280	53823280	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53823280G>A	uc001scx.1	+	8	1089	c.1011G>A	c.(1009-1011)CAG>CAA	p.Q337Q	AMHR2_uc009zmy.1_Silent_p.Q337Q	NM_020547	NP_065434	Q16671	AMHR2_HUMAN	anti-Mullerian hormone receptor, type II isoform	337	Cytoplasmic (Potential).|Protein kinase.				Mullerian duct regression		ATP binding|hormone binding|metal ion binding			ovary(1)|skin(1)	2					Adenosine triphosphate(DB00171)	TGAGCAGCCAGAATGTGCTCA	0.502									Persistant_Mullerian_Duct_Syndrome_(type_I_and_II)				27	81	---	---	---	---	PASS
HOXC5	3222	broad.mit.edu	37	12	54428265	54428265	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54428265G>C	uc001sew.2	+	2	733	c.658G>C	c.(658-660)GAG>CAG	p.E220Q	HOXC5_uc001set.2_RNA|HOXC4_uc001seu.2_Intron	NM_018953	NP_061826	Q00444	HXC5_HUMAN	homeobox C5	220					regulation of transcription from RNA polymerase II promoter	cell junction|nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0						GAAAAGCAAAGAGGCTCTTTA	0.522													20	37	---	---	---	---	PASS
HOXC4	3221	broad.mit.edu	37	12	54447709	54447709	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:54447709G>C	uc001seu.2	+	3	683	c.3G>C	c.(1-3)ATG>ATC	p.M1I	HOXC4_uc001sex.2_Missense_Mutation_p.M1I	NM_014620	NP_055435	P09017	HXC4_HUMAN	homeobox C4	1						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1						AGAAATTAATGATCATGAGCT	0.413													36	61	---	---	---	---	PASS
SLC39A5	283375	broad.mit.edu	37	12	56625235	56625235	+	Silent	SNP	G	A	A	rs148881378		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56625235G>A	uc010sqj.1	+	4	434	c.177G>A	c.(175-177)GCG>GCA	p.A59A	SLC39A5_uc010sqi.1_Intron|SLC39A5_uc010sqk.1_Silent_p.A59A	NM_173596	NP_775867	Q6ZMH5	S39A5_HUMAN	solute carrier family 39 (metal ion	59	Extracellular (By similarity).				zinc ion transport	basolateral plasma membrane|integral to membrane	metal ion transmembrane transporter activity			ovary(1)|skin(1)	2						GGGGCTTGGCGCGGCTTCTCC	0.647													51	68	---	---	---	---	PASS
LRP1	4035	broad.mit.edu	37	12	57578643	57578643	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57578643G>A	uc001snd.2	+	39	6674	c.6208G>A	c.(6208-6210)GAT>AAT	p.D2070N		NM_002332	NP_002323	Q07954	LRP1_HUMAN	low density lipoprotein-related protein 1	2070	LDL-receptor class B 20.|Extracellular (Potential).				aorta morphogenesis|apoptotic cell clearance|negative regulation of platelet-derived growth factor receptor-beta signaling pathway|negative regulation of smooth muscle cell migration|negative regulation of Wnt receptor signaling pathway|positive regulation of cholesterol efflux|regulation of actin cytoskeleton organization|regulation of phospholipase A2 activity	coated pit|integral to plasma membrane|nucleus	apolipoprotein E binding|calcium ion binding|lipoprotein transporter activity|protein complex binding|receptor activity			ovary(8)|lung(3)|breast(3)|large_intestine(2)|central_nervous_system(2)|skin(2)|pancreas(2)	22				BRCA - Breast invasive adenocarcinoma(357;0.0103)	Alteplase(DB00009)|Anistreplase(DB00029)|Antihemophilic Factor(DB00025)|Becaplermin(DB00102)|Coagulation Factor IX(DB00100)|Tenecteplase(DB00031)	GTACTGGTGCGATGCACGGAC	0.587													25	35	---	---	---	---	PASS
GLI1	2735	broad.mit.edu	37	12	57861263	57861263	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:57861263C>T	uc001snx.2	+	9	1138	c.1060C>T	c.(1060-1062)CGG>TGG	p.R354W	GLI1_uc009zpq.2_Missense_Mutation_p.R226W	NM_005269	NP_005260	P08151	GLI1_HUMAN	GLI family zinc finger 1 isoform 1	354	C2H2-type 4.				epidermal cell differentiation|negative regulation of canonical Wnt receptor signaling pathway|osteoblast differentiation|positive regulation of DNA replication|positive regulation of smoothened signaling pathway|positive regulation of transcription from RNA polymerase II promoter	cytosol|nucleus	transcription regulatory region DNA binding|zinc ion binding			skin(4)|ovary(4)|breast(3)|central_nervous_system(1)|urinary_tract(1)|kidney(1)|pancreas(1)	15			GBM - Glioblastoma multiforme(3;3.99e-32)			GCACCAGAATCGGACCCATTC	0.557													6	51	---	---	---	---	PASS
DTX3	196403	broad.mit.edu	37	12	58002422	58002422	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:58002422C>T	uc001sow.1	+	6	1207	c.870C>T	c.(868-870)CTC>CTT	p.L290L	DTX3_uc001sox.1_Silent_p.L283L|DTX3_uc001soy.1_Silent_p.L283L|GEFT_uc009zpy.2_5'Flank|GEFT_uc001soz.1_5'Flank|GEFT_uc001spb.2_5'Flank|GEFT_uc001spa.2_5'Flank	NM_178502	NP_848597	Q8N9I9	DTX3_HUMAN	deltex homolog 3	290					Notch signaling pathway	cytoplasm	zinc ion binding			breast(1)|central_nervous_system(1)	2	Melanoma(17;0.122)					ACCAGCGTCTCACCTTCACTA	0.607													44	61	---	---	---	---	PASS
GNS	2799	broad.mit.edu	37	12	65115473	65115473	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:65115473C>T	uc001ssg.3	-	12	1491	c.1321G>A	c.(1321-1323)GAC>AAC	p.D441N	GNS_uc001ssf.2_Missense_Mutation_p.D385N|GNS_uc010ssq.1_Missense_Mutation_p.D473N|GNS_uc010ssr.1_Missense_Mutation_p.D421N	NM_002076	NP_002067	P15586	GNS_HUMAN	glucosamine (N-acetyl)-6-sulfatase precursor	441						lysosome	metal ion binding|N-acetylglucosamine-6-sulfatase activity|protein binding			central_nervous_system(1)	1	Lung NSC(1;7.25e-14)|all_lung(1;1.25e-12)		LUAD - Lung adenocarcinoma(6;0.115)	GBM - Glioblastoma multiforme(28;0.0435)		CATACACAGTCTGGGAAGCAT	0.418													50	103	---	---	---	---	PASS
HELB	92797	broad.mit.edu	37	12	66696510	66696510	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:66696510G>A	uc001sti.2	+	1	155	c.127G>A	c.(127-129)GAC>AAC	p.D43N	HELB_uc010ssz.1_RNA|HELB_uc009zqt.1_RNA	NM_033647	NP_387467	Q8NG08	HELB_HUMAN	helicase (DNA) B	43					DNA replication, synthesis of RNA primer		ATP binding|ATP-dependent 5'-3' DNA helicase activity|single-stranded DNA-dependent ATP-dependent DNA helicase activity			central_nervous_system(1)|pancreas(1)	2			GBM - Glioblastoma multiforme(2;0.000142)	GBM - Glioblastoma multiforme(28;0.0265)		CGTGTTCATCGACGCCGAGGA	0.652													15	33	---	---	---	---	PASS
TSPAN8	7103	broad.mit.edu	37	12	71526553	71526553	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:71526553G>C	uc009zrt.1	-	6	658	c.496C>G	c.(496-498)CAA>GAA	p.Q166E	TSPAN8_uc001swk.1_Missense_Mutation_p.Q166E|TSPAN8_uc001swj.1_Missense_Mutation_p.Q166E	NM_004616	NP_004607	P19075	TSN8_HUMAN	transmembrane 4 superfamily member 3	166	Extracellular (Potential).				protein glycosylation	integral to membrane|lysosome	signal transducer activity			skin(2)|lung(1)|central_nervous_system(1)	4			LUSC - Lung squamous cell carcinoma(43;0.24)|OV - Ovarian serous cystadenocarcinoma(12;0.244)			GGATAGTGTTGAAAATTATTT	0.358													40	94	---	---	---	---	PASS
UHRF1BP1L	23074	broad.mit.edu	37	12	100502333	100502333	+	Intron	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:100502333G>C	uc001tgq.2	-						UHRF1BP1L_uc001tgr.2_Intron	NM_015054	NP_055869	A0JNW5	UH1BL_HUMAN	UHRF1 (ICBP90) binding protein 1-like isoform a											ovary(2)	2						AAATCTGAAAGAGAATACACA	0.279													17	45	---	---	---	---	PASS
TCHP	84260	broad.mit.edu	37	12	110345389	110345389	+	Missense_Mutation	SNP	G	A	A	rs140118187		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:110345389G>A	uc001tpn.2	+	6	737	c.584G>A	c.(583-585)CGA>CAA	p.R195Q	TCHP_uc001tpo.1_RNA|TCHP_uc001tpp.2_Missense_Mutation_p.R195Q	NM_001143852	NP_001137324	Q9BT92	TCHP_HUMAN	trichoplein	195	Glu-rich.|Interaction with keratin proteins.|Potential.				apoptosis|negative regulation of cell growth	apical cortex|centrosome|keratin filament|mitochondrion|plasma membrane	protein binding			skin(1)	1						GAAAGGGCCCGAAGGGAGGCG	0.517													50	83	---	---	---	---	PASS
ATXN2	6311	broad.mit.edu	37	12	111954009	111954009	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:111954009G>A	uc001tsj.2	-	10	1966	c.1804C>T	c.(1804-1806)CAT>TAT	p.H602Y	ATXN2_uc001tsh.2_Missense_Mutation_p.H337Y|ATXN2_uc001tsi.2_Missense_Mutation_p.H313Y|ATXN2_uc001tsk.2_RNA|ATXN2_uc001tsm.1_Missense_Mutation_p.H337Y	NM_002973	NP_002964	Q99700	ATX2_HUMAN	ataxin 2	602	Pro-rich.				cell death|cytoplasmic mRNA processing body assembly|regulation of translation|RNA metabolic process|RNA transport|stress granule assembly	nucleus|perinuclear region of cytoplasm|polysome|stress granule|trans-Golgi network	protein C-terminus binding|RNA binding			ovary(1)|breast(1)	2						GGAGAACCATGAGCAGAGGGG	0.552													27	47	---	---	---	---	PASS
C12orf51	283450	broad.mit.edu	37	12	112690221	112690221	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112690221C>T	uc009zwc.2	-						C12orf51_uc010syk.1_Intron|C12orf51_uc001tts.2_Intron|C12orf51_uc001ttt.3_Intron	NM_001109662	NP_001103132			chromosome 12 open reading frame 51											ovary(1)|lung(1)	2						TGGTTAGATTCAAGTACCTGA	0.453													57	110	---	---	---	---	PASS
RPL6	6128	broad.mit.edu	37	12	112846139	112846139	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112846139C>T	uc001ttu.2	-	3	470	c.241G>A	c.(241-243)GAA>AAA	p.E81K	RPL6_uc001ttv.2_Missense_Mutation_p.E81K|RPL6_uc009zwd.1_3'UTR	NM_001024662	NP_001019833	Q02878	RL6_HUMAN	ribosomal protein L6	81					endocrine pancreas development|regulation of transcription, DNA-dependent|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit	DNA binding|RNA binding|structural constituent of ribosome			large_intestine(1)	1						TTTTTCTTTTCAACCTACAAG	0.443													56	112	---	---	---	---	PASS
KSR2	283455	broad.mit.edu	37	12	117993045	117993045	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:117993045G>A	uc001two.2	-	9	1415	c.1360C>T	c.(1360-1362)CTA>TTA	p.L454L		NM_173598	NP_775869	Q6VAB6	KSR2_HUMAN	kinase suppressor of ras 2	483					intracellular signal transduction	cytoplasm|membrane	ATP binding|metal ion binding|protein serine/threonine kinase activity			lung(10)|central_nervous_system(2)|stomach(1)|large_intestine(1)|breast(1)	15	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)					GGCTTCCGTAGAGGGTTGTTG	0.507													18	44	---	---	---	---	PASS
PIWIL1	9271	broad.mit.edu	37	12	130827568	130827568	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:130827568C>T	uc001uik.2	+	3	202	c.112C>T	c.(112-114)CAG>TAG	p.Q38*	PIWIL1_uc001uij.1_Nonsense_Mutation_p.Q38*	NM_004764	NP_004755	Q96J94	PIWL1_HUMAN	piwi-like 1	38					gene silencing by RNA|meiosis|multicellular organismal development|regulation of translation|spermatid development	chromatoid body|P granule	mRNA binding|piRNA binding|protein binding			ovary(2)	2	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;3.02e-06)|Epithelial(86;3.85e-05)|all cancers(50;4.65e-05)		GCCTAGGCCTCAGCCGCCACC	0.478													26	49	---	---	---	---	PASS
FREM2	341640	broad.mit.edu	37	13	39424215	39424215	+	Missense_Mutation	SNP	C	A	A	rs144582052		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:39424215C>A	uc001uwv.2	+	9	6729	c.6420C>A	c.(6418-6420)AGC>AGA	p.S2140R	FREM2_uc001uww.2_Missense_Mutation_p.S226R	NM_207361	NP_997244	Q5SZK8	FREM2_HUMAN	FRAS1-related extracellular matrix protein 2	2140	Extracellular (Potential).|Calx-beta 4.				cell communication|homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(7)|pancreas(1)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|skin(1)	11		Lung NSC(96;1.04e-07)|Prostate(109;0.00384)|Breast(139;0.00396)|Lung SC(185;0.0565)|Hepatocellular(188;0.114)		all cancers(112;3.32e-07)|Epithelial(112;1.66e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.00154)|BRCA - Breast invasive adenocarcinoma(63;0.00631)|GBM - Glioblastoma multiforme(144;0.0312)		ATACTGGCAGCGAAAGTGATG	0.433													3	53	---	---	---	---	PASS
PCDH17	27253	broad.mit.edu	37	13	58208026	58208026	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:58208026C>T	uc001vhq.1	+	1	2238	c.1346C>T	c.(1345-1347)TCT>TTT	p.S449F	PCDH17_uc010aec.1_Missense_Mutation_p.S449F	NM_001040429	NP_001035519	O14917	PCD17_HUMAN	protocadherin 17 precursor	449	Extracellular (Potential).|Cadherin 4.				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding|protein binding			ovary(3)|pancreas(2)|upper_aerodigestive_tract(1)|skin(1)	7		Lung NSC(96;0.027)|Prostate(109;0.0453)|Breast(118;0.128)|Hepatocellular(98;0.132)		GBM - Glioblastoma multiforme(99;1.06e-05)		GACGGGGGCTCTCCTCCCCTC	0.592													37	23	---	---	---	---	PASS
ERCC5	2073	broad.mit.edu	37	13	103514574	103514574	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:103514574G>A	uc001vpw.2	+	8	1518	c.1075G>A	c.(1075-1077)GAG>AAG	p.E359K	ERCC5_uc001vpu.1_Missense_Mutation_p.E813K|ERCC5_uc010tjb.1_Missense_Mutation_p.E359K|ERCC5_uc010tjc.1_RNA|ERCC5_uc010tjd.1_Missense_Mutation_p.E191K	NM_000123	NP_000114	P28715	ERCC5_HUMAN	XPG-complementing protein	359					negative regulation of apoptosis|nucleotide-excision repair, DNA damage removal|nucleotide-excision repair, DNA incision, 3'-to lesion|response to UV-C|transcription-coupled nucleotide-excision repair|UV protection	nucleoplasm	bubble DNA binding|double-stranded DNA binding|endodeoxyribonuclease activity|metal ion binding|protein homodimerization activity|protein N-terminus binding|single-stranded DNA binding			ovary(4)|lung(1)|central_nervous_system(1)|skin(1)	7	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.211)					TAGCTCAGAAGAGGAGCTGGA	0.517			Mis|N|F			skin basal cell|skin squamous cell|melanoma		Direct_reversal_of_damage|NER	Xeroderma_Pigmentosum				6	245	---	---	---	---	PASS
POTEG	404785	broad.mit.edu	37	14	19553571	19553571	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:19553571C>T	uc001vuz.1	+	1	207	c.155C>T	c.(154-156)TCT>TTT	p.S52F	POTEG_uc001vva.1_RNA|POTEG_uc010ahc.1_RNA	NM_001005356	NP_001005356	Q6S5H5	POTEG_HUMAN	POTE ankyrin domain family, member G	52										ovary(1)	1						CACGACGATTCTGCTATGAAG	0.612													30	491	---	---	---	---	PASS
BAZ1A	11177	broad.mit.edu	37	14	35243591	35243591	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:35243591C>G	uc001wsk.2	-	19	3507	c.2939G>C	c.(2938-2940)AGA>ACA	p.R980T	BAZ1A_uc001wsl.2_Missense_Mutation_p.R948T	NM_013448	NP_038476	Q9NRL2	BAZ1A_HUMAN	bromodomain adjacent to zinc finger domain, 1A	980					chromatin remodeling|regulation of transcription, DNA-dependent|transcription, DNA-dependent	ACF complex	zinc ion binding			lung(2)|central_nervous_system(2)|ovary(1)|breast(1)|skin(1)	7	Breast(36;0.0388)|Hepatocellular(127;0.158)		LUAD - Lung adenocarcinoma(48;7.23e-05)|Lung(238;0.00019)|Epithelial(34;0.0793)|all cancers(34;0.175)	GBM - Glioblastoma multiforme(112;0.0659)		AAGAAAATCTCTCAGCCTTAG	0.388													42	94	---	---	---	---	PASS
BRMS1L	84312	broad.mit.edu	37	14	36333125	36333125	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:36333125C>G	uc001wtl.2	+	6	714	c.588C>G	c.(586-588)TTC>TTG	p.F196L	BRMS1L_uc010tpx.1_Missense_Mutation_p.F148L	NM_032352	NP_115728	Q5PSV4	BRM1L_HUMAN	breast cancer metastasis-suppressor 1-like	196					regulation of growth|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				skin(1)	1	Breast(36;0.137)|Hepatocellular(127;0.158)		Lung(8;1.7e-07)|LUAD - Lung adenocarcinoma(9;3e-07)|Epithelial(34;0.00467)|all cancers(34;0.0157)|BRCA - Breast invasive adenocarcinoma(188;0.158)	GBM - Glioblastoma multiforme(112;0.0333)		AGGATCCTTTCAGTCCTGACA	0.373													3	59	---	---	---	---	PASS
DLGAP5	9787	broad.mit.edu	37	14	55650367	55650367	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:55650367G>A	uc001xbs.2	-	3	560	c.343C>T	c.(343-345)CGA>TGA	p.R115*	DLGAP5_uc001xbt.2_Nonsense_Mutation_p.R115*	NM_014750	NP_055565	Q15398	DLGP5_HUMAN	discs large homolog 7 isoform a	115	Potential.				cell proliferation|cell-cell signaling|mitotic chromosome movement towards spindle pole|positive regulation of mitotic metaphase/anaphase transition	nucleus|spindle pole centrosome	phosphoprotein phosphatase activity|protein binding			ovary(1)|skin(1)	2						AATATTCCTCGTTTAGCTTTC	0.338													23	38	---	---	---	---	PASS
EIF2S1	1965	broad.mit.edu	37	14	67847454	67847454	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:67847454G>C	uc001xjg.2	+	5	693	c.552G>C	c.(550-552)TTG>TTC	p.L184F		NM_004094	NP_004085	P05198	IF2A_HUMAN	eukaryotic translation initiation factor 2,	184						cytosol|eukaryotic translation initiation factor 2 complex|polysome|stress granule	protein binding|ribosome binding|translation initiation factor activity			ovary(1)	1				all cancers(60;0.000683)|OV - Ovarian serous cystadenocarcinoma(108;0.00579)|BRCA - Breast invasive adenocarcinoma(234;0.00937)		ATAGGCGCTTGACCCCACAGG	0.308													33	53	---	---	---	---	PASS
C14orf145	145508	broad.mit.edu	37	14	81259400	81259400	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:81259400G>A	uc001xux.2	-	13	1435	c.1264C>T	c.(1264-1266)CGA>TGA	p.R422*	C14orf145_uc010asz.1_RNA	NM_152446	NP_689659	Q6ZU80	CE128_HUMAN	hypothetical protein LOC145508	422	Potential.					centriole|spindle pole					0				BRCA - Breast invasive adenocarcinoma(234;0.0586)		TCCTTAAGTCGATCCAACATC	0.448													54	87	---	---	---	---	PASS
SPATA7	55812	broad.mit.edu	37	14	88892580	88892580	+	Nonsense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:88892580C>G	uc001xwq.2	+	6	528	c.377C>G	c.(376-378)TCA>TGA	p.S126*	SPATA7_uc001xwr.2_Nonsense_Mutation_p.S94*|SPATA7_uc001xws.2_Nonsense_Mutation_p.S62*|SPATA7_uc001xwt.2_Nonsense_Mutation_p.S20*	NM_018418	NP_060888	Q9P0W8	SPAT7_HUMAN	spermatogenesis-associated protein 7 isoform a	126					response to stimulus|visual perception					ovary(1)	1						TCTTAGCCCTCAGGCGAACCG	0.383													11	37	---	---	---	---	PASS
ZC3H14	79882	broad.mit.edu	37	14	89039025	89039025	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:89039025G>A	uc001xww.2	+	6	760	c.535G>A	c.(535-537)GAT>AAT	p.D179N	ZC3H14_uc010twd.1_Missense_Mutation_p.D179N|ZC3H14_uc010twe.1_Missense_Mutation_p.D179N|ZC3H14_uc001xwx.2_Missense_Mutation_p.D179N|ZC3H14_uc010twf.1_Missense_Mutation_p.D24N|ZC3H14_uc001xwy.2_Missense_Mutation_p.D145N|ZC3H14_uc010twg.1_Missense_Mutation_p.D24N	NM_024824	NP_079100	Q6PJT7	ZC3HE_HUMAN	zinc finger CCCH-type containing 14 isoform 1	179						cytoplasm|cytoplasm|nuclear speck	protein binding|RNA binding|zinc ion binding			ovary(2)|skin(1)	3						GCCAGAACCAGATGATCTCAT	0.443													59	129	---	---	---	---	PASS
