Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	filter
PLA2G2A	5320	broad.mit.edu	37	1	20304528	20304528	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:20304528G>A	uc001bcu.2	-	4	490	c.272C>T	c.(271-273)TCG>TTG	p.S91L	PLA2G2A_uc001bcv.2_Missense_Mutation_p.S91L|PLA2G2A_uc010oda.1_Missense_Mutation_p.S91L|PLA2G2A_uc010odb.1_Missense_Mutation_p.S91L	NM_001161729	NP_001155201	P14555	PA2GA_HUMAN	phospholipase A2, group IIA precursor	91					defense response to Gram-positive bacterium|lipid catabolic process|low-density lipoprotein particle remodeling|phosphatidic acid metabolic process|positive regulation of inflammatory response|positive regulation of macrophage derived foam cell differentiation	endoplasmic reticulum|extracellular space|membrane	calcium ion binding|calcium-dependent phospholipase A2 activity|phospholipid binding				0		Colorectal(325;0.000147)|Renal(390;0.000469)|all_lung(284;0.00459)|Lung NSC(340;0.00475)|Breast(348;0.00526)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0427)		UCEC - Uterine corpus endometrioid carcinoma (279;0.018)|COAD - Colon adenocarcinoma(152;1.11e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000138)|Kidney(64;0.000171)|GBM - Glioblastoma multiforme(114;0.00032)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)		TCTGCTCCCCGAGTTGCTAAA	0.448													14	69	---	---	---	---	PASS
MYOM3	127294	broad.mit.edu	37	1	24426202	24426202	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:24426202G>T	uc001bin.3	-	6	787	c.624C>A	c.(622-624)AAC>AAA	p.N208K	MYOM3_uc001bio.2_Missense_Mutation_p.N208K|MYOM3_uc001bip.1_5'UTR	NM_152372	NP_689585	Q5VTT5	MYOM3_HUMAN	myomesin family, member 3	208	Ig-like C2-type 1.									skin(2)|ovary(1)	3		Colorectal(325;3.55e-05)|Renal(390;0.000703)|Lung NSC(340;0.001)|all_lung(284;0.0014)|Ovarian(437;0.00351)|Breast(348;0.0126)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|OV - Ovarian serous cystadenocarcinoma(117;5.31e-24)|Colorectal(126;7.52e-08)|COAD - Colon adenocarcinoma(152;4.01e-06)|GBM - Glioblastoma multiforme(114;4.36e-06)|BRCA - Breast invasive adenocarcinoma(304;0.00108)|KIRC - Kidney renal clear cell carcinoma(1967;0.00404)|STAD - Stomach adenocarcinoma(196;0.00966)|READ - Rectum adenocarcinoma(331;0.0678)|Lung(427;0.153)		GCCCGTAGTTGTTGGTGATTC	0.542													34	84	---	---	---	---	PASS
CSMD2	114784	broad.mit.edu	37	1	34209097	34209097	+	Nonsense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:34209097C>A	uc001bxn.1	-	14	1866	c.1837G>T	c.(1837-1839)GAG>TAG	p.E613*	CSMD2_uc001bxm.1_Nonsense_Mutation_p.E653*	NM_052896	NP_443128	Q7Z408	CSMD2_HUMAN	CUB and Sushi multiple domains 2	613	Extracellular (Potential).|CUB 4.					integral to membrane|plasma membrane	protein binding			ovary(6)|skin(5)|pancreas(1)	12		Myeloproliferative disorder(586;0.0294)|all_neural(195;0.249)				ATGCGGCTCTCAGGCCTGGCC	0.607													29	102	---	---	---	---	PASS
RIMS3	9783	broad.mit.edu	37	1	41107406	41107406	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:41107406C>G	uc001cfu.1	-	3	661	c.192G>C	c.(190-192)AAG>AAC	p.K64N	RIMS3_uc001cfv.1_Missense_Mutation_p.K64N	NM_014747	NP_055562	Q9UJD0	RIMS3_HUMAN	regulating synaptic membrane exocytosis 3	64					neurotransmitter transport	cell junction|synapse					0	Ovarian(52;0.00769)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;1.47e-17)			GGAGTGTGCTCTTGCTCCACT	0.662													20	71	---	---	---	---	PASS
SLC2A1	6513	broad.mit.edu	37	1	43392786	43392786	+	Nonsense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43392786G>A	uc001cik.2	-	10	1930	c.1405C>T	c.(1405-1407)CAG>TAG	p.Q469*		NM_006516	NP_006507	P11166	GTR1_HUMAN	solute carrier family 2 (facilitated glucose	469	Cytoplasmic (Potential).				carbohydrate metabolic process|energy reserve metabolic process|regulation of insulin secretion|water-soluble vitamin metabolic process	integral to membrane|melanosome|membrane fraction|midbody	D-glucose transmembrane transporter activity|dehydroascorbic acid transporter activity			central_nervous_system(2)|pancreas(2)|ovary(1)	5	Ovarian(52;0.00579)|all_hematologic(146;0.0977)|Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0122)			Etomidate(DB00292)	GCTCCCCCCTGCCGGAAGCCG	0.577													58	79	---	---	---	---	PASS
DNAJC6	9829	broad.mit.edu	37	1	65851519	65851519	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:65851519C>A	uc001dcd.1	+	7	918	c.754C>A	c.(754-756)CGC>AGC	p.R252S	DNAJC6_uc001dcc.1_Missense_Mutation_p.R283S|DNAJC6_uc010opc.1_Missense_Mutation_p.R239S|DNAJC6_uc001dce.1_Missense_Mutation_p.R309S	NM_014787	NP_055602	O75061	AUXI_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 6	252	C2 tensin-type.				cellular membrane organization|post-Golgi vesicle-mediated transport	cytosol	heat shock protein binding|protein tyrosine phosphatase activity|SH3 domain binding			large_intestine(1)|lung(1)|ovary(1)	3						GAATGGATGTCGCCCTTACTG	0.418													57	55	---	---	---	---	PASS
PTGFR	5737	broad.mit.edu	37	1	79002200	79002200	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:79002200T>A	uc001din.2	+	3	1174	c.908T>A	c.(907-909)GTA>GAA	p.V303E	PTGFR_uc001dim.2_3'UTR	NM_000959	NP_000950	P43088	PF2R_HUMAN	prostaglandin F receptor isoform a precursor	303	Helical; Name=7; (Potential).				parturition	extracellular region|integral to plasma membrane	prostaglandin F receptor activity			ovary(3)|breast(2)|skin(1)	6				Colorectal(170;0.248)	Bimatoprost(DB00905)|Latanoprost(DB00654)|Travoprost(DB00287)	GATCCTTGGGTATATATTCTT	0.398													39	169	---	---	---	---	PASS
COL11A1	1301	broad.mit.edu	37	1	103453275	103453275	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103453275G>A	uc001dul.2	-	30	2734	c.2416C>T	c.(2416-2418)CCA>TCA	p.P806S	COL11A1_uc001duk.2_5'UTR|COL11A1_uc001dum.2_Missense_Mutation_p.P818S|COL11A1_uc001dun.2_Missense_Mutation_p.P767S|COL11A1_uc009weh.2_Missense_Mutation_p.P690S	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	806	Triple-helical region.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)		TCCCCTCTTGGGCCAATTTGA	0.388													31	100	---	---	---	---	PASS
COL11A1	1301	broad.mit.edu	37	1	103487259	103487259	+	Intron	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103487259T>A	uc001dul.2	-						COL11A1_uc001duk.2_Intron|COL11A1_uc001dum.2_Intron|COL11A1_uc001dun.2_Intron|COL11A1_uc009weh.2_Intron	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A						collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)		ACACTACTACTTACAGGCTCA	0.353													22	96	---	---	---	---	PASS
SARS	6301	broad.mit.edu	37	1	109779170	109779170	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:109779170G>A	uc001dwu.1	+	9	1332	c.1257G>A	c.(1255-1257)AAG>AAA	p.K419K	SARS_uc001dwv.1_Silent_p.K419K|SARS_uc001dww.1_Silent_p.K352K|SARS_uc001dwx.1_Silent_p.K371K|SARS_uc009wfa.1_Intron|SARS_uc001dwy.1_Silent_p.K244K|SARS_uc001dwz.1_Silent_p.K244K	NM_006513	NP_006504	P49591	SYSC_HUMAN	seryl-tRNA synthetase	419					seryl-tRNA aminoacylation|tRNA processing	cytosol	ATP binding|protein binding|RNA binding|serine-tRNA ligase activity			central_nervous_system(1)	1		all_epithelial(167;7.64e-05)|all_lung(203;0.000321)|Lung NSC(277;0.000626)|Breast(1374;0.244)		Colorectal(144;0.0301)|Lung(183;0.0677)|COAD - Colon adenocarcinoma(174;0.116)|Epithelial(280;0.233)	L-Serine(DB00133)	TGATGGACAAGGTAGATGGCC	0.557													15	69	---	---	---	---	PASS
GSTM5	2949	broad.mit.edu	37	1	110254936	110254936	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110254936T>A	uc001dyn.2	+	1	73	c.2T>A	c.(1-3)ATG>AAG	p.M1K	GSTM5_uc010ovu.1_5'UTR	NM_000851	NP_000842	P46439	GSTM5_HUMAN	glutathione S-transferase mu 5	1					xenobiotic metabolic process	endoplasmic reticulum membrane	glutathione transferase activity			central_nervous_system(6)	6		all_epithelial(167;2.5e-05)|all_lung(203;0.000135)|Lung NSC(277;0.000269)|Breast(1374;0.244)		Colorectal(144;0.0131)|all cancers(265;0.0252)|Epithelial(280;0.0265)|Lung(183;0.0425)|COAD - Colon adenocarcinoma(174;0.0474)|LUSC - Lung squamous cell carcinoma(189;0.228)	Glutathione(DB00143)	ACCAGCACCATGCCCATGACT	0.667													82	250	---	---	---	---	PASS
CD53	963	broad.mit.edu	37	1	111434971	111434971	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:111434971G>T	uc001dzw.2	+	4	239	c.68G>T	c.(67-69)TGT>TTT	p.C23F	CD53_uc001dzx.2_Missense_Mutation_p.C23F|CD53_uc010owa.1_Missense_Mutation_p.C23F|CD53_uc001dzy.2_Missense_Mutation_p.C23F	NM_001040033	NP_001035122	P19397	CD53_HUMAN	CD53 antigen	23	Helical; (Potential).				signal transduction	integral to membrane|plasma membrane					0		all_cancers(81;1.06e-05)|all_epithelial(167;1.95e-05)|all_lung(203;0.000199)|Lung NSC(277;0.000398)		Lung(183;0.0264)|Colorectal(144;0.0375)|all cancers(265;0.11)|Epithelial(280;0.114)|COAD - Colon adenocarcinoma(174;0.141)|LUSC - Lung squamous cell carcinoma(189;0.144)		TTTCAGATCTGTGGCTGCTGC	0.458													40	48	---	---	---	---	PASS
BCL9	607	broad.mit.edu	37	1	147083634	147083634	+	Translation_Start_Site	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:147083634C>G	uc001epq.2	+	4	739	c.-1C>G	c.(-3-1)ATCAA>ATGAA		BCL9_uc010ozr.1_Translation_Start_Site	NM_004326	NP_004317	O00512	BCL9_HUMAN	B-cell CLL/lymphoma 9						Wnt receptor signaling pathway	nucleus	protein binding			ovary(2)|large_intestine(2)|breast(1)|skin(1)	6	all_hematologic(923;0.115)					GGATTTCAATCAATGCATTCC	0.577			T	IGH@|IGL@	B-ALL								35	74	---	---	---	---	PASS
RPRD2	23248	broad.mit.edu	37	1	150443105	150443105	+	Missense_Mutation	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150443105A>C	uc009wlr.2	+	11	1882	c.1681A>C	c.(1681-1683)ACT>CCT	p.T561P	RPRD2_uc010pcc.1_Missense_Mutation_p.T535P|RPRD2_uc001eup.3_Missense_Mutation_p.T535P	NM_015203	NP_056018	Q5VT52	RPRD2_HUMAN	Regulation of nuclear pre-mRNA domain containing	561	Ser-rich.						protein binding			ovary(1)	1						CTCACAGAGCACTTCAGCCTC	0.478													14	27	---	---	---	---	PASS
ZNF687	57592	broad.mit.edu	37	1	151260226	151260226	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151260226G>C	uc001exq.2	+	2	1557	c.1459G>C	c.(1459-1461)GGC>CGC	p.G487R	ZNF687_uc001exp.1_Missense_Mutation_p.G496R|ZNF687_uc009wmo.2_Missense_Mutation_p.G487R|ZNF687_uc009wmp.2_Missense_Mutation_p.G487R	NM_020832	NP_065883	Q8N1G0	ZN687_HUMAN	zinc finger protein 687	487					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus	DNA binding|zinc ion binding			central_nervous_system(3)|ovary(1)	4	Lung SC(34;0.00471)|Ovarian(49;0.0147)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.112)|LUSC - Lung squamous cell carcinoma(543;0.181)			TACAGGGGGCGGCACAGTGAT	0.607													39	97	---	---	---	---	PASS
INTS3	65123	broad.mit.edu	37	1	153745435	153745435	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153745435G>A	uc009wom.2	+	30	3150	c.2929G>A	c.(2929-2931)GAG>AAG	p.E977K	INTS3_uc001fct.2_Missense_Mutation_p.E977K|INTS3_uc001fcu.2_Missense_Mutation_p.E669K|INTS3_uc001fcv.2_Missense_Mutation_p.E771K|INTS3_uc010peb.1_Missense_Mutation_p.E837K|INTS3_uc001fcw.2_Missense_Mutation_p.E490K|INTS3_uc010pec.1_Missense_Mutation_p.E490K|INTS3_uc001fcy.2_Missense_Mutation_p.E340K|INTS3_uc001fcx.2_Missense_Mutation_p.E274K	NM_023015	NP_075391	Q68E01	INT3_HUMAN	integrator complex subunit 3	978					DNA repair|G2/M transition checkpoint|response to ionizing radiation|snRNA processing	integrator complex|SOSS complex	protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	all_lung(78;3.75e-32)|Lung NSC(65;1.37e-30)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.151)			GGAGGAATATGAGGACTCTTC	0.562													58	143	---	---	---	---	PASS
GATAD2B	57459	broad.mit.edu	37	1	153782741	153782741	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153782741C>T	uc001fdb.3	-	11	1938	c.1694G>A	c.(1693-1695)GGC>GAC	p.G565D		NM_020699	NP_065750	Q8WXI9	P66B_HUMAN	GATA zinc finger domain containing 2B	565						nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0	all_lung(78;1.34e-32)|Lung NSC(65;1.04e-30)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.151)			CAAACTGGGGCCTTTGTGTCC	0.488													44	64	---	---	---	---	PASS
NUP210L	91181	broad.mit.edu	37	1	153973458	153973458	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153973458C>T	uc001fdw.2	-	37	5332	c.5260G>A	c.(5260-5262)GTA>ATA	p.V1754I	NUP210L_uc009woq.2_Missense_Mutation_p.V663I|NUP210L_uc010peh.1_Intron	NM_207308	NP_997191	Q5VU65	P210L_HUMAN	nucleoporin 210kDa-like isoform 1	1754						integral to membrane				skin(5)|ovary(4)|large_intestine(1)|central_nervous_system(1)	11	all_lung(78;9.35e-31)|Lung NSC(65;1.33e-28)|Hepatocellular(266;0.0877)|Melanoma(130;0.128)		LUSC - Lung squamous cell carcinoma(543;0.151)|Colorectal(543;0.198)			ACCACTCTTACAGAGTAAATG	0.488													75	150	---	---	---	---	PASS
SPTA1	6708	broad.mit.edu	37	1	158596725	158596725	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158596725G>A	uc001fst.1	-	41	5936	c.5737C>T	c.(5737-5739)CTG>TTG	p.L1913L		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	1913	Spectrin 18.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)					GCCTTAGCCAGAGAAGGGGTC	0.438													87	179	---	---	---	---	PASS
DNM3	26052	broad.mit.edu	37	1	172051015	172051015	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:172051015A>G	uc001gie.2	+	12	1642	c.1466A>G	c.(1465-1467)AAC>AGC	p.N489S	DNM3_uc001gid.3_Missense_Mutation_p.N489S|DNM3_uc009wwb.2_Missense_Mutation_p.N489S|DNM3_uc001gif.2_Missense_Mutation_p.N489S	NM_015569	NP_056384	Q9UQ16	DYN3_HUMAN	dynamin 3 isoform a	489					endocytosis|filopodium assembly|synapse assembly	dendritic spine|microtubule|perinuclear region of cytoplasm|postsynaptic density	GTP binding|GTPase activity|protein binding			breast(1)	1						ATCAACACCAACCATGAAGAC	0.363													47	127	---	---	---	---	PASS
TDRD5	163589	broad.mit.edu	37	1	179561943	179561943	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:179561943C>A	uc001gnf.1	+	2	443	c.193C>A	c.(193-195)CGT>AGT	p.R65S	TDRD5_uc010pnp.1_Missense_Mutation_p.R65S|uc010pno.1_5'Flank	NM_173533	NP_775804	Q8NAT2	TDRD5_HUMAN	tudor domain containing 5	65	Lotus/OST-HTH 1.				DNA methylation involved in gamete generation|P granule organization|spermatid development	chromatoid body|pi-body	nucleic acid binding			ovary(2)|skin(2)|central_nervous_system(1)	5						TGATGTTGTTCGTGTCTGCCC	0.423													43	103	---	---	---	---	PASS