KIAA1409	57578	broad.mit.edu	37	14	94152932	94152932	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94152932G>A	uc001ybv.1	+	42	6569	c.6486G>A	c.(6484-6486)GCG>GCA	p.A2162A	KIAA1409_uc001ybs.1_Silent_p.A2140A	NM_020818	NP_065869	Q9P2D8	UNC79_HUMAN	hypothetical protein LOC57578	2317						integral to membrane				ovary(10)|skin(4)|large_intestine(3)	17		all_cancers(154;0.0354)|all_epithelial(191;0.216)		Epithelial(152;0.188)		GGACTGCAGCGATGGAGTGTG	0.507													15	77	---	---	---	---	PASS
C14orf73	91828	broad.mit.edu	37	14	103566795	103566795	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103566795C>T	uc001ymk.2	+	1	315	c.239C>T	c.(238-240)TCC>TTC	p.S80F		NM_001077594	NP_001071062	Q17RC7	EX3L4_HUMAN	hypothetical protein LOC91828	80											0		Melanoma(154;0.155)	Epithelial(46;0.221)			CGGCGAAGCTCCTGCTCCCTG	0.667													3	45	---	---	---	---	PASS
ADAM6	8755	broad.mit.edu	37	14	106306784	106306784	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:106306784G>A	uc010tyt.1	-						uc001yrs.2_Intron|uc001yrt.2_Intron|uc001yrw.1_Intron|uc001yrx.1_Intron|uc001yrz.1_Intron|uc001yse.2_Intron|uc001ysf.2_Intron|uc001ysj.2_Nonsense_Mutation_p.Q363*|uc001ysk.1_Nonsense_Mutation_p.Q363*|uc001ysl.1_Nonsense_Mutation_p.Q363*|uc001ysm.1_Nonsense_Mutation_p.Q306*|uc001ysn.1_Nonsense_Mutation_p.Q306*|uc001yso.1_Nonsense_Mutation_p.Q306*					Parts of antibodies, mostly variable regions.												0						GTGGCTGGCTGAGGGCTGGGC	0.682													3	11	---	---	---	---	PASS
GABRG3	2567	broad.mit.edu	37	15	27222246	27222246	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:27222246C>T	uc001zbg.1	+	2	317	c.151C>T	c.(151-153)CTC>TTC	p.L51F	GABRG3_uc001zbf.2_Missense_Mutation_p.L51F	NM_033223	NP_150092	Q99928	GBRG3_HUMAN	gamma-aminobutyric acid (GABA) A receptor, gamma	51	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity				0		all_lung(180;4.58e-12)|Breast(32;0.000625)|Colorectal(260;0.235)		all cancers(64;3.15e-07)|Epithelial(43;1.17e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0261)		GACTCTTATTCTCAACAAGTT	0.378													51	77	---	---	---	---	PASS
MTMR15	22909	broad.mit.edu	37	15	31197561	31197561	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:31197561G>A	uc001zff.2	+	2	986	c.695G>A	c.(694-696)AGA>AAA	p.R232K	MTMR15_uc001zfc.3_Missense_Mutation_p.R232K|MTMR15_uc010azw.2_Missense_Mutation_p.R232K|MTMR15_uc001zfd.3_Missense_Mutation_p.R232K|MTMR15_uc001zfe.2_5'UTR	NM_014967	NP_055782	Q9Y2M0	FAN1_HUMAN	myotubularin related protein 15 isoform a	232					double-strand break repair via homologous recombination|nucleotide-excision repair, DNA incision	nucleus	5'-3' exonuclease activity|5'-flap endonuclease activity|DNA binding|magnesium ion binding|phosphodiesterase I activity|ubiquitin binding				0		all_lung(180;2.23e-09)		all cancers(64;4.72e-15)|Epithelial(43;5.4e-11)|GBM - Glioblastoma multiforme(186;0.000136)|BRCA - Breast invasive adenocarcinoma(123;0.00402)|Lung(196;0.168)		CATATGGTAAGAGGAAGTAAA	0.403								Direct_reversal_of_damage|Editing_and_processing_nucleases					26	57	---	---	---	---	PASS
AVEN	57099	broad.mit.edu	37	15	34159737	34159737	+	Missense_Mutation	SNP	A	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34159737A>G	uc001zhj.2	-	5	988	c.932T>C	c.(931-933)CTG>CCG	p.L311P		NM_020371	NP_065104	Q9NQS1	AVEN_HUMAN	cell death regulator aven	311					anti-apoptosis|apoptosis	endomembrane system|intracellular|membrane|membrane fraction	protein binding			kidney(1)	1		all_lung(180;1.78e-08)		all cancers(64;1.66e-15)|GBM - Glioblastoma multiforme(113;1.42e-05)|BRCA - Breast invasive adenocarcinoma(123;0.0359)		CTTGGATTTCAGGTCCTGAGA	0.428													3	173	---	---	---	---	PASS
GPR176	11245	broad.mit.edu	37	15	40099335	40099335	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40099335G>A	uc001zkj.1	-	2	1163	c.297C>T	c.(295-297)ATC>ATT	p.I99I	GPR176_uc010uck.1_Silent_p.I39I	NM_007223	NP_009154	Q14439	GP176_HUMAN	G protein-coupled receptor 176	99	Helical; Name=2; (Potential).				synaptic transmission	integral to plasma membrane	G-protein coupled receptor activity			ovary(2)|skin(2)|pancreas(1)|central_nervous_system(1)	6		all_cancers(109;4.05e-15)|all_epithelial(112;2.96e-13)|Lung NSC(122;8.53e-11)|all_lung(180;2.71e-09)|Melanoma(134;0.091)|Colorectal(260;0.198)|Ovarian(310;0.243)		GBM - Glioblastoma multiforme(113;4.4e-06)|BRCA - Breast invasive adenocarcinoma(123;0.123)		TGCTGAGGATGATGTCGAAGG	0.507													97	163	---	---	---	---	PASS
SLC24A5	283652	broad.mit.edu	37	15	48414129	48414129	+	Missense_Mutation	SNP	A	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48414129A>G	uc001zwe.2	+	2	270	c.197A>G	c.(196-198)GAT>GGT	p.D66G	SLC24A5_uc001zwd.2_Missense_Mutation_p.D66G|SLC24A5_uc010bel.2_Intron	NM_205850	NP_995322	Q71RS6	NCKX5_HUMAN	solute carrier family 24, member 5 precursor	66	Extracellular (Potential).				response to stimulus	integral to membrane|melanosome|plasma membrane	calcium, potassium:sodium antiporter activity|symporter activity				0		all_lung(180;0.00217)		all cancers(107;3.29e-10)|GBM - Glioblastoma multiforme(94;7.32e-07)		GAGCGCAGAGATGGAGGCATC	0.418													51	110	---	---	---	---	PASS
FBN1	2200	broad.mit.edu	37	15	48703267	48703267	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48703267C>T	uc001zwx.1	-	66	8864	c.8536G>A	c.(8536-8538)GAA>AAA	p.E2846K	FBN1_uc010beo.1_RNA	NM_000138	NP_000129	P35555	FBN1_HUMAN	fibrillin 1 precursor	2846					heart development|negative regulation of BMP signaling pathway by extracellular sequestering of BMP|negative regulation of transforming growth factor beta receptor signaling pathway by extracellular sequestering of TGFbeta|skeletal system development	basement membrane|extracellular space|microfibril	calcium ion binding|extracellular matrix structural constituent|protein binding			ovary(2)|large_intestine(1)	3		all_lung(180;0.00279)		all cancers(107;4.24e-07)|GBM - Glioblastoma multiforme(94;1.41e-05)		TATTTGTCTTCTAGTTGGTTA	0.383													49	77	---	---	---	---	PASS
MYO5C	55930	broad.mit.edu	37	15	52543640	52543640	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:52543640C>G	uc010bff.2	-	13	1746	c.1609G>C	c.(1609-1611)GAA>CAA	p.E537Q	MYO5C_uc010uga.1_RNA|MYO5C_uc010ugb.1_RNA	NM_018728	NP_061198	Q9NQX4	MYO5C_HUMAN	myosin VC	537	Myosin head-like.					myosin complex	actin binding|ATP binding|calmodulin binding|motor activity			ovary(7)|central_nervous_system(3)|large_intestine(2)|skin(2)	14				all cancers(107;0.0137)		CTAGGCTTTTCAAACAAAGGG	0.398													11	123	---	---	---	---	PASS
MYO5A	4644	broad.mit.edu	37	15	52671836	52671836	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:52671836C>T	uc002aby.2	-	18	2438	c.2194G>A	c.(2194-2196)GAG>AAG	p.E732K	MYO5A_uc002abx.3_Missense_Mutation_p.E732K|MYO5A_uc010uge.1_Missense_Mutation_p.E601K	NM_000259	NP_000250	Q9Y4I1	MYO5A_HUMAN	myosin VA isoform 1	732	Myosin head-like.				actin filament-based movement|transport	cytoplasm|growth cone|myosin complex|ruffle	actin binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(3)|central_nervous_system(1)	4				all cancers(107;0.0085)|Colorectal(133;0.077)|READ - Rectum adenocarcinoma(133;0.196)		ATCAGTTTCTCTAACACATTC	0.433													48	116	---	---	---	---	PASS
CCPG1	9236	broad.mit.edu	37	15	55652788	55652788	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:55652788C>A	uc002acv.1	-	8	1348	c.1183G>T	c.(1183-1185)GCT>TCT	p.A395S	CCPG1_uc002acy.2_Missense_Mutation_p.A395S|CCPG1_uc002acu.1_Missense_Mutation_p.A251S|CCPG1_uc002acw.1_Missense_Mutation_p.A120S|CCPG1_uc002acx.2_Intron|CCPG1_uc010bfk.1_Missense_Mutation_p.A395S|CCPG1_uc002acz.1_Missense_Mutation_p.A395S	NM_020739	NP_065790	Q9ULG6	CCPG1_HUMAN	cell cycle progression 1 isoform 2	395	Potential.|Lumenal (Potential).				cell cycle	integral to membrane				ovary(1)	1				all cancers(107;0.0354)		CCCCTTAAAGCCGTAGTTACT	0.408													26	106	---	---	---	---	PASS
TEX9	374618	broad.mit.edu	37	15	56686955	56686955	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:56686955G>C	uc002adp.2	+	9	756	c.751G>C	c.(751-753)GAA>CAA	p.E251Q	TEX9_uc002ado.1_Missense_Mutation_p.E251Q|TEX9_uc010ugl.1_Missense_Mutation_p.E176Q|TEX9_uc002adq.1_Missense_Mutation_p.E176Q	NM_198524	NP_940926	Q8N6V9	TEX9_HUMAN	testis expressed 9	251	Potential.										0				all cancers(107;0.0394)|GBM - Glioblastoma multiforme(80;0.056)		GTCTCAAGTAGAAAAATACAA	0.303													29	43	---	---	---	---	PASS
CSNK1G1	53944	broad.mit.edu	37	15	64496789	64496789	+	Splice_Site	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:64496789C>G	uc002anf.2	-	9	1331	c.851_splice	c.e9-1	p.E284_splice	CSNK1G1_uc002ane.2_Splice_Site|CSNK1G1_uc002ang.1_Splice_Site_p.E284_splice|CSNK1G1_uc002anh.1_Splice_Site_p.E284_splice|CSNK1G1_uc002anj.2_Splice_Site_p.E266_splice	NM_022048	NP_071331	Q9HCP0	KC1G1_HUMAN	casein kinase 1, gamma 1						Wnt receptor signaling pathway	cytoplasm	ATP binding|protein serine/threonine kinase activity				0						GCCATCTCCTCTGTTAGGAAA	0.438													51	86	---	---	---	---	PASS
DENND4A	10260	broad.mit.edu	37	15	66048590	66048590	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:66048590C>G	uc002aph.2	-	3	577	c.199G>C	c.(199-201)GAT>CAT	p.D67H	DENND4A_uc002api.2_Missense_Mutation_p.D67H|DENND4A_uc002apj.3_Missense_Mutation_p.D67H|DENND4A_uc010ujj.1_Missense_Mutation_p.D67H	NM_005848	NP_005839	Q7Z401	MYCPP_HUMAN	DENN/MADD domain containing 4A isoform 2	67	MABP.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding			ovary(2)|haematopoietic_and_lymphoid_tissue(1)|skin(1)	4						GGGGTAACATCAATACAGATA	0.393													14	32	---	---	---	---	PASS
NPTN	27020	broad.mit.edu	37	15	73889684	73889684	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:73889684C>G	uc002avs.2	-	2	315	c.118G>C	c.(118-120)GAA>CAA	p.E40Q	NPTN_uc010bjc.2_Missense_Mutation_p.E40Q|NPTN_uc002avt.2_Intron|NPTN_uc002avr.2_Intron|NPTN_uc010ula.1_Intron	NM_012428	NP_036560	Q9Y639	NPTN_HUMAN	neuroplastin isoform b precursor	40	Ig-like 1.|Extracellular (Potential).				elevation of cytosolic calcium ion concentration|homophilic cell adhesion|long-term synaptic potentiation|positive regulation of fibroblast growth factor receptor signaling pathway|positive regulation of long-term neuronal synaptic plasticity|positive regulation of neuron projection development|positive regulation of protein phosphorylation	integral to membrane|plasma membrane|presynaptic membrane	cell adhesion molecule binding|type 1 fibroblast growth factor receptor binding				0						AGCTTAGTTTCTGACATGGGC	0.532													19	37	---	---	---	---	PASS
EDC3	80153	broad.mit.edu	37	15	74948272	74948272	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:74948272C>T	uc002ayn.2	-	7	1110	c.622G>A	c.(622-624)GGG>AGG	p.G208R	EDC3_uc002ayo.2_Missense_Mutation_p.G208R|EDC3_uc002aym.2_Missense_Mutation_p.G208R	NM_001142443	NP_001135915	Q96F86	EDC3_HUMAN	enhancer of mRNA decapping 3	208	DFDF.|Required for interaction with DDX6 (By similarity).				exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay	cytoplasmic mRNA processing body|cytosol	protein binding|RNA binding			ovary(1)	1						GCCAGGTTCCCTTCAAAATCA	0.453													57	102	---	---	---	---	PASS
PPCDC	60490	broad.mit.edu	37	15	75335866	75335866	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75335866G>A	uc002azo.2	+	3	333	c.220G>A	c.(220-222)GAT>AAT	p.D74N		NM_021823	NP_068595	Q96CD2	COAC_HUMAN	phosphopantothenoylcysteine decarboxylase	74					coenzyme A biosynthetic process|pantothenate metabolic process	cytosol	phosphopantothenoylcysteine decarboxylase activity				0						CAGCGACGCTGATGAATGGGA	0.557											OREG0023296	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	4	18	---	---	---	---	PASS
FAM108C1	58489	broad.mit.edu	37	15	81042041	81042041	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:81042041C>T	uc002bfu.2	+						FAM108C1_uc002bft.2_Intron	NM_021214	NP_067037	Q6PCB6	F108C_HUMAN	hypothetical protein LOC58489								hydrolase activity				0						CAGGTAAGTTCATGCTTGTCC	0.388													12	28	---	---	---	---	PASS
KIF7	374654	broad.mit.edu	37	15	90190075	90190075	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:90190075C>G	uc002bof.2	-	7	1851	c.1774G>C	c.(1774-1776)GAG>CAG	p.E592Q	KIF7_uc010upw.1_Missense_Mutation_p.E79Q	NM_198525	NP_940927	Q2M1P5	KIF7_HUMAN	kinesin family member 7	592					microtubule-based movement|negative regulation of smoothened signaling pathway|positive regulation of smoothened signaling pathway	cilium	ATP binding|microtubule motor activity|protein binding			ovary(2)|lung(1)	3	Lung NSC(78;0.0237)|all_lung(78;0.0478)		BRCA - Breast invasive adenocarcinoma(143;0.128)			CCCCTCTGCTCAGAGCCAACT	0.662											OREG0023460	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	33	76	---	---	---	---	PASS
IGF1R	3480	broad.mit.edu	37	15	99500353	99500353	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:99500353C>T	uc002bul.2	+	21	3836	c.3786C>T	c.(3784-3786)ATC>ATT	p.I1262I	IGF1R_uc010bon.2_Silent_p.I1261I	NM_000875	NP_000866	P08069	IGF1R_HUMAN	insulin-like growth factor 1 receptor precursor	1262	Protein kinase.|Cytoplasmic (Potential).				anti-apoptosis|immune response|insulin receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of DNA replication|protein autophosphorylation|protein tetramerization	microsome	ATP binding|identical protein binding|insulin binding|insulin receptor binding|insulin receptor substrate binding|insulin-like growth factor I binding|insulin-like growth factor receptor activity|metal ion binding|phosphatidylinositol 3-kinase binding			lung(3)|kidney(3)|ovary(1)|central_nervous_system(1)	8	all_cancers(4;4.17e-14)|all_epithelial(3;4.34e-15)|Lung NSC(78;0.00175)|all_lung(78;0.00351)|Melanoma(26;0.00505)|Medulloblastoma(229;0.163)		Epithelial(2;1.94e-12)|all cancers(5;6.83e-11)|BRCA - Breast invasive adenocarcinoma(2;2.88e-09)|OV - Ovarian serous cystadenocarcinoma(32;0.00261)		Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Mecasermin(DB01277)	TCCTGGAGATCATCAGCAGCA	0.587													46	77	---	---	---	---	PASS
IGF1R	3480	broad.mit.edu	37	15	99500356	99500356	+	Silent	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:99500356C>A	uc002bul.2	+	21	3839	c.3789C>A	c.(3787-3789)ATC>ATA	p.I1263I	IGF1R_uc010bon.2_Silent_p.I1262I	NM_000875	NP_000866	P08069	IGF1R_HUMAN	insulin-like growth factor 1 receptor precursor	1263	Protein kinase.|Cytoplasmic (Potential).				anti-apoptosis|immune response|insulin receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of DNA replication|protein autophosphorylation|protein tetramerization	microsome	ATP binding|identical protein binding|insulin binding|insulin receptor binding|insulin receptor substrate binding|insulin-like growth factor I binding|insulin-like growth factor receptor activity|metal ion binding|phosphatidylinositol 3-kinase binding			lung(3)|kidney(3)|ovary(1)|central_nervous_system(1)	8	all_cancers(4;4.17e-14)|all_epithelial(3;4.34e-15)|Lung NSC(78;0.00175)|all_lung(78;0.00351)|Melanoma(26;0.00505)|Medulloblastoma(229;0.163)		Epithelial(2;1.94e-12)|all cancers(5;6.83e-11)|BRCA - Breast invasive adenocarcinoma(2;2.88e-09)|OV - Ovarian serous cystadenocarcinoma(32;0.00261)		Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Mecasermin(DB01277)	TGGAGATCATCAGCAGCATCA	0.582													43	81	---	---	---	---	PASS
ADAMTS17	170691	broad.mit.edu	37	15	100695466	100695466	+	Nonsense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:100695466G>C	uc002bvv.1	-	9	1320	c.1241C>G	c.(1240-1242)TCA>TGA	p.S414*	ADAMTS17_uc002bvx.1_Nonsense_Mutation_p.S171*	NM_139057	NP_620688	Q8TE56	ATS17_HUMAN	ADAM metallopeptidase with thrombospondin type 1	414	Peptidase M12B.				proteolysis	intracellular|proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(2)|central_nervous_system(1)	3	Lung NSC(78;0.00299)|all_lung(78;0.00457)|Melanoma(26;0.00571)		OV - Ovarian serous cystadenocarcinoma(32;0.0013)|LUSC - Lung squamous cell carcinoma(107;0.132)|Lung(145;0.161)	COAD - Colon adenocarcinoma(1;0.111)|all cancers(203;0.219)		CCACTCTCCTGACATGATGTG	0.527													20	30	---	---	---	---	PASS
SRRM2	23524	broad.mit.edu	37	16	2812813	2812813	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2812813C>G	uc002crk.2	+	11	2833	c.2284C>G	c.(2284-2286)CTC>GTC	p.L762V	SRRM2_uc002crj.1_Missense_Mutation_p.L666V|SRRM2_uc002crl.1_Missense_Mutation_p.L762V|SRRM2_uc010bsu.1_Missense_Mutation_p.L666V	NM_016333	NP_057417	Q9UQ35	SRRM2_HUMAN	splicing coactivator subunit SRm300	762	Arg-rich.|Ser-rich.					Cajal body|catalytic step 2 spliceosome|nuclear speck	C2H2 zinc finger domain binding|protein N-terminus binding|RNA binding			ovary(1)|pancreas(1)|central_nervous_system(1)|skin(1)	4						GAGCAGGTCTCTCTCTTCACC	0.483													84	163	---	---	---	---	PASS
SNN	8303	broad.mit.edu	37	16	11770188	11770188	+	3'UTR	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11770188G>A	uc002dbf.2	+	2						NM_003498	NP_003489	O75324	SNN_HUMAN	Stannin						response to abiotic stimulus|response to stress	integral to membrane|mitochondrial outer membrane					0						GCTGAGCCAGGATGCAAGGCT	0.617													17	32	---	---	---	---	PASS
SCNN1G	6340	broad.mit.edu	37	16	23224213	23224213	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23224213G>C	uc002dlm.1	+	10	1568	c.1429G>C	c.(1429-1431)GAG>CAG	p.E477Q		NM_001039	NP_001030	P51170	SCNNG_HUMAN	sodium channel, nonvoltage-gated 1, gamma	477	Extracellular (By similarity).				excretion|sensory perception of taste	apical plasma membrane|integral to plasma membrane	ligand-gated sodium channel activity|WW domain binding			ovary(2)|skin(2)|large_intestine(1)|pancreas(1)	6				GBM - Glioblastoma multiforme(48;0.0366)	Amiloride(DB00594)|Triamterene(DB00384)	TGTGGTTTCGGAGGTAAGTTC	0.577													15	28	---	---	---	---	PASS