PTPRC	5788	broad.mit.edu	37	1	198725322	198725322	+	3'UTR	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:198725322A>C	uc001gur.1	+	33					PTPRC_uc001gus.1_3'UTR|PTPRC_uc001gut.1_3'UTR	NM_002838	NP_002829	P08575	PTPRC_HUMAN	protein tyrosine phosphatase, receptor type, C						axon guidance|B cell proliferation|B cell receptor signaling pathway|defense response to virus|immunoglobulin biosynthetic process|negative regulation of cytokine-mediated signaling pathway|negative regulation of protein kinase activity|negative regulation of T cell mediated cytotoxicity|positive regulation of antigen receptor-mediated signaling pathway|positive regulation of B cell proliferation|positive regulation of protein kinase activity|positive regulation of T cell proliferation|regulation of S phase|release of sequestered calcium ion into cytosol|T cell differentiation|T cell receptor signaling pathway	focal adhesion|integral to plasma membrane|membrane raft	protein kinase binding|transmembrane receptor protein tyrosine phosphatase activity			breast(4)|skin(3)|ovary(2)|lung(1)|kidney(1)|pancreas(1)	12						AAAAGACATAAATGAGGAAAC	0.408													7	83	---	---	---	---	PASS
NAV1	89796	broad.mit.edu	37	1	201687762	201687762	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201687762A>G	uc001gwu.2	+	3	1452	c.1105A>G	c.(1105-1107)ATC>GTC	p.I369V		NM_020443	NP_065176	Q8NEY1	NAV1_HUMAN	neuron navigator 1	369					cell differentiation|nervous system development	cytoplasm|microtubule	nucleoside-triphosphatase activity|nucleotide binding			central_nervous_system(3)|ovary(1)	4						GCTCAGCCATATCTCCCGCCT	0.642													70	111	---	---	---	---	PASS
PRELP	5549	broad.mit.edu	37	1	203452317	203452317	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:203452317G>A	uc001gzs.2	+	2	205	c.5G>A	c.(4-6)AGG>AAG	p.R2K	PRELP_uc001gzt.2_Missense_Mutation_p.R2K	NM_002725	NP_002716	P51888	PRELP_HUMAN	proline arginine-rich end leucine-rich repeat	2					skeletal system development	proteinaceous extracellular matrix	extracellular matrix structural constituent			ovary(1)|central_nervous_system(1)|pancreas(1)	3			BRCA - Breast invasive adenocarcinoma(75;0.109)			TGGATCATGAGGTCACCCCTC	0.572													83	220	---	---	---	---	PASS
PM20D1	148811	broad.mit.edu	37	1	205801751	205801751	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205801751G>A	uc001hdj.2	-	11	1305	c.1260C>T	c.(1258-1260)TTC>TTT	p.F420F	PM20D1_uc009xbr.2_RNA	NM_152491	NP_689704	Q6GTS8	P20D1_HUMAN	peptidase M20 domain containing 1 precursor	420						extracellular region	metal ion binding|peptidase activity			skin(1)	1	Breast(84;0.201)		BRCA - Breast invasive adenocarcinoma(75;0.0252)			TGACTTCCGGGAAGACGGACT	0.562													40	95	---	---	---	---	PASS
C1orf107	27042	broad.mit.edu	37	1	210012355	210012355	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:210012355C>A	uc001hhr.1	+	7	1240	c.1164C>A	c.(1162-1164)AAC>AAA	p.N388K	C1orf107_uc009xcu.1_Missense_Mutation_p.N103K	NM_014388	NP_055203	Q68CQ4	DIEXF_HUMAN	digestive-organ expansion factor homolog	388					multicellular organismal development	nucleus					0				OV - Ovarian serous cystadenocarcinoma(81;0.0367)		TTGTGAGCAACAAAAAGAGGT	0.493													60	138	---	---	---	---	PASS
KCNH1	3756	broad.mit.edu	37	1	211192563	211192563	+	Nonsense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:211192563G>C	uc001hib.2	-	6	764	c.594C>G	c.(592-594)TAC>TAG	p.Y198*	KCNH1_uc001hic.2_Nonsense_Mutation_p.Y198*	NM_172362	NP_758872	O95259	KCNH1_HUMAN	potassium voltage-gated channel, subfamily H,	198	Cytoplasmic (Potential).				myoblast fusion|regulation of transcription, DNA-dependent	voltage-gated potassium channel complex	calmodulin binding|delayed rectifier potassium channel activity|two-component sensor activity			ovary(4)|central_nervous_system(1)	5				OV - Ovarian serous cystadenocarcinoma(81;0.0109)|all cancers(67;0.141)|Epithelial(68;0.185)		CCTCTTGCTTGTACTGGGGAA	0.428													30	108	---	---	---	---	PASS
MOSC1	64757	broad.mit.edu	37	1	220970070	220970070	+	Missense_Mutation	SNP	C	T	T	rs144056103		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:220970070C>T	uc001hms.2	+	3	783	c.535C>T	c.(535-537)CGC>TGC	p.R179C	MOSC1_uc001hmt.2_Missense_Mutation_p.R179C	NM_022746	NP_073583	Q5VT66	MOSC1_HUMAN	MOCO sulphurase C-terminal domain containing 1	179							molybdenum ion binding|oxidoreductase activity|pyridoxal phosphate binding				0				GBM - Glioblastoma multiforme(131;0.0358)		ACAGCCCTACCGCCTGGTGCA	0.602													29	37	---	---	---	---	PASS
ITPKB	3707	broad.mit.edu	37	1	226924191	226924191	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:226924191G>A	uc010pvo.1	-	2	1309	c.969C>T	c.(967-969)CTC>CTT	p.L323L	ITPKB_uc001hqh.2_Silent_p.L323L	NM_002221	NP_002212	P27987	IP3KB_HUMAN	1D-myo-inositol-trisphosphate 3-kinase B	323							ATP binding|calmodulin binding|inositol trisphosphate 3-kinase activity			ovary(4)|central_nervous_system(1)	5		Prostate(94;0.0773)				ACGGCTCAGTGAGGGCAAGAT	0.627													48	69	---	---	---	---	PASS
OBSCN	84033	broad.mit.edu	37	1	228529182	228529182	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228529182C>T	uc009xez.1	+	74	17945	c.17901C>T	c.(17899-17901)CGC>CGT	p.R5967R	OBSCN_uc001hsn.2_Silent_p.R5967R|OBSCN_uc001hsr.1_Silent_p.R596R	NM_001098623	NP_001092093	Q5VST9	OBSCN_HUMAN	obscurin, cytoskeletal calmodulin and	5967	PH.				apoptosis|cell differentiation|induction of apoptosis by extracellular signals|multicellular organismal development|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|M band|Z disc	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity|Rho guanyl-nucleotide exchange factor activity|structural constituent of muscle|titin binding			stomach(8)|large_intestine(7)|breast(5)|ovary(4)|skin(2)|central_nervous_system(1)|pancreas(1)	28		Prostate(94;0.0405)				GGGATGACCGCGCCTTCGAGG	0.637													8	19	---	---	---	---	PASS
COG2	22796	broad.mit.edu	37	1	230810741	230810741	+	Intron	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:230810741C>T	uc001htw.2	+						COG2_uc001htx.2_Intron|COG2_uc010pwc.1_Intron	NM_007357	NP_031383	Q14746	COG2_HUMAN	component of oligomeric golgi complex 2 isoform						Golgi organization|intra-Golgi vesicle-mediated transport|intracellular protein transport|oligosaccharide biosynthetic process|protein glycosylation	Golgi membrane|Golgi stack|Golgi transport complex	protein binding|protein transporter activity				0	Breast(184;0.0871)|Ovarian(103;0.183)	Prostate(94;0.178)				CCTTATTTTACAGTGAAAAAG	0.353													68	144	---	---	---	---	PASS
RYR2	6262	broad.mit.edu	37	1	237777821	237777821	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237777821C>A	uc001hyl.1	+	37	5513	c.5393C>A	c.(5392-5394)GCT>GAT	p.A1798D		NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	1798	Cytoplasmic (By similarity).|4 X approximate repeats.				cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)			CTGACAGAAGCTGTTAAAGAG	0.463													118	261	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	1	247902808	247902808	+	IGR	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247902808G>C								OR6F1 (26751 upstream) : OR1C1 (17958 downstream)																							CATTAAATCCGCTCTGAGTAA	0.274													21	81	---	---	---	---	PASS
OR2M2	391194	broad.mit.edu	37	1	248343407	248343407	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248343407G>T	uc010pzf.1	+	1	120	c.120G>T	c.(118-120)ATG>ATT	p.M40I		NM_001004688	NP_001004688	Q96R28	OR2M2_HUMAN	olfactory receptor, family 2, subfamily M,	40	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(3)|skin(1)	4	all_cancers(71;0.000149)|all_epithelial(71;1.27e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0245)			TGGCCTTCATGGGAAACTCTG	0.522													39	415	---	---	---	---	PASS
OR2T34	127068	broad.mit.edu	37	1	248737448	248737448	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248737448G>T	uc001iep.1	-	1	611	c.611C>A	c.(610-612)ACG>AAG	p.T204K		NM_001001821	NP_001001821	Q8NGX1	O2T34_HUMAN	olfactory receptor, family 2, subfamily T,	204	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			large_intestine(1)|ovary(1)	2	all_cancers(71;0.000108)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)		OV - Ovarian serous cystadenocarcinoma(106;0.0265)			GCACAGGTACGTGAGCATCTT	0.517													64	308	---	---	---	---	PASS
TPO	7173	broad.mit.edu	37	2	1507739	1507739	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1507739C>A	uc002qww.2	+	14	2497	c.2406C>A	c.(2404-2406)GAC>GAA	p.D802E	TPO_uc010ewj.2_RNA|TPO_uc002qwu.2_Missense_Mutation_p.D745E|TPO_uc002qwr.2_Missense_Mutation_p.D802E|TPO_uc002qwx.2_Missense_Mutation_p.D745E|TPO_uc010yio.1_Missense_Mutation_p.D629E|TPO_uc010yip.1_Intron|TPO_uc002qwy.1_Intron|TPO_uc002qwz.2_Intron	NM_000547	NP_000538	P07202	PERT_HUMAN	thyroid peroxidase isoform a	802	Extracellular (Potential).|EGF-like; calcium-binding (Potential).				cellular nitrogen compound metabolic process|hormone biosynthetic process|hydrogen peroxide catabolic process	cell surface|cytoplasm|integral to plasma membrane	calcium ion binding|heme binding|iodide peroxidase activity			ovary(7)|pancreas(6)|skin(5)|lung(1)|kidney(1)	20	all_hematologic(175;0.0487)|Acute lymphoblastic leukemia(172;0.0627)	all_cancers(51;0.0338)		all cancers(51;0.0356)|OV - Ovarian serous cystadenocarcinoma(76;0.0748)|Epithelial(75;0.12)	Carbimazole(DB00389)|Methimazole(DB00763)|Propylthiouracil(DB00550)	AGTGTGCAGACGGTGCCCACC	0.642													29	41	---	---	---	---	PASS
ASAP2	8853	broad.mit.edu	37	2	9490936	9490936	+	Splice_Site	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:9490936G>A	uc002qzh.2	+	12	1364	c.1024_splice	c.e12-1	p.A342_splice	ASAP2_uc002qzi.2_Splice_Site_p.A342_splice	NM_003887	NP_003878	O43150	ASAP2_HUMAN	ArfGAP with SH3 domain, ankyrin repeat and PH						regulation of ARF GTPase activity	Golgi cisterna membrane|plasma membrane	ARF GTPase activator activity|protein binding|zinc ion binding				0						CTTTTAAACAGGCTAACCGGC	0.468													8	58	---	---	---	---	PASS
GREB1	9687	broad.mit.edu	37	2	11780490	11780490	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:11780490C>G	uc002rbk.1	+	33	6060	c.5760C>G	c.(5758-5760)GAC>GAG	p.D1920E	GREB1_uc002rbp.1_Missense_Mutation_p.D918E	NM_014668	NP_055483	Q4ZG55	GREB1_HUMAN	growth regulation by estrogen in breast cancer 1	1920						integral to membrane				ovary(1)	1	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.115)|OV - Ovarian serous cystadenocarcinoma(76;0.186)		AGCTCGAGGACGAGTGGCAGT	0.627													7	40	---	---	---	---	PASS
DDX1	1653	broad.mit.edu	37	2	15767206	15767206	+	Silent	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:15767206A>T	uc002rce.2	+	20	1911	c.1623A>T	c.(1621-1623)TCA>TCT	p.S541S	DDX1_uc010yjq.1_Silent_p.S449S	NM_004939	NP_004930	Q92499	DDX1_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 1	541	Helicase C-terminal.|Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV.|Necessary for interaction with HNRNPK.				DNA duplex unwinding|double-strand break repair|multicellular organismal development|regulation of transcription, DNA-dependent|regulation of translational initiation|spliceosome assembly|transcription, DNA-dependent	cleavage body|stress granule|tRNA-splicing ligase complex	ATP binding|ATP-dependent helicase activity|chromatin binding|DNA binding|DNA/RNA helicase activity|exonuclease activity|poly(A) RNA binding|protein binding|RNA helicase activity|transcription cofactor activity			central_nervous_system(2)|upper_aerodigestive_tract(1)|ovary(1)	4	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.197)	all_epithelial(98;2.96e-07)|Acute lymphoblastic leukemia(84;4.24e-05)|Ovarian(717;0.0694)	GBM - Glioblastoma multiforme(3;0.00969)	Epithelial(75;4.35e-05)|OV - Ovarian serous cystadenocarcinoma(76;0.133)		ACCAGTTCTCATGTGTTTGTC	0.343													38	52	---	---	---	---	PASS
C2orf16	84226	broad.mit.edu	37	2	27802598	27802598	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27802598G>C	uc002rkz.3	+	1	3210	c.3159G>C	c.(3157-3159)CAG>CAC	p.Q1053H		NM_032266	NP_115642	Q68DN1	CB016_HUMAN	hypothetical protein LOC84226	1053										large_intestine(1)	1	Acute lymphoblastic leukemia(172;0.155)					AGGACTCACAGAGTGATTCCC	0.473													90	131	---	---	---	---	PASS
MAP4K3	8491	broad.mit.edu	37	2	39485729	39485729	+	Splice_Site	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:39485729C>T	uc002rro.2	-	30	2400	c.2309_splice	c.e30-1	p.D770_splice	MAP4K3_uc002rrp.2_Splice_Site_p.D749_splice|MAP4K3_uc010yns.1_Splice_Site_p.D323_splice	NM_003618	NP_003609	Q8IVH8	M4K3_HUMAN	mitogen-activated protein kinase kinase kinase						JNK cascade		ATP binding|protein binding|protein serine/threonine kinase activity|small GTPase regulator activity			ovary(3)|lung(3)|stomach(1)|pancreas(1)	8		all_hematologic(82;0.211)				TGTGGGGTATCTACAATACAA	0.333													10	98	---	---	---	---	PASS
ZFP36L2	678	broad.mit.edu	37	2	43452461	43452461	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:43452461G>C	uc002rsv.3	-	2	773	c.482C>G	c.(481-483)CCC>CGC	p.P161R	LOC100129726_uc010ynx.1_5'Flank	NM_006887	NP_008818	P47974	TISD_HUMAN	zinc finger protein 36, C3H type-like 2	161	C3H1-type 1.				cell proliferation	nucleus	DNA binding|RNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Acute lymphoblastic leukemia(82;0.00323)|all_hematologic(82;0.00824)				CTCCTCGAAGGGCCGGCACAG	0.652													21	28	---	---	---	---	PASS
CCDC88A	55704	broad.mit.edu	37	2	55601952	55601952	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:55601952G>A	uc002ryv.2	-	4	1183	c.341C>T	c.(340-342)TCT>TTT	p.S114F	CCDC88A_uc010yoz.1_Missense_Mutation_p.S114F|CCDC88A_uc010ypa.1_Missense_Mutation_p.S114F|CCDC88A_uc010ypb.1_Missense_Mutation_p.S16F	NM_001135597	NP_001129069	Q3V6T2	GRDN_HUMAN	coiled-coil domain containing 88A isoform 1	114					activation of protein kinase B activity|cell migration|cellular membrane organization|DNA replication|lamellipodium assembly|microtubule cytoskeleton organization|regulation of actin cytoskeleton organization|regulation of cell proliferation|regulation of DNA replication|regulation of neuron projection development|TOR signaling cascade	cytoplasmic membrane-bounded vesicle|cytosol|endoplasmic reticulum|Golgi apparatus|lamellipodium|plasma membrane	actin binding|microtubule binding|phosphatidylinositol binding|protein homodimerization activity|protein kinase B binding			ovary(2)|skin(2)	4						ATACTTACCAGAAAAGGGATT	0.194													13	128	---	---	---	---	PASS
FANCL	55120	broad.mit.edu	37	2	58459241	58459241	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:58459241C>A	uc002rzw.3	-	2	170	c.103G>T	c.(103-105)GAC>TAC	p.D35Y	FANCL_uc002rzx.3_Missense_Mutation_p.D35Y|FANCL_uc010fce.2_Missense_Mutation_p.D35Y|FANCL_uc010fcf.1_Intron	NM_018062	NP_060532	Q9NW38	FANCL_HUMAN	Fanconi anemia, complementation group L isoform	35					DNA repair	cytoplasm|nucleoplasm	ubiquitin-protein ligase activity|zinc ion binding			ovary(2)	2						AGGTGGAAGTCTCTTCCCTGT	0.348								Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia				47	47	---	---	---	---	PASS
AFTPH	54812	broad.mit.edu	37	2	64780404	64780404	+	Missense_Mutation	SNP	G	C	C	rs145180972	byFrequency	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:64780404G>C	uc002sdc.2	+	1	1828	c.1796G>C	c.(1795-1797)CGA>CCA	p.R599P	AFTPH_uc002scz.2_Missense_Mutation_p.R599P|AFTPH_uc002sda.2_Missense_Mutation_p.R599P|AFTPH_uc002sdb.2_Missense_Mutation_p.R599P	NM_203437	NP_982261	Q6ULP2	AFTIN_HUMAN	aftiphilin protein isoform a	599					protein transport	AP-1 adaptor complex|cytosol|nucleus	clathrin binding			ovary(2)	2						TCTCATCATCGAAAGGAAGCC	0.448													29	183	---	---	---	---	PASS
AFTPH	54812	broad.mit.edu	37	2	64780445	64780445	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:64780445G>C	uc002sdc.2	+	1	1869	c.1837G>C	c.(1837-1839)GAT>CAT	p.D613H	AFTPH_uc002scz.2_Missense_Mutation_p.D613H|AFTPH_uc002sda.2_Missense_Mutation_p.D613H|AFTPH_uc002sdb.2_Missense_Mutation_p.D613H	NM_203437	NP_982261	Q6ULP2	AFTIN_HUMAN	aftiphilin protein isoform a	613					protein transport	AP-1 adaptor complex|cytosol|nucleus	clathrin binding			ovary(2)	2						TGAAAATATTGATACTCCAGG	0.463													28	163	---	---	---	---	PASS
TIA1	7072	broad.mit.edu	37	2	70457920	70457920	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:70457920C>G	uc002sgj.3	-	3	407	c.190G>C	c.(190-192)GCT>CCT	p.A64P	TIA1_uc002sgk.3_Missense_Mutation_p.A64P|TIA1_uc002sgl.3_RNA|TIA1_uc002sgm.3_Missense_Mutation_p.A64P|TIA1_uc010yqt.1_Missense_Mutation_p.A64P	NM_022173	NP_071505	P31483	TIA1_HUMAN	TIA1 cytotoxic granule-associated RNA binding	64	RRM 1.				apoptosis|induction of apoptosis|regulation of nuclear mRNA splicing, via spliceosome	nucleus	nucleotide binding|poly(A) RNA binding|protein binding				0						TTCATAGCAGCTAATGCTGCA	0.383													40	111	---	---	---	---	PASS
ALMS1	7840	broad.mit.edu	37	2	73679497	73679497	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73679497G>T	uc002sje.1	+	10	5957	c.5846G>T	c.(5845-5847)AGT>ATT	p.S1949I	ALMS1_uc002sjf.1_Missense_Mutation_p.S1905I|ALMS1_uc002sjg.2_Missense_Mutation_p.S1335I|ALMS1_uc002sjh.1_Missense_Mutation_p.S1335I	NM_015120	NP_055935	Q8TCU4	ALMS1_HUMAN	Alstrom syndrome 1	1947	34 X 47 AA approximate tandem repeat.|30.				G2/M transition of mitotic cell cycle	centrosome|cilium|cytosol|microtubule basal body|spindle pole				skin(3)|ovary(2)|breast(2)|pancreas(1)|lung(1)	9						GAGAAGCCCAGTGTTATCTCT	0.443													43	69	---	---	---	---	PASS
TACR1	6869	broad.mit.edu	37	2	75425883	75425883	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:75425883G>C	uc002sng.2	-	1	763	c.178C>G	c.(178-180)CAC>GAC	p.H60D	TACR1_uc002snh.2_Missense_Mutation_p.H60D	NM_001058	NP_001049	P25103	NK1R_HUMAN	tachykinin receptor 1 isoform long	60	Cytoplasmic (Potential).				activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|detection of abiotic stimulus|mechanosensory behavior	integral to plasma membrane	protein binding			ovary(1)	1					Aprepitant(DB00673)|Ketamine(DB01221)|Vapreotide(DB04894)	ATTCTTTTGTGGGCTAAGATG	0.522													22	36	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	2	89986364	89986364	+	Intron	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:89986364G>A	uc010fhm.2	+						uc002stn.1_5'Flank					Parts of antibodies, mostly variable regions.																		GAGGCTCCCTGCTCAGCTCCT	0.567													25	173	---	---	---	---	PASS
ASTL	431705	broad.mit.edu	37	2	96795863	96795863	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:96795863T>A	uc010yui.1	-	7	659	c.659A>T	c.(658-660)AAG>ATG	p.K220M		NM_001002036	NP_001002036	Q6HA08	ASTL_HUMAN	astacin-like metalloendopeptidase precursor	220					proteolysis		metalloendopeptidase activity|zinc ion binding				0						GCTCTGAGACTTGATGAAGTT	0.483													44	99	---	---	---	---	PASS
SEPT10	151011	broad.mit.edu	37	2	110350640	110350640	+	Missense_Mutation	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:110350640A>C	uc002tew.2	-	2	466	c.87T>G	c.(85-87)GAT>GAG	p.D29E	SEPT10_uc010ywu.1_Missense_Mutation_p.D29E|SEPT10_uc002tex.2_Intron|SEPT10_uc002tey.2_Missense_Mutation_p.D29E|SEPT10_uc010ywv.1_5'UTR	NM_144710	NP_653311	Q9P0V9	SEP10_HUMAN	septin 10 isoform 1	29					cell cycle|cell division	septin complex	GTP binding				0						TCTGTTCATCATCTGATCCTT	0.323													24	151	---	---	---	---	PASS
DPP10	57628	broad.mit.edu	37	2	116066869	116066869	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:116066869C>A	uc002tla.1	+	2	572	c.115C>A	c.(115-117)CTG>ATG	p.L39M	DPP10_uc002tlb.1_Translation_Start_Site|DPP10_uc002tlc.1_Missense_Mutation_p.L35M|DPP10_uc002tle.2_Missense_Mutation_p.L43M|DPP10_uc002tlf.1_Missense_Mutation_p.L32M	NM_020868	NP_065919	Q8N608	DPP10_HUMAN	dipeptidyl peptidase 10 isoform long	39	Mediates effects on KCND2.|Helical; Signal-anchor for type II membrane protein; (Potential).				proteolysis	integral to membrane|membrane fraction	serine-type peptidase activity			ovary(5)|large_intestine(2)|skin(2)|breast(1)	10						TGCTATTGCTCTGCTGGTGAT	0.403													46	93	---	---	---	---	PASS
YSK4	80122	broad.mit.edu	37	2	135745727	135745727	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:135745727G>C	uc002tue.1	-	7	746	c.715C>G	c.(715-717)CCA>GCA	p.P239A	YSK4_uc002tuf.1_Intron|YSK4_uc010fnc.1_Intron|YSK4_uc010fnd.1_Missense_Mutation_p.P126A|YSK4_uc010zbg.1_Intron|YSK4_uc002tuh.3_5'UTR|YSK4_uc002tui.3_Missense_Mutation_p.P256A	NM_025052	NP_079328	Q56UN5	YSK4_HUMAN	Yeast Sps1/Ste20-related kinase 4 isoform 1	239							ATP binding|protein serine/threonine kinase activity			stomach(2)|urinary_tract(1)|ovary(1)|breast(1)	5				BRCA - Breast invasive adenocarcinoma(221;0.112)		GTGAGACTTGGAATGTTTCTT	0.468													102	196	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141032062	141032062	+	Missense_Mutation	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141032062A>C	uc002tvj.1	-	85	14045	c.13073T>G	c.(13072-13074)GTT>GGT	p.V4358G		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	4358	Extracellular (Potential).				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		ACACTTGTCAACCTCACATTT	0.413										TSP Lung(27;0.18)			55	131	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141072664	141072664	+	Silent	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141072664A>G	uc002tvj.1	-	83	13617	c.12645T>C	c.(12643-12645)GAT>GAC	p.D4215D		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	4215	Extracellular (Potential).|EGF-like 10.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		ACTTACATGAATCATCTGTTT	0.308										TSP Lung(27;0.18)			14	79	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141201916	141201916	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141201916T>A	uc002tvj.1	-	65	11249	c.10277A>T	c.(10276-10278)GAA>GTA	p.E3426V		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	3426	Extracellular (Potential).|LDL-receptor class A 23.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		TCTTTCATCTTCCTCATCACC	0.358										TSP Lung(27;0.18)			19	195	---	---	---	---	PASS
NMI	9111	broad.mit.edu	37	2	152139423	152139423	+	Nonsense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152139423C>A	uc002txi.2	-	2	370	c.40G>T	c.(40-42)GAG>TAG	p.E14*	NMI_uc010zbx.1_Nonsense_Mutation_p.E14*|NMI_uc002txj.2_Nonsense_Mutation_p.E14*	NM_004688	NP_004679	Q13287	NMI_HUMAN	N-myc and STAT interactor	14					inflammatory response|JAK-STAT cascade|transcription from RNA polymerase II promoter	cytoplasm|nucleus	nucleotide binding|protein binding|transcription cofactor activity				0				BRCA - Breast invasive adenocarcinoma(221;0.0571)		GGCGAATGCTCCTTAAGAATT	0.249													37	68	---	---	---	---	PASS
RBMS1	5937	broad.mit.edu	37	2	161138778	161138778	+	Intron	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:161138778G>C	uc002ubo.2	-						RBMS1_uc002ubj.2_Missense_Mutation_p.S277C|RBMS1_uc002ubk.2_Intron|RBMS1_uc002ubl.2_Intron|RBMS1_uc002ubn.2_Intron|RBMS1_uc002ubi.3_Missense_Mutation_p.S310C|RBMS1_uc002ubm.2_Missense_Mutation_p.S280C|RBMS1_uc002ubp.2_Missense_Mutation_p.S313C|RBMS1_uc010fox.2_3'UTR	NM_016836	NP_058520	P29558	RBMS1_HUMAN	RNA binding motif, single stranded interacting						DNA replication|RNA processing	nucleus	double-stranded DNA binding|nucleotide binding|protein binding|RNA binding|single-stranded DNA binding				0						CTTGATAGCAGAGCCCCGATA	0.438													32	111	---	---	---	---	PASS
XIRP2	129446	broad.mit.edu	37	2	168115170	168115170	+	3'UTR	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:168115170A>G	uc002udx.2	+	10					XIRP2_uc010fpn.2_Missense_Mutation_p.N738S|XIRP2_uc010fpo.2_Missense_Mutation_p.N705S|XIRP2_uc010fpp.2_Missense_Mutation_p.N705S|XIRP2_uc010fpq.2_3'UTR|XIRP2_uc010fpr.2_Missense_Mutation_p.N483S	NM_152381	NP_689594	A4UGR9	XIRP2_HUMAN	xin actin-binding repeat containing 2 isoform 1						actin cytoskeleton organization	cell junction	actin binding			skin(7)|ovary(6)|pancreas(1)	14						GAAAATTTGAATAAGAATAAT	0.303													32	60	---	---	---	---	PASS
KBTBD10	10324	broad.mit.edu	37	2	170374740	170374740	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170374740G>A	uc002ueu.1	+	4	1494	c.1417G>A	c.(1417-1419)GGA>AGA	p.G473R	KBTBD10_uc010zdh.1_Missense_Mutation_p.G411R	NM_006063	NP_006054	O60662	KBTBA_HUMAN	kelch repeat and BTB (POZ) domain containing 10	473	Kelch 3.				striated muscle contraction	centrosome|nucleolus|plasma membrane|pseudopodium|ruffle					0						CCCCAAAAAAGGAGATTGGAA	0.378													42	58	---	---	---	---	PASS
AGPS	8540	broad.mit.edu	37	2	178346847	178346847	+	Missense_Mutation	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:178346847A>C	uc002ull.2	+	11	1213	c.1166A>C	c.(1165-1167)AAG>ACG	p.K389T	AGPS_uc010zfb.1_Missense_Mutation_p.K299T	NM_003659	NP_003650	O00116	ADAS_HUMAN	alkyldihydroxyacetone phosphate synthase	389					ether lipid biosynthetic process	peroxisomal matrix|peroxisomal membrane|plasma membrane	alkylglycerone-phosphate synthase activity|flavin adenine dinucleotide binding|oxidoreductase activity			ovary(2)|central_nervous_system(1)	3			OV - Ovarian serous cystadenocarcinoma(117;0.0018)|Epithelial(96;0.00919)|all cancers(119;0.0358)			GAATACCAAAAGTATGGCTCA	0.323													8	64	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179667021	179667021	+	Missense_Mutation	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179667021A>C	uc002und.2	-	3	364	c.139T>G	c.(139-141)TCC>GCC	p.S47A	TTN_uc010zfg.1_Missense_Mutation_p.S47A|TTN_uc010zfh.1_Missense_Mutation_p.S47A|TTN_uc010zfi.1_Missense_Mutation_p.S47A|TTN_uc010zfj.1_Missense_Mutation_p.S47A|TTN_uc002unb.2_Missense_Mutation_p.S47A			Q8WZ42	TITIN_HUMAN	Homo sapiens cDNA FLJ32040 fis, clone NTONG2000858, highly similar to H.sapiens mRNA for titin protein.	47							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			GTGGAAGTGGAAATCACCTGG	0.517													22	55	---	---	---	---	PASS
SSFA2	6744	broad.mit.edu	37	2	182766798	182766798	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:182766798G>T	uc002uoi.2	+	8	1340	c.1018G>T	c.(1018-1020)GAT>TAT	p.D340Y	SSFA2_uc002uoh.2_Missense_Mutation_p.D340Y|SSFA2_uc002uoj.2_Missense_Mutation_p.D340Y|SSFA2_uc002uok.2_RNA|SSFA2_uc010zfo.1_Missense_Mutation_p.D187Y|SSFA2_uc002uol.2_Missense_Mutation_p.D187Y	NM_001130445	NP_001123917	P28290	SSFA2_HUMAN	sperm specific antigen 2 isoform 1	340						cytoplasm|plasma membrane	actin binding			breast(1)|central_nervous_system(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.0856)			CAATAAAAACGATCAAAAGTC	0.353													12	70	---	---	---	---	PASS
DNAH7	56171	broad.mit.edu	37	2	196741338	196741338	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196741338T>A	uc002utj.3	-	37	6148	c.6047A>T	c.(6046-6048)CAG>CTG	p.Q2016L		NM_018897	NP_061720	Q8WXX0	DYH7_HUMAN	dynein, axonemal, heavy chain 7	2016	AAA 3 (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(10)|ovary(2)	12						GACAATATTCTGAGTTTGAGC	0.358													41	111	---	---	---	---	PASS
DNAH7	56171	broad.mit.edu	37	2	196883987	196883987	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196883987G>T	uc002utj.3	-	9	877	c.776C>A	c.(775-777)TCT>TAT	p.S259Y		NM_018897	NP_061720	Q8WXX0	DYH7_HUMAN	dynein, axonemal, heavy chain 7	259	Stem (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(10)|ovary(2)	12						AGCTAAAAAAGATTTCCTCCA	0.333													26	110	---	---	---	---	PASS
COL4A4	1286	broad.mit.edu	37	2	227924179	227924179	+	Silent	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:227924179A>G	uc010zlt.1	-	28	2979	c.2325T>C	c.(2323-2325)CTT>CTC	p.L775L		NM_000092	NP_000083	P53420	CO4A4_HUMAN	alpha 4 type IV collagen precursor	775	Triple-helical region.				axon guidance|glomerular basement membrane development	basal lamina|collagen type IV	extracellular matrix structural constituent|protein binding			ovary(5)|central_nervous_system(3)|pancreas(1)|breast(1)|skin(1)	11		Renal(207;0.00844)|all_lung(227;0.0187)|Lung NSC(271;0.0879)|all_hematologic(139;0.21)|Esophageal squamous(248;0.242)		Epithelial(121;6.7e-11)|all cancers(144;5.39e-08)|Lung(261;0.0132)|LUSC - Lung squamous cell carcinoma(224;0.0181)		GCACTCCTGAAAGACCCCTCT	0.602													83	146	---	---	---	---	PASS
CNTN6	27255	broad.mit.edu	37	3	1320115	1320115	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:1320115C>G	uc003boz.2	+	5	644	c.377C>G	c.(376-378)ACT>AGT	p.T126S	CNTN6_uc010hbo.2_Missense_Mutation_p.T121S|CNTN6_uc011asj.1_Missense_Mutation_p.T54S|CNTN6_uc003bpa.2_Missense_Mutation_p.T126S	NM_014461	NP_055276	Q9UQ52	CNTN6_HUMAN	contactin 6 precursor	126	Ig-like C2-type 2.				axon guidance|cell adhesion|central nervous system development|Notch signaling pathway	anchored to membrane|plasma membrane				skin(3)|lung(2)|breast(2)|pancreas(1)	8		all_cancers(2;0.000164)|all_epithelial(2;0.107)		Epithelial(13;0.000233)|all cancers(10;0.0013)|OV - Ovarian serous cystadenocarcinoma(96;0.0139)		GACTTTGAAACTAAAACAAGA	0.368													51	65	---	---	---	---	PASS