PRKCB	5579	broad.mit.edu	37	16	24166139	24166139	+	Silent	SNP	G	A	A	rs141827066		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24166139G>A	uc002dmd.2	+	10	1397	c.1200G>A	c.(1198-1200)CCG>CCA	p.P400P	PRKCB_uc002dme.2_Silent_p.P400P	NM_212535	NP_997700	P05771	KPCB_HUMAN	protein kinase C, beta isoform 1	400	Protein kinase.				apoptosis|B cell activation|B cell receptor signaling pathway|intracellular signal transduction|lipoprotein transport|platelet activation|positive regulation of I-kappaB kinase/NF-kappaB cascade|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|synaptic transmission|transcription, DNA-dependent	cytosol|nucleus|plasma membrane	androgen receptor binding|ATP binding|chromatin binding|histone binding|histone kinase activity (H3-T6 specific)|ligand-dependent nuclear receptor transcription coactivator activity|protein kinase C activity|protein kinase C binding|zinc ion binding	p.P400P(1)		ovary(3)|central_nervous_system(3)|lung(2)|large_intestine(1)	9					Vitamin E(DB00163)	CTGGGAAGCCGCCCTTCCTGA	0.567													12	20	---	---	---	---	PASS
TNRC6A	27327	broad.mit.edu	37	16	24831599	24831599	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24831599G>T	uc002dmm.2	+	22	5334	c.5220G>T	c.(5218-5220)CAG>CAT	p.Q1740H	TNRC6A_uc010bxs.2_Missense_Mutation_p.Q1487H|TNRC6A_uc002dmn.2_Missense_Mutation_p.Q1438H|TNRC6A_uc002dmo.2_Missense_Mutation_p.Q1379H|TNRC6A_uc002dmr.2_5'Flank	NM_014494	NP_055309	Q8NDV7	TNR6A_HUMAN	trinucleotide repeat containing 6A	1740	Sufficient for interaction with EIF2C2.				negative regulation of translation involved in gene silencing by miRNA	cytoplasmic mRNA processing body|micro-ribonucleoprotein complex	nucleotide binding|RNA binding			ovary(2)	2				GBM - Glioblastoma multiforme(48;0.0394)		TGACTGGTCAGAAGCCACCCT	0.532													56	118	---	---	---	---	PASS
KCTD13	253980	broad.mit.edu	37	16	29922489	29922489	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29922489G>A	uc002duv.2	-	5	754	c.563C>T	c.(562-564)TCA>TTA	p.S188L	uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|ASPHD1_uc002duu.3_Intron|ASPHD1_uc010bzi.2_Intron|KCTD13_uc010vee.1_RNA	NM_178863	NP_849194	Q8WZ19	BACD1_HUMAN	potassium channel tetramerisation domain	188					cell migration|DNA replication|negative regulation of Rho protein signal transduction|proteasomal ubiquitin-dependent protein catabolic process|protein ubiquitination|stress fiber assembly	Cul3-RING ubiquitin ligase complex|nucleus|voltage-gated potassium channel complex	GTP-Rho binding|voltage-gated potassium channel activity				0						GTTGTCATCTGAAGTGCTGGG	0.607													11	42	---	---	---	---	PASS
ALDOA	226	broad.mit.edu	37	16	30081308	30081308	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30081308G>A	uc002dvw.2	+	11	2085	c.957G>A	c.(955-957)GAG>GAA	p.E319E	uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|ALDOA_uc002dvx.2_Silent_p.E319E|ALDOA_uc002dvy.2_Silent_p.E319E|ALDOA_uc002dvz.2_Silent_p.E319E|ALDOA_uc002dwa.3_Silent_p.E319E|ALDOA_uc002dwb.1_Silent_p.E319E|ALDOA_uc002dwc.2_Silent_p.E319E|ALDOA_uc010veg.1_Silent_p.E373E|ALDOA_uc002dwd.2_Silent_p.E323E	NM_184043	NP_908932	P04075	ALDOA_HUMAN	fructose-bisphosphate aldolase A	319					actin filament organization|ATP biosynthetic process|fructose 1,6-bisphosphate metabolic process|gluconeogenesis|glycolysis|muscle cell homeostasis|platelet activation|platelet degranulation|protein homotetramerization|regulation of cell shape|striated muscle contraction	actin cytoskeleton|cytosol|extracellular vesicular exosome|I band|platelet alpha granule lumen	actin binding|fructose binding|fructose-bisphosphate aldolase activity|identical protein binding|tubulin binding			lung(1)	1						GGAAGAAGGAGAACCTGAAGG	0.642													22	55	---	---	---	---	PASS
ITGAL	3683	broad.mit.edu	37	16	30485563	30485563	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30485563C>T	uc002dyi.3	+	2	284	c.108C>T	c.(106-108)TTC>TTT	p.F36F	ITGAL_uc010veu.1_RNA|ITGAL_uc002dyj.3_Silent_p.F36F|ITGAL_uc010vev.1_Silent_p.F36F	NM_002209	NP_002200	P20701	ITAL_HUMAN	integrin alpha L isoform a precursor	36	FG-GAP 1.|Extracellular (Potential).				blood coagulation|heterophilic cell-cell adhesion|inflammatory response|integrin-mediated signaling pathway|leukocyte cell-cell adhesion|leukocyte migration|regulation of immune response|T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	integrin complex	cell adhesion molecule binding|receptor activity			ovary(3)|lung(3)|central_nervous_system(3)|breast(1)	10					Efalizumab(DB00095)	CGCGGAGCTTCTCCCCACCGC	0.706													9	14	---	---	---	---	PASS
SRCAP	10847	broad.mit.edu	37	16	30721400	30721400	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30721400G>A	uc002dze.1	+	8	1470	c.1085G>A	c.(1084-1086)CGA>CAA	p.R362Q	SRCAP_uc002dzf.2_RNA|SRCAP_uc002dzg.1_Missense_Mutation_p.R219Q|SRCAP_uc010bzz.1_5'UTR|SNORA30_uc002dzh.1_5'Flank	NM_006662	NP_006653	Q6ZRS2	SRCAP_HUMAN	Snf2-related CBP activator protein	362	Glu-rich.				interspecies interaction between organisms|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	Golgi apparatus|nucleus|protein complex	ATP binding|DNA binding|helicase activity|histone acetyltransferase activity|transcription coactivator activity			ovary(3)|skin(1)	4			Colorectal(24;0.198)			AGTGACACCCGAGATGGGCCT	0.582													27	44	---	---	---	---	PASS
SRCAP	10847	broad.mit.edu	37	16	30723240	30723240	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30723240C>T	uc002dze.1	+	12	1962	c.1577C>T	c.(1576-1578)TCT>TTT	p.S526F	SRCAP_uc002dzf.2_RNA|SRCAP_uc002dzg.1_Missense_Mutation_p.S383F|SRCAP_uc010bzz.1_Missense_Mutation_p.S96F	NM_006662	NP_006653	Q6ZRS2	SRCAP_HUMAN	Snf2-related CBP activator protein	526	Glu-rich.				interspecies interaction between organisms|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	Golgi apparatus|nucleus|protein complex	ATP binding|DNA binding|helicase activity|histone acetyltransferase activity|transcription coactivator activity			ovary(3)|skin(1)	4			Colorectal(24;0.198)			TCAGAGGAATCTGAGTCTGAA	0.483													42	65	---	---	---	---	PASS
SRCAP	10847	broad.mit.edu	37	16	30723395	30723395	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30723395C>G	uc002dze.1	+	12	2117	c.1732C>G	c.(1732-1734)CTA>GTA	p.L578V	SRCAP_uc002dzf.2_RNA|SRCAP_uc002dzg.1_Missense_Mutation_p.L435V|SRCAP_uc010bzz.1_Missense_Mutation_p.L148V	NM_006662	NP_006653	Q6ZRS2	SRCAP_HUMAN	Snf2-related CBP activator protein	578					interspecies interaction between organisms|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	Golgi apparatus|nucleus|protein complex	ATP binding|DNA binding|helicase activity|histone acetyltransferase activity|transcription coactivator activity			ovary(3)|skin(1)	4			Colorectal(24;0.198)			GCCCACTACTCTAGGTCCAAA	0.547													33	89	---	---	---	---	PASS
SHCBP1	79801	broad.mit.edu	37	16	46655178	46655178	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:46655178G>A	uc002eec.3	-	1	134	c.94C>T	c.(94-96)CTG>TTG	p.L32L		NM_024745	NP_079021	Q8NEM2	SHCBP_HUMAN	SHC SH2-domain binding protein 1	32										ovary(1)|breast(1)	2		all_cancers(37;0.00404)|all_epithelial(9;0.00527)|all_lung(18;0.0413)|Lung NSC(13;0.213)				CCTTTCTCCAGAGACGCCAGC	0.716													17	59	---	---	---	---	PASS
CNGB1	1258	broad.mit.edu	37	16	57953058	57953058	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:57953058G>C	uc002emt.2	-	20	1967	c.1902C>G	c.(1900-1902)TTC>TTG	p.F634L	CNGB1_uc010cdh.2_Missense_Mutation_p.F628L	NM_001297	NP_001288	Q14028	CNGB1_HUMAN	cyclic nucleotide gated channel beta 1 isoform	634	Cytoplasmic (Potential).				sensory perception of smell	intracellular cyclic nucleotide activated cation channel complex	cAMP binding|intracellular cAMP activated cation channel activity			breast(3)|pancreas(1)	4						GGCGGTGTTTGAACTTGCAGC	0.572													37	71	---	---	---	---	PASS
SLC9A5	6553	broad.mit.edu	37	16	67288978	67288978	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67288978C>T	uc002esm.2	+	3	608	c.545C>T	c.(544-546)TCG>TTG	p.S182L	SLC9A5_uc010cee.2_5'UTR|SLC9A5_uc010vji.1_5'UTR	NM_004594	NP_004585	Q14940	SL9A5_HUMAN	solute carrier family 9 (sodium/hydrogen	182	Helical; (Potential).				regulation of pH	integral to membrane|plasma membrane	sodium:hydrogen antiporter activity			ovary(1)|pancreas(1)	2		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.00376)|Epithelial(162;0.0173)|all cancers(182;0.116)		AGCCTCATCTCGGCGGTGGAC	0.562													42	78	---	---	---	---	PASS
ZDHHC1	29800	broad.mit.edu	37	16	67432778	67432778	+	Silent	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67432778G>C	uc010vjm.1	-	6	904	c.600C>G	c.(598-600)GTC>GTG	p.V200V		NM_013304	NP_037436	Q8WTX9	ZDHC1_HUMAN	zinc finger, DHHC-type containing 1	200	Helical; (Potential).					integral to membrane	DNA binding|zinc ion binding				0		Ovarian(137;0.223)		UCEC - Uterine corpus endometrioid carcinoma (183;0.0178)|all cancers(182;5.71e-53)|Epithelial(162;4.73e-52)|OV - Ovarian serous cystadenocarcinoma(108;1.53e-29)|Kidney(780;4.37e-05)|BRCA - Breast invasive adenocarcinoma(181;5.8e-05)|GBM - Glioblastoma multiforme(240;0.0022)		ACTCCACGAAGACATATGTGG	0.582													10	20	---	---	---	---	PASS
RLTPR	146206	broad.mit.edu	37	16	67688786	67688786	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67688786G>A	uc002etn.2	+	32	3808	c.3688G>A	c.(3688-3690)GAA>AAA	p.E1230K	RLTPR_uc010vjr.1_Missense_Mutation_p.E1194K	NM_001013838	NP_001013860	Q6F5E8	LR16C_HUMAN	RGD motif, leucine rich repeats, tropomodulin	1230										breast(1)	1		Acute lymphoblastic leukemia(13;3.23e-05)|all_hematologic(13;0.00251)|Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0146)|Epithelial(162;0.0481)|all cancers(182;0.232)		CGGGGGTGCCGAAGGCAAGAG	0.577													32	53	---	---	---	---	PASS
SLC12A4	6560	broad.mit.edu	37	16	67986291	67986291	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67986291G>A	uc002euz.2	-	7	854	c.713C>T	c.(712-714)TCG>TTG	p.S238L	SLC12A4_uc010ceu.2_Missense_Mutation_p.S232L|SLC12A4_uc010vkh.1_Missense_Mutation_p.S207L|SLC12A4_uc010vki.1_Missense_Mutation_p.S238L|SLC12A4_uc010vkj.1_Missense_Mutation_p.S240L|SLC12A4_uc002eva.2_Missense_Mutation_p.S238L|SLC12A4_uc002evb.2_RNA|SLC12A4_uc010cew.1_Missense_Mutation_p.R160W	NM_005072	NP_005063	Q9UP95	S12A4_HUMAN	solute carrier family 12, member 4 isoform a	238					cell volume homeostasis|potassium ion transport|sodium ion transport	integral to plasma membrane|membrane fraction	potassium:chloride symporter activity			ovary(1)	1		Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0042)|Epithelial(162;0.0185)|all cancers(182;0.121)	Bumetanide(DB00887)|Potassium Chloride(DB00761)	ATGAGCACCCGATGGGTAAAA	0.453													37	81	---	---	---	---	PASS
PDPR	55066	broad.mit.edu	37	16	70190480	70190480	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70190480G>C	uc002eyf.1	+	19	3295	c.2338G>C	c.(2338-2340)GAC>CAC	p.D780H	CLEC18C_uc002exy.2_Intron|PDPR_uc010vlr.1_Missense_Mutation_p.D680H|PDPR_uc002eyg.1_Missense_Mutation_p.D447H|PDPR_uc002eyh.2_Missense_Mutation_p.D125H|PDPR_uc010vls.1_Missense_Mutation_p.D125H	NM_017990	NP_060460	Q8NCN5	PDPR_HUMAN	pyruvate dehydrogenase phosphatase regulatory	780					glycine catabolic process|pyruvate metabolic process|regulation of acetyl-CoA biosynthetic process from pyruvate	mitochondrial matrix	aminomethyltransferase activity|oxidoreductase activity			breast(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.124)		TTCAGACCTAGACCTTTGGCC	0.547													69	263	---	---	---	---	PASS
HYDIN	54768	broad.mit.edu	37	16	70843797	70843797	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70843797C>T	uc002ezr.2	-	85	14897	c.14769G>A	c.(14767-14769)ACG>ACA	p.T4923T	HYDIN_uc010cfy.2_RNA	NM_032821	NP_116210	Q4G0P3	HYDIN_HUMAN	hydrocephalus inducing isoform a	4924										ovary(1)|skin(1)	2		Ovarian(137;0.0654)				GAAGTGCTGGCGTGGCTTTCA	0.468													25	567	---	---	---	---	PASS
ZFHX3	463	broad.mit.edu	37	16	72821171	72821171	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:72821171G>A	uc002fck.2	-	10	11677	c.11004C>T	c.(11002-11004)CTC>CTT	p.L3668L	uc002fcj.1_RNA|ZFHX3_uc002fcl.2_Silent_p.L2754L	NM_006885	NP_008816	Q15911	ZFHX3_HUMAN	zinc finger homeobox 3 isoform A	3668					muscle organ development|negative regulation of myoblast differentiation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|positive regulation of myoblast differentiation	transcription factor complex	enzyme binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(2)|skin(2)	4		Ovarian(137;0.13)				ACTTTTGGCTGAGATCCGTGT	0.582													131	236	---	---	---	---	PASS
PKD1L2	114780	broad.mit.edu	37	16	81190478	81190478	+	Nonsense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:81190478G>A	uc002fgh.1	-	24	4111	c.4111C>T	c.(4111-4113)CAG>TAG	p.Q1371*	PKD1L2_uc002fgg.1_RNA	NM_052892	NP_443124	Q7Z442	PK1L2_HUMAN	polycystin 1-like 2 isoform a	1371	Cytoplasmic (Potential).				neuropeptide signaling pathway	integral to membrane	calcium ion binding|ion channel activity|sugar binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3						GCCTGATCCTGAGCGTCCTTC	0.547													21	38	---	---	---	---	PASS
CPNE7	27132	broad.mit.edu	37	16	89655159	89655159	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89655159C>A	uc002fnp.2	+	12	1359	c.1229C>A	c.(1228-1230)CCG>CAG	p.P410Q	CPNE7_uc002fnq.2_Missense_Mutation_p.P335Q	NM_014427	NP_055242	Q9UBL6	CPNE7_HUMAN	copine 7 isoform b	410	VWFA.				lipid metabolic process		transporter activity				0		all_hematologic(23;0.0748)		all cancers(4;3.63e-08)|OV - Ovarian serous cystadenocarcinoma(4;1.7e-06)|BRCA - Breast invasive adenocarcinoma(80;0.0147)		CCCTACCAGCCGAACGAGTAC	0.637													3	71	---	---	---	---	PASS
DLG4	1742	broad.mit.edu	37	17	7099654	7099654	+	Splice_Site	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7099654C>G	uc002get.3	-	13	2517	c.1316_splice	c.e13-1	p.E439_splice	DLG4_uc010vtm.1_Splice_Site|DLG4_uc010vtn.1_Splice_Site_p.E336_splice|DLG4_uc010cly.2_Splice_Site_p.E393_splice|DLG4_uc010vto.1_Splice_Site_p.E436_splice	NM_001365	NP_001356	P78352	DLG4_HUMAN	post-synaptic density protein 95 isoform 1						axon guidance|learning|protein complex assembly|protein localization to synapse|signal transduction|synaptic transmission	cell junction|cortical cytoskeleton|endocytic vesicle membrane|neuron spine|postsynaptic density|postsynaptic membrane|synaptosome	protein binding|protein C-terminus binding			ovary(1)|breast(1)	2						CGGCTGTACTCTGAGGAAGGA	0.582													35	36	---	---	---	---	PASS
CHRNB1	1140	broad.mit.edu	37	17	7357785	7357785	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7357785C>G	uc002ghb.2	+	8	1031	c.990C>G	c.(988-990)CTC>CTG	p.L330L	CHRNB1_uc010vty.1_Silent_p.L258L|CHRNB1_uc010vtz.1_Silent_p.L164L	NM_000747	NP_000738	P11230	ACHB_HUMAN	nicotinic acetylcholine receptor beta 1 subunit	330	Helical; (Potential).				behavioral response to nicotine|muscle contraction|muscle fiber development|neuromuscular synaptic transmission|postsynaptic membrane organization|regulation of membrane potential|synaptic transmission, cholinergic	cell junction|nicotinic acetylcholine-gated receptor-channel complex|postsynaptic membrane	acetylcholine binding|receptor activity			ovary(2)	2		Prostate(122;0.157)				TCGTGGTTCTCAACCTGCACC	0.493													38	85	---	---	---	---	PASS
CHD3	1107	broad.mit.edu	37	17	7804195	7804195	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7804195C>T	uc002gje.2	+	19	3154	c.3004C>T	c.(3004-3006)CGA>TGA	p.R1002*	CHD3_uc002gjd.2_Nonsense_Mutation_p.R1061*|CHD3_uc002gjf.2_Nonsense_Mutation_p.R1002*|CHD3_uc002gjh.2_5'Flank	NM_001005273	NP_001005273	Q12873	CHD3_HUMAN	chromodomain helicase DNA binding protein 3	1002					chromatin modification|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	microtubule organizing center|NuRD complex	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding|zinc ion binding			breast(1)	1		Prostate(122;0.202)				CATCCTGACTCGAAATTTTGA	0.413													47	99	---	---	---	---	PASS
MYH13	8735	broad.mit.edu	37	17	10204258	10204258	+	3'UTR	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10204258C>T	uc002gmk.1	-	41						NM_003802	NP_003793	Q9UKX3	MYH13_HUMAN	myosin, heavy polypeptide 13, skeletal muscle						muscle contraction	muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(4)|skin(2)	6						CAACGAGCATCAGGTGAGCCT	0.423													8	102	---	---	---	---	PASS
ELAC2	60528	broad.mit.edu	37	17	12899993	12899993	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:12899993C>T	uc002gnz.3	-	17	1625	c.1530G>A	c.(1528-1530)ACG>ACA	p.T510T	ELAC2_uc002gnu.3_5'UTR|ELAC2_uc002gnv.3_Silent_p.T138T|ELAC2_uc002gnw.3_Silent_p.T168T|ELAC2_uc002gnx.3_Silent_p.T270T|ELAC2_uc010vvo.1_Silent_p.T308T|ELAC2_uc010vvp.1_Silent_p.T491T|ELAC2_uc010vvq.1_Silent_p.T509T|ELAC2_uc010vvr.1_Silent_p.T470T	NM_018127	NP_060597	Q9BQ52	RNZ2_HUMAN	elaC homolog 2 isoform 1	510					tRNA processing	nucleus	endonuclease activity|metal ion binding|protein binding				0						GTAGCAGAGACGTGTCGGGGC	0.572									Hereditary_Prostate_Cancer				7	33	---	---	---	---	PASS
KIAA0100	9703	broad.mit.edu	37	17	26942204	26942204	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26942204C>T	uc002hbu.2	-	39	6685	c.6586G>A	c.(6586-6588)GAA>AAA	p.E2196K	SGK494_uc010waq.1_5'Flank|SGK494_uc010war.1_5'Flank|SGK494_uc002hbr.1_5'Flank|uc002hbs.1_Intron|KIAA0100_uc002hbt.2_Missense_Mutation_p.E525K	NM_014680	NP_055495	Q14667	K0100_HUMAN	hypothetical protein LOC9703 precursor	2196						extracellular region				ovary(2)|breast(1)|skin(1)	4	Lung NSC(42;0.00431)					GATTTAGTTTCTAGCTTTCCC	0.473													54	112	---	---	---	---	PASS
SUPT6H	6830	broad.mit.edu	37	17	27020847	27020847	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27020847G>A	uc002hby.2	+	28	3857	c.3767G>A	c.(3766-3768)CGA>CAA	p.R1256Q	SUPT6H_uc010crt.2_Missense_Mutation_p.R1256Q	NM_003170	NP_003161	Q7KZ85	SPT6H_HUMAN	suppressor of Ty 6 homolog	1256	S1 motif.				chromatin remodeling|regulation of transcription elongation, DNA-dependent|regulation of transcription from RNA polymerase II promoter	nucleus	hydrolase activity, acting on ester bonds|RNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)|skin(1)	3	Lung NSC(42;0.00431)					CCAGAAGAACGAGTGAAGGTA	0.517													26	57	---	---	---	---	PASS