HRH1	3269	broad.mit.edu	37	3	11301811	11301811	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:11301811C>T	uc010hdr.2	+	2	1430	c.1088C>T	c.(1087-1089)TCA>TTA	p.S363L	HRH1_uc010hds.2_Missense_Mutation_p.S363L|HRH1_uc010hdt.2_Missense_Mutation_p.S363L|HRH1_uc003bwb.3_Missense_Mutation_p.S363L	NM_001098213	NP_001091683	P35367	HRH1_HUMAN	histamine receptor H1	363	Cytoplasmic (Potential).				activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|inflammatory response	cytoplasm|integral to plasma membrane|nucleus	histamine receptor activity			large_intestine(1)|ovary(1)	2					Aceprometazine(DB01615)|Astemizole(DB00637)|Azatadine(DB00719)|Azelastine(DB00972)|Benzquinamide(DB00767)|Bepotastine(DB04890)|Bromodiphenhydramine(DB01237)|Brompheniramine(DB00835)|Buclizine(DB00354)|Carbinoxamine(DB00748)|Cetirizine(DB00341)|Chlophedianol(DB04837)|Chlorpheniramine(DB01114)|Chlorprothixene(DB01239)|Cinnarizine(DB00568)|Clemastine(DB00283)|Clozapine(DB00363)|Cyclizine(DB01176)|Cyproheptadine(DB00434)|Desipramine(DB01151)|Desloratadine(DB00967)|Dexbrompheniramine(DB00405)|Dimenhydrinate(DB00985)|Diphenhydramine(DB01075)|Diphenylpyraline(DB01146)|Doxepin(DB01142)|Doxylamine(DB00366)|Emedastine(DB01084)|Epinastine(DB00751)|Fexofenadine(DB00950)|Flunarizine(DB04841)|Histamine Phosphate(DB00667)|Hydroxyzine(DB00557)|Ketotifen(DB00920)|Levocabastine(DB01106)|Loratadine(DB00455)|Maprotiline(DB00934)|Meclizine(DB00737)|Mequitazine(DB01071)|Methdilazine(DB00902)|Methotrimeprazine(DB01403)|Mianserin(DB06148)|Mirtazapine(DB00370)|Nedocromil(DB00716)|Olanzapine(DB00334)|Olopatadine(DB00768)|Orphenadrine(DB01173)|Pemirolast(DB00885)|Phenindamine(DB01619)|Pheniramine(DB01620)|Prochlorperazine(DB00433)|Promazine(DB00420)|Promethazine(DB01069)|Propiomazine(DB00777)|Quetiapine(DB01224)|Risperidone(DB00734)|Terfenadine(DB00342)|Thiethylperazine(DB00372)|Trazodone(DB00656)|Trimeprazine(DB01246)|Tripelennamine(DB00792)|Triprolidine(DB00427)|Ziprasidone(DB00246)	CGAACGGACTCAGATACCACC	0.517													55	50	---	---	---	---	PASS
KCNH8	131096	broad.mit.edu	37	3	19295285	19295285	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:19295285G>T	uc003cbk.1	+	2	411	c.216G>T	c.(214-216)GGG>GGT	p.G72G	KCNH8_uc011awe.1_Silent_p.G72G|KCNH8_uc010hex.1_5'UTR	NM_144633	NP_653234	Q96L42	KCNH8_HUMAN	potassium voltage-gated channel, subfamily H,	72	Cytoplasmic (Potential).|PAS.					integral to membrane	two-component sensor activity			lung(4)|ovary(1)	5						TCTTATTTGGGGTTGAAACCA	0.423													109	98	---	---	---	---	PASS
SCN10A	6336	broad.mit.edu	37	3	38770244	38770244	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38770244C>A	uc003ciq.2	-	15	2429	c.2429G>T	c.(2428-2430)GGG>GTG	p.G810V		NM_006514	NP_006505	Q9Y5Y9	SCNAA_HUMAN	sodium channel, voltage-gated, type X, alpha	810	Helical; Name=S5 of repeat II; (Potential).|II.				sensory perception	voltage-gated sodium channel complex				ovary(5)|skin(3)|large_intestine(1)|kidney(1)	10				KIRC - Kidney renal clear cell carcinoma(284;0.0769)|Kidney(284;0.0945)	Benzocaine(DB01086)|Bupivacaine(DB00297)|Chloroprocaine(DB01161)|Cocaine(DB00907)|Dibucaine(DB00527)|Dyclonine(DB00645)|Hexylcaine(DB00473)|Levobupivacaine(DB01002)|Lidocaine(DB00281)|Mepivacaine(DB00961)|Oxybuprocaine(DB00892)|Procaine(DB00721)|Proparacaine(DB00807)|Ropivacaine(DB00296)	GTAGTTTTCCCCTAGGAGCTG	0.517													41	54	---	---	---	---	PASS
KBTBD5	131377	broad.mit.edu	37	3	42727965	42727965	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:42727965G>A	uc003clv.1	+	1	955	c.855G>A	c.(853-855)AAG>AAA	p.K285K		NM_152393	NP_689606	Q2TBA0	KBTB5_HUMAN	kelch repeat and BTB (POZ) domain containing 5	285										ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.214)		AGGCTGATAAGGGCACAAGCA	0.582													91	107	---	---	---	---	PASS
KBTBD5	131377	broad.mit.edu	37	3	42729743	42729743	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:42729743A>T	uc003clv.1	+	2	1362	c.1262A>T	c.(1261-1263)GAG>GTG	p.E421V		NM_152393	NP_689606	Q2TBA0	KBTB5_HUMAN	kelch repeat and BTB (POZ) domain containing 5	421	Kelch 2.									ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(284;0.214)		GGTGGCAGAGAGATCAAGGAC	0.652													27	63	---	---	---	---	PASS
STAB1	23166	broad.mit.edu	37	3	52538859	52538859	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52538859G>T	uc003dej.2	+	12	1418	c.1344G>T	c.(1342-1344)GGG>GGT	p.G448G	STAB1_uc003dei.1_Silent_p.G448G	NM_015136	NP_055951	Q9NY15	STAB1_HUMAN	stabilin 1 precursor	448	Extracellular (Potential).|FAS1 1.				cell adhesion|cell-cell signaling|defense response to bacterium|inflammatory response|negative regulation of angiogenesis|receptor-mediated endocytosis	integral to plasma membrane	bacterial cell surface binding|hyaluronic acid binding|low-density lipoprotein receptor activity|protein disulfide oxidoreductase activity|scavenger receptor activity			large_intestine(3)|upper_aerodigestive_tract(2)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	9				BRCA - Breast invasive adenocarcinoma(193;1.73e-05)|Kidney(197;0.00182)|KIRC - Kidney renal clear cell carcinoma(197;0.00205)|OV - Ovarian serous cystadenocarcinoma(275;0.0482)		CGCTGGCCGGGCAGGAGATCA	0.607													26	19	---	---	---	---	PASS
STAB1	23166	broad.mit.edu	37	3	52551966	52551966	+	Missense_Mutation	SNP	G	A	A	rs147254311	byFrequency	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52551966G>A	uc003dej.2	+	45	4782	c.4708G>A	c.(4708-4710)GAC>AAC	p.D1570N	STAB1_uc003dek.1_5'Flank	NM_015136	NP_055951	Q9NY15	STAB1_HUMAN	stabilin 1 precursor	1570	Extracellular (Potential).|EGF-like 13.				cell adhesion|cell-cell signaling|defense response to bacterium|inflammatory response|negative regulation of angiogenesis|receptor-mediated endocytosis	integral to plasma membrane	bacterial cell surface binding|hyaluronic acid binding|low-density lipoprotein receptor activity|protein disulfide oxidoreductase activity|scavenger receptor activity			large_intestine(3)|upper_aerodigestive_tract(2)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	9				BRCA - Breast invasive adenocarcinoma(193;1.73e-05)|Kidney(197;0.00182)|KIRC - Kidney renal clear cell carcinoma(197;0.00205)|OV - Ovarian serous cystadenocarcinoma(275;0.0482)		ATGTACCTGCGACACAGCCCA	0.607													33	29	---	---	---	---	PASS
ADAMTS9	56999	broad.mit.edu	37	3	64554154	64554154	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:64554154C>G	uc003dmg.2	-	29	4446	c.4414G>C	c.(4414-4416)GAT>CAT	p.D1472H	ADAMTS9_uc011bfo.1_Missense_Mutation_p.D1444H|ADAMTS9_uc003dmh.1_Missense_Mutation_p.D1301H|ADAMTS9_uc011bfp.1_Missense_Mutation_p.D383H|uc003dmi.1_Intron	NM_182920	NP_891550	Q9P2N4	ATS9_HUMAN	ADAM metallopeptidase with thrombospondin type 1	1472	TSP type-1 11.				glycoprotein catabolic process|multicellular organismal development|proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(2)|urinary_tract(1)|skin(1)	4		Lung NSC(201;0.00682)		BRCA - Breast invasive adenocarcinoma(55;0.00142)|Kidney(15;0.00202)|KIRC - Kidney renal clear cell carcinoma(15;0.00221)		TGGCTTCCATCTTTTGCCATG	0.443													11	91	---	---	---	---	PASS
ROBO2	6092	broad.mit.edu	37	3	77607259	77607259	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:77607259A>G	uc003dpy.3	+	9	2039	c.1396A>G	c.(1396-1398)ACA>GCA	p.T466A	ROBO2_uc003dpz.2_Missense_Mutation_p.T470A|ROBO2_uc011bgj.1_RNA|ROBO2_uc011bgk.1_Missense_Mutation_p.T470A	NM_002942	NP_002933	Q9HCK4	ROBO2_HUMAN	roundabout, axon guidance receptor, homolog 2	466	Ig-like C2-type 5.|Extracellular (Potential).				apoptosis involved in luteolysis|axon midline choice point recognition|cellular response to hormone stimulus|homophilic cell adhesion|metanephros development|negative regulation of negative chemotaxis|negative regulation of synaptogenesis|olfactory bulb interneuron development|positive regulation of axonogenesis|retinal ganglion cell axon guidance|ureteric bud development	axolemma|cell surface|integral to membrane	axon guidance receptor activity|identical protein binding			lung(5)|skin(3)|ovary(1)|large_intestine(1)|liver(1)	11				Epithelial(33;0.00199)|LUSC - Lung squamous cell carcinoma(21;0.008)|BRCA - Breast invasive adenocarcinoma(55;0.00884)|Lung(72;0.0183)|KIRC - Kidney renal clear cell carcinoma(39;0.0832)|Kidney(39;0.103)		TCCAAGAGCAACAATTCAAGA	0.398													20	76	---	---	---	---	PASS
ROBO1	6091	broad.mit.edu	37	3	78706414	78706414	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:78706414C>A	uc003dqe.2	-	18	2656	c.2448G>T	c.(2446-2448)TGG>TGT	p.W816C	ROBO1_uc003dqb.2_Missense_Mutation_p.W777C|ROBO1_uc003dqc.2_Missense_Mutation_p.W780C|ROBO1_uc003dqd.2_Missense_Mutation_p.W780C|ROBO1_uc010hoh.2_Missense_Mutation_p.W8C|ROBO1_uc011bgl.1_Missense_Mutation_p.W388C	NM_002941	NP_002932	Q9Y6N7	ROBO1_HUMAN	roundabout 1 isoform a	816	Extracellular (Potential).|Fibronectin type-III 3.				activation of caspase activity|axon midline choice point recognition|cell migration involved in sprouting angiogenesis|chemorepulsion involved in postnatal olfactory bulb interneuron migration|homophilic cell adhesion|negative regulation of chemokine-mediated signaling pathway|negative regulation of mammary gland epithelial cell proliferation|negative regulation of negative chemotaxis|positive regulation of axonogenesis|Roundabout signaling pathway	cell surface|cytoplasm|integral to plasma membrane	axon guidance receptor activity|identical protein binding|LRR domain binding			large_intestine(2)	2		Lung SC(41;0.0257)|Lung NSC(201;0.0439)		LUSC - Lung squamous cell carcinoma(21;0.008)|Epithelial(33;0.00999)|Lung(72;0.0177)|BRCA - Breast invasive adenocarcinoma(55;0.0274)		TGCCCAGACACCAAACCTGTA	0.428													10	23	---	---	---	---	PASS
ROBO1	6091	broad.mit.edu	37	3	78706415	78706415	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:78706415C>G	uc003dqe.2	-	18	2655	c.2447G>C	c.(2446-2448)TGG>TCG	p.W816S	ROBO1_uc003dqb.2_Missense_Mutation_p.W777S|ROBO1_uc003dqc.2_Missense_Mutation_p.W780S|ROBO1_uc003dqd.2_Missense_Mutation_p.W780S|ROBO1_uc010hoh.2_Missense_Mutation_p.W8S|ROBO1_uc011bgl.1_Missense_Mutation_p.W388S	NM_002941	NP_002932	Q9Y6N7	ROBO1_HUMAN	roundabout 1 isoform a	816	Extracellular (Potential).|Fibronectin type-III 3.				activation of caspase activity|axon midline choice point recognition|cell migration involved in sprouting angiogenesis|chemorepulsion involved in postnatal olfactory bulb interneuron migration|homophilic cell adhesion|negative regulation of chemokine-mediated signaling pathway|negative regulation of mammary gland epithelial cell proliferation|negative regulation of negative chemotaxis|positive regulation of axonogenesis|Roundabout signaling pathway	cell surface|cytoplasm|integral to plasma membrane	axon guidance receptor activity|identical protein binding|LRR domain binding			large_intestine(2)	2		Lung SC(41;0.0257)|Lung NSC(201;0.0439)		LUSC - Lung squamous cell carcinoma(21;0.008)|Epithelial(33;0.00999)|Lung(72;0.0177)|BRCA - Breast invasive adenocarcinoma(55;0.0274)		GCCCAGACACCAAACCTGTAA	0.423													10	23	---	---	---	---	PASS
TMEM108	66000	broad.mit.edu	37	3	133100015	133100015	+	Intron	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133100015G>A	uc003eph.2	+						TMEM108_uc003epi.2_Intron|TMEM108_uc003epj.1_Intron|TMEM108_uc003epk.2_Intron|TMEM108_uc003epm.2_Intron	NM_023943	NP_076432	Q6UXF1	TM108_HUMAN	transmembrane protein 108 precursor							integral to membrane				ovary(2)|skin(2)	4						TGTAAGTGCCGCCCTCTCCCA	0.562													13	41	---	---	---	---	PASS
EPHB1	2047	broad.mit.edu	37	3	134880897	134880897	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:134880897A>T	uc003eqt.2	+	7	1680	c.1460A>T	c.(1459-1461)CAG>CTG	p.Q487L	EPHB1_uc003equ.2_Missense_Mutation_p.Q48L	NM_004441	NP_004432	P54762	EPHB1_HUMAN	ephrin receptor EphB1 precursor	487	Fibronectin type-III 2.|Extracellular (Potential).					integral to plasma membrane	ATP binding|ephrin receptor activity|protein binding			lung(11)|ovary(6)|stomach(4)|breast(3)|central_nervous_system(2)|skin(2)|large_intestine(1)|pancreas(1)	30						GCCAGGAGTCAGACCAACACA	0.547													16	162	---	---	---	---	PASS
CPB1	1360	broad.mit.edu	37	3	148562254	148562254	+	Intron	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:148562254T>C	uc003ewl.2	+							NM_001871	NP_001862	P15086	CBPB1_HUMAN	pancreatic carboxypeptidase B1 preproprotein						proteolysis	extracellular region	metallocarboxypeptidase activity|zinc ion binding			ovary(1)|central_nervous_system(1)|skin(1)	3			LUSC - Lung squamous cell carcinoma(72;0.0934)|Lung(72;0.115)			CTCTTCATAATTCACATACAG	0.373													9	64	---	---	---	---	PASS
NLGN1	22871	broad.mit.edu	37	3	173996793	173996793	+	Silent	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:173996793A>G	uc003fio.1	+	6	1425	c.1002A>G	c.(1000-1002)CTA>CTG	p.L334L	NLGN1_uc010hww.1_Silent_p.L374L|NLGN1_uc003fip.1_Silent_p.L334L	NM_014932	NP_055747	Q8N2Q7	NLGN1_HUMAN	neuroligin 1	351	Extracellular (Potential).				calcium-dependent cell-cell adhesion|neuron cell-cell adhesion|neuronal signal transduction|positive regulation of dendritic spine development|positive regulation of excitatory postsynaptic membrane potential|positive regulation of intracellular protein kinase cascade|positive regulation of synaptogenesis|protein targeting|regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity|regulation of N-methyl-D-aspartate selective glutamate receptor activity|synapse assembly|synaptic vesicle targeting	cell junction|cell surface|dendrite|integral to plasma membrane|postsynaptic density|postsynaptic membrane	cell adhesion molecule binding|neurexin binding|receptor activity			lung(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)|ovary(1)|pancreas(1)	7	Ovarian(172;0.0025)		LUSC - Lung squamous cell carcinoma(14;5.36e-13)|Lung(28;9.49e-13)			TGGAATGCCTACAGAAGAAGC	0.423													38	500	---	---	---	---	PASS
ZNF639	51193	broad.mit.edu	37	3	179051541	179051541	+	Silent	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179051541A>G	uc003fjq.1	+	6	1132	c.789A>G	c.(787-789)AAA>AAG	p.K263K	ZNF639_uc003fjr.1_Silent_p.K263K	NM_016331	NP_057415	Q9UID6	ZN639_HUMAN	zinc finger protein 639	263	C2H2-type 3.				initiation of viral infection|negative regulation by host of viral transcription|negative regulation of transcription, DNA-dependent|positive regulation by host of viral transcription|positive regulation of cell growth|positive regulation of transcription, DNA-dependent	nucleus	protein self-association|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding				0	all_cancers(143;7.9e-17)|Ovarian(172;0.0172)|Breast(254;0.155)		OV - Ovarian serous cystadenocarcinoma(80;5.78e-26)|GBM - Glioblastoma multiforme(14;0.003)|BRCA - Breast invasive adenocarcinoma(182;0.0923)			ACATTTGTAAATACTGTGATT	0.393													93	207	---	---	---	---	PASS
LRPAP1	4043	broad.mit.edu	37	4	3521853	3521853	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:3521853A>T	uc003ghi.2	-	3	502	c.417T>A	c.(415-417)AGT>AGA	p.S139R		NM_002337	NP_002328	P30533	AMRP_HUMAN	low density lipoprotein receptor-related protein	139					negative regulation of protein binding|negative regulation of very-low-density lipoprotein particle clearance|protein folding|vesicle-mediated transport	cell surface|integral to membrane|plasma membrane	asialoglycoprotein receptor activity|heparin binding|low-density lipoprotein particle receptor binding|receptor antagonist activity|unfolded protein binding|very-low-density lipoprotein particle receptor binding			ovary(1)|skin(1)	2				UCEC - Uterine corpus endometrioid carcinoma (64;0.165)		CCTGGGTGCCACTGAGGGAGT	0.537													28	40	---	---	---	---	PASS