PHF12	57649	broad.mit.edu	37	17	27251153	27251153	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27251153C>A	uc002hdg.1	-	4	1019	c.489G>T	c.(487-489)AGG>AGT	p.R163S	PHF12_uc010wbb.1_Missense_Mutation_p.R145S|PHF12_uc002hdi.1_Missense_Mutation_p.R159S|PHF12_uc002hdj.1_Missense_Mutation_p.R163S|PHF12_uc010crw.1_Intron|uc002hdl.2_5'Flank|PHF12_uc002hdh.1_5'UTR	NM_001033561	NP_001028733	Q96QT6	PHF12_HUMAN	PHD finger protein 12 isoform 1	163	Interaction with SIN3A.				negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	transcriptional repressor complex	protein binding|zinc ion binding			ovary(1)	1	all_cancers(5;1.95e-14)|all_epithelial(6;5e-18)|Lung NSC(42;0.01)		Epithelial(11;1.64e-05)|all cancers(11;7.47e-05)|BRCA - Breast invasive adenocarcinoma(11;9.79e-05)			GTGTGCCAGGCCTGCTGGCTC	0.562													20	49	---	---	---	---	PASS
C17orf102	400591	broad.mit.edu	37	17	32904624	32904624	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:32904624G>A	uc002hie.1	-	2	515	c.426C>T	c.(424-426)ATC>ATT	p.I142I		NM_207454	NP_997337	A2RUQ5	CQ102_HUMAN	hypothetical protein LOC400591	142										ovary(1)	1						TGATGTTGGAGATATGCACCA	0.274													23	54	---	---	---	---	PASS
MED1	5469	broad.mit.edu	37	17	37571569	37571569	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37571569C>T	uc002hrv.3	-	15	1533	c.1321G>A	c.(1321-1323)GAA>AAA	p.E441K	MED1_uc010wee.1_Missense_Mutation_p.E269K|MED1_uc002hru.2_Missense_Mutation_p.E441K	NM_004774	NP_004765	Q15648	MED1_HUMAN	mediator complex subunit 1	441	Interaction with ESR1.|Interaction with THRA.|Interaction with the Mediator complex and THRA.				androgen biosynthetic process|androgen receptor signaling pathway|cellular lipid metabolic process|fat cell differentiation|positive regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|transcription initiation from RNA polymerase II promoter	mediator complex	DNA binding|estrogen receptor binding|ligand-dependent nuclear receptor binding|ligand-dependent nuclear receptor transcription coactivator activity|peroxisome proliferator activated receptor binding|receptor activity|retinoic acid receptor binding|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			lung(2)|ovary(2)|breast(1)|skin(1)|kidney(1)|pancreas(1)	8		Ovarian(249;1.78e-06)|Lung SC(565;0.0262)	Lung(15;0.0178)|LUAD - Lung adenocarcinoma(14;0.146)	UCEC - Uterine corpus endometrioid carcinoma (308;6.64e-05)|BRCA - Breast invasive adenocarcinoma(366;0.00136)|READ - Rectum adenocarcinoma(1115;0.0649)		GGACACACTTCAAATTGGAGA	0.388										HNSCC(31;0.082)			17	33	---	---	---	---	PASS
COASY	80347	broad.mit.edu	37	17	40714664	40714664	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40714664C>T	uc002hzz.2	+	2	181	c.24C>T	c.(22-24)CTC>CTT	p.L8L	COASY_uc010cyj.2_Silent_p.L37L|COASY_uc002iab.2_Intron|COASY_uc002iad.2_Silent_p.L8L|COASY_uc002iac.2_Silent_p.L8L|COASY_uc002iae.2_5'Flank	NM_001042529	NP_001035994	Q13057	COASY_HUMAN	coenzyme A synthase isoform a	8					coenzyme A biosynthetic process|pantothenate metabolic process	mitochondrial outer membrane	ATP binding|dephospho-CoA kinase activity|pantetheine-phosphate adenylyltransferase activity				0		all_cancers(22;1.06e-05)|Breast(137;0.000153)|all_epithelial(22;0.000344)		BRCA - Breast invasive adenocarcinoma(366;0.13)		GGTCGGGTCTCCTGGTGCTGA	0.677													24	38	---	---	---	---	PASS
COASY	80347	broad.mit.edu	37	17	40714665	40714665	+	Silent	SNP	C	T	T	rs117419466	byFrequency	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40714665C>T	uc002hzz.2	+	2	182	c.25C>T	c.(25-27)CTG>TTG	p.L9L	COASY_uc010cyj.2_Silent_p.L38L|COASY_uc002iab.2_Intron|COASY_uc002iad.2_Silent_p.L9L|COASY_uc002iac.2_Silent_p.L9L|COASY_uc002iae.2_5'Flank	NM_001042529	NP_001035994	Q13057	COASY_HUMAN	coenzyme A synthase isoform a	9					coenzyme A biosynthetic process|pantothenate metabolic process	mitochondrial outer membrane	ATP binding|dephospho-CoA kinase activity|pantetheine-phosphate adenylyltransferase activity				0		all_cancers(22;1.06e-05)|Breast(137;0.000153)|all_epithelial(22;0.000344)		BRCA - Breast invasive adenocarcinoma(366;0.13)		GTCGGGTCTCCTGGTGCTGAC	0.677													24	38	---	---	---	---	PASS
CDC27	996	broad.mit.edu	37	17	45247376	45247376	+	Missense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:45247376C>A	uc002ild.3	-	4	411	c.284G>T	c.(283-285)GGA>GTA	p.G95V	CDC27_uc002ile.3_Missense_Mutation_p.G95V|CDC27_uc002ilf.3_Missense_Mutation_p.G95V|CDC27_uc010wkp.1_Missense_Mutation_p.G34V|CDC27_uc010wkq.1_RNA	NM_001256	NP_001247	P30260	CDC27_HUMAN	cell division cycle protein 27 isoform 2	95	TPR 1.				anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell proliferation|mitotic cell cycle spindle assembly checkpoint|mitotic metaphase/anaphase transition|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|centrosome|cytosol|nucleoplasm|spindle microtubule	protein phosphatase binding			lung(2)|breast(2)|ovary(1)	5						ATTAAACACTCCACCAGATAA	0.313													40	148	---	---	---	---	PASS
ANKFN1	162282	broad.mit.edu	37	17	54558019	54558019	+	Intron	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:54558019C>G	uc002iun.1	+							NM_153228	NP_694960	Q8N957	ANKF1_HUMAN	ankyrin-repeat and fibronectin type III domain											large_intestine(1)|ovary(1)	2						TAACTTGACTCAACATACAGA	0.393													37	120	---	---	---	---	PASS
BZRAP1	9256	broad.mit.edu	37	17	56399716	56399716	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:56399716G>A	uc002ivx.3	-	10	2246	c.1375C>T	c.(1375-1377)CGG>TGG	p.R459W	BZRAP1_uc010dcs.2_Missense_Mutation_p.R399W|BZRAP1_uc010wnt.1_Missense_Mutation_p.R459W	NM_004758	NP_004749	O95153	RIMB1_HUMAN	peripheral benzodiazepine receptor-associated	459						mitochondrion	benzodiazepine receptor binding			upper_aerodigestive_tract(2)|skin(1)	3	Medulloblastoma(34;0.127)|all_neural(34;0.237)					AGGCTGAGCCGAGCCTGTTCA	0.637													35	73	---	---	---	---	PASS
TANC2	26115	broad.mit.edu	37	17	61466879	61466879	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61466879G>A	uc002jal.3	+	15	2826	c.2803G>A	c.(2803-2805)GTG>ATG	p.V935M	TANC2_uc010wpe.1_Missense_Mutation_p.V845M|TANC2_uc002jan.1_Missense_Mutation_p.V86M|TANC2_uc002jao.3_Missense_Mutation_p.V36M|TANC2_uc002jam.1_Missense_Mutation_p.V302M	NM_025185	NP_079461	Q9HCD6	TANC2_HUMAN	tetratricopeptide repeat, ankyrin repeat and	935	ANK 3.						binding			ovary(2)	2						GAGCATTGTGGTGCTGCTGTG	0.537													8	12	---	---	---	---	PASS
CACNG5	27091	broad.mit.edu	37	17	64880840	64880840	+	Intron	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:64880840G>A	uc010wqi.1	+						CACNG5_uc002jfr.2_Missense_Mutation_p.G211E|CACNG5_uc010wqj.1_Intron	NM_145811	NP_665810	Q9UF02	CCG5_HUMAN	voltage-dependent calcium channel gamma-5						regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity	alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex|cell junction|postsynaptic density|postsynaptic membrane	voltage-gated calcium channel activity			pancreas(1)|skin(1)	2			BRCA - Breast invasive adenocarcinoma(6;1.61e-08)			CTGAGCCGGGGAGAGTGGGGA	0.572													45	85	---	---	---	---	PASS
TMEM104	54868	broad.mit.edu	37	17	72832424	72832424	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:72832424C>T	uc002jls.3	+	10	1251	c.1089C>T	c.(1087-1089)TTC>TTT	p.F363F	TMEM104_uc010wrf.1_Intron|TMEM104_uc010wrg.1_Intron|TMEM104_uc010dfx.2_Silent_p.F363F	NM_017728	NP_060198	Q8NE00	TM104_HUMAN	transmembrane protein 104	363	Helical; (Potential).					integral to membrane					0	all_lung(278;0.23)					TCCCCGTCTTCACCATCAGCA	0.632													85	191	---	---	---	---	PASS
FDXR	2232	broad.mit.edu	37	17	72862305	72862305	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:72862305C>T	uc002jly.2	-	5	542	c.455G>A	c.(454-456)TGC>TAC	p.C152Y	FDXR_uc010wri.1_Missense_Mutation_p.C100Y|FDXR_uc010wrj.1_Missense_Mutation_p.C150Y|FDXR_uc002jlw.2_5'UTR|FDXR_uc002jlx.2_Missense_Mutation_p.C152Y|FDXR_uc002jmc.2_Missense_Mutation_p.C153Y|FDXR_uc010wrk.1_Missense_Mutation_p.C183Y|FDXR_uc010wrl.1_Missense_Mutation_p.C195Y|FDXR_uc002jma.2_Missense_Mutation_p.C153Y|FDXR_uc010wrm.1_Missense_Mutation_p.C112Y|FDXR_uc002jlz.2_Missense_Mutation_p.C144Y|FDXR_uc002jmb.2_RNA	NM_024417	NP_077728	P22570	ADRO_HUMAN	ferredoxin reductase isoform 1 precursor	152					cholesterol metabolic process|electron transport chain|steroid biosynthetic process|transport	mitochondrial matrix	ferredoxin-NADP+ reductase activity|protein binding				0	all_lung(278;0.172)|Lung NSC(278;0.207)					CCGGGCGGAGCACACACCTGG	0.652													17	109	---	---	---	---	PASS
LLGL2	3993	broad.mit.edu	37	17	73559178	73559178	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73559178C>T	uc002joh.2	+	7	766	c.612C>T	c.(610-612)ATC>ATT	p.I204I	LLGL2_uc002jog.1_Silent_p.I204I|LLGL2_uc010dgf.1_Silent_p.I204I|LLGL2_uc002joi.2_Silent_p.I204I|LLGL2_uc010dgg.1_Silent_p.I204I|LLGL2_uc002joj.2_Silent_p.I193I|LLGL2_uc010wsd.1_5'Flank|uc002jok.2_5'Flank	NM_001031803	NP_001026973	Q6P1M3	L2GL2_HUMAN	lethal giant larvae homolog 2 isoform c	204	WD 4.				cell cycle|cell division|exocytosis|regulation of establishment or maintenance of cell polarity	cytoplasm|intracellular membrane-bounded organelle	PDZ domain binding			ovary(2)	2	all_cancers(13;3.15e-09)|all_epithelial(9;5.78e-10)|Breast(9;5.8e-10)|all_lung(278;0.246)		all cancers(21;1.8e-07)|Epithelial(20;1.38e-06)|Lung(188;0.0696)|LUSC - Lung squamous cell carcinoma(166;0.112)			CCAACCAGATCCTGATCGGCT	0.657													30	30	---	---	---	---	PASS
UNC13D	201294	broad.mit.edu	37	17	73838975	73838975	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:73838975C>T	uc002jpp.2	-	5	731	c.351G>A	c.(349-351)GTG>GTA	p.V117V	UNC13D_uc010wsk.1_Silent_p.V117V|UNC13D_uc002jpq.1_5'UTR|UNC13D_uc010dgq.1_5'UTR	NM_199242	NP_954712	Q70J99	UN13D_HUMAN	unc-13 homolog D	117	C2 1.				positive regulation of exocytosis|regulation of mast cell degranulation	exocytic vesicle|late endosome|lysosome|membrane|recycling endosome	protein binding			upper_aerodigestive_tract(1)|skin(1)	2			all cancers(21;2.11e-06)|Epithelial(20;2.32e-06)|BRCA - Breast invasive adenocarcinoma(9;0.000618)|LUSC - Lung squamous cell carcinoma(166;0.154)			TGGCCTGTTTCACTGTTGCCT	0.607									Familial_Hemophagocytic_Lymphohistiocytosis				102	193	---	---	---	---	PASS
RNF213	57674	broad.mit.edu	37	17	78332128	78332128	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78332128C>T	uc002jyh.1	+	12	5345	c.5122C>T	c.(5122-5124)CTG>TTG	p.L1708L	uc002jyi.1_Intron|RNF213_uc010dhw.1_Silent_p.L90L	NM_020914	NP_065965	Q9HCF4	ALO17_HUMAN	ring finger protein 213	Error:Variant_position_missing_in_Q9HCF4_after_alignment										ovary(8)|lung(6)|breast(3)|large_intestine(2)|central_nervous_system(1)|pancreas(1)	21	all_neural(118;0.0538)		BRCA - Breast invasive adenocarcinoma(99;0.0252)|OV - Ovarian serous cystadenocarcinoma(97;0.057)			TGTCACCCCTCTGCTGGCGAG	0.572													29	65	---	---	---	---	PASS
RNF213	57674	broad.mit.edu	37	17	78355466	78355466	+	Silent	SNP	C	T	T	rs147013725		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:78355466C>T	uc002jyh.1	+	32	8359	c.8136C>T	c.(8134-8136)ATC>ATT	p.I2712I	uc002jyi.1_Intron|RNF213_uc010dhw.1_Silent_p.I1094I	NM_020914	NP_065965	Q9HCF4	ALO17_HUMAN	ring finger protein 213	Error:Variant_position_missing_in_Q9HCF4_after_alignment										ovary(8)|lung(6)|breast(3)|large_intestine(2)|central_nervous_system(1)|pancreas(1)	21	all_neural(118;0.0538)		BRCA - Breast invasive adenocarcinoma(99;0.0252)|OV - Ovarian serous cystadenocarcinoma(97;0.057)			ACGAGACCATCGGCGTGGTCC	0.607													23	42	---	---	---	---	PASS
FASN	2194	broad.mit.edu	37	17	80038078	80038078	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80038078C>T	uc002kdu.2	-	41	7201	c.7084G>A	c.(7084-7086)GAG>AAG	p.E2362K	FASN_uc002kdv.1_RNA	NM_004104	NP_004095	P49327	FAS_HUMAN	fatty acid synthase	2362	Thioesterase (By similarity).				energy reserve metabolic process|fatty acid biosynthetic process|long-chain fatty-acyl-CoA biosynthetic process|pantothenate metabolic process|positive regulation of cellular metabolic process|triglyceride biosynthetic process	cytosol|Golgi apparatus|melanosome|plasma membrane	3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity|3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity|3-oxoacyl-[acyl-carrier-protein] synthase activity|[acyl-carrier-protein] S-acetyltransferase activity|[acyl-carrier-protein] S-malonyltransferase activity|acyl carrier activity|cofactor binding|enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific) activity|myristoyl-[acyl-carrier-protein] hydrolase activity|oleoyl-[acyl-carrier-protein] hydrolase activity|palmitoyl-[acyl-carrier-protein] hydrolase activity|phosphopantetheine binding|protein binding|zinc ion binding			central_nervous_system(1)	1	all_neural(118;0.0878)|Ovarian(332;0.227)|all_lung(278;0.246)		OV - Ovarian serous cystadenocarcinoma(97;0.0211)|BRCA - Breast invasive adenocarcinoma(99;0.0237)		Cerulenin(DB01034)|Orlistat(DB01083)|Pyrazinamide(DB00339)	GTCTCAGCCTCAGCCTCACAG	0.642													45	116	---	---	---	---	PASS
SMCHD1	23347	broad.mit.edu	37	18	2740770	2740770	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2740770C>T	uc002klm.3	+	28	3773	c.3584C>T	c.(3583-3585)TCA>TTA	p.S1195L	SMCHD1_uc002klk.3_RNA|SMCHD1_uc002kll.3_RNA	NM_015295	NP_056110	A6NHR9	SMHD1_HUMAN	structural maintenance of chromosomes flexible	1195					chromosome organization		ATP binding				0						TCTTCTTTGTCAATTGCTGGG	0.308													25	72	---	---	---	---	PASS
LAMA1	284217	broad.mit.edu	37	18	7049150	7049150	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:7049150C>G	uc002knm.2	-	5	789	c.695G>C	c.(694-696)AGA>ACA	p.R232T	LAMA1_uc010wzj.1_5'UTR	NM_005559	NP_005550	P25391	LAMA1_HUMAN	laminin, alpha 1 precursor	232	Laminin N-terminal.				axon guidance|cell adhesion|cell surface receptor linked signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	extracellular space|laminin-1 complex|laminin-3 complex	extracellular matrix structural constituent|receptor binding			ovary(8)|large_intestine(4)|upper_aerodigestive_tract(2)|breast(2)|skin(2)|pancreas(2)|central_nervous_system(1)	21		Colorectal(10;0.172)			Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)	ATTGAGCGTTCTAATGCGTTG	0.493													42	88	---	---	---	---	PASS
RBBP8	5932	broad.mit.edu	37	18	20573283	20573283	+	Nonsense_Mutation	SNP	C	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:20573283C>A	uc002ktw.2	+	11	1824	c.1493C>A	c.(1492-1494)TCA>TAA	p.S498*	RBBP8_uc002kty.2_Nonsense_Mutation_p.S498*|RBBP8_uc002ktz.2_Nonsense_Mutation_p.S498*|RBBP8_uc002kua.2_Nonsense_Mutation_p.S498*|RBBP8_uc002ktx.1_Nonsense_Mutation_p.S498*	NM_002894	NP_002885	Q99708	COM1_HUMAN	retinoblastoma binding protein 8 isoform a	498					cell cycle checkpoint|DNA double-strand break processing involved in repair via single-strand annealing|meiosis|regulation of transcription from RNA polymerase II promoter	nucleus	damaged DNA binding|protein binding|single-stranded DNA specific endodeoxyribonuclease activity			ovary(1)|lung(1)|skin(1)	3	all_cancers(21;4.34e-05)|all_epithelial(16;8.3e-07)|Lung NSC(20;0.0107)|Colorectal(14;0.0202)|all_lung(20;0.0291)|Ovarian(20;0.19)		OV - Ovarian serous cystadenocarcinoma(1;0.00196)			GATCGATTTTCAGCTATTCAG	0.388								Direct_reversal_of_damage|Homologous_recombination					41	63	---	---	---	---	PASS
RBBP8	5932	broad.mit.edu	37	18	20573291	20573291	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:20573291C>T	uc002ktw.2	+	11	1832	c.1501C>T	c.(1501-1503)CAG>TAG	p.Q501*	RBBP8_uc002kty.2_Nonsense_Mutation_p.Q501*|RBBP8_uc002ktz.2_Nonsense_Mutation_p.Q501*|RBBP8_uc002kua.2_Nonsense_Mutation_p.Q501*|RBBP8_uc002ktx.1_Nonsense_Mutation_p.Q501*	NM_002894	NP_002885	Q99708	COM1_HUMAN	retinoblastoma binding protein 8 isoform a	501					cell cycle checkpoint|DNA double-strand break processing involved in repair via single-strand annealing|meiosis|regulation of transcription from RNA polymerase II promoter	nucleus	damaged DNA binding|protein binding|single-stranded DNA specific endodeoxyribonuclease activity			ovary(1)|lung(1)|skin(1)	3	all_cancers(21;4.34e-05)|all_epithelial(16;8.3e-07)|Lung NSC(20;0.0107)|Colorectal(14;0.0202)|all_lung(20;0.0291)|Ovarian(20;0.19)		OV - Ovarian serous cystadenocarcinoma(1;0.00196)			TTCAGCTATTCAGCGTCAAGA	0.398								Direct_reversal_of_damage|Homologous_recombination					38	59	---	---	---	---	PASS
ZNF521	25925	broad.mit.edu	37	18	22805425	22805425	+	Missense_Mutation	SNP	A	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:22805425A>C	uc002kvk.2	-	4	2704	c.2457T>G	c.(2455-2457)CAT>CAG	p.H819Q	ZNF521_uc010xbe.1_RNA|ZNF521_uc010dly.2_Missense_Mutation_p.H819Q|ZNF521_uc002kvl.2_Missense_Mutation_p.H599Q	NM_015461	NP_056276	Q96K83	ZN521_HUMAN	zinc finger protein 521	819	C2H2-type 20.				cell differentiation|multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein domain specific binding|zinc ion binding			ovary(4)|large_intestine(2)|lung(1)	7	all_cancers(21;0.0025)|all_epithelial(16;3.62e-05)|Ovarian(20;0.0991)					AAATGATCGCATGGAAGGCTT	0.463			T	PAX5	ALL								58	154	---	---	---	---	PASS
MEP1B	4225	broad.mit.edu	37	18	29784241	29784241	+	Silent	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29784241C>G	uc002kxj.3	+	7	512	c.465C>G	c.(463-465)CTC>CTG	p.L155L		NM_005925	NP_005916	Q16820	MEP1B_HUMAN	meprin A beta precursor	155	Extracellular (Potential).|Metalloprotease.				digestion|proteolysis	extracellular space|integral to plasma membrane	metalloendopeptidase activity|zinc ion binding			ovary(2)	2						ACGAGTTCCTCCACGCTCTGG	0.483													6	8	---	---	---	---	PASS
DCC	1630	broad.mit.edu	37	18	50936959	50936959	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:50936959C>G	uc002lfe.1	+	20	3660	c.3073C>G	c.(3073-3075)CGA>GGA	p.R1025G	DCC_uc010xdr.1_Missense_Mutation_p.R853G|DCC_uc010dpf.1_Missense_Mutation_p.R660G	NM_005215	NP_005206	P43146	DCC_HUMAN	netrin receptor DCC precursor	1025	Extracellular (Potential).|Fibronectin type-III 6.				apoptosis|induction of apoptosis|negative regulation of collateral sprouting|negative regulation of dendrite development	cytosol|integral to membrane				skin(8)|ovary(6)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	17		all_cancers(7;0.11)|all_epithelial(6;0.00126)		Colorectal(16;0.0251)|COAD - Colon adenocarcinoma(17;0.0942)		AATTCAAGCACGAAATTCAAA	0.378													36	111	---	---	---	---	PASS
ALPK2	115701	broad.mit.edu	37	18	56203851	56203851	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:56203851C>T	uc002lhj.3	-	5	3782	c.3568G>A	c.(3568-3570)GGG>AGG	p.G1190R	ALPK2_uc002lhk.1_Missense_Mutation_p.G521R	NM_052947	NP_443179	Q86TB3	ALPK2_HUMAN	heart alpha-kinase	1190							ATP binding|protein serine/threonine kinase activity			ovary(7)|skin(5)|lung(1)|central_nervous_system(1)	14						ACCCTCGTCCCCCAACCTGAG	0.557													39	116	---	---	---	---	PASS
CNDP2	55748	broad.mit.edu	37	18	72186318	72186318	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:72186318G>A	uc002llm.1	+	11	1507	c.1345G>A	c.(1345-1347)GAA>AAA	p.E449K	CNDP2_uc002lln.1_Missense_Mutation_p.E365K|CNDP2_uc010dqs.2_Intron	NM_018235	NP_060705	Q96KP4	CNDP2_HUMAN	CNDP dipeptidase 2	449						cytoplasm	carboxypeptidase activity|metal ion binding|metallopeptidase activity|protein binding|tripeptidase activity			ovary(2)|skin(1)	3		Esophageal squamous(42;0.131)|Prostate(75;0.173)		BRCA - Breast invasive adenocarcinoma(31;0.22)		CTCCCAGAATGAAAAGCTCAA	0.632													18	48	---	---	---	---	PASS
ADAMTSL5	339366	broad.mit.edu	37	19	1510233	1510233	+	Missense_Mutation	SNP	A	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1510233A>G	uc002ltd.2	-	5	721	c.277T>C	c.(277-279)TTC>CTC	p.F93L	ADAMTSL5_uc010dsl.2_5'UTR|ADAMTSL5_uc010xgq.1_Missense_Mutation_p.F103L	NM_213604	NP_998769	Q6ZMM2	ATL5_HUMAN	ADAMTS-like 5 precursor	93						proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding				0		Acute lymphoblastic leukemia(61;5.61e-13)|all_hematologic(61;2.65e-08)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		AGGTCTCGGAAGGGCACAGCC	0.637													7	24	---	---	---	---	PASS
ARHGEF18	23370	broad.mit.edu	37	19	7527213	7527213	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7527213G>C	uc002mgi.2	+	11	2317	c.2064G>C	c.(2062-2064)ATG>ATC	p.M688I	ARHGEF18_uc010xjm.1_Missense_Mutation_p.M530I|ARHGEF18_uc002mgh.2_Missense_Mutation_p.M530I|ARHGEF18_uc002mgj.1_Missense_Mutation_p.M331I	NM_001130955	NP_001124427	Q6ZSZ5	ARHGI_HUMAN	Rho/Rac guanine nucleotide exchange factor 18	688					actin cytoskeleton organization|apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of cell shape|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	Rho guanyl-nucleotide exchange factor activity			ovary(1)	1		Renal(5;0.0902)				AGTCGGCCATGAGCGAGAGTA	0.652													17	12	---	---	---	---	PASS
ZNF846	162993	broad.mit.edu	37	19	9868423	9868423	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9868423G>C	uc002mmb.1	-	6	1861	c.1330C>G	c.(1330-1332)CAC>GAC	p.H444D	ZNF846_uc010xky.1_Intron|ZNF846_uc010xkz.1_Intron|ZNF846_uc010dww.2_Intron|ZNF846_uc002mmc.1_Missense_Mutation_p.H315D	NM_001077624	NP_001071092	Q147U1	ZN846_HUMAN	zinc finger protein 846	444	C2H2-type 11.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1						TCTCCAGTGTGAGTTCTTAAA	0.438													40	48	---	---	---	---	PASS
ZNF700	90592	broad.mit.edu	37	19	12059989	12059989	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12059989C>T	uc002msu.2	+	4	1276	c.1150C>T	c.(1150-1152)CAC>TAC	p.H384Y	ZNF700_uc010xme.1_Missense_Mutation_p.H402Y|ZNF763_uc010xmf.1_Intron	NM_144566	NP_653167	Q9H0M5	ZN700_HUMAN	zinc finger protein 700	384	C2H2-type 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						TGAAAAAACTCACACTGGAGA	0.373													30	32	---	---	---	---	PASS
ZNF442	79973	broad.mit.edu	37	19	12461533	12461533	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12461533C>T	uc002mtr.1	-	6	1477	c.866G>A	c.(865-867)GGA>GAA	p.G289E	ZNF442_uc010xmk.1_Missense_Mutation_p.G220E	NM_030824	NP_110451	Q9H7R0	ZN442_HUMAN	zinc finger protein 442	289					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			large_intestine(2)|breast(1)|kidney(1)	4						GGGTTTTTCTCCAGTGTGAGT	0.418													93	83	---	---	---	---	PASS
BRD4	23476	broad.mit.edu	37	19	15379752	15379752	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15379752G>T	uc002nar.2	-	3	609	c.387C>A	c.(385-387)TTC>TTA	p.F129L	BRD4_uc002nas.2_Missense_Mutation_p.F129L|BRD4_uc002nat.3_Missense_Mutation_p.F129L|BRD4_uc002nau.3_Missense_Mutation_p.F129L	NM_058243	NP_490597	O60885	BRD4_HUMAN	bromodomain-containing protein 4 isoform long	129	Bromo 1.				interspecies interaction between organisms|positive regulation of G2/M transition of mitotic cell cycle|positive regulation of transcription elongation from RNA polymerase II promoter|regulation of transcription involved in G1 phase of mitotic cell cycle	condensed nuclear chromosome|cytoplasm	protein binding			ovary(2)	2			OV - Ovarian serous cystadenocarcinoma(3;3.02e-24)|Epithelial(3;4.71e-20)|all cancers(3;2.26e-18)			ACATAGTGTTGAAGTCCTGGA	0.453			T	NUT|C15orf55	lethal midline carcinoma of young people								34	64	---	---	---	---	PASS
WIZ	58525	broad.mit.edu	37	19	15537784	15537784	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15537784C>T	uc002nbc.2	-						WIZ_uc002nba.3_Intron|WIZ_uc002nbb.3_Intron	NM_021241	NP_067064	O95785	WIZ_HUMAN	widely-interspaced zinc finger motifs							nucleus	zinc ion binding				0						ACTGCAGGGTCACACTTACAC	0.622													58	102	---	---	---	---	PASS
EPS15L1	58513	broad.mit.edu	37	19	16495997	16495997	+	Silent	SNP	G	A	A	rs145707581	byFrequency	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16495997G>A	uc002ndz.1	-	21	2196	c.2190C>T	c.(2188-2190)TTC>TTT	p.F730F	EPS15L1_uc002ndx.2_Silent_p.F730F|EPS15L1_uc002ndy.2_RNA|EPS15L1_uc010xpe.1_Silent_p.F620F|EPS15L1_uc010xpf.1_Silent_p.F633F|EPS15L1_uc002nea.1_Silent_p.F730F|EPS15L1_uc010eah.1_Silent_p.F732F	NM_021235	NP_067058	Q9UBC2	EP15R_HUMAN	epidermal growth factor receptor pathway	730	11.|15 X 3 AA repeats of D-P-F.				endocytosis|epidermal growth factor receptor signaling pathway|negative regulation of epidermal growth factor receptor signaling pathway	coated pit|nucleus|plasma membrane	calcium ion binding			ovary(3)|skin(2)	5						ACCCACTTCCGAAGGGATCTA	0.532													64	149	---	---	---	---	PASS
ZNF91	7644	broad.mit.edu	37	19	23544483	23544483	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:23544483G>C	uc002nre.2	-	4	1411	c.1298C>G	c.(1297-1299)CCT>CGT	p.P433R	ZNF91_uc002nrd.2_5'Flank|ZNF91_uc010xrj.1_Missense_Mutation_p.P401R	NM_003430	NP_003421	Q05481	ZNF91_HUMAN	zinc finger protein 91	433						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		all_lung(12;0.0349)|Lung NSC(12;0.0538)|all_epithelial(12;0.0611)				ACACTTGTAAGGTTTCTCTCC	0.343													17	35	---	---	---	---	PASS
GPATCH1	55094	broad.mit.edu	37	19	33587166	33587166	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33587166C>T	uc002nug.1	+	7	980	c.666C>T	c.(664-666)GTC>GTT	p.V222V		NM_018025	NP_060495	Q9BRR8	GPTC1_HUMAN	G patch domain containing 1	222						catalytic step 2 spliceosome	nucleic acid binding			skin(1)	1	Esophageal squamous(110;0.137)					CCAAAGATGTCACACCTGTGG	0.443													74	114	---	---	---	---	PASS
HAUS5	23354	broad.mit.edu	37	19	36106006	36106006	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36106006C>T	uc002oam.1	+	5	333	c.282C>T	c.(280-282)CTC>CTT	p.L94L		NM_015302	NP_056117	O94927	HAUS5_HUMAN	HAUS augmin-like complex, subunit 5	94	Potential.				cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|spindle					0						TCCAGGAACTCGACCAGAGCC	0.602													8	19	---	---	---	---	PASS
LRFN3	79414	broad.mit.edu	37	19	36431465	36431465	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:36431465G>A	uc002oco.2	+	2	1590	c.1138G>A	c.(1138-1140)GAG>AAG	p.E380K		NM_024509	NP_078785	Q9BTN0	LRFN3_HUMAN	leucine rich repeat and fibronectin type III	380	Extracellular (Potential).|Ig-like.				cell adhesion	axon|cell junction|dendrite|integral to membrane|postsynaptic membrane|presynaptic membrane					0	all_lung(56;7.14e-07)|Lung NSC(56;1.12e-06)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.06)			AGCTGCTGTGGAGCTGACTGT	0.667													17	43	---	---	---	---	PASS
PSMC4	5704	broad.mit.edu	37	19	40485721	40485721	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40485721C>T	uc002omq.2	+						PSMC4_uc002omr.2_Intron	NM_006503	NP_006494	P43686	PRS6B_HUMAN	proteasome 26S ATPase subunit 4 isoform 1						anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	mitochondrion|nucleus|proteasome complex	ATP binding|ATPase activity|protein binding			ovary(1)	1	all_cancers(60;9.55e-06)|all_lung(34;1.17e-07)|Lung NSC(34;1.41e-07)|Ovarian(47;0.0925)					ATCCTGTCATCAGCTGCATTC	0.542													61	120	---	---	---	---	PASS
PRX	57716	broad.mit.edu	37	19	40902682	40902682	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40902682G>A	uc002onr.2	-	7	1846	c.1577C>T	c.(1576-1578)TCG>TTG	p.S526L	PRX_uc002onq.2_Missense_Mutation_p.S387L|PRX_uc002ons.2_3'UTR	NM_181882	NP_870998	Q9BXM0	PRAX_HUMAN	periaxin isoform 2	526	15.|55 X 5 AA approximate tandem repeats of [LVMAG]-[PSREQC]-[EDKL]-[LIVMAP]- [AQKHRPE]; that may have a tripeptide spacer of [LV]-P-[KER].				axon ensheathment	cytoplasm|nucleus|plasma membrane	protein binding			ovary(2)	2			Lung(22;6.24e-05)|LUSC - Lung squamous cell carcinoma(20;0.000384)			TTTCATCTCCGACACTTTCAG	0.567													73	146	---	---	---	---	PASS
SHKBP1	92799	broad.mit.edu	37	19	41083468	41083468	+	Silent	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41083468C>T	uc002oob.2	+	4	241	c.192C>T	c.(190-192)TTC>TTT	p.F64F	SHKBP1_uc002ooc.2_Silent_p.F64F|SHKBP1_uc002ood.2_Silent_p.F64F|SHKBP1_uc010xvl.1_Missense_Mutation_p.S7L|SHKBP1_uc002ooe.2_5'UTR|SHKBP1_uc002oof.2_5'UTR|SHKBP1_uc010xvm.1_5'Flank|SHKBP1_uc010xvn.1_5'Flank	NM_138392	NP_612401	Q8TBC3	SHKB1_HUMAN	SH3KBP1 binding protein 1	64	BTB.					voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(1)|pancreas(1)	2			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)			CGCAGATCTTCATCGACAGGG	0.592													118	205	---	---	---	---	PASS
LTBP4	8425	broad.mit.edu	37	19	41111379	41111379	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41111379G>C	uc002ooh.1	+	6	712	c.712G>C	c.(712-714)GAG>CAG	p.E238Q	LTBP4_uc002oog.1_Missense_Mutation_p.E201Q|LTBP4_uc002ooi.1_Missense_Mutation_p.E171Q	NM_001042544	NP_001036009	Q8N2S1	LTBP4_HUMAN	latent transforming growth factor beta binding	238					growth hormone secretion|multicellular organismal development|protein folding|regulation of cell differentiation|regulation of cell growth|regulation of proteolysis|regulation of transforming growth factor beta receptor signaling pathway	extracellular space|proteinaceous extracellular matrix	calcium ion binding|glycosaminoglycan binding|integrin binding|transforming growth factor beta binding|transforming growth factor beta receptor activity			central_nervous_system(1)	1			Lung(22;0.000158)|LUSC - Lung squamous cell carcinoma(20;0.000384)			GCACCAGGTGGAGCGTGTGTC	0.453													14	27	---	---	---	---	PASS
ZNF526	116115	broad.mit.edu	37	19	42729490	42729490	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42729490G>A	uc002osz.1	+	3	1091	c.935G>A	c.(934-936)CGC>CAC	p.R312H		NM_133444	NP_597701	Q8TF50	ZN526_HUMAN	zinc finger protein 526	312	C2H2-type 5.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Prostate(69;0.0704)				CAGTGTCAGCGCAGTTTCAGC	0.652													17	13	---	---	---	---	PASS
RSPH6A	81492	broad.mit.edu	37	19	46307553	46307553	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46307553G>C	uc002pdm.2	-	3	1753	c.1610C>G	c.(1609-1611)TCC>TGC	p.S537C	RSPH6A_uc002pdl.2_Missense_Mutation_p.S273C	NM_030785	NP_110412	Q9H0K4	RSH6A_HUMAN	radial spokehead-like 1	537	Glu-rich.					intracellular				ovary(1)|central_nervous_system(1)	2						GTTGGCCATGGAGTCGACCAG	0.662													22	74	---	---	---	---	PASS
SYMPK	8189	broad.mit.edu	37	19	46341781	46341781	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46341781C>G	uc002pdn.2	-	10	1425	c.1180G>C	c.(1180-1182)GAC>CAC	p.D394H	SYMPK_uc002pdo.1_Missense_Mutation_p.D394H|SYMPK_uc002pdp.1_Missense_Mutation_p.D394H|SYMPK_uc002pdq.1_Missense_Mutation_p.D394H	NM_004819	NP_004810	Q92797	SYMPK_HUMAN	symplekin	394					cell adhesion|mRNA processing	cytoplasm|cytoskeleton|nucleoplasm|tight junction	protein binding			ovary(1)	1		all_neural(266;0.0299)|Ovarian(192;0.0308)		OV - Ovarian serous cystadenocarcinoma(262;0.00509)|GBM - Glioblastoma multiforme(486;0.0593)		ATGTCCGTGTCTGACTGGCCG	0.617													26	47	---	---	---	---	PASS
SLC1A5	6510	broad.mit.edu	37	19	47287779	47287779	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:47287779G>A	uc002pfs.2	-	2	1224	c.604C>T	c.(604-606)CGC>TGC	p.R202C	SLC1A5_uc010xyh.1_Intron|SLC1A5_uc002pfq.2_Missense_Mutation_p.R26C|SLC1A5_uc002pfr.2_5'UTR	NM_005628	NP_005619	Q15758	AAAT_HUMAN	solute carrier family 1 member 5 isoform 1	202	Extracellular (Potential).				cellular nitrogen compound metabolic process	integral to plasma membrane|melanosome|membrane fraction	neutral amino acid transmembrane transporter activity|protein binding|receptor activity|sodium:dicarboxylate symporter activity				0		all_epithelial(76;0.00314)|Ovarian(192;0.0798)|all_neural(266;0.107)		OV - Ovarian serous cystadenocarcinoma(262;0.000338)|all cancers(93;0.000882)|Epithelial(262;0.0211)|GBM - Glioblastoma multiforme(486;0.0341)	L-Asparagine(DB00174)|L-Glutamine(DB00130)	CTCACTGAGCGAAAGGCTGCT	0.552													102	193	---	---	---	---	PASS
RPL13A	23521	broad.mit.edu	37	19	49993523	49993523	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49993523C>G	uc002pny.2	+	3	145	c.123C>G	c.(121-123)ATC>ATG	p.I41M	RPL13A_uc002pnz.2_Translation_Start_Site|RPL13A_uc002poa.2_Nonsense_Mutation_p.S32*|SNORD33_uc010emz.1_5'Flank|SNORD34_uc010ena.1_5'Flank|SNORD35A_uc010enb.1_5'Flank	NM_012423	NP_036555	P40429	RL13A_HUMAN	ribosomal protein L13a	41					endocrine pancreas development|translational elongation|translational termination|viral transcription	cytosol|large ribosomal subunit	structural constituent of ribosome				0		all_lung(116;1.62e-07)|Lung NSC(112;8.47e-07)|all_neural(266;0.0381)|Ovarian(192;0.0392)		OV - Ovarian serous cystadenocarcinoma(262;0.00154)|GBM - Glioblastoma multiforme(486;0.0246)		GTGAAGGCATCAACATTTCTG	0.557													21	36	---	---	---	---	PASS
PRMT1	3276	broad.mit.edu	37	19	50188017	50188017	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50188017G>A	uc010enf.1	+	7	604	c.562G>A	c.(562-564)GAT>AAT	p.D188N	PRMT1_uc002ppc.1_RNA|PRMT1_uc002ppd.2_Missense_Mutation_p.D164N|PRMT1_uc002ppe.2_Missense_Mutation_p.D170N|PRMT1_uc002ppf.2_RNA|PRMT1_uc002ppg.2_Missense_Mutation_p.D135N|PRMT1_uc010yba.1_RNA	NM_001536	NP_001527	Q8WUW5	Q8WUW5_HUMAN	HMT1 hnRNP methyltransferase-like 2 isoform 1	169						cytoplasm	protein methyltransferase activity			ovary(1)	1		all_lung(116;3.24e-07)|Lung NSC(112;1.6e-06)|all_neural(266;0.0459)|Ovarian(192;0.0728)		OV - Ovarian serous cystadenocarcinoma(262;0.00103)|GBM - Glioblastoma multiforme(134;0.012)		GTAGGCGCCCGATGGCCTCAT	0.647											OREG0025627	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	3	3	---	---	---	---	PASS
C19orf41	126123	broad.mit.edu	37	19	50661604	50661604	+	Silent	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50661604G>T	uc002prp.1	-	5	504	c.417C>A	c.(415-417)CGC>CGA	p.R139R		NM_152358	NP_689571	Q6UXV1	IZUM2_HUMAN	hypothetical protein LOC126123 precursor	139	Extracellular (Potential).					integral to membrane					0		all_neural(266;0.0459)|Ovarian(192;0.0728)		GBM - Glioblastoma multiforme(134;0.00364)|OV - Ovarian serous cystadenocarcinoma(262;0.0052)		CTTTTAGCAAGCCTAGGCAAG	0.512													5	111	---	---	---	---	PASS
MYH14	79784	broad.mit.edu	37	19	50753910	50753910	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:50753910C>T	uc002prr.1	+	14	1818	c.1771C>T	c.(1771-1773)CAG>TAG	p.Q591*	MYH14_uc010enu.1_Nonsense_Mutation_p.Q599*|MYH14_uc002prq.1_Nonsense_Mutation_p.Q599*	NM_024729	NP_079005	Q7Z406	MYH14_HUMAN	myosin, heavy chain 14 isoform 2	591	Myosin head-like.				axon guidance|regulation of cell shape	myosin complex	actin binding|ATP binding|calmodulin binding|motor activity			central_nervous_system(1)	1		all_neural(266;0.0571)|Ovarian(192;0.0728)		OV - Ovarian serous cystadenocarcinoma(262;0.00389)|GBM - Glioblastoma multiforme(134;0.0195)		CCTGCGGGATCAGGCCGACTT	0.647													4	64	---	---	---	---	PASS
ZNF578	147660	broad.mit.edu	37	19	53007938	53007938	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53007938G>A	uc002pzp.3	+	5	338	c.94G>A	c.(94-96)GAA>AAA	p.E32K		NM_001099694	NP_001093164	Q96N58	ZN578_HUMAN	zinc finger protein 578	Error:Variant_position_missing_in_Q96N58_after_alignment					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.00819)|OV - Ovarian serous cystadenocarcinoma(262;0.01)		TGTGGCTATAGAATTCTCATT	0.448													5	233	---	---	---	---	PASS
NLRP11	204801	broad.mit.edu	37	19	56321310	56321310	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:56321310C>G	uc010ygf.1	-	5	1377	c.666G>C	c.(664-666)AAG>AAC	p.K222N	NLRP11_uc002qlz.2_Missense_Mutation_p.K123N|NLRP11_uc002qmb.2_Missense_Mutation_p.K123N|NLRP11_uc002qmc.2_RNA|NLRP11_uc010ete.1_RNA	NM_145007	NP_659444	P59045	NAL11_HUMAN	NLR family, pyrin domain containing 11	222	NACHT.						ATP binding			ovary(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	6		Colorectal(82;0.0002)		GBM - Glioblastoma multiforme(193;0.0325)		AAAGGAGTTTCTTGGGATCAG	0.473													26	67	---	---	---	---	PASS
ZNF8	7554	broad.mit.edu	37	19	58806467	58806467	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58806467G>A	uc002qry.1	+	4	1423	c.1293G>A	c.(1291-1293)CTG>CTA	p.L431L	ZNF8_uc002qrz.2_RNA	NM_021089	NP_066575	P17098	ZNF8_HUMAN	zinc finger protein 8	431					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		all_cancers(17;6.46e-05)|Lung NSC(17;0.0233)|all_neural(62;0.0381)|all_epithelial(17;0.0427)|all_lung(17;0.057)|Ovarian(87;0.17)|Colorectal(82;0.227)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.00619)		GCCAGAGGCTGATCTTTGAGC	0.592													78	127	---	---	---	---	PASS