COX7B2	170712	broad.mit.edu	37	4	46737167	46737167	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:46737167T>A	uc003gxf.2	-	3	223	c.43A>T	c.(43-45)ATT>TTT	p.I15F	COX7B2_uc010ige.2_RNA	NM_130902	NP_570972	Q8TF08	CX7B2_HUMAN	cytochrome c oxidase subunit VIIb2 precursor	15						integral to membrane|mitochondrial respiratory chain	cytochrome-c oxidase activity				0						ATGCTTTGAATCTTGAGACTG	0.428													11	115	---	---	---	---	PASS
ATP10D	57205	broad.mit.edu	37	4	47559926	47559926	+	Silent	SNP	T	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47559926T>G	uc003gxk.1	+	12	2234	c.2070T>G	c.(2068-2070)GCT>GCG	p.A690A	ATP10D_uc003gxl.1_Intron	NM_020453	NP_065186	Q9P241	AT10D_HUMAN	ATPase, class V, type 10D	690	Cytoplasmic (Potential).				ATP biosynthetic process|cation transport	integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(2)|pancreas(1)	3						GTAGCTCAGCTTGCTGCACAG	0.552													28	91	---	---	---	---	PASS
TECRL	253017	broad.mit.edu	37	4	65180484	65180484	+	Intron	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:65180484G>A	uc003hcv.2	-						TECRL_uc003hcw.2_Intron	NM_001010874	NP_001010874	Q5HYJ1	TECRL_HUMAN	steroid 5 alpha-reductase 2-like 2						lipid metabolic process	cytoplasm|integral to membrane	oxidoreductase activity, acting on the CH-CH group of donors				0						AAAAACACCTGAAAATAAAAC	0.328													32	47	---	---	---	---	PASS
UGT2B11	10720	broad.mit.edu	37	4	70070204	70070204	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70070204G>C	uc003heh.2	-	5	1263	c.1254C>G	c.(1252-1254)AAC>AAG	p.N418K	uc003hei.1_Intron	NM_001073	NP_001064	O75310	UDB11_HUMAN	UDP glucuronosyltransferase 2 family,	418					estrogen metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glucuronosyltransferase activity			ovary(1)|haematopoietic_and_lymphoid_tissue(1)|skin(1)	3						TCGACATTGTGTTGAAGTCCA	0.428													77	259	---	---	---	---	PASS
CSN3	1448	broad.mit.edu	37	4	71113572	71113572	+	Intron	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:71113572G>T	uc003hfe.3	+							NM_005212	NP_005203	P07498	CASK_HUMAN	casein kappa precursor							extracellular region	protein binding			ovary(2)|kidney(1)|central_nervous_system(1)	4						CCAGCAGTAAGTCTATTTTAA	0.313													27	69	---	---	---	---	PASS
GC	2638	broad.mit.edu	37	4	72634150	72634150	+	Silent	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:72634150C>A	uc003hge.2	-	3	282	c.129G>T	c.(127-129)CTG>CTT	p.L43L	GC_uc003hgd.2_5'UTR|GC_uc010iie.2_Silent_p.L43L|GC_uc010iif.2_Silent_p.L62L	NM_000583	NP_000574	P02774	VTDB_HUMAN	vitamin D-binding protein precursor	43	Albumin 1.				hormone biosynthetic process|vitamin D metabolic process	cytosol|lysosomal lumen	actin binding|vitamin D binding|vitamin transporter activity			ovary(2)|upper_aerodigestive_tract(1)	3		all_hematologic(202;0.107)	Lung(101;0.148)		Cholecalciferol(DB00169)	GGACTAGTGACCTGAGGGGAA	0.323													21	45	---	---	---	---	PASS
GC	2638	broad.mit.edu	37	4	72634151	72634151	+	Splice_Site	SNP	C	A	A	rs112961993		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:72634151C>A	uc003hge.2	-	3	282	c.129_splice	c.e3-1	p.L43_splice	GC_uc003hgd.2_Splice_Site|GC_uc010iie.2_Splice_Site_p.L43_splice|GC_uc010iif.2_Splice_Site_p.L62_splice	NM_000583	NP_000574	P02774	VTDB_HUMAN	vitamin D-binding protein precursor						hormone biosynthetic process|vitamin D metabolic process	cytosol|lysosomal lumen	actin binding|vitamin D binding|vitamin transporter activity			ovary(2)|upper_aerodigestive_tract(1)	3		all_hematologic(202;0.107)	Lung(101;0.148)		Cholecalciferol(DB00169)	GACTAGTGACCTGAGGGGAAA	0.318													21	44	---	---	---	---	PASS
MRPL1	65008	broad.mit.edu	37	4	78870974	78870974	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:78870974A>G	uc003hku.2	+	8	999	c.801A>G	c.(799-801)ATA>ATG	p.I267M	MRPL1_uc010iji.1_Intron	NM_020236	NP_064621	Q9BYD6	RM01_HUMAN	mitochondrial ribosomal protein L1 precursor	267							RNA binding				0						GTGACCAGATAGCTGCCAATC	0.358													52	83	---	---	---	---	PASS
FRAS1	80144	broad.mit.edu	37	4	79322022	79322022	+	Silent	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79322022A>G	uc003hlb.2	+	30	4550	c.4110A>G	c.(4108-4110)ACA>ACG	p.T1370T	FRAS1_uc003hkw.2_Silent_p.T1370T	NM_025074	NP_079350	Q86XX4	FRAS1_HUMAN	Fraser syndrome 1	1369	CSPG 3.|Extracellular (Potential).				cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5						ACAAGATTACACAAGACTACC	0.483													21	33	---	---	---	---	PASS
FRAS1	80144	broad.mit.edu	37	4	79418102	79418102	+	Silent	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79418102C>A	uc003hlb.2	+	60	9542	c.9102C>A	c.(9100-9102)TCC>TCA	p.S3034S	FRAS1_uc003hlc.1_Silent_p.S36S	NM_025074	NP_079350	Q86XX4	FRAS1_HUMAN	Fraser syndrome 1	3029	Calx-beta 5.|Extracellular (Potential).				cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5						TCACCATATCCAATGATGAAG	0.388													25	103	---	---	---	---	PASS
ABCG2	9429	broad.mit.edu	37	4	89052313	89052313	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:89052313G>T	uc003hrg.2	-	5	924	c.431C>A	c.(430-432)GCA>GAA	p.A144E	ABCG2_uc003hrh.2_Missense_Mutation_p.A144E|ABCG2_uc003hrf.2_Missense_Mutation_p.A14E	NM_004827	NP_004818	Q9UNQ0	ABCG2_HUMAN	ATP-binding cassette, sub-family G, member 2	144	ABC transporter.|Cytoplasmic (Potential).				cellular iron ion homeostasis|urate metabolic process	integral to membrane|plasma membrane	ATP binding|heme transporter activity|protein homodimerization activity|xenobiotic-transporting ATPase activity			central_nervous_system(1)	1		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;7.02e-05)	Imatinib(DB00619)|Mitoxantrone(DB01204)|Nicardipine(DB00622)|Nitrendipine(DB01054)|Rosuvastatin(DB01098)|Saquinavir(DB01232)|Topotecan(DB01030)	CCGAAGAGCTGCTGAGAACTG	0.403													53	186	---	---	---	---	PASS
BANK1	55024	broad.mit.edu	37	4	102942683	102942683	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:102942683G>A	uc003hvy.3	+	8	1493	c.1219G>A	c.(1219-1221)GAC>AAC	p.D407N	BANK1_uc003hvx.3_Missense_Mutation_p.D392N|BANK1_uc010ill.2_Missense_Mutation_p.D274N|BANK1_uc003hvz.3_Missense_Mutation_p.D377N	NM_017935	NP_060405	Q8NDB2	BANK1_HUMAN	B-cell scaffold protein with ankyrin repeats 1	407	ANK 2.				B cell activation					ovary(2)|skin(1)	3		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;2.7e-07)		CCAAGAAATTGACATAAATAA	0.239													18	37	---	---	---	---	PASS
NHEDC1	150159	broad.mit.edu	37	4	103870594	103870594	+	Intron	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:103870594A>G	uc003hww.2	-						NHEDC1_uc003hwu.2_Intron|NHEDC1_uc010ilm.2_Intron|NHEDC1_uc003hwv.2_Intron|NHEDC1_uc011cev.1_Intron	NM_139173	NP_631912	Q4ZJI4	NHDC1_HUMAN	Na+/H+ exchanger domain containing 1 isoform 1							integral to membrane	solute:hydrogen antiporter activity			ovary(1)|skin(1)	2		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;1.5e-08)		CCTGAAATACAAAAAAGTGTA	0.318													45	76	---	---	---	---	PASS
TACR3	6870	broad.mit.edu	37	4	104577502	104577502	+	Splice_Site	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:104577502C>G	uc003hxe.1	-	3	881	c.738_splice	c.e3-1	p.T246_splice		NM_001059	NP_001050	P29371	NK3R_HUMAN	tachykinin receptor 3							integral to plasma membrane	tachykinin receptor activity			ovary(3)|lung(2)|breast(1)|skin(1)	7		Hepatocellular(203;0.217)		UCEC - Uterine corpus endometrioid carcinoma (10;0.22)|OV - Ovarian serous cystadenocarcinoma(123;3.4e-08)		AATATGGTAACTATGAAAAAT	0.353													24	93	---	---	---	---	PASS
HSPA4L	22824	broad.mit.edu	37	4	128725004	128725004	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:128725004T>C	uc003ifm.2	+	7	1137	c.884T>C	c.(883-885)CTT>CCT	p.L295P	HSPA4L_uc010iny.1_Missense_Mutation_p.L254P|HSPA4L_uc011cgr.1_Missense_Mutation_p.L262P	NM_014278	NP_055093	O95757	HS74L_HUMAN	heat shock 70kDa protein 4-like	295					protein folding|response to unfolded protein	cytoplasm|nucleus	ATP binding|protein binding			ovary(2)|central_nervous_system(1)|skin(1)	4						ATGAATGACCTTGATGTTTCT	0.323													24	81	---	---	---	---	PASS
GYPE	2996	broad.mit.edu	37	4	144797984	144797984	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:144797984G>A	uc003ijj.2	-	3	217	c.161C>T	c.(160-162)GCG>GTG	p.A54V	GYPE_uc010ion.2_Intron|GYPE_uc003ijk.3_Missense_Mutation_p.A54V	NM_198682	NP_941391	P15421	GLPE_HUMAN	glycophorin E precursor	54	Helical; (Potential).					integral to plasma membrane					0	all_hematologic(180;0.158)					ACGAGCCATCGCCCACCAATT	0.348													26	9	---	---	---	---	PASS
CDH9	1007	broad.mit.edu	37	5	26906871	26906871	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:26906871G>T	uc003jgs.1	-	4	769	c.600C>A	c.(598-600)AGC>AGA	p.S200R	CDH9_uc010iug.2_Missense_Mutation_p.S200R	NM_016279	NP_057363	Q9ULB4	CADH9_HUMAN	cadherin 9, type 2 preproprotein	200	Extracellular (Potential).|Cadherin 2.				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(5)|skin(2)|upper_aerodigestive_tract(1)|haematopoietic_and_lymphoid_tissue(1)	9						CTTGCAATATGCTATAGACCA	0.383													16	94	---	---	---	---	PASS
RXFP3	51289	broad.mit.edu	37	5	33936966	33936966	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:33936966G>T	uc003jic.1	+	1	478	c.121G>T	c.(121-123)GCG>TCG	p.A41S		NM_016568	NP_057652	Q9NSD7	RL3R1_HUMAN	relaxin/insulin-like family peptide receptor 3	41	Extracellular (Potential).					integral to plasma membrane	N-formyl peptide receptor activity			upper_aerodigestive_tract(1)	1						GAGTGGTAACGCGTCGCTGCA	0.667													40	159	---	---	---	---	PASS
CAPSL	133690	broad.mit.edu	37	5	35921225	35921225	+	Intron	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35921225G>A	uc003jjt.1	-						CAPSL_uc003jju.1_Intron	NM_001042625	NP_001036090	Q8WWF8	CAPSL_HUMAN	calcyphosine-like							cytoplasm	calcium ion binding			skin(1)	1	all_lung(31;0.000268)		Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Epithelial(62;0.167)|Colorectal(62;0.202)			CCTGCCATCTGAGGGGAAGCC	0.577													16	57	---	---	---	---	PASS
UGT3A2	167127	broad.mit.edu	37	5	36038083	36038083	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:36038083C>G	uc003jjz.1	-	6	1204	c.1111G>C	c.(1111-1113)GGG>CGG	p.G371R	UGT3A2_uc011cos.1_Missense_Mutation_p.G337R|UGT3A2_uc011cot.1_Missense_Mutation_p.G69R	NM_174914	NP_777574	Q3SY77	UD3A2_HUMAN	UDP glycosyltransferase 3 family, polypeptide A2	371	Extracellular (Potential).					integral to membrane	glucuronosyltransferase activity			ovary(2)|skin(2)|large_intestine(1)|pancreas(1)	6	all_lung(31;0.000179)		Lung(74;0.111)|Epithelial(62;0.113)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			CTATTCTGCCCGCCGTGGGTG	0.502													34	148	---	---	---	---	PASS
UGT3A2	167127	broad.mit.edu	37	5	36049408	36049408	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:36049408C>T	uc003jjz.1	-	4	519	c.426G>A	c.(424-426)GTG>GTA	p.V142V	UGT3A2_uc011cos.1_Silent_p.V108V|UGT3A2_uc011cot.1_Intron	NM_174914	NP_777574	Q3SY77	UD3A2_HUMAN	UDP glycosyltransferase 3 family, polypeptide A2	142	Extracellular (Potential).					integral to membrane	glucuronosyltransferase activity			ovary(2)|skin(2)|large_intestine(1)|pancreas(1)	6	all_lung(31;0.000179)		Lung(74;0.111)|Epithelial(62;0.113)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			TTTCAACTATCACCATGTCGA	0.378													19	198	---	---	---	---	PASS
OSMR	9180	broad.mit.edu	37	5	38931986	38931986	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:38931986C>T	uc003jln.1	+	16	2581	c.2214C>T	c.(2212-2214)TCC>TCT	p.S738S	OSMR_uc011cpj.1_Intron	NM_003999	NP_003990	Q99650	OSMR_HUMAN	oncostatin M receptor precursor	738	Extracellular (Potential).				cell proliferation|positive regulation of cell proliferation	oncostatin-M receptor complex	growth factor binding|oncostatin-M receptor activity			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5	all_lung(31;0.000365)					CTCGTTCAGCCTCGATGCTGA	0.373													49	255	---	---	---	---	PASS
ZNF131	7690	broad.mit.edu	37	5	43122223	43122223	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:43122223G>T	uc011cpw.1	+	2	104	c.68G>T	c.(67-69)CGA>CTA	p.R23L	ZNF131_uc010ivl.1_Missense_Mutation_p.R23L|ZNF131_uc003jnj.3_5'UTR|ZNF131_uc003jnk.2_Missense_Mutation_p.R23L|ZNF131_uc003jnn.3_5'UTR|ZNF131_uc003jnl.1_RNA|ZNF131_uc010ivm.1_RNA|ZNF131_uc003jnm.2_Missense_Mutation_p.R23L	NM_003432	NP_003423	P52739	ZN131_HUMAN	zinc finger protein 131	23						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0						ATCCTCGACCGATTGAATGAA	0.512													39	202	---	---	---	---	PASS
F2R	2149	broad.mit.edu	37	5	76029116	76029116	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:76029116T>C	uc003ken.3	+	2	1331	c.1066T>C	c.(1066-1068)TGT>CGT	p.C356R		NM_001992	NP_001983	P25116	PAR1_HUMAN	coagulation factor II receptor precursor	356	Helical; Name=7; (Potential).				activation of caspase activity|anatomical structure morphogenesis|connective tissue replacement involved in inflammatory response wound healing|negative regulation of cell proliferation|platelet activation|positive regulation of blood coagulation|positive regulation of cell migration|positive regulation of collagen biosynthetic process|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of JAK-STAT cascade|positive regulation of MAPKKK cascade|positive regulation of release of sequestered calcium ion into cytosol|positive regulation of transcription, DNA-dependent|STAT protein import into nucleus|tyrosine phosphorylation of STAT protein	caveola|extracellular region|Golgi apparatus|integral to plasma membrane|platelet dense tubular network	receptor binding|thrombin receptor activity			ovary(3)	3		all_lung(232;0.000414)|Lung NSC(167;0.0011)|Prostate(461;0.00955)|Ovarian(174;0.0129)		all cancers(79;4.43e-43)	Streptokinase(DB00086)	CTACCTCCTCTGTGTCTGTGT	0.493													87	86	---	---	---	---	PASS
GPR98	84059	broad.mit.edu	37	5	90052867	90052867	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90052867G>T	uc003kju.2	+	57	11925	c.11829G>T	c.(11827-11829)CGG>CGT	p.R3943R	GPR98_uc003kjt.2_Silent_p.R1649R|GPR98_uc003kjv.2_Silent_p.R1543R	NM_032119	NP_115495	Q8WXG9	GPR98_HUMAN	G protein-coupled receptor 98 precursor	3943	Extracellular (Potential).				cell communication|cell-cell adhesion|maintenance of organ identity|neuropeptide signaling pathway|photoreceptor cell maintenance	cell surface|cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(11)|central_nervous_system(3)|pancreas(2)	16		all_cancers(142;1.05e-09)|all_epithelial(76;1.81e-12)|all_lung(232;5.41e-06)|Lung NSC(167;1.72e-05)|Ovarian(174;0.00948)|Colorectal(57;0.133)|Breast(839;0.192)		OV - Ovarian serous cystadenocarcinoma(54;7.01e-30)|Epithelial(54;6.79e-25)|all cancers(79;1.88e-20)		CTGTAGTCCGGCTGGCTGGAA	0.453													36	49	---	---	---	---	PASS