RBM39	9584	broad.mit.edu	37	20	34295046	34295046	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34295046G>C	uc002xeb.2	-	14	1647	c.1303C>G	c.(1303-1305)CAA>GAA	p.Q435E	RBM39_uc002xdz.2_Missense_Mutation_p.Q411E|RBM39_uc002xea.2_Missense_Mutation_p.Q278E|RBM39_uc010gfn.2_Missense_Mutation_p.Q278E|RBM39_uc010zvm.1_Missense_Mutation_p.Q407E|RBM39_uc002xeg.2_Missense_Mutation_p.Q413E|RBM39_uc002xec.2_Missense_Mutation_p.Q429E|RBM39_uc002xed.2_Missense_Mutation_p.Q153E|RBM39_uc002xee.2_Missense_Mutation_p.Q278E|RBM39_uc002xef.2_Missense_Mutation_p.Q272E|RBM39_uc010zvn.1_Missense_Mutation_p.Q278E	NM_184234	NP_909122	Q14498	RBM39_HUMAN	RNA binding motif protein 39 isoform a	435	Interaction with NCOA6 (By similarity).				mRNA processing|regulation of transcription, DNA-dependent|RNA splicing|transcription, DNA-dependent	centrosome|nuclear speck	nucleotide binding|protein binding|RNA binding			ovary(1)|central_nervous_system(1)	2	all_epithelial(2;0.00295)|Lung NSC(9;0.00453)|Breast(12;0.00544)|all_lung(11;0.00676)					ACTTACGTTTGAGGGTTAAAC	0.294													15	37	---	---	---	---	PASS
SEMG1	6406	broad.mit.edu	37	20	43836630	43836630	+	Nonsense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43836630C>G	uc002xni.2	+	2	749	c.692C>G	c.(691-693)TCA>TGA	p.S231*	SEMG1_uc002xnj.2_Nonsense_Mutation_p.S231*|SEMG2_uc010ggz.2_Intron|SEMG1_uc002xnh.2_Nonsense_Mutation_p.S231*	NM_003007	NP_002998	P04279	SEMG1_HUMAN	semenogelin I preproprotein	231					insemination|sexual reproduction	extracellular space|stored secretory granule	structural molecule activity			skin(2)	2		Myeloproliferative disorder(115;0.0122)				GAGGAACATTCAAGTAAAGTA	0.388													43	78	---	---	---	---	PASS
MIR1259	100302194	broad.mit.edu	37	20	47896949	47896949	+	RNA	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47896949G>C	hsa-mir-1259|MI0006393	+			c.103G>C			ZNFX1_uc002xui.2_5'Flank|C20orf199_uc002xuj.2_Intron|C20orf199_uc002xul.3_Intron|C20orf199_uc002xun.3_Intron|C20orf199_uc002xum.3_Intron|C20orf199_uc002xuo.2_Intron|SNORD12B_uc010gia.1_RNA|SNORD12_uc002xup.1_5'Flank																	0						ATGCCAGCTTGAGCAGCTCCT	0.443													13	22	---	---	---	---	PASS
SNAI1	6615	broad.mit.edu	37	20	48604538	48604538	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:48604538G>C	uc002xuz.2	+	3	810	c.740G>C	c.(739-741)CGA>CCA	p.R247P		NM_005985	NP_005976	O95863	SNAI1_HUMAN	snail 1 homolog	247	C2H2-type 4; atypical.				epithelial to mesenchymal transition|mesoderm formation|negative regulation of transcription from RNA polymerase II promoter|osteoblast differentiation|positive regulation of cell migration|positive regulation of epithelial to mesenchymal transition|positive regulation of transcription, DNA-dependent	cytoplasm|nucleus	kinase binding|zinc ion binding			ovary(1)	1			BRCA - Breast invasive adenocarcinoma(9;4.03e-06)			ACCTTCTCCCGAATGTCCCTG	0.632													39	54	---	---	---	---	PASS
ATP9A	10079	broad.mit.edu	37	20	50346391	50346391	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:50346391G>T	uc002xwg.1	-	2	195	c.195C>A	c.(193-195)TTC>TTA	p.F65L	ATP9A_uc010gih.1_Missense_Mutation_p.F50L	NM_006045	NP_006036	O75110	ATP9A_HUMAN	ATPase, class II, type 9A	65	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(4)	4						GAAAGGTGAAGAAATTGTACT	0.507													46	95	---	---	---	---	PASS
RIMBP3	85376	broad.mit.edu	37	22	20457248	20457248	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:20457248G>A	uc002zsd.3	-	1	4539	c.4054C>T	c.(4054-4056)CGG>TGG	p.R1352W		NM_015672	NP_056487			RIMS binding protein 3												0	Colorectal(54;0.0993)|Melanoma(16;0.165)		LUSC - Lung squamous cell carcinoma(15;0.0405)|Lung(15;0.224)			TGCTTTTGCCGAAGTACCCTC	0.562													6	25	---	---	---	---	PASS
NEFH	4744	broad.mit.edu	37	22	29886321	29886321	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:29886321G>A	uc003afo.2	+	4	2763	c.2692G>A	c.(2692-2694)GAA>AAA	p.E898K	NEFH_uc003afp.2_5'UTR	NM_021076	NP_066554	P12036	NFH_HUMAN	neurofilament, heavy polypeptide 200kDa	904	Tail.				cell death|nervous system development	neurofilament					0						GGAAGAGGCTGAAGATAAGAA	0.502													6	18	---	---	---	---	PASS
RRP7A	27341	broad.mit.edu	37	22	42910684	42910684	+	Intron	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:42910684C>G	uc003bcq.2	-						SERHL_uc011apm.1_Intron|RRP7A_uc003bcp.2_Intron	NM_015703	NP_056518	Q9Y3A4	RRP7A_HUMAN	ribosomal RNA processing 7 homolog A								nucleotide binding|RNA binding			central_nervous_system(1)|skin(1)	2						CGCGGGGCCTCTACCTCAGCG	0.657													9	32	---	---	---	---	PASS
CERK	64781	broad.mit.edu	37	22	47107008	47107008	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:47107008C>T	uc003bia.2	-	5	651	c.544G>A	c.(544-546)GAG>AAG	p.E182K	CERK_uc010hae.2_Intron	NM_022766	NP_073603	Q8TCT0	CERK1_HUMAN	ceramide kinase	182	DAGKc.				activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|ceramide metabolic process	integral to membrane of membrane fraction|membrane|nucleus	ATP binding|ceramide kinase activity|diacylglycerol kinase activity|magnesium ion binding			skin(1)	1		Breast(42;0.00571)|Ovarian(80;0.00965)|all_neural(38;0.0416)|Lung SC(80;0.164)		UCEC - Uterine corpus endometrioid carcinoma (28;0.0182)|BRCA - Breast invasive adenocarcinoma(115;0.171)		ATGTTAATCTCATACAGAGTC	0.413													23	56	---	---	---	---	PASS
ASMTL	8623	broad.mit.edu	37	X	1531691	1531691	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1531691G>A	uc004cpx.1	-	12	1690	c.1579C>T	c.(1579-1581)CTG>TTG	p.L527L	NCRNA00105_uc004cpv.2_RNA|NCRNA00105_uc004cpw.2_RNA|ASMTL_uc011mhe.1_Silent_p.L451L|ASMTL_uc004cpy.1_Silent_p.L511L|ASMTL_uc011mhf.1_Silent_p.L469L	NM_004192	NP_004183	O95671	ASML_HUMAN	acetylserotonin O-methyltransferase-like	527	ASMT-like.				melatonin biosynthetic process	cytoplasm	acetylserotonin O-methyltransferase activity				0		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)				CAGTCATGCAGGATCCGGCAC	0.542													99	417	---	---	---	---	PASS
MXRA5	25878	broad.mit.edu	37	X	3229099	3229099	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:3229099G>A	uc004crg.3	-	7	7302	c.7145C>T	c.(7144-7146)TCC>TTC	p.S2382F		NM_015419	NP_056234	Q9NR99	MXRA5_HUMAN	adlican precursor	2382	Ig-like C2-type 8.					extracellular region				ovary(5)|lung(1)|central_nervous_system(1)|skin(1)	8		all_lung(23;0.00031)|Lung NSC(23;0.000946)				GTTGGTTGGGGACAACCAAGT	0.532													89	160	---	---	---	---	PASS
SHROOM2	357	broad.mit.edu	37	X	9864427	9864427	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:9864427G>A	uc004csu.1	+	4	2569	c.2479G>A	c.(2479-2481)GAG>AAG	p.E827K		NM_001649	NP_001640	Q13796	SHRM2_HUMAN	apical protein of Xenopus-like	827					apical protein localization|brain development|cell migration|cell morphogenesis|cellular pigment accumulation|ear development|establishment of melanosome localization|eye pigment granule organization|lens morphogenesis in camera-type eye|melanosome organization	apical plasma membrane|cell-cell adherens junction|microtubule|tight junction	actin filament binding|beta-catenin binding|ligand-gated sodium channel activity			ovary(3)|skin(3)|upper_aerodigestive_tract(1)|breast(1)	8		Hepatocellular(5;0.000888)				AGACAAGCCAGAGAGGCCGCG	0.617													25	69	---	---	---	---	PASS
RS1	6247	broad.mit.edu	37	X	18662593	18662593	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:18662593C>T	uc004cyo.2	-	5	514	c.479G>A	c.(478-480)CGC>CAC	p.R160H	CDKL5_uc004cym.2_Intron|CDKL5_uc004cyn.2_Intron	NM_000330	NP_000321	O15537	XLRS1_HUMAN	X-linked juvenile retinoschisis protein	160	F5/8 type C.				cell adhesion|multicellular organismal development|response to stimulus|visual perception	extracellular space				ovary(2)	2	Hepatocellular(33;0.183)					CCAGTTCAGGCGCTCATCGGT	0.537													122	212	---	---	---	---	PASS
KLHL34	257240	broad.mit.edu	37	X	21675600	21675600	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:21675600G>A	uc004czz.1	-	1	849	c.307C>T	c.(307-309)CTG>TTG	p.L103L		NM_153270	NP_695002	Q8N239	KLH34_HUMAN	kelch-like 34	103										ovary(1)	1						GCGGCCTCCAGAGTGTCCTCT	0.642													20	24	---	---	---	---	PASS
EIF2S3	1968	broad.mit.edu	37	X	24078221	24078221	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:24078221G>C	uc004dbc.2	+	5	421	c.400G>C	c.(400-402)GAC>CAC	p.D134H		NM_001415	NP_001406	P41091	IF2G_HUMAN	eukaryotic translation initiation factor 2,	134	GTP (By similarity).					cytosol	GTP binding|GTPase activity|protein binding|translation initiation factor activity			lung(1)	1						TTCCTTTGTTGACTGTCCTGG	0.363													4	175	---	---	---	---	PASS
MAGEB18	286514	broad.mit.edu	37	X	26157793	26157793	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:26157793G>A	uc004dbq.1	+	2	878	c.691G>A	c.(691-693)GAT>AAT	p.D231N		NM_173699	NP_775970	Q96M61	MAGBI_HUMAN	melanoma antigen family B, 18	231	MAGE.						protein binding			central_nervous_system(1)	1						TGTATATGCCGATAGGAAGCA	0.498													12	33	---	---	---	---	PASS
DMD	1756	broad.mit.edu	37	X	32591732	32591732	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:32591732G>A	uc004dda.1	-	15	1971	c.1727C>T	c.(1726-1728)TCA>TTA	p.S576L	DMD_uc004dcz.2_Missense_Mutation_p.S453L|DMD_uc004dcy.1_Missense_Mutation_p.S572L|DMD_uc004ddb.1_Missense_Mutation_p.S568L|DMD_uc010ngo.1_Intron|DMD_uc004ddf.2_Missense_Mutation_p.S568L|DMD_uc010ngp.1_Nonsense_Mutation_p.Q96*|DMD_uc010ngq.1_RNA	NM_004006	NP_003997	P11532	DMD_HUMAN	dystrophin Dp427m isoform	576	Spectrin 3.				muscle filament sliding|peptide biosynthetic process	cell surface|costamere|cytoskeleton|cytosol|dystrophin-associated glycoprotein complex|sarcolemma	actin binding|dystroglycan binding|nitric-oxide synthase binding|protein binding|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(3)|pancreas(2)|large_intestine(1)	6		all_cancers(2;1.22e-16)|Acute lymphoblastic leukemia(2;4.65e-06)|all_hematologic(2;0.00108)|all_epithelial(3;0.00626)|all_neural(2;0.0189)|all_lung(315;0.182)|Glioma(3;0.203)				TTCTTTTTCTGAAAGCCATGC	0.338													44	140	---	---	---	---	PASS
PRRG1	5638	broad.mit.edu	37	X	37312806	37312806	+	Nonsense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:37312806G>T	uc004ddn.2	+	5	842	c.589G>T	c.(589-591)GAG>TAG	p.E197*	PRRG1_uc004ddo.2_Nonsense_Mutation_p.E197*	NM_000950	NP_000941	O14668	TMG1_HUMAN	proline rich Gla (G-carboxyglutamic acid) 1	197	Cytoplasmic (Potential).					extracellular region|integral to plasma membrane	calcium ion binding			ovary(1)|breast(1)	2						CCCAGAGTATGAGGACATAGT	0.483													4	135	---	---	---	---	PASS
SLC9A7	84679	broad.mit.edu	37	X	46532051	46532051	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:46532051G>A	uc004dgu.1	-	4	623	c.615C>T	c.(613-615)TTC>TTT	p.F205F	SLC9A7_uc004dgv.1_Silent_p.F205F	NM_032591	NP_115980	Q96T83	SL9A7_HUMAN	solute carrier family 9, member 7	205					regulation of pH	Golgi membrane|integral to membrane|recycling endosome membrane|trans-Golgi network	potassium:hydrogen antiporter activity|protein homodimerization activity|sodium:hydrogen antiporter activity			ovary(2)	2						CAAGATTTCTGAAAAAGTGTC	0.348													29	102	---	---	---	---	PASS
UBA1	7317	broad.mit.edu	37	X	47062948	47062948	+	Silent	SNP	G	C	C	rs145317174		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:47062948G>C	uc004dhj.3	+	14	1579	c.1428G>C	c.(1426-1428)GCG>GCC	p.A476A	UBA1_uc004dhk.3_Silent_p.A476A|INE1_uc004dhl.2_5'Flank	NM_153280	NP_695012	P22314	UBA1_HUMAN	ubiquitin-activating enzyme E1	476	1-2.|2 approximate repeats.				cell death|protein modification process		ATP binding|ligase activity|protein binding|small protein activating enzyme activity			ovary(1)	1						AGGTGGGTGCGGGGGCCATTG	0.562													27	70	---	---	---	---	PASS
SLC38A5	92745	broad.mit.edu	37	X	48324395	48324395	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:48324395C>T	uc010nid.2	-						SLC38A5_uc004djk.3_Intron	NM_033518	NP_277053	Q8WUX1	S38A5_HUMAN	solute carrier family 38, member 5						cellular nitrogen compound metabolic process|ion transport	integral to membrane|plasma membrane				ovary(3)	3						GGGTGTTGCTCACTCACCCCT	0.582											OREG0019763	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	7	23	---	---	---	---	PASS
AKAP4	8852	broad.mit.edu	37	X	49958365	49958365	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:49958365G>A	uc004dow.1	-	5	1123	c.999C>T	c.(997-999)CTC>CTT	p.L333L	AKAP4_uc004dov.1_Intron|AKAP4_uc010njp.1_Silent_p.L155L|AKAP4_uc004dou.1_Silent_p.L324L	NM_003886	NP_003877	Q5JQC9	AKAP4_HUMAN	A-kinase anchor protein 4 isoform 1	333					cell projection organization|single fertilization|sperm motility	cAMP-dependent protein kinase complex|cilium|cytoskeleton|microtubule-based flagellum	protein kinase A binding			kidney(3)|central_nervous_system(2)|ovary(1)|lung(1)|skin(1)	8	Ovarian(276;0.236)					CATAAACCATGAGCCCCTTGC	0.458													8	52	---	---	---	---	PASS
GPR173	54328	broad.mit.edu	37	X	53106338	53106338	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53106338C>T	uc004dru.2	+	2	793	c.535C>T	c.(535-537)CGC>TGC	p.R179C		NM_018969	NP_061842	Q9NS66	GP173_HUMAN	G protein-coupled receptor 173	179	Extracellular (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			skin(1)	1						CTTTGAGCATCGCTACTTCAA	0.552													11	36	---	---	---	---	PASS
TRO	7216	broad.mit.edu	37	X	54950197	54950197	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54950197G>A	uc004dtq.2	+	3	1339	c.1232G>A	c.(1231-1233)CGA>CAA	p.R411Q	TRO_uc011moj.1_Missense_Mutation_p.R354Q|TRO_uc004dts.2_Missense_Mutation_p.R411Q|TRO_uc004dtr.2_Missense_Mutation_p.R411Q|TRO_uc004dtt.2_RNA|TRO_uc004dtu.2_Intron|TRO_uc004dtv.2_Intron|TRO_uc011mok.1_Intron|TRO_uc004dtw.2_Intron|TRO_uc004dtx.2_5'Flank	NM_001039705	NP_001034794	Q12816	TROP_HUMAN	trophinin isoform 5	411					embryo implantation|homophilic cell adhesion	integral to plasma membrane				ovary(1)	1						AAAAGAAACCGAAAGGTGAGA	0.433													14	33	---	---	---	---	PASS
PFKFB1	5207	broad.mit.edu	37	X	54982618	54982618	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54982618G>A	uc004dty.1	-	7	677	c.606C>T	c.(604-606)GTC>GTT	p.V202V	PFKFB1_uc010nkd.1_Intron|PFKFB1_uc011mol.1_Silent_p.V137V	NM_002625	NP_002616	P16118	F261_HUMAN	6-phosphofructo-2-kinase/fructose-2,	202	6-phosphofructo-2-kinase.				energy reserve metabolic process|fructose 2,6-bisphosphate metabolic process|gluconeogenesis|glycolysis|intracellular protein kinase cascade	6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 complex	6-phosphofructo-2-kinase activity|ATP binding|fructose-2,6-bisphosphate 2-phosphatase activity|identical protein binding			ovary(1)	1						GTTGGTAGTTGACCTCATAGC	0.274													30	105	---	---	---	---	PASS
MAGEH1	28986	broad.mit.edu	37	X	55479285	55479285	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:55479285G>C	uc004dum.2	+	1	748	c.478G>C	c.(478-480)GAG>CAG	p.E160Q		NM_014061	NP_054780	Q9H213	MAGH1_HUMAN	melanoma antigen, family H, 1 protein	160	MAGE.				apoptosis					ovary(1)|lung(1)|central_nervous_system(1)|skin(1)	4						GGTGGAGTATGAGTTCTTCTG	0.517													35	122	---	---	---	---	PASS
GDPD2	54857	broad.mit.edu	37	X	69652802	69652802	+	Intron	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:69652802C>T	uc004dyh.2	+						GDPD2_uc011mpk.1_Intron|GDPD2_uc011mpl.1_Intron|GDPD2_uc011mpm.1_Intron	NM_017711	NP_060181	Q9HCC8	GDPD2_HUMAN	osteoblast differentiation promoting factor						glycerol metabolic process|lipid metabolic process	cytoplasm|cytoskeleton|integral to membrane|plasma membrane	glycerophosphodiester phosphodiesterase activity|glycerophosphoinositol inositolphosphodiesterase activity|metal ion binding			ovary(2)	2	Renal(35;0.156)					TAAGAACTTTCTCCCCTCACC	0.507											OREG0019852	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	19	45	---	---	---	---	PASS
MAGEE2	139599	broad.mit.edu	37	X	75003459	75003459	+	Silent	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:75003459G>A	uc004ecj.1	-	1	1613	c.1428C>T	c.(1426-1428)ATC>ATT	p.I476I		NM_138703	NP_619648	Q8TD90	MAGE2_HUMAN	melanoma antigen family E, 2	476	MAGE 2.									ovary(1)|skin(1)	2						CTTTCATTTTGATGGTTTCAT	0.493													43	119	---	---	---	---	PASS
BRWD3	254065	broad.mit.edu	37	X	79955474	79955474	+	Nonsense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:79955474C>T	uc004edt.2	-	25	3188	c.2925G>A	c.(2923-2925)TGG>TGA	p.W975*	BRWD3_uc010nmi.1_RNA|BRWD3_uc004edo.2_Nonsense_Mutation_p.W571*|BRWD3_uc004edp.2_Nonsense_Mutation_p.W804*|BRWD3_uc004edq.2_Nonsense_Mutation_p.W571*|BRWD3_uc010nmj.1_Nonsense_Mutation_p.W571*|BRWD3_uc004edr.2_Nonsense_Mutation_p.W645*|BRWD3_uc004eds.2_Nonsense_Mutation_p.W571*|BRWD3_uc004edu.2_Nonsense_Mutation_p.W645*|BRWD3_uc004edv.2_Nonsense_Mutation_p.W571*|BRWD3_uc004edw.2_Nonsense_Mutation_p.W571*|BRWD3_uc004edx.2_Nonsense_Mutation_p.W571*|BRWD3_uc004edy.2_Nonsense_Mutation_p.W571*|BRWD3_uc004edz.2_Nonsense_Mutation_p.W645*|BRWD3_uc004eea.2_Nonsense_Mutation_p.W645*|BRWD3_uc004eeb.2_Nonsense_Mutation_p.W571*	NM_153252	NP_694984	Q6RI45	BRWD3_HUMAN	bromodomain and WD repeat domain containing 3	975										ovary(4)	4						CCATTTTGTTCCATGGCTGTT	0.358													5	30	---	---	---	---	PASS
IRS4	8471	broad.mit.edu	37	X	107976265	107976265	+	Missense_Mutation	SNP	G	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107976265G>A	uc004eoc.2	-	1	3343	c.3310C>T	c.(3310-3312)CCA>TCA	p.P1104S		NM_003604	NP_003595	O14654	IRS4_HUMAN	insulin receptor substrate 4	1104	Ala-rich.					plasma membrane	insulin receptor binding|SH3/SH2 adaptor activity|signal transducer activity			ovary(4)|large_intestine(2)|lung(1)|breast(1)|skin(1)|pancreas(1)	10						CTGTCTGTTGGAAAAGCAGAG	0.577													85	242	---	---	---	---	PASS
STAG2	10735	broad.mit.edu	37	X	123164963	123164963	+	Missense_Mutation	SNP	G	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:123164963G>C	uc004etz.3	+	4	615	c.276G>C	c.(274-276)AAG>AAC	p.K92N	STAG2_uc004eua.2_Missense_Mutation_p.K92N|STAG2_uc004eub.2_Missense_Mutation_p.K92N|STAG2_uc004euc.2_Missense_Mutation_p.K92N|STAG2_uc004eud.2_Missense_Mutation_p.K92N|STAG2_uc004eue.2_Missense_Mutation_p.K92N	NM_006603	NP_006594	Q8N3U4	STAG2_HUMAN	stromal antigen 2 isoform b	92					cell division|meiosis|mitotic metaphase/anaphase transition|mitotic prometaphase|negative regulation of DNA endoreduplication|sister chromatid cohesion	chromatin|chromosome, centromeric region|nucleoplasm	protein binding			ovary(4)|skin(1)	5						AAATGGGCAAGAGTGCTATGC	0.368													51	252	---	---	---	---	PASS