AQPEP	206338	broad.mit.edu	37	5	115327812	115327812	+	Intron	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:115327812C>A	uc003kro.2	+						AQPEP_uc003krp.2_Intron	NM_173800	NP_776161	Q6Q4G3	AMPQ_HUMAN	laeverin						proteolysis	integral to membrane	metallopeptidase activity|zinc ion binding				0						CCATTTAAATCCACTTAGATA	0.294													38	56	---	---	---	---	PASS
SLC27A6	28965	broad.mit.edu	37	5	128365396	128365396	+	Missense_Mutation	SNP	T	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:128365396T>G	uc003kuy.2	+	10	2075	c.1679T>G	c.(1678-1680)ATT>AGT	p.I560S	SLC27A6_uc003kuz.2_Missense_Mutation_p.I560S	NM_014031	NP_054750	Q9Y2P4	S27A6_HUMAN	solute carrier family 27 (fatty acid	560					long-chain fatty acid transport|transmembrane transport|very long-chain fatty acid metabolic process	integral to membrane|sarcolemma	fatty acid transporter activity|long-chain fatty acid-CoA ligase activity|nucleotide binding				0		all_cancers(142;0.0483)|Prostate(80;0.055)	KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)	Epithelial(69;0.171)|OV - Ovarian serous cystadenocarcinoma(64;0.186)		TTTTTAAGAATTCAGGTAATT	0.279													41	38	---	---	---	---	PASS
C5orf56	441108	broad.mit.edu	37	5	131796410	131796410	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:131796410C>T	uc003kwy.1	+	4	376	c.245C>T	c.(244-246)TCG>TTG	p.S82L	C5orf56_uc003kwz.1_Intron|C5orf56_uc010jds.1_Intron|IRF1_uc003kxd.2_Intron	NM_001013717	NP_001013739	Q8N8D9	CE056_HUMAN	hypothetical protein LOC441108	82											0						CCTTTTTCCTCGTCATCAACC	0.050													29	36	---	---	---	---	PASS
SIL1	64374	broad.mit.edu	37	5	138362594	138362594	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:138362594C>T	uc003ldm.2	-	5	558	c.541G>A	c.(541-543)GAC>AAC	p.D181N	SIL1_uc003ldn.2_Missense_Mutation_p.D180N|SIL1_uc003ldo.2_Missense_Mutation_p.D181N|SIL1_uc003ldp.2_Missense_Mutation_p.D181N|SIL1_uc003ldq.1_Intron	NM_022464	NP_071909	Q9H173	SIL1_HUMAN	SIL1 protein precursor	181	Interaction with HSPA5 and localization to the endoplasmic reticulum (By similarity).				intracellular protein transport|protein folding|transmembrane transport	endoplasmic reticulum lumen	unfolded protein binding				0			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00325)			ATCTGCATGTCAGTCTCAATG	0.463									Marinesco-Sj_gren_syndrome				44	44	---	---	---	---	PASS
PCDHA5	56143	broad.mit.edu	37	5	140201816	140201816	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140201816G>A	uc003lhl.2	+	1	456	c.456G>A	c.(454-456)CCG>CCA	p.P152P	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Silent_p.P152P|PCDHA5_uc003lhj.1_Silent_p.P152P	NM_018908	NP_061731	Q9Y5H7	PCDA5_HUMAN	protocadherin alpha 5 isoform 1 precursor	152	Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(1)|breast(1)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			CGCGGTTTCCGCTAGAGGGCG	0.413													10	58	---	---	---	---	PASS
GABRP	2568	broad.mit.edu	37	5	170239249	170239249	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:170239249A>G	uc003mau.2	+	10	1508	c.1310A>G	c.(1309-1311)TAC>TGC	p.Y437C	GABRP_uc011dev.1_3'UTR	NM_014211	NP_055026	O00591	GBRP_HUMAN	gamma-aminobutyric acid (GABA) A receptor, pi	437	Helical; (Potential).					cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			breast(1)	1	Renal(175;0.000159)|Lung NSC(126;0.0122)|all_lung(126;0.0193)	Medulloblastoma(196;0.0109)|all_neural(177;0.0298)	Kidney(164;7.24e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000516)			TGGGCATACTACATGTATTTT	0.348													39	48	---	---	---	---	PASS
CDHR2	54825	broad.mit.edu	37	5	176002375	176002375	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176002375C>A	uc003mem.1	+	9	782	c.716C>A	c.(715-717)CCC>CAC	p.P239H	CDHR2_uc003men.1_Missense_Mutation_p.P239H	NM_017675	NP_060145	Q9BYE9	CDHR2_HUMAN	protocadherin LKC precursor	239	Extracellular (Potential).|Cadherin 2.				homophilic cell adhesion|negative regulation of cell growth	apical plasma membrane|cell junction|integral to membrane	calcium ion binding|protein binding			ovary(2)	2						GACCTTGACCCCCAGTTTGTC	0.632													40	26	---	---	---	---	PASS
BTNL3	10917	broad.mit.edu	37	5	180424256	180424256	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:180424256C>A	uc003mmr.2	+	3	569	c.441C>A	c.(439-441)GAC>GAA	p.D147E		NM_197975	NP_932079	Q6UXE8	BTNL3_HUMAN	butyrophilin-like 3 precursor	147	Ig-like V-type.|Extracellular (Potential).				lipid metabolic process	integral to membrane					0	all_cancers(89;3.37e-05)|all_epithelial(37;3.77e-06)|Renal(175;0.000159)|Lung NSC(126;0.00211)|all_lung(126;0.00371)|Breast(19;0.114)	all_cancers(40;0.00336)|Medulloblastoma(196;0.0133)|all_neural(177;0.0199)|all_hematologic(541;0.163)|Ovarian(839;0.238)|all_lung(500;0.248)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000272)			GATATGTTGACGGAGGTATCC	0.498													75	31	---	---	---	---	PASS
RANBP9	10048	broad.mit.edu	37	6	13711172	13711172	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:13711172T>C	uc003nbb.2	-	1	625	c.566A>G	c.(565-567)TAC>TGC	p.Y189C		NM_005493	NP_005484	Q96S59	RANB9_HUMAN	RAN binding protein 9	189	B30.2/SPRY.				axon guidance|microtubule nucleation|protein complex assembly	cytosol|microtubule associated complex|nucleus	Ran GTPase binding			lung(1)|skin(1)	2	Breast(50;0.00669)|Ovarian(93;0.0634)	all_hematologic(90;0.117)	Epithelial(50;0.223)			AGTACCTTTGTAGTGCACCCG	0.692													10	13	---	---	---	---	PASS
JARID2	3720	broad.mit.edu	37	6	15496958	15496958	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:15496958G>A	uc003nbj.2	+	7	1746	c.1502G>A	c.(1501-1503)CGG>CAG	p.R501Q	JARID2_uc011diu.1_Missense_Mutation_p.R365Q|JARID2_uc011div.1_Missense_Mutation_p.R329Q|JARID2_uc011diw.1_Missense_Mutation_p.R463Q	NM_004973	NP_004964	Q92833	JARD2_HUMAN	jumonji, AT rich interactive domain 2 protein	501					central nervous system development|chromatin modification|negative regulation of histone methylation|positive regulation of histone H3-K9 methylation|stem cell differentiation|transcription, DNA-dependent		chromatin binding			ovary(2)|lung(1)|pancreas(1)	4	Breast(50;0.0142)|Ovarian(93;0.103)	all_hematologic(90;0.00612)				CGGCCGAAGCGGGCCACGGCC	0.642													25	33	---	---	---	---	PASS
CUTA	51596	broad.mit.edu	37	6	33385345	33385345	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33385345G>A	uc003oej.1	-	2	458	c.170C>T	c.(169-171)TCG>TTG	p.S57L	CUTA_uc003oek.1_Missense_Mutation_p.S34L|CUTA_uc003oel.1_Missense_Mutation_p.S34L|CUTA_uc003oem.1_Missense_Mutation_p.S34L|CUTA_uc003oen.1_Missense_Mutation_p.S76L|SYNGAP1_uc003oeo.1_5'Flank|SYNGAP1_uc011dri.1_5'Flank|SYNGAP1_uc010juy.2_5'Flank	NM_001014840	NP_001014840	O60888	CUTA_HUMAN	cutA divalent cation tolerance homolog isoform	57					protein localization|response to metal ion	membrane	enzyme binding				0						GCCGGAATCCGAGGCCGGCGA	0.647													45	150	---	---	---	---	PASS
SRPK1	6732	broad.mit.edu	37	6	35837429	35837429	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35837429C>T	uc003olj.2	-	11	1364	c.1241G>A	c.(1240-1242)TGT>TAT	p.C414Y	SRPK1_uc011dtg.1_Missense_Mutation_p.C398Y|SRPK1_uc003olh.2_Missense_Mutation_p.C307Y|SRPK1_uc003oli.2_Missense_Mutation_p.C307Y	NM_003137	NP_003128	Q96SB4	SRPK1_HUMAN	SFRS protein kinase 1	414	Protein kinase.				cell differentiation|chromosome segregation|interspecies interaction between organisms|intracellular protein kinase cascade|mRNA processing|negative regulation of viral genome replication|positive regulation of viral genome replication|regulation of mRNA processing|RNA splicing	cytoplasm|nucleus	ATP binding|magnesium ion binding|protein binding|protein serine/threonine kinase activity			ovary(1)	1						TATAGGTGTACAAGAGTCTGT	0.418													9	79	---	---	---	---	PASS
BYSL	705	broad.mit.edu	37	6	41899507	41899507	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41899507C>T	uc003orl.2	+	6	1243	c.907C>T	c.(907-909)CGG>TGG	p.R303W		NM_004053	NP_004044	Q13895	BYST_HUMAN	bystin	303					cell adhesion|female pregnancy|ribosome biogenesis	cytoplasm|nucleolus					0	Colorectal(47;0.121)		STAD - Stomach adenocarcinoma(11;0.000204)|Epithelial(12;0.000473)|Colorectal(64;0.00062)|COAD - Colon adenocarcinoma(64;0.00152)			TTGTACCCTCCGGGAAGCCAT	0.552													29	159	---	---	---	---	PASS
HSP90AB1	3326	broad.mit.edu	37	6	44221330	44221330	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44221330G>A	uc003oxa.1	+	12	2254	c.2170G>A	c.(2170-2172)GAT>AAT	p.D724N	HSP90AB1_uc011dvr.1_Missense_Mutation_p.D714N|HSP90AB1_uc003oxb.1_Missense_Mutation_p.D724N|HSP90AB1_uc011dvs.1_Missense_Mutation_p.D544N|HSP90AB1_uc003oxc.1_Missense_Mutation_p.D362N	NM_007355	NP_031381	P08238	HS90B_HUMAN	heat shock 90kDa protein 1, beta	724	TPR repeat-binding.				axon guidance|negative regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of nitric oxide biosynthetic process|protein folding|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|response to unfolded protein	cytosol|melanosome	ATP binding|nitric-oxide synthase regulator activity|TPR domain binding|unfolded protein binding			lung(3)|breast(1)	4	all_cancers(18;1.7e-05)|all_lung(25;0.00747)|Hepatocellular(11;0.00908)|Ovarian(13;0.0273)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)			GGAAGAAGTCGATTAGGTTAG	0.557											OREG0017471	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	29	63	---	---	---	---	PASS
C6orf138	442213	broad.mit.edu	37	6	47847001	47847001	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:47847001G>A	uc011dwm.1	-	3	1613	c.1528C>T	c.(1528-1530)CTA>TTA	p.L510L	C6orf138_uc011dwn.1_Silent_p.L274L	NM_001013732	NP_001013754	Q6ZW05	CF138_HUMAN	hypothetical protein LOC442213	527						integral to membrane	hedgehog receptor activity			central_nervous_system(1)	1						CAGTACTCTAGGGGCTCATAG	0.478													13	20	---	---	---	---	PASS
BAI3	577	broad.mit.edu	37	6	70098745	70098745	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70098745C>A	uc003pev.3	+	32	4979	c.4531C>A	c.(4531-4533)CTG>ATG	p.L1511M	BAI3_uc010kak.2_Missense_Mutation_p.L1511M|BAI3_uc011dxx.1_Missense_Mutation_p.L717M	NM_001704	NP_001695	O60242	BAI3_HUMAN	brain-specific angiogenesis inhibitor 3	1511	Cytoplasmic (Potential).				negative regulation of angiogenesis|neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(27)|ovary(8)|skin(6)|pancreas(4)|central_nervous_system(3)|urinary_tract(1)|breast(1)	50		all_lung(197;0.212)				GAATTTGCCTCTGGATGTGCA	0.418													25	58	---	---	---	---	PASS
COL19A1	1310	broad.mit.edu	37	6	70900022	70900022	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70900022G>A	uc003pfc.1	+	48	3148	c.3031G>A	c.(3031-3033)GAT>AAT	p.D1011N		NM_001858	NP_001849	Q14993	COJA1_HUMAN	alpha 1 type XIX collagen precursor	1011	Triple-helical region 5 (COL5).				cell differentiation|cell-cell adhesion|extracellular matrix organization|skeletal system development	collagen	extracellular matrix structural constituent|protein binding, bridging			ovary(2)|breast(2)	4						TCTTCAGGCTGATGCAGTTTC	0.284													25	87	---	---	---	---	PASS
TTK	7272	broad.mit.edu	37	6	80715595	80715595	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:80715595C>G	uc003pjc.2	+	2	109	c.35C>G	c.(34-36)ACA>AGA	p.T12R	TTK_uc003pjb.3_Missense_Mutation_p.T12R	NM_003318	NP_003309	P33981	TTK_HUMAN	TTK protein kinase	12					mitotic cell cycle spindle assembly checkpoint|mitotic spindle organization|positive regulation of cell proliferation|positive regulation of pathway-restricted SMAD protein phosphorylation	spindle	ATP binding|identical protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(4)|stomach(2)|lung(2)|large_intestine(2)|pancreas(1)	11		all_cancers(76;0.00177)|Acute lymphoblastic leukemia(125;1.24e-05)|all_hematologic(105;0.00223)|all_epithelial(107;0.2)		BRCA - Breast invasive adenocarcinoma(397;0.0321)		AGAGAATTGACAATTGATTCC	0.303													23	96	---	---	---	---	PASS
KIAA1009	22832	broad.mit.edu	37	6	84930778	84930778	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:84930778C>T	uc010kbp.2	-	3	266	c.169G>A	c.(169-171)GAT>AAT	p.D57N	KIAA1009_uc003pkj.3_5'UTR|KIAA1009_uc003pkk.2_Missense_Mutation_p.D57N	NM_014895	NP_055710	Q5TB80	QN1_HUMAN	KIAA1009 protein	57					cell division|mitosis	centrosome|nucleus|plasma membrane|spindle	protein binding			ovary(1)	1		all_cancers(76;1.5e-06)|Acute lymphoblastic leukemia(125;2.69e-07)|all_hematologic(105;0.000151)|all_epithelial(107;0.00258)		BRCA - Breast invasive adenocarcinoma(397;0.089)		CATTTACCATCATCTTTAAAA	0.308													41	111	---	---	---	---	PASS
SPACA1	81833	broad.mit.edu	37	6	88768510	88768510	+	Silent	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:88768510A>G	uc003pmn.2	+	4	561	c.444A>G	c.(442-444)AAA>AAG	p.K148K		NM_030960	NP_112222	Q9HBV2	SACA1_HUMAN	sperm acrosome associated 1 precursor	148	Extracellular (Potential).					integral to membrane					0		all_cancers(76;8.24e-09)|Acute lymphoblastic leukemia(125;2.15e-10)|Prostate(29;4.11e-10)|all_hematologic(105;1.08e-06)|all_epithelial(107;0.00011)		BRCA - Breast invasive adenocarcinoma(108;0.11)		ATCGTTTCAAATATATGTGGA	0.343													11	79	---	---	---	---	PASS
ANKRD6	22881	broad.mit.edu	37	6	90327746	90327746	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90327746C>T	uc003pni.3	+	9	1129	c.788C>T	c.(787-789)CCC>CTC	p.P263L	ANKRD6_uc003pne.3_Missense_Mutation_p.P263L|ANKRD6_uc003pnf.3_Missense_Mutation_p.P263L|ANKRD6_uc011dzy.1_Missense_Mutation_p.P263L|ANKRD6_uc010kcd.2_Intron|LYRM2_uc010kce.1_Intron|LYRM2_uc003png.2_Intron|ANKRD6_uc003pnh.3_5'UTR	NM_014942	NP_055757	Q9Y2G4	ANKR6_HUMAN	ankyrin repeat domain 6	263	ANK 8.						protein binding			ovary(2)|pancreas(1)	3		all_cancers(76;1.22e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.49e-10)|all_hematologic(105;7.79e-07)|all_epithelial(107;1.83e-05)|Lung NSC(302;0.239)		BRCA - Breast invasive adenocarcinoma(108;0.0209)		ACTAAAGCTCCCCAGGTAGGA	0.517													59	84	---	---	---	---	PASS
THEMIS	387357	broad.mit.edu	37	6	128176300	128176300	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:128176300C>A	uc003qbi.2	-	3	444	c.125G>T	c.(124-126)TGT>TTT	p.C42F	THEMIS_uc010kfa.2_5'UTR|THEMIS_uc011ebt.1_Missense_Mutation_p.C42F|THEMIS_uc010kfb.2_Missense_Mutation_p.C7F	NM_001010923	NP_001010923	Q8N1K5	THMS1_HUMAN	thymocyte selection pathway associated isoform	42	CABIT 1.				negative T cell selection|positive T cell selection|T cell receptor signaling pathway	cytoplasm|nucleus				ovary(2)|skin(2)	4						TGTTGAAAAACAGCATTCATT	0.318													15	65	---	---	---	---	PASS