ODZ1	10178	broad.mit.edu	37	X	123695634	123695634	+	Missense_Mutation	SNP	C	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:123695634C>T	uc004euj.2	-	14	2385	c.2321G>A	c.(2320-2322)CGA>CAA	p.R774Q	ODZ1_uc011muj.1_Missense_Mutation_p.R773Q|ODZ1_uc010nqy.2_Missense_Mutation_p.R774Q	NM_014253	NP_055068	Q9UKZ4	TEN1_HUMAN	odz, odd Oz/ten-m homolog 1 isoform 3	774	EGF-like 8.|Extracellular (Potential).				immune response|negative regulation of cell proliferation|nervous system development|signal transduction	extracellular region	heparin binding			ovary(11)|breast(4)|large_intestine(2)|skin(2)|pancreas(2)|upper_aerodigestive_tract(1)|lung(1)	23						CAGGGTACATCGTCCATTTCC	0.473													45	157	---	---	---	---	PASS
ZDHHC9	51114	broad.mit.edu	37	X	128948628	128948628	+	Intron	SNP	A	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:128948628A>C	uc004euv.2	-						ZDHHC9_uc004euw.2_Intron	NM_001008222	NP_001008223	Q9Y397	ZDHC9_HUMAN	zinc finger, DHHC domain containing 9							endoplasmic reticulum membrane|Golgi membrane|integral to membrane	acyltransferase activity|zinc ion binding			ovary(1)	1						TGCCCTGTATACTCACTGAGG	0.512													4	504	---	---	---	---	PASS
GPR112	139378	broad.mit.edu	37	X	135428816	135428816	+	Missense_Mutation	SNP	A	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135428816A>T	uc004ezu.1	+	6	3242	c.2951A>T	c.(2950-2952)GAC>GTC	p.D984V	GPR112_uc010nsb.1_Missense_Mutation_p.D779V|GPR112_uc010nsc.1_Missense_Mutation_p.D751V	NM_153834	NP_722576	Q8IZF6	GP112_HUMAN	G-protein coupled receptor 112	984	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(5)|large_intestine(2)|skin(2)|lung(1)|breast(1)|pancreas(1)	12	Acute lymphoblastic leukemia(192;0.000127)					ACCCCTACAGACAGGACAGCT	0.502													20	395	---	---	---	---	PASS
ARHGEF6	9459	broad.mit.edu	37	X	135750212	135750212	+	Missense_Mutation	SNP	A	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135750212A>C	uc004fab.2	-	22	2769	c.2307T>G	c.(2305-2307)AGT>AGG	p.S769R	ARHGEF6_uc011mwd.1_Missense_Mutation_p.S642R|ARHGEF6_uc011mwe.1_Missense_Mutation_p.S615R	NM_004840	NP_004831	Q15052	ARHG6_HUMAN	Rac/Cdc42 guanine nucleotide exchange factor 6	769					apoptosis|cell junction assembly|induction of apoptosis by extracellular signals|JNK cascade|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity|Rho guanyl-nucleotide exchange factor activity				0	Acute lymphoblastic leukemia(192;0.000127)					AGGTCTTGCTACTGGACTCGC	0.478													6	234	---	---	---	---	PASS
RBMX	27316	broad.mit.edu	37	X	135957302	135957302	+	Missense_Mutation	SNP	G	A	A	rs142954172	by1000genomes	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135957302G>A	uc004fae.1	-	8	1018	c.808C>T	c.(808-810)CGT>TGT	p.R270C	RBMX_uc004fac.1_5'Flank|RBMX_uc011mwf.1_Silent_p.I161I|RBMX_uc004fad.1_Missense_Mutation_p.R270C|RBMX_uc011mwg.1_Missense_Mutation_p.R231C|RBMX_uc004faf.1_Missense_Mutation_p.R131C|RBMX_uc010nsf.1_Missense_Mutation_p.R231C|RBMX_uc004fag.1_Missense_Mutation_p.R142C	NM_002139	NP_002130	P38159	HNRPG_HUMAN	RNA binding motif protein, X-linked isoform 1	270						catalytic step 2 spliceosome|heterogeneous nuclear ribonucleoprotein complex|nucleoplasm	nucleotide binding|protein binding|RNA binding			ovary(1)	1	Acute lymphoblastic leukemia(192;0.000127)					GAATAGTCACGATCACGACCA	0.383													12	405	---	---	---	---	PASS
GDI1	2664	broad.mit.edu	37	X	153670074	153670074	+	Missense_Mutation	SNP	C	G	G			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153670074C>G	uc004fli.3	+	8	1266	c.924C>G	c.(922-924)ATC>ATG	p.I308M	GDI1_uc011mzo.1_3'UTR|GDI1_uc004flj.2_5'Flank|FAM50A_uc004fll.3_5'Flank	NM_001493	NP_001484	P31150	GDIA_HUMAN	GDP dissociation inhibitor 1	308					protein transport|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|midbody	GTPase activator activity|protein binding				0	all_cancers(53;5.05e-16)|all_epithelial(53;1.87e-10)|all_lung(58;1.84e-07)|Lung NSC(58;5.84e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)					GCCACCCCATCAAGAACACCA	0.582													52	178	---	---	---	---	PASS
IL9R	3581	broad.mit.edu	37	X	155234190	155234190	+	Missense_Mutation	SNP	G	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:155234190G>T	uc004fnv.1	+	5	718	c.539G>T	c.(538-540)AGC>ATC	p.S180I	IL9R_uc010nvn.2_Missense_Mutation_p.S159I|IL9R_uc004fnu.1_Missense_Mutation_p.S215I	NM_002186	NP_002177	Q01113	IL9R_HUMAN	interleukin 9 receptor precursor	180	Extracellular (Potential).|Fibronectin type-III.				cell proliferation	extracellular space|integral to plasma membrane	interleukin-9 receptor activity				0	all_cancers(53;1.86e-17)|all_epithelial(53;2.71e-11)|all_lung(58;1.84e-07)|Lung NSC(58;5.62e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)|Renal(33;0.214)					ACACTTCTCAGCTATGAGCTG	0.582													35	75	---	---	---	---	PASS
PPT1	5538	broad.mit.edu	37	1	40557553	40557554	+	Intron	DEL	AG	-	-	rs58820666		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40557553_40557554delAG	uc001cfb.2	-						PPT1_uc010ojf.1_Intron|PPT1_uc010ojg.1_Intron|PPT1_uc009vwa.2_Intron	NM_000310	NP_000301	P50897	PPT1_HUMAN	palmitoyl-protein thioesterase 1 isoform 1						brain development|cofactor metabolic process|cofactor transport|DNA fragmentation involved in apoptotic nuclear change|lysosomal lumen acidification|membrane raft organization|negative regulation of cell growth|negative regulation of neuron apoptosis|neuron development|pinocytosis|positive regulation of pinocytosis|positive regulation of receptor-mediated endocytosis|protein depalmitoylation|protein transport|receptor-mediated endocytosis|regulation of synapse structure and activity|sphingolipid catabolic process|visual perception	axon|cytosol|Golgi apparatus|lysosome|membrane fraction|membrane raft|nucleus|synaptic vesicle	palmitoyl-(protein) hydrolase activity|palmitoyl-CoA hydrolase activity			ovary(1)	1	Lung NSC(20;3.43e-06)|Ovarian(52;0.00167)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;1e-18)|Epithelial(16;3.6e-17)|all cancers(16;1.1e-15)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)			aaaaaaaaaaagaaaagaaaTT	0.163													4	2	---	---	---	---	
ZMYND12	84217	broad.mit.edu	37	1	42905858	42905859	+	Intron	INS	-	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:42905858_42905859insA	uc001chj.2	-						ZMYND12_uc010ojt.1_Intron	NM_032257	NP_115633	Q9H0C1	ZMY12_HUMAN	zinc finger, MYND-type containing 12 isoform 1							intracellular	zinc ion binding			ovary(1)	1	Ovarian(52;0.00744)|all_hematologic(146;0.0977)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0505)				tttggaagagtaaaaaaaaaaa	0.079													3	3	---	---	---	---	
PTPRC	5788	broad.mit.edu	37	1	198691479	198691480	+	Intron	DEL	AT	-	-	rs71717833		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:198691479_198691480delAT	uc001gur.1	+						PTPRC_uc001gus.1_Intron|PTPRC_uc001gut.1_Intron|PTPRC_uc009wzf.1_Intron|PTPRC_uc010ppg.1_Intron	NM_002838	NP_002829	P08575	PTPRC_HUMAN	protein tyrosine phosphatase, receptor type, C						axon guidance|B cell proliferation|B cell receptor signaling pathway|defense response to virus|immunoglobulin biosynthetic process|negative regulation of cytokine-mediated signaling pathway|negative regulation of protein kinase activity|negative regulation of T cell mediated cytotoxicity|positive regulation of antigen receptor-mediated signaling pathway|positive regulation of B cell proliferation|positive regulation of protein kinase activity|positive regulation of T cell proliferation|regulation of S phase|release of sequestered calcium ion into cytosol|T cell differentiation|T cell receptor signaling pathway	focal adhesion|integral to plasma membrane|membrane raft	protein kinase binding|transmembrane receptor protein tyrosine phosphatase activity			breast(4)|skin(3)|ovary(2)|lung(1)|kidney(1)|pancreas(1)	12						GTGatatataatatatatatat	0.262													4	2	---	---	---	---	
USH2A	7399	broad.mit.edu	37	1	215814187	215814187	+	Intron	DEL	A	-	-	rs138417166		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:215814187delA	uc001hku.1	-							NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B						maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)		CAATCCaaacaaaaaaaaaaa	0.318										HNSCC(13;0.011)			6	3	---	---	---	---	
AHCTF1	25909	broad.mit.edu	37	1	247067157	247067157	+	Intron	DEL	G	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247067157delG	uc001ibu.1	-						AHCTF1_uc001ibv.1_Intron	NM_015446	NP_056261	Q8WYP5	ELYS_HUMAN	transcription factor ELYS						cytokinesis|mitotic prometaphase|mRNA transport|nuclear pore complex assembly|protein transport|transmembrane transport	condensed chromosome kinetochore|cytosol|nuclear matrix|nuclear membrane|nuclear pore|nucleoplasm	DNA binding			ovary(5)|skin(2)	7	all_cancers(71;3.05e-05)|all_epithelial(71;6.72e-06)|Ovarian(71;0.0173)|Breast(184;0.0318)|all_lung(81;0.0458)|Lung NSC(105;0.0518)	all_cancers(173;0.0266)	OV - Ovarian serous cystadenocarcinoma(106;0.00271)			aaaaaaaaaagaaTCACTTTT	0.124													11	5	---	---	---	---	
SATB1	6304	broad.mit.edu	37	3	18457303	18457304	+	Intron	INS	-	T	T	rs112868614	by1000genomes	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:18457303_18457304insT	uc003cbh.2	-						SATB1_uc003cbi.2_Intron|SATB1_uc003cbj.2_Intron	NM_002971	NP_002962	Q01826	SATB1_HUMAN	special AT-rich sequence binding protein 1						cellular component disassembly involved in apoptosis|interspecies interaction between organisms|negative regulation of transcription from RNA polymerase II promoter	nuclear matrix|PML body	double-stranded DNA binding|sequence-specific DNA binding			skin(2)|ovary(1)|lung(1)	4						TTGTGTGTGTGGGGGGGGGGAT	0.347													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	83790732	83790733	+	IGR	INS	-	GGAG	GGAG	rs13089076		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:83790732_83790733insGGAG								None (None upstream) : None (None downstream)																							aaggaaggaaaggagggaggga	0.089													3	3	---	---	---	---	
TBL1XR1	79718	broad.mit.edu	37	3	176767668	176767671	+	Intron	DEL	TTAC	-	-	rs35503291		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:176767668_176767671delTTAC	uc003fiw.3	-						TBL1XR1_uc003fix.3_Intron|TBL1XR1_uc011bpz.1_Intron	NM_024665	NP_078941	Q9BZK7	TBL1R_HUMAN	transducin (beta)-like 1 X-linked receptor 1						canonical Wnt receptor signaling pathway|cellular lipid metabolic process|chromatin modification|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|proteasomal ubiquitin-dependent protein catabolic process|transcription, DNA-dependent	spindle microtubule|transcriptional repressor complex	beta-catenin binding|histone binding|protein N-terminus binding|transcription corepressor activity|transcription regulatory region DNA binding			ovary(1)	1	all_cancers(143;1.44e-17)|Ovarian(172;0.00163)|Breast(254;0.214)	Acute lymphoblastic leukemia(1;0.00599)|all_hematologic(1;0.0632)|Prostate(884;0.215)	OV - Ovarian serous cystadenocarcinoma(80;9.83e-31)			CGGTTTGTTGTTACTAGTTAATAA	0.333													3	4	---	---	---	---	
NOP14	8602	broad.mit.edu	37	4	2953836	2953837	+	Intron	INS	-	A	A	rs5855767		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:2953836_2953837insA	uc003ggj.1	-						C4orf10_uc003ggi.1_Intron|NOP14_uc010icp.2_Intron|NOP14_uc003ggk.3_Intron|NOP14_uc003ggl.2_Intron|NOP14_uc010icq.1_Intron	NM_003703	NP_003694	P78316	NOP14_HUMAN	probable nucleolar complex protein 14						endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)|endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	mitochondrion|Noc4p-Nop14p complex|small-subunit processome	snoRNA binding			pancreas(1)	1						ctgtctcaaagaaaaaaaaaaa	0.129													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	4	57554288	57554290	+	IGR	DEL	AGG	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57554288_57554290delAGG								HOPX (6416 upstream) : SPINK2 (121744 downstream)																							gaaggaaaaaaggagggagggag	0.000													3	4	---	---	---	---	
WDR17	116966	broad.mit.edu	37	4	177071552	177071569	+	Intron	DEL	TGAAGATGCAAAATATTA	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:177071552_177071569delTGAAGATGCAAAATATTA	uc003iuj.2	+						WDR17_uc003iuk.2_Intron|WDR17_uc003ium.3_Intron|WDR17_uc003iul.1_Intron|WDR17_uc003iun.2_5'Flank	NM_170710	NP_733828	Q8IZU2	WDR17_HUMAN	WD repeat domain 17 isoform 1											ovary(2)|skin(2)|pancreas(1)|central_nervous_system(1)	6		Breast(14;0.00015)|Melanoma(52;0.00886)|Prostate(90;0.00996)|Renal(120;0.0183)|all_hematologic(60;0.107)|all_neural(102;0.164)		all cancers(43;2.21e-20)|Epithelial(43;9.71e-18)|OV - Ovarian serous cystadenocarcinoma(60;2.38e-09)|GBM - Glioblastoma multiforme(59;0.000295)|STAD - Stomach adenocarcinoma(60;0.000703)|LUSC - Lung squamous cell carcinoma(193;0.0232)		ATAATATTTTTGAAGATGCAAAATATTATGAGGTTTTT	0.275													43	27	---	---	---	---	
HLA-DQA1	3117	broad.mit.edu	37	6	32605387	32605388	+	Intron	INS	-	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32605387_32605388insT	uc003obr.2	+						HLA-DQA1_uc003obs.2_Intron|HLA-DQA1_uc003obt.1_Intron	NM_002122	NP_002113	P01909	DQA1_HUMAN	major histocompatibility complex, class II, DQ						antigen processing and presentation of peptide or polysaccharide antigen via MHC class II|interferon-gamma-mediated signaling pathway|T cell costimulation|T cell receptor signaling pathway	endoplasmic reticulum membrane|endosome membrane|Golgi apparatus|integral to plasma membrane|lysosomal membrane|MHC class II protein complex	MHC class II receptor activity				0						AGATAAAGCGATTTGCAGAGAA	0.431													3	10	---	---	---	---	
C6orf126	389383	broad.mit.edu	37	6	35745086	35745087	+	Intron	INS	-	G	G	rs147993418	by1000genomes	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35745086_35745087insG	uc010jvz.1	+						C6orf126_uc003olc.1_Intron	NM_207409	NP_997292	Q6UWE3	CF126_HUMAN	hypothetical protein LOC389383 precursor						digestion|lipid catabolic process	extracellular region	enzyme activator activity				0						GGGGTGGGGCTGGGGGGGGAAC	0.663													7	6	---	---	---	---	
Unknown	0	broad.mit.edu	37	6	41275845	41275845	+	IGR	DEL	T	-	-	rs71702533		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41275845delT								TREM1 (21388 upstream) : NCR2 (27683 downstream)																							GATGTGGTTCTTTTTTTTTTT	0.423													6	3	---	---	---	---	
CUL9	23113	broad.mit.edu	37	6	43173568	43173568	+	Intron	DEL	A	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43173568delA	uc003ouk.2	+						CUL9_uc003oul.2_Intron|CUL9_uc010jyk.2_Intron	NM_015089	NP_055904	Q8IWT3	CUL9_HUMAN	p53-associated parkin-like cytoplasmic protein						ubiquitin-dependent protein catabolic process	cullin-RING ubiquitin ligase complex|cytoplasm	ATP binding|ubiquitin protein ligase binding|zinc ion binding			ovary(5)|lung(3)|skin(2)|breast(1)|central_nervous_system(1)	12						actccgtctcaaaaaaaaaaa	0.234													3	3	---	---	---	---	
MAP3K7	6885	broad.mit.edu	37	6	91261583	91261583	+	Intron	DEL	A	-	-	rs35787813		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:91261583delA	uc003pnz.1	-						MAP3K7_uc003poa.1_Intron|MAP3K7_uc003pob.1_Intron|MAP3K7_uc003poc.1_Intron	NM_145331	NP_663304	O43318	M3K7_HUMAN	mitogen-activated protein kinase kinase kinase 7						activation of MAPK activity|activation of NF-kappaB-inducing kinase activity|histone H3 acetylation|I-kappaB phosphorylation|innate immune response|JNK cascade|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-2 production|positive regulation of JUN kinase activity|positive regulation of NF-kappaB transcription factor activity|positive regulation of T cell cytokine production|stress-activated MAPK cascade|T cell receptor signaling pathway|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway|transforming growth factor beta receptor signaling pathway	Ada2/Gcn5/Ada3 transcription activator complex|cytosol|endosome membrane	ATP binding|magnesium ion binding|MAP kinase kinase kinase activity|protein binding|protein binding			ovary(2)|lung(2)|upper_aerodigestive_tract(1)|stomach(1)	6		all_cancers(76;6.4e-08)|Acute lymphoblastic leukemia(125;1.43e-09)|Prostate(29;9.32e-09)|all_hematologic(105;3.69e-06)|all_epithelial(107;0.000187)|Ovarian(999;0.0164)		OV - Ovarian serous cystadenocarcinoma(136;2.05e-11)|all cancers(137;3.25e-11)|GBM - Glioblastoma multiforme(226;0.0416)|BRCA - Breast invasive adenocarcinoma(108;0.0429)		AGTGATAAAGAACTAGATTTT	0.274													4	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	7	57659644	57659644	+	IGR	DEL	G	-	-	rs111399871		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:57659644delG								ZNF716 (126379 upstream) : None (None downstream)																							CATGTTTTTTGTGTTTTTCTT	0.353													5	3	---	---	---	---	
PTCD1	26024	broad.mit.edu	37	7	99032217	99032218	+	Intron	INS	-	A	A	rs149310419		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99032217_99032218insA	uc003uqh.2	-						PTCD1_uc011kiw.1_Intron	NM_015545	NP_056360	O75127	PTCD1_HUMAN	pentatricopeptide repeat domain 1											ovary(1)	1	all_cancers(62;2.54e-08)|all_epithelial(64;2.55e-09)|Lung NSC(181;0.0053)|all_lung(186;0.00895)|Esophageal squamous(72;0.0166)		STAD - Stomach adenocarcinoma(171;0.215)			tccgtctcTACaaaaaaaaaaa	0.208													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	8	97442756	97442771	+	IGR	DEL	CCCCCCTCCCTCCCTC	-	-	rs71267254		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:97442756_97442771delCCCCCCTCCCTCCCTC								PTDSS1 (95982 upstream) : SDC2 (63111 downstream)																							ttccttccttcccccctccctccctcccttcctccc	0.000													6	3	---	---	---	---	
YWHAZ	7534	broad.mit.edu	37	8	101960892	101960893	+	Frame_Shift_Ins	INS	-	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101960892_101960893insT	uc011lhe.1	-	2	402_403	c.225_226insA	c.(223-228)AAACAGfs	p.K75fs	YWHAZ_uc003yjv.2_Frame_Shift_Ins_p.K75fs|YWHAZ_uc011lhf.1_Frame_Shift_Ins_p.K75fs|YWHAZ_uc003yjw.2_Frame_Shift_Ins_p.K75fs|YWHAZ_uc010mbq.2_5'UTR|YWHAZ_uc011lhg.1_Intron|YWHAZ_uc010mbr.2_Frame_Shift_Ins_p.K75fs|YWHAZ_uc003yjx.2_Frame_Shift_Ins_p.K75fs|YWHAZ_uc003yjy.2_Frame_Shift_Ins_p.K75fs	NM_001135702	NP_001129174	P63104	1433Z_HUMAN	tyrosine 3/tryptophan 5 -monooxygenase	75_76					anti-apoptosis|mRNA metabolic process|platelet activation|signal transduction	cytosol|melanosome	transcription factor binding				0	all_cancers(14;7.43e-06)|all_epithelial(15;2.77e-08)|Lung NSC(17;6.08e-05)|all_lung(17;0.000197)		Epithelial(11;2.79e-11)|all cancers(13;5.45e-09)|OV - Ovarian serous cystadenocarcinoma(57;4.75e-05)		Ginkgo biloba(DB01381)	GCCATCTGCTGTTTTTTCTCAG	0.416													380	165	---	---	---	---	
NDRG1	10397	broad.mit.edu	37	8	134292669	134292669	+	Intron	DEL	T	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:134292669delT	uc003yuh.2	-						NDRG1_uc003yug.2_Intron|NDRG1_uc010mee.2_Intron|NDRG1_uc010mef.2_Intron|NDRG1_uc011ljh.1_Intron|NDRG1_uc011lji.1_Intron	NM_001135242	NP_001128714	Q92597	NDRG1_HUMAN	N-myc downstream regulated 1						cellular response to hypoxia|response to metal ion	cytoplasm|microtubule cytoskeleton|nucleus|plasma membrane	protein binding			ovary(4)	4	all_epithelial(106;4.26e-24)|Lung NSC(106;7.26e-07)|all_lung(105;2.77e-06)|Ovarian(258;0.00438)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0107)			tccttttctcttttttttttt	0.209													6	3	---	---	---	---	
FLJ43860	389690	broad.mit.edu	37	8	142477454	142477463	+	Intron	DEL	CCTGGCCCTT	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142477454_142477463delCCTGGCCCTT	uc003ywi.2	-						FLJ43860_uc011ljs.1_Intron|FLJ43860_uc010meu.1_Intron	NM_207414	NP_997297	Q6ZUA9	Q6ZUA9_HUMAN	hypothetical protein LOC389690								binding				0	all_cancers(97;7.79e-15)|all_epithelial(106;4.52e-13)|Lung NSC(106;2.07e-05)|all_lung(105;2.89e-05)|Ovarian(258;0.0303)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0493)			CCCTCCGCCCcctggcccttcctggccctt	0.571													9	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	6663836	6663839	+	IGR	DEL	AAAC	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:6663836_6663839delAAAC								GLDC (18144 upstream) : KDM4C (52656 downstream)																							TCCTATTTGTaaacaaacaaacaa	0.176													3	3	---	---	---	---	
KDM4C	23081	broad.mit.edu	37	9	6805465	6805465	+	Intron	DEL	T	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:6805465delT	uc003zkh.2	+						KDM4C_uc010mhu.2_Intron|KDM4C_uc010mhw.2_Intron|KDM4C_uc011lmi.1_Intron|KDM4C_uc011lmj.1_Intron|KDM4C_uc003zkg.2_Intron|KDM4C_uc011lmk.1_Intron|KDM4C_uc010mhv.2_Intron	NM_015061	NP_055876	Q9H3R0	KDM4C_HUMAN	jumonji domain containing 2C isoform 1						positive regulation of cell proliferation|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|transcription, DNA-dependent	nuclear chromatin	androgen receptor binding|enzyme binding|histone demethylase activity (H3-K9 specific)|nucleic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|zinc ion binding			ovary(1)	1						AATATTCATCTTTTTTTTTTT	0.169													15	7	---	---	---	---	
AQP7	364	broad.mit.edu	37	9	33386733	33386734	+	Intron	INS	-	A	A	rs144694820	by1000genomes	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33386733_33386734insA	uc003zst.2	-						SUGT1P1_uc010mjq.1_Intron|AQP7_uc003zsu.1_Intron|AQP7_uc010mjs.2_Intron|AQP7_uc010mjt.2_Intron|AQP7_uc011lnx.1_Intron|AQP7_uc011lny.1_Intron|AQP7_uc003zss.3_Intron|AQP7_uc011lnz.1_Intron|AQP7_uc011loa.1_Intron	NM_001170	NP_001161	O14520	AQP7_HUMAN	aquaporin 7						excretion|generation of precursor metabolites and energy	cell-cell junction|cytoplasm|integral to plasma membrane	glycerol channel activity|water channel activity				0			LUSC - Lung squamous cell carcinoma(29;0.00788)	GBM - Glioblastoma multiforme(74;0.191)		gaggaacacagaggcgatggct	0.158													4	2	---	---	---	---	
PCDH15	65217	broad.mit.edu	37	10	57298276	57298278	+	Intron	DEL	TCC	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:57298276_57298278delTCC	uc001jjv.1	-							NM_001142770	NP_001136242	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD2-2 precursor						equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				cttctttccttccttcctccctt	0.000										HNSCC(58;0.16)			4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	11	4911677	4911677	+	IGR	DEL	A	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4911677delA								OR51T1 (7565 upstream) : OR51A7 (16923 downstream)																							CAGTCCTGATAACAAAGAGGA	0.502													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	11	11158593	11158593	+	IGR	DEL	A	-	-	rs11303970		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:11158593delA								ZBED5 (278973 upstream) : GALNTL4 (133828 downstream)																							aaaaaaaaagaaaaaaaaata	0.154													4	3	---	---	---	---	
TP53I11	9537	broad.mit.edu	37	11	44956297	44956298	+	3'UTR	INS	-	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:44956297_44956298insC	uc001myi.2	-	10					TP53I11_uc001myf.1_Intron|TP53I11_uc001myj.2_3'UTR|TP53I11_uc001myk.2_3'UTR|TP53I11_uc001myl.2_3'UTR|TP53I11_uc001mym.2_3'UTR	NM_006034	NP_006025	O14683	P5I11_HUMAN	p53-induced protein						negative regulation of cell proliferation|response to stress	integral to membrane				ovary(1)	1						GGAAAGGAAGGCCCCCCACCCC	0.673													1	6	---	---	---	---	
NUP160	23279	broad.mit.edu	37	11	47843814	47843814	+	Intron	DEL	T	-	-	rs71875671		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47843814delT	uc001ngm.2	-						NUP160_uc009ylw.2_Intron	NM_015231	NP_056046	Q12769	NU160_HUMAN	nucleoporin 160kDa						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			ovary(4)|lung(1)|central_nervous_system(1)|skin(1)	7						TAAAAAAAAAttttttttttt	0.144													4	2	---	---	---	---	
RHEBL1	121268	broad.mit.edu	37	12	49463361	49463376	+	Intron	DEL	TCCTCCACTCTTCCAT	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49463361_49463376delTCCTCCACTCTTCCAT	uc001rtc.1	-						RHEBL1_uc001rtd.1_Intron|RHEBL1_uc009zlc.1_Intron	NM_144593	NP_653194	Q8TAI7	REBL1_HUMAN	Ras homolog enriched in brain like 1 precursor						positive regulation of NF-kappaB transcription factor activity|small GTPase mediated signal transduction|TOR signaling cascade	cytoplasm|plasma membrane	GTP binding|GTPase activity|protein binding			lung(1)|breast(1)	2						ACTCTTCCAATCCTCCACTCTTCCATTCCTCCACTC	0.569													4	2	---	---	---	---	
C12orf29	91298	broad.mit.edu	37	12	88441882	88441883	+	Intron	INS	-	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:88441882_88441883insA	uc001tao.2	+						C12orf29_uc001tap.2_Intron|C12orf29_uc009zsk.2_Intron	NM_001009894	NP_001009894	Q8N999	CL029_HUMAN	hypothetical protein LOC91298												0						agaccagctataaaaaaaaaaa	0.040													4	2	---	---	---	---	
SOCS2	8835	broad.mit.edu	37	12	93968378	93968379	+	Intron	INS	-	T	T	rs35259505		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:93968378_93968379insT	uc001tcw.1	+						uc001tcv.1_5'Flank|uc001tcu.2_5'Flank|SOCS2_uc001tcx.1_Intron|SOCS2_uc009zsu.2_3'UTR|SOCS2_uc001tcy.1_Intron|SOCS2_uc001tcz.2_3'UTR	NM_003877	NP_003868	O14508	SOCS2_HUMAN	suppressor of cytokine signaling-2						anti-apoptosis|growth hormone receptor signaling pathway|JAK-STAT cascade|negative regulation of signal transduction|regulation of cell growth|response to estradiol stimulus	cytoplasm	growth hormone receptor binding|insulin-like growth factor receptor binding|JAK pathway signal transduction adaptor activity|prolactin receptor binding|SH3/SH2 adaptor activity			lung(1)	1						CACACACCACCTTTTTTTTTTT	0.327													4	2	---	---	---	---	
KSR2	283455	broad.mit.edu	37	12	117965152	117965153	+	Intron	DEL	AG	-	-	rs10545784		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:117965152_117965153delAG	uc001two.2	-							NM_173598	NP_775869	Q6VAB6	KSR2_HUMAN	kinase suppressor of ras 2						intracellular signal transduction	cytoplasm|membrane	ATP binding|metal ion binding|protein serine/threonine kinase activity			lung(10)|central_nervous_system(2)|stomach(1)|large_intestine(1)|breast(1)	15	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)					acacacacacagacacacacac	0.238													4	3	---	---	---	---	
SFRS8	6433	broad.mit.edu	37	12	132283436	132283437	+	Intron	INS	-	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132283436_132283437insA	uc001uja.1	+						SFRS8_uc010tbn.1_Intron	NM_004592	NP_004583	Q12872	SFSWA_HUMAN	splicing factor, arginine/serine-rich 8						mRNA splice site selection|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding|RNA binding				0	all_neural(191;0.0982)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;3.44e-07)|Epithelial(86;2.94e-06)|all cancers(50;4.82e-05)		ctcttgtctggaaaaaaaaaaa	0.238													6	3	---	---	---	---	
EP400	57634	broad.mit.edu	37	12	132489704	132489704	+	Frame_Shift_Del	DEL	T	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132489704delT	uc001ujn.2	+	12	2945	c.2910delT	c.(2908-2910)GATfs	p.D970fs	EP400_uc001ujl.2_Frame_Shift_Del_p.D969fs|EP400_uc001ujm.2_Frame_Shift_Del_p.D970fs	NM_015409	NP_056224	Q96L91	EP400_HUMAN	E1A binding protein p400	1006	Interactions with RUVBL1 and RUVBL2.				histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent	NuA4 histone acetyltransferase complex|nuclear speck	ATP binding|DNA binding|helicase activity			central_nervous_system(4)|ovary(3)|breast(3)|skin(2)	12	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.198)		OV - Ovarian serous cystadenocarcinoma(86;3.01e-08)|Epithelial(86;3.43e-07)|all cancers(50;2.01e-06)		CGAAGCCTGATGGGGAGGACA	0.567													4	2	---	---	---	---	
POU4F1	5457	broad.mit.edu	37	13	79176484	79176486	+	In_Frame_Del	DEL	TGG	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:79176484_79176486delTGG	uc001vkv.2	-	2	558_560	c.324_326delCCA	c.(322-327)CACCAG>CAG	p.H108del	uc001vku.1_Intron	NM_006237	NP_006228	Q01851	PO4F1_HUMAN	POU domain, class 4, transcription factor 1	108	Poly-His.				axonogenesis|regulation of transcription from RNA polymerase II promoter|synapse assembly	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1		Acute lymphoblastic leukemia(28;0.0279)|Breast(118;0.0848)		GBM - Glioblastoma multiforme(99;0.129)		TTCGAGCGCCtggtggtggtggt	0.473													8	4	---	---	---	---	
SLC15A1	6564	broad.mit.edu	37	13	99336799	99336800	+	3'UTR	INS	-	A	A			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:99336799_99336800insA	uc001vno.2	-	23						NM_005073	NP_005064	P46059	S15A1_HUMAN	solute carrier family 15 (oligopeptide						digestion|protein transport	integral to plasma membrane|membrane fraction	peptide:hydrogen symporter activity			ovary(1)	1	all_neural(89;0.101)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)				Cefadroxil(DB01140)|Ceftibuten(DB01415)|Cyclacillin(DB01000)	aactctgtctcaaaaaaaaaaa	0.124													4	2	---	---	---	---	
SMEK1	55671	broad.mit.edu	37	14	91939168	91939169	+	Intron	INS	-	CAAC	CAAC	rs142250966	by1000genomes	TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:91939168_91939169insCAAC	uc001xzn.2	-						SMEK1_uc001xzm.2_Intron|SMEK1_uc001xzo.2_Intron|SMEK1_uc010atz.2_Intron|SMEK1_uc001xzp.1_Intron	NM_032560	NP_115949	Q6IN85	P4R3A_HUMAN	SMEK homolog 1, suppressor of mek1							microtubule organizing center|nucleus	protein binding				0		all_cancers(154;0.0691)|all_epithelial(191;0.219)		COAD - Colon adenocarcinoma(157;0.221)		TTTGATAAAAAcaaccaaccaa	0.228													4	3	---	---	---	---	
C15orf27	123591	broad.mit.edu	37	15	76480421	76480422	+	Intron	INS	-	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:76480421_76480422insC	uc002bbq.2	+						C15orf27_uc010bkp.2_Intron|C15orf27_uc002bbr.2_Intron	NM_152335	NP_689548	Q2M3C6	CO027_HUMAN	hypothetical protein LOC123591							integral to membrane					0						gagtatGCCTTCCCCCCCCACC	0.213													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	102316167	102316167	+	5'Flank	DEL	C	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:102316167delC	uc002ccz.2	+											DQ576545																		ACTTCTCCTTCTTCAATGTGT	0.562													63	52	---	---	---	---	
Unknown	0	broad.mit.edu	37	16	32490382	32490382	+	IGR	DEL	A	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:32490382delA								HERC2P4 (326508 upstream) : TP53TG3B (194459 downstream)																							ACAAGAGACCAGGGGGATAAG	0.393													7	4	---	---	---	---	
RHBDF2	79651	broad.mit.edu	37	17	74476076	74476077	+	Intron	DEL	AT	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74476076_74476077delAT	uc002jrq.1	-						RHBDF2_uc002jrp.1_Intron|RHBDF2_uc002jrr.1_Intron|RHBDF2_uc010wtf.1_Intron|RHBDF2_uc002jrs.1_Intron	NM_024599	NP_078875	Q6PJF5	RHDF2_HUMAN	rhomboid, veinlet-like 6 isoform 1						negative regulation of protein secretion|protein transport|proteolysis	endoplasmic reticulum membrane|integral to membrane	growth factor binding|serine-type endopeptidase activity				0						TCATTTGGAAatatatatatat	0.223													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	18	60753943	60753946	+	IGR	DEL	TTCC	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:60753943_60753946delTTCC								PHLPP1 (106278 upstream) : BCL2 (36633 downstream)																							cttcctttctttccttccttcctt	0.147													4	2	---	---	---	---	
POLR3F	10621	broad.mit.edu	37	20	18462626	18462627	+	Intron	DEL	AC	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:18462626_18462627delAC	uc002wqv.2	+						POLR3F_uc002wqw.2_Intron|POLR3F_uc002wqx.2_Intron	NM_006466	NP_006457	Q9H1D9	RPC6_HUMAN	DNA-directed RNA polymerase III 39 kDa						innate immune response|positive regulation of innate immune response|positive regulation of interferon-beta production|regulation of transcription from RNA polymerase III promoter|response to virus|termination of RNA polymerase III transcription|transcription elongation from RNA polymerase III promoter	DNA-directed RNA polymerase III complex	DNA binding|DNA-directed RNA polymerase activity|protein binding				0						TCATTCCTTTACtttttttttt	0.213													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	20	46109796	46109797	+	IGR	DEL	TT	-	-			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:46109796_46109797delTT								ZMYND8 (124322 upstream) : NCOA3 (20860 downstream)																							tctttctttctttttctttctt	0.000													1	5	---	---	---	---	
PRIC285	85441	broad.mit.edu	37	20	62190831	62190832	+	Intron	INS	-	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62190831_62190832insT	uc002yfm.2	-						PRIC285_uc002yfl.1_Intron	NM_001037335	NP_001032412	Q9BYK8	PR285_HUMAN	PPAR-alpha interacting complex protein 285						cellular lipid metabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm	ATP binding|DNA binding|helicase activity|ribonuclease activity|RNA binding|transcription coactivator activity|zinc ion binding			central_nervous_system(2)	2	all_cancers(38;2.51e-11)|all_epithelial(29;8.27e-13)		Epithelial(9;1.27e-08)|all cancers(9;7.32e-08)|BRCA - Breast invasive adenocarcinoma(10;5.15e-06)			tcaggtgggaggagtcagggtc	0.139													3	3	---	---	---	---	
BAGE2	85319	broad.mit.edu	37	21	11085863	11085864	+	Intron	INS	-	C	C			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:11085863_11085864insC	uc002yit.1	-						BAGE_uc002yix.2_Intron	NM_182482	NP_872288			B melanoma antigen family, member 2 precursor												0			Colorectal(6;3.44e-05)|COAD - Colon adenocarcinoma(6;0.00727)|READ - Rectum adenocarcinoma(6;0.0723)	UCEC - Uterine corpus endometrioid carcinoma (6;0.0974)|all cancers(6;2.54e-22)|Epithelial(6;4.21e-19)|OV - Ovarian serous cystadenocarcinoma(6;1.16e-09)|BRCA - Breast invasive adenocarcinoma(6;7.72e-05)|Lung(8;0.000189)|LUSC - Lung squamous cell carcinoma(6;0.00379)|GBM - Glioblastoma multiforme(6;0.00391)|Kidney(17;0.0773)|LUAD - Lung adenocarcinoma(8;0.247)		catcaccaccaccaccatcacc	0.000													5	3	---	---	---	---	
TMEM211	255349	broad.mit.edu	37	22	25336603	25336604	+	5'Flank	INS	-	CCTT	CCTT			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:25336603_25336604insCCTT	uc003abk.1	-							NM_001001663	NP_001001663	Q6ICI0	TM211_HUMAN	transmembrane protein 211							integral to membrane					0						CATATGCCCGCccttccttcct	0.050													4	2	---	---	---	---	
AP1B1	162	broad.mit.edu	37	22	29745509	29745510	+	Intron	INS	-	T	T			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:29745509_29745510insT	uc003afj.2	-						AP1B1_uc003afi.2_Intron|AP1B1_uc003afk.2_Intron|AP1B1_uc003afl.2_Intron|AP1B1_uc011ako.1_Intron	NM_001127	NP_001118	Q10567	AP1B1_HUMAN	adaptor-related protein complex 1 beta 1 subunit						endocytosis|intracellular protein transport|post-Golgi vesicle-mediated transport|regulation of defense response to virus by virus|viral reproduction	clathrin adaptor complex|clathrin coated vesicle membrane|cytosol|Golgi membrane|lysosomal membrane	protein binding|protein transporter activity			ovary(1)|skin(1)	2						TCTGAGttttgttttttttttt	0.292													4	2	---	---	---	---	
IL3RA	3563	broad.mit.edu	37	X	1467599	1467600	+	Intron	INS	-	TTTC	TTTC			TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1467599_1467600insTTTC	uc004cps.2	+						IL3RA_uc011mhd.1_Intron	NM_002183	NP_002174	P26951	IL3RA_HUMAN	interleukin 3 receptor, alpha precursor							integral to membrane|plasma membrane	interleukin-3 receptor activity			skin(2)|lung(1)	3		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)			Sargramostim(DB00020)	ctttctttctgtttctgtttct	0.045													6	6	---	---	---	---	
DOCK11	139818	broad.mit.edu	37	X	117676483	117676484	+	Intron	INS	-	TA	TA	rs149027952		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:117676483_117676484insTA	uc004eqp.2	+							NM_144658	NP_653259	Q5JSL3	DOC11_HUMAN	dedicator of cytokinesis 11						blood coagulation	cytosol	GTP binding			ovary(3)	3						gtgtgtgtgtttgtgtgtgtgt	0.124													5	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	X	134748987	134748987	+	IGR	DEL	T	-	-	rs66464343		TCGA-DS-A0VM-01	TCGA-DS-A0VM-01									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:134748987delT								DDX26B (32528 upstream) : CT45A1 (98198 downstream)																							TCAATCATAGTTCATACTATT	0.433													23	12	---	---	---	---	