UTRN	7402	broad.mit.edu	37	6	145148815	145148815	+	Intron	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:145148815A>T	uc003qkt.2	+							NM_007124	NP_009055	P46939	UTRO_HUMAN	utrophin						muscle contraction|muscle organ development|positive regulation of cell-matrix adhesion	cell junction|cytoplasm|cytoskeleton|membrane fraction|nucleus|postsynaptic membrane	actin binding|calcium ion binding|zinc ion binding			ovary(4)|pancreas(1)	5		Ovarian(120;0.218)		OV - Ovarian serous cystadenocarcinoma(155;5.72e-07)|GBM - Glioblastoma multiforme(68;4.9e-05)|Colorectal(48;0.213)		GCCACACGGTAAGAAACTTTG	0.348													25	72	---	---	---	---	PASS
MTRF1L	54516	broad.mit.edu	37	6	153316325	153316325	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:153316325C>G	uc003qpi.3	-	3	574	c.469G>C	c.(469-471)GCT>CCT	p.A157P	MTRF1L_uc003qpl.3_Missense_Mutation_p.A157P|MTRF1L_uc011efa.1_Intron|MTRF1L_uc003qpj.3_Missense_Mutation_p.A15P|MTRF1L_uc003qpk.3_Intron	NM_019041	NP_061914	Q9UGC7	RF1ML_HUMAN	mitochondrial translational release factor	157						mitochondrion	translation release factor activity, codon specific				0		Ovarian(120;0.125)		OV - Ovarian serous cystadenocarcinoma(155;4.24e-10)|BRCA - Breast invasive adenocarcinoma(81;0.0888)		TTAAATGCAGCATATTGCTGA	0.353													18	40	---	---	---	---	PASS
IGF2R	3482	broad.mit.edu	37	6	160412337	160412337	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:160412337C>G	uc003qta.2	+	2	419	c.271C>G	c.(271-273)CGC>GGC	p.R91G		NM_000876	NP_000867	P11717	MPRI_HUMAN	insulin-like growth factor 2 receptor precursor	91	1.|Lumenal (Potential).				receptor-mediated endocytosis	cell surface|endocytic vesicle|endosome|integral to plasma membrane|lysosomal membrane|trans-Golgi network transport vesicle	glycoprotein binding|insulin-like growth factor receptor activity|phosphoprotein binding|transporter activity			ovary(3)	3		Breast(66;0.000777)|Ovarian(120;0.0305)		OV - Ovarian serous cystadenocarcinoma(65;2.45e-17)|BRCA - Breast invasive adenocarcinoma(81;1.09e-05)		CTTGAAGACACGCACTTATCA	0.378													43	86	---	---	---	---	PASS
LPA	4018	broad.mit.edu	37	6	160999556	160999556	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:160999556T>A	uc003qtl.2	-	28	4590	c.4470A>T	c.(4468-4470)CAA>CAT	p.Q1490H		NM_005577	NP_005568	P08519	APOA_HUMAN	lipoprotein Lp(a) precursor	3998	Kringle 35.				blood circulation|lipid metabolic process|lipid transport|lipoprotein metabolic process|proteolysis|receptor-mediated endocytosis	plasma lipoprotein particle	apolipoprotein binding|endopeptidase inhibitor activity|fibronectin binding|heparin binding|serine-type endopeptidase activity			ovary(3)|skin(2)|pancreas(1)	6		Breast(66;0.000496)|Ovarian(120;0.0303)|Prostate(117;0.0965)		OV - Ovarian serous cystadenocarcinoma(65;2.5e-17)|BRCA - Breast invasive adenocarcinoma(81;6.48e-06)	Aminocaproic Acid(DB00513)	ATTTCTTACCTTGTTCAGAAG	0.483													29	149	---	---	---	---	PASS
C6orf118	168090	broad.mit.edu	37	6	165715563	165715563	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:165715563G>C	uc003qum.3	-	2	284	c.248C>G	c.(247-249)GCC>GGC	p.A83G	C6orf118_uc011egi.1_RNA	NM_144980	NP_659417	Q5T5N4	CF118_HUMAN	hypothetical protein LOC168090	83											0		Breast(66;6.27e-05)|Ovarian(120;0.0228)|Prostate(117;0.0906)|all_neural(5;0.157)		OV - Ovarian serous cystadenocarcinoma(33;3.23e-18)|BRCA - Breast invasive adenocarcinoma(81;3.11e-06)|GBM - Glioblastoma multiforme(31;0.000313)		GGGCCGGTGGGCATTGGGCCA	0.637													36	88	---	---	---	---	PASS
PRKAR1B	5575	broad.mit.edu	37	7	720311	720311	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:720311G>A	uc003siu.1	-	4	336	c.230C>T	c.(229-231)TCC>TTC	p.S77F	PRKAR1B_uc003siv.2_Missense_Mutation_p.S77F|PRKAR1B_uc003siw.1_Missense_Mutation_p.S77F	NM_002735	NP_002726	P31321	KAP1_HUMAN	protein kinase, cAMP-dependent, regulatory, type	77	Dimerization and phosphorylation.				activation of phospholipase C activity|activation of protein kinase A activity|blood coagulation|cellular response to glucagon stimulus|energy reserve metabolic process|nerve growth factor receptor signaling pathway|protein phosphorylation|regulation of insulin secretion|transmembrane transport|water transport	cAMP-dependent protein kinase complex|cytosol	cAMP binding|cAMP-dependent protein kinase regulator activity				0		Ovarian(82;0.0779)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0181)|Epithelial(4;5.75e-19)|OV - Ovarian serous cystadenocarcinoma(56;2.01e-18)|all cancers(6;3.96e-16)|BRCA - Breast invasive adenocarcinoma(126;0.152)		CTCATCATGGGAGTCCGACTG	0.602													22	109	---	---	---	---	PASS
SDK1	221935	broad.mit.edu	37	7	4009032	4009032	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4009032G>A	uc003smx.2	+	11	1829	c.1690G>A	c.(1690-1692)GCA>ACA	p.A564T		NM_152744	NP_689957	Q7Z5N4	SDK1_HUMAN	sidekick 1 precursor	564	Ig-like C2-type 5.				cell adhesion	integral to membrane				large_intestine(3)|ovary(2)|skin(1)	6		all_cancers(1;0.127)|Ovarian(82;0.0177)|Myeloproliferative disorder(862;0.194)		UCEC - Uterine corpus endometrioid carcinoma (126;0.121)|OV - Ovarian serous cystadenocarcinoma(56;9.65e-15)		CTCCCTGAATGCATCGGCCAC	0.577													78	98	---	---	---	---	PASS
RADIL	55698	broad.mit.edu	37	7	4855864	4855864	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4855864T>C	uc003snj.1	-	8	2134	c.1961A>G	c.(1960-1962)GAC>GGC	p.D654G	RADIL_uc003sng.1_RNA|RADIL_uc003sni.1_Missense_Mutation_p.D159G|RADIL_uc011jwc.1_Missense_Mutation_p.D414G|RADIL_uc011jwd.1_RNA	NM_018059	NP_060529	Q96JH8	RADIL_HUMAN	Rap GTPase interactor	654	Dilute.				cell adhesion|multicellular organismal development|signal transduction		protein binding			lung(2)|central_nervous_system(2)|pancreas(2)|breast(1)	7		Ovarian(82;0.0175)		UCEC - Uterine corpus endometrioid carcinoma (126;0.0986)|OV - Ovarian serous cystadenocarcinoma(56;7.41e-15)		CTCACCCCTGTCGAGGAGCTG	0.667													15	54	---	---	---	---	PASS
PAPOLB	56903	broad.mit.edu	37	7	4901019	4901019	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4901019C>T	uc003snk.2	-	1	607	c.423G>A	c.(421-423)CAG>CAA	p.Q141Q	RADIL_uc003sng.1_Intron|RADIL_uc011jwd.1_Intron|RADIL_uc003snj.1_Intron	NM_020144	NP_064529	Q9NRJ5	PAPOB_HUMAN	poly(A) polymerase beta (testis specific)	140					mRNA processing|RNA polyadenylation|transcription, DNA-dependent	nucleus	ATP binding|metal ion binding|polynucleotide adenylyltransferase activity|RNA binding			ovary(1)	1		Ovarian(82;0.0175)		UCEC - Uterine corpus endometrioid carcinoma (126;0.089)|OV - Ovarian serous cystadenocarcinoma(56;2.06e-14)		TCACTTCCTCCTGTAGTTTCA	0.413													28	40	---	---	---	---	PASS
RADIL	55698	broad.mit.edu	37	7	4917420	4917420	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:4917420G>A	uc003snj.1	-	2	524	c.351C>T	c.(349-351)GGC>GGT	p.G117G	RADIL_uc003sng.1_RNA|RADIL_uc011jwd.1_RNA	NM_018059	NP_060529	Q96JH8	RADIL_HUMAN	Rap GTPase interactor	117	Ras-associating.				cell adhesion|multicellular organismal development|signal transduction		protein binding			lung(2)|central_nervous_system(2)|pancreas(2)|breast(1)	7		Ovarian(82;0.0175)		UCEC - Uterine corpus endometrioid carcinoma (126;0.0986)|OV - Ovarian serous cystadenocarcinoma(56;7.41e-15)		CGCCGGCTTGGCCCACCACGT	0.672													37	68	---	---	---	---	PASS
RELN	5649	broad.mit.edu	37	7	103206771	103206771	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:103206771G>A	uc003vca.2	-	33	4996	c.4836C>T	c.(4834-4836)GGC>GGT	p.G1612G	RELN_uc010liz.2_Silent_p.G1612G	NM_005045	NP_005036	P78509	RELN_HUMAN	reelin isoform a	1612					axon guidance|cell adhesion|cerebral cortex tangential migration|glial cell differentiation|neuron migration|peptidyl-tyrosine phosphorylation|positive regulation of protein kinase activity|positive regulation of small GTPase mediated signal transduction|response to pain|spinal cord patterning	cytoplasm|dendrite|extracellular space|proteinaceous extracellular matrix	metal ion binding|protein serine/threonine/tyrosine kinase activity|serine-type peptidase activity			ovary(8)|upper_aerodigestive_tract(5)|large_intestine(2)|central_nervous_system(2)|skin(1)|pancreas(1)	19				COAD - Colon adenocarcinoma(1;8.98e-05)|Colorectal(1;0.00184)		AATCTATAGAGCCATCAAATT	0.408													60	112	---	---	---	---	PASS
COPG2	26958	broad.mit.edu	37	7	130295938	130295938	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:130295938C>A	uc003vqh.1	-	9	713	c.623G>T	c.(622-624)CGA>CTA	p.R208L		NM_012133	NP_036265	Q9UBF2	COPG2_HUMAN	coatomer protein complex, subunit gamma 2	208					intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat	protein binding|structural molecule activity				0	Melanoma(18;0.0435)					AACAGCAAGTCGATCATTCTT	0.373													9	66	---	---	---	---	PASS
UBN2	254048	broad.mit.edu	37	7	138943252	138943252	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138943252G>T	uc011kqr.1	+	4	682	c.682G>T	c.(682-684)GCT>TCT	p.A228S	UBN2_uc003vuv.2_5'UTR	NM_173569	NP_775840	Q6ZU65	UBN2_HUMAN	ubinuclein 2	228										ovary(1)|skin(1)	2						ATTAGTTCCCGCTTCTCTAAC	0.353													32	102	---	---	---	---	PASS
MGAM	8972	broad.mit.edu	37	7	141765165	141765165	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141765165G>T	uc003vwy.2	+	38	4569	c.4515G>T	c.(4513-4515)GGG>GGT	p.G1505G		NM_004668	NP_004659	O43451	MGA_HUMAN	maltase-glucoamylase	1505	Glucoamylase.|Lumenal (Potential).				polysaccharide digestion|starch catabolic process	apical plasma membrane|integral to membrane	carbohydrate binding|glucan 1,4-alpha-glucosidase activity|maltose alpha-glucosidase activity			ovary(2)	2	Melanoma(164;0.0272)				Acarbose(DB00284)|Miglitol(DB00491)|Voglibose(DB04878)	GACAGCGAGGGGTCGTCATCA	0.592													6	18	---	---	---	---	PASS
MGAM	8972	broad.mit.edu	37	7	141794666	141794666	+	Intron	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141794666A>C	uc003vwy.2	+							NM_004668	NP_004659	O43451	MGA_HUMAN	maltase-glucoamylase						polysaccharide digestion|starch catabolic process	apical plasma membrane|integral to membrane	carbohydrate binding|glucan 1,4-alpha-glucosidase activity|maltose alpha-glucosidase activity			ovary(2)	2	Melanoma(164;0.0272)				Acarbose(DB00284)|Miglitol(DB00491)|Voglibose(DB04878)	GGACCAGGGTAGGACAGTGGC	0.453													15	44	---	---	---	---	PASS
OR2A5	393046	broad.mit.edu	37	7	143747998	143747998	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143747998C>T	uc011ktw.1	+	1	504	c.504C>T	c.(502-504)TTC>TTT	p.F168F		NM_012365	NP_036497	Q96R48	OR2A5_HUMAN	olfactory receptor, family 2, subfamily A,	168	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(3)	3	Melanoma(164;0.0783)					GGCTGCCCTTCTGTGGGCCCC	0.547													96	254	---	---	---	---	PASS
CNTNAP2	26047	broad.mit.edu	37	7	146825877	146825877	+	Silent	SNP	C	A	A	rs142122012		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:146825877C>A	uc003weu.1	+	7	1548	c.1032C>A	c.(1030-1032)GGC>GGA	p.G344G		NM_014141	NP_054860	Q9UHC6	CNTP2_HUMAN	cell recognition molecule Caspr2 precursor	344	Laminin G-like 1.|Extracellular (Potential).				behavior|cell adhesion|clustering of voltage-gated potassium channels|limbic system development|neuron recognition|signal transduction|striatum development|superior temporal gyrus development|thalamus development|transmission of nerve impulse	axolemma|cell body fiber|dendrite|juxtaparanode region of axon|voltage-gated potassium channel complex	receptor binding			ovary(9)|central_nervous_system(1)|pancreas(1)	11	Melanoma(164;0.153)	all_cancers(3;3.51e-10)|all_epithelial(3;1.4e-05)|Myeloproliferative disorder(3;0.00452)|Lung NSC(3;0.0067)|all_lung(3;0.00794)	OV - Ovarian serous cystadenocarcinoma(82;0.0319)			ACTACAATGGCGTCAACATTA	0.413										HNSCC(39;0.1)			89	183	---	---	---	---	PASS
GIMAP4	55303	broad.mit.edu	37	7	150269805	150269805	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150269805A>G	uc003whl.2	+	3	729	c.647A>G	c.(646-648)AAC>AGC	p.N216S	GIMAP4_uc011kuu.1_Missense_Mutation_p.N77S|GIMAP4_uc011kuv.1_Missense_Mutation_p.N230S	NM_018326	NP_060796	Q9NUV9	GIMA4_HUMAN	GTPase, IMAP family member 4	216	Potential.						GTP binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(82;0.0179)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)		GTGAGGGAGAACAAGGAAGGC	0.562													45	112	---	---	---	---	PASS
EPHX2	2053	broad.mit.edu	37	8	27361174	27361174	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:27361174C>T	uc003xfu.2	+	3	321	c.240C>T	c.(238-240)GTC>GTT	p.V80V	EPHX2_uc010lut.1_Silent_p.V80V|EPHX2_uc010luu.2_Silent_p.V80V|EPHX2_uc010luv.2_Silent_p.V14V|EPHX2_uc003xfv.2_Silent_p.V27V|EPHX2_uc010luw.2_Silent_p.V14V|EPHX2_uc011lam.1_5'Flank	NM_001979	NP_001970	P34913	HYES_HUMAN	epoxide hydrolase 2, cytoplasmic	80	Phosphatase.				aromatic compound catabolic process|cellular calcium ion homeostasis|drug metabolic process|inflammatory response|positive regulation of vasodilation|reactive oxygen species metabolic process|regulation of blood pressure|response to toxin|xenobiotic metabolic process	cytosol|focal adhesion|Golgi apparatus|nucleolus|peroxisome|soluble fraction	epoxide hydrolase activity|metal ion binding|protein homodimerization activity			ovary(1)	1		Ovarian(32;2.61e-05)|all_epithelial(46;0.207)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0226)|Epithelial(17;1.12e-09)|Colorectal(74;0.157)	Tamoxifen(DB00675)	CCGCTAAAGTCTGCCTCCCCA	0.438													11	24	---	---	---	---	PASS
KIF13B	23303	broad.mit.edu	37	8	29006249	29006249	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:29006249C>A	uc003xhh.3	-	16	1717	c.1658G>T	c.(1657-1659)CGA>CTA	p.R553L	KIF13B_uc003xhj.2_Missense_Mutation_p.R450L|KIF13B_uc010lvf.1_Missense_Mutation_p.R489L	NM_015254	NP_056069	Q9NQT8	KI13B_HUMAN	kinesin family member 13B	553					microtubule-based movement|protein targeting|signal transduction|T cell activation	cytoplasm|microtubule	ATP binding|microtubule motor activity|protein kinase binding				0		Ovarian(32;0.000536)		KIRC - Kidney renal clear cell carcinoma(542;0.152)|Kidney(114;0.181)		CTCATCCTCTCGTTCTGCTTT	0.398													77	75	---	---	---	---	PASS
WRN	7486	broad.mit.edu	37	8	31015036	31015036	+	Silent	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:31015036C>G	uc003xio.3	+	33	4760	c.3972C>G	c.(3970-3972)CCC>CCG	p.P1324P	WRN_uc010lvk.2_Silent_p.P791P	NM_000553	NP_000544	Q14191	WRN_HUMAN	Werner syndrome protein	1324					base-excision repair|cellular response to starvation|DNA recombination|DNA synthesis involved in DNA repair|multicellular organismal aging|nucleolus to nucleoplasm transport|positive regulation of hydrolase activity|regulation of apoptosis|replication fork processing|response to oxidative stress|response to UV-C|telomere maintenance	centrosome|nucleolus|nucleoplasm	3'-5' exonuclease activity|ATP binding|ATP-dependent 3'-5' DNA helicase activity|bubble DNA binding|four-way junction helicase activity|G-quadruplex DNA binding|magnesium ion binding|manganese ion binding|protein complex binding|protein homodimerization activity|Y-form DNA binding			ovary(2)|kidney(2)|large_intestine(1)|lung(1)|skin(1)	7		Breast(100;0.195)		KIRC - Kidney renal clear cell carcinoma(542;0.147)|Kidney(114;0.176)|Colorectal(111;0.192)		GAAACCCTCCCGTCAACTCAG	0.473			Mis|N|F|S			osteosarcoma|meningioma|others		Genes_defective_in_diseases_associated_with_sensitivity_to_DNA_damaging_agents	Werner_syndrome				21	27	---	---	---	---	PASS
UNC5D	137970	broad.mit.edu	37	8	35542150	35542150	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:35542150T>A	uc003xjr.1	+	6	1130	c.802T>A	c.(802-804)TGT>AGT	p.C268S	UNC5D_uc003xjs.1_Missense_Mutation_p.C263S|UNC5D_uc003xjt.1_Missense_Mutation_p.C37S	NM_080872	NP_543148	Q6UXZ4	UNC5D_HUMAN	unc-5 homolog D precursor	268	TSP type-1 1.|Extracellular (Potential).				apoptosis|axon guidance	integral to membrane	receptor activity			upper_aerodigestive_tract(2)|ovary(2)|pancreas(1)|skin(1)	6				READ - Rectum adenocarcinoma(1;1.31e-05)|Colorectal(1;0.000723)		CAATGTTCGCTGTGGTAGAGG	0.507													70	81	---	---	---	---	PASS
ADAM2	2515	broad.mit.edu	37	8	39602390	39602390	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:39602390G>C	uc003xnj.2	-	20	2272	c.2197C>G	c.(2197-2199)CCT>GCT	p.P733A	ADAM2_uc003xnk.2_Missense_Mutation_p.P714A|ADAM2_uc011lck.1_Missense_Mutation_p.P670A|ADAM2_uc003xnl.2_Missense_Mutation_p.P577A	NM_001464	NP_001455	Q99965	ADAM2_HUMAN	ADAM metallopeptidase domain 2 proprotein	733	Cytoplasmic (Potential).				cell adhesion|fusion of sperm to egg plasma membrane|proteolysis	integral to plasma membrane	integrin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2		all_cancers(7;2.38e-28)|all_epithelial(6;8.85e-21)|all_lung(54;1.24e-07)|Lung NSC(58;1.94e-07)|Hepatocellular(245;0.00745)|Breast(189;0.00908)|Renal(179;0.0183)|Colorectal(162;0.246)	LUSC - Lung squamous cell carcinoma(45;0.000149)	READ - Rectum adenocarcinoma(644;0.0689)|Kidney(114;0.162)		TACCCTTTAGGTTCACTCTCA	0.264													72	466	---	---	---	---	PASS
SLC7A13	157724	broad.mit.edu	37	8	87235224	87235224	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:87235224G>C	uc003ydq.1	-	2	892	c.794C>G	c.(793-795)ACA>AGA	p.T265R	SLC7A13_uc003ydr.1_Missense_Mutation_p.T256R	NM_138817	NP_620172	Q8TCU3	S7A13_HUMAN	solute carrier family 7, (cationic amino acid	265	Extracellular (Potential).					integral to membrane	amino acid transmembrane transporter activity			central_nervous_system(1)	1						TTCCCTGGGTGTCAGAACAGT	0.393													35	76	---	---	---	---	PASS
MTERFD1	51001	broad.mit.edu	37	8	97251914	97251914	+	Intron	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:97251914C>A	uc003yhs.1	-						MTERFD1_uc003yhr.1_Intron|MTERFD1_uc010mbd.1_Intron	NM_015942	NP_057026	Q96E29	MTER1_HUMAN	MTERF domain containing 1 precursor						negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	mitochondrion	transcription regulatory region DNA binding			ovary(1)	1	Breast(36;5.16e-05)					TATTAAATACCTAGAAAAGAA	0.313													14	66	---	---	---	---	PASS
PKHD1L1	93035	broad.mit.edu	37	8	110457007	110457007	+	Missense_Mutation	SNP	G	A	A	rs116863919	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110457007G>A	uc003yne.2	+	38	5013	c.4909G>A	c.(4909-4911)GTC>ATC	p.V1637I		NM_177531	NP_803875	Q86WI1	PKHL1_HUMAN	fibrocystin L precursor	1637	Extracellular (Potential).|IPT/TIG 8.				immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)			CACTTTGACTGTCTACAACCT	0.423										HNSCC(38;0.096)			38	344	---	---	---	---	PASS
ZFAT	57623	broad.mit.edu	37	8	135524758	135524758	+	Silent	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:135524758C>A	uc003yup.2	-	14	3496	c.3321G>T	c.(3319-3321)GCG>GCT	p.A1107A	ZFAT_uc011ljj.1_Silent_p.A226A|ZFAT_uc003yun.2_Silent_p.A1095A|ZFAT_uc003yuo.2_Silent_p.A1095A|ZFAT_uc010meh.2_Intron|ZFAT_uc010mei.2_RNA|ZFAT_uc003yuq.2_Silent_p.A1095A|ZFAT_uc010mej.2_Silent_p.A1045A	NM_020863	NP_065914	Q9P243	ZFAT_HUMAN	zinc finger protein 406 isoform ZFAT-1	1107					regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|nucleus	DNA binding|zinc ion binding			central_nervous_system(1)	1	all_epithelial(106;8.26e-19)|Lung NSC(106;3.47e-07)|all_lung(105;1.39e-06)|Ovarian(258;0.0102)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0432)			GCGCGGCCACCGCTGCCTGTG	0.532													65	339	---	---	---	---	PASS
ZNF623	9831	broad.mit.edu	37	8	144732380	144732380	+	Missense_Mutation	SNP	T	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144732380T>G	uc003yzd.2	+	1	427	c.338T>G	c.(337-339)CTT>CGT	p.L113R	ZNF623_uc011lkp.1_Missense_Mutation_p.L73R|ZNF623_uc003yzc.2_Missense_Mutation_p.L73R	NM_014789	NP_055604	O75123	ZN623_HUMAN	zinc finger protein 623 isoform 1	113					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(97;3.74e-11)|all_epithelial(106;2.62e-09)|Lung NSC(106;0.00013)|all_lung(105;0.000374)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;2.46e-41)|Epithelial(56;5.28e-40)|all cancers(56;5.23e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.146)			CTTCTTCTGCTTCAGAGAGAG	0.473													29	211	---	---	---	---	PASS
SCRIB	23513	broad.mit.edu	37	8	144887289	144887289	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144887289C>A	uc003yzp.1	-	19	2670	c.2663G>T	c.(2662-2664)GGT>GTT	p.G888V	SCRIB_uc003yzn.1_5'Flank|SCRIB_uc003yzo.1_Missense_Mutation_p.G888V	NM_015356	NP_056171	Q14160	SCRIB_HUMAN	scribble isoform b	888	PDZ 2.|Interaction with ARHGEF7.				activation of Rac GTPase activity|apoptosis involved in morphogenesis|cell migration|cell proliferation|cell-cell adhesion|establishment of apical/basal cell polarity|interspecies interaction between organisms|mammary gland duct morphogenesis|negative regulation of mitotic cell cycle|positive chemotaxis|positive regulation of apoptosis|positive regulation of receptor recycling|protein localization to adherens junction	cell-cell adherens junction|Scrib-APC-beta-catenin complex	protein binding			urinary_tract(1)|ovary(1)|kidney(1)|central_nervous_system(1)|pancreas(1)	5	all_cancers(97;2.31e-11)|all_epithelial(106;1.58e-09)|Lung NSC(106;0.00013)|all_lung(105;0.000374)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;2.46e-41)|Epithelial(56;1.23e-39)|all cancers(56;1.12e-34)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.18)			CACCGCATCACCAGCCCTGTA	0.711													10	26	---	---	---	---	PASS
C8orf33	65265	broad.mit.edu	37	8	146278499	146278499	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:146278499G>A	uc003zfc.3	+	3	424	c.370G>A	c.(370-372)GGC>AGC	p.G124S	C8orf33_uc003zfd.2_RNA	NM_023080	NP_075568	Q9H7E9	CH033_HUMAN	hypothetical protein LOC65265	124											0	all_cancers(97;8.72e-12)|all_epithelial(106;1.07e-10)|Lung NSC(106;7.18e-05)|all_lung(105;0.00021)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		Epithelial(56;9.1e-38)|all cancers(56;7.37e-33)|BRCA - Breast invasive adenocarcinoma(115;0.0424)|Colorectal(110;0.055)	GBM - Glioblastoma multiforme(99;0.243)		ACTGGAGCTGGGCCTCAAGAG	0.572													22	84	---	---	---	---	PASS
RGP1	9827	broad.mit.edu	37	9	35752037	35752037	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35752037C>T	uc011lpf.1	+	8	988	c.847C>T	c.(847-849)CAT>TAT	p.H283Y	GBA2_uc003zxw.2_5'Flank|GBA2_uc011lpc.1_5'Flank|GBA2_uc011lpd.1_5'Flank|RGP1_uc011lpe.1_Missense_Mutation_p.H323Y	NM_001080496	NP_001073965	Q92546	RGP1_HUMAN	RGP1 retrograde golgi transport homolog	283										ovary(1)	1	all_epithelial(49;0.167)		Lung(28;0.00416)|LUSC - Lung squamous cell carcinoma(32;0.00418)|STAD - Stomach adenocarcinoma(86;0.194)			CTCTGTGTCACATGTGACTCA	0.587													19	19	---	---	---	---	PASS
PGM5	5239	broad.mit.edu	37	9	71094442	71094442	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:71094442C>T	uc004agr.2	+	8	1497	c.1268C>T	c.(1267-1269)GCC>GTC	p.A423V		NM_021965	NP_068800	Q15124	PGM5_HUMAN	phosphoglucomutase 5	423					cell adhesion|cellular calcium ion homeostasis|glucose metabolic process	costamere|dystrophin-associated glycoprotein complex|focal adhesion|intercalated disc|internal side of plasma membrane|sarcolemma|spot adherens junction|stress fiber|Z disc	intramolecular transferase activity, phosphotransferases|magnesium ion binding|structural molecule activity			ovary(1)|pancreas(1)	2						GATCACTGGGCCAAATTTGGC	0.527													44	72	---	---	---	---	PASS
NAA35	60560	broad.mit.edu	37	9	88633621	88633621	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:88633621C>G	uc004aoi.3	+	21	2059	c.1922C>G	c.(1921-1923)TCT>TGT	p.S641C	NAA35_uc004aoj.3_Missense_Mutation_p.S641C	NM_024635	NP_078911	Q5VZE5	NAA35_HUMAN	corneal wound healing-related protein	641					smooth muscle cell proliferation	cytoplasm|nucleus|plasma membrane				skin(2)|central_nervous_system(1)	3						TAGGAAATGTCTGACCTCAAT	0.328													46	158	---	---	---	---	PASS
ITGA8	8516	broad.mit.edu	37	10	15648376	15648376	+	Missense_Mutation	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:15648376A>C	uc001ioc.1	-	18	1810	c.1810T>G	c.(1810-1812)TTG>GTG	p.L604V	ITGA8_uc010qcb.1_Missense_Mutation_p.L589V	NM_003638	NP_003629	P53708	ITA8_HUMAN	integrin, alpha 8 precursor	604	Extracellular (Potential).				cell differentiation|cell-cell adhesion|cell-matrix adhesion|integrin-mediated signaling pathway|nervous system development	integrin complex	receptor activity			ovary(3)|lung(3)	6						CTGTAATTCAAACTAATGTTG	0.363													34	68	---	---	---	---	PASS
GPR158	57512	broad.mit.edu	37	10	25886839	25886839	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:25886839C>A	uc001isj.2	+	11	2344	c.2284C>A	c.(2284-2286)CCA>ACA	p.P762T	GPR158_uc001isk.2_Missense_Mutation_p.P137T	NM_020752	NP_065803	Q5T848	GP158_HUMAN	G protein-coupled receptor 158 precursor	762	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(4)|large_intestine(2)|pancreas(1)|skin(1)	8						TACGGAGATCCCAGAGACAGT	0.547													89	115	---	---	---	---	PASS
ZNF33B	7582	broad.mit.edu	37	10	43090054	43090054	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:43090054G>A	uc001jaf.1	-	5	459	c.344C>T	c.(343-345)ACT>ATT	p.T115I	ZNF33B_uc009xmg.1_Missense_Mutation_p.T115I|ZNF33B_uc001jae.1_RNA|ZNF33B_uc001jag.1_Missense_Mutation_p.T3I|ZNF33B_uc001jad.2_RNA	NM_006955	NP_008886	Q06732	ZN33B_HUMAN	zinc finger protein 33B	115						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0						TTGTTCCTTAGTCAGCATTTC	0.368													45	88	---	---	---	---	PASS
TMEM72	643236	broad.mit.edu	37	10	45430567	45430567	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:45430567C>T	uc001jbn.2	+	5	1010	c.813C>T	c.(811-813)GCC>GCT	p.A271A	uc001jbk.1_Intron|uc001jbl.2_Intron|TMEM72_uc009xmm.1_Silent_p.A153A	NM_001123376	NP_001116848	A0PK05	TMM72_HUMAN	transmembrane protein 72	271						integral to membrane					0						CTCTTACAGCCACCGGCCTGT	0.602													18	37	---	---	---	---	PASS
ERCC6	2074	broad.mit.edu	37	10	50732520	50732520	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:50732520C>G	uc001jhs.3	-	5	1110	c.956G>C	c.(955-957)AGA>ACA	p.R319T	PGBD3_uc001jht.2_5'Flank|PGBD3_uc009xoe.2_Missense_Mutation_p.R319T|PGBD3_uc001jhu.2_Missense_Mutation_p.R319T	NM_000124	NP_000115	Q03468	ERCC6_HUMAN	excision repair cross-complementing rodent	319					base-excision repair|positive regulation of transcription elongation, DNA-dependent|transcription from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair	nucleolus|soluble fraction|transcription elongation factor complex	ATP binding|chromatin binding|DNA binding|DNA-dependent ATPase activity|helicase activity|protein C-terminus binding|protein complex binding|protein N-terminus binding			lung(5)|breast(5)|ovary(3)|large_intestine(2)|skin(1)	16						GGACAGAACTCTGGCTTTCTT	0.463								Direct_reversal_of_damage|NER					40	186	---	---	---	---	PASS
DKK1	22943	broad.mit.edu	37	10	54074381	54074381	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:54074381G>T	uc001jjr.2	+	1	341	c.187G>T	c.(187-189)GCG>TCG	p.A63S	uc001jjq.1_5'Flank|uc009xox.1_5'Flank	NM_012242	NP_036374	O94907	DKK1_HUMAN	dickkopf homolog 1 precursor	63					negative regulation of peptidyl-serine phosphorylation|negative regulation of protein complex assembly|negative regulation of transcription from RNA polymerase II promoter|positive regulation of heart induction by negative regulation of canonical Wnt receptor signaling pathway|regulation of receptor internalization	extracellular space|plasma membrane	growth factor activity|low-density lipoprotein particle receptor binding|receptor antagonist activity|signal transducer activity			ovary(1)|lung(1)|kidney(1)	3						AGTCAGCGCCGCGCCGGGAAT	0.622											OREG0020191	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	9	56	---	---	---	---	PASS
ADO	84890	broad.mit.edu	37	10	64565180	64565180	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64565180C>T	uc001jmg.2	+	1	665	c.361C>T	c.(361-363)CTC>TTC	p.L121F		NM_032804	NP_116193	Q96SZ5	AEDO_HUMAN	2-aminoethanethiol (cysteamine) dioxygenase	121							cysteamine dioxygenase activity|metal ion binding				0	Prostate(12;0.0297)|all_hematologic(501;0.228)					GCACGGCATGCTCAAGGTGCT	0.672													6	7	---	---	---	---	PASS
LRRTM3	347731	broad.mit.edu	37	10	68686994	68686994	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:68686994G>T	uc001jmz.1	+	2	870	c.320G>T	c.(319-321)GGA>GTA	p.G107V	CTNNA3_uc009xpn.1_Intron|CTNNA3_uc001jmw.2_Intron|CTNNA3_uc001jmx.3_Intron|CTNNA3_uc009xpo.1_Intron|LRRTM3_uc001jmy.2_Missense_Mutation_p.G107V	NM_178011	NP_821079	Q86VH5	LRRT3_HUMAN	leucine rich repeat transmembrane neuronal 3	107	Extracellular (Potential).|LRR 2.					integral to membrane				upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3						GCTTTTAATGGAATACGCAGA	0.363													96	141	---	---	---	---	PASS
GHITM	27069	broad.mit.edu	37	10	85901279	85901279	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:85901279G>T	uc001kcs.1	+	2	227	c.23G>T	c.(22-24)TGT>TTT	p.C8F	GHITM_uc010qma.1_5'UTR|GHITM_uc010qmb.1_5'Flank	NM_014394	NP_055209	Q9H3K2	GHITM_HUMAN	growth hormone inducible transmembrane protein	8					apoptosis	integral to membrane|mitochondrial inner membrane					0						AGGCTGGTGTGTCTCCGGACA	0.468													32	115	---	---	---	---	PASS
MYOF	26509	broad.mit.edu	37	10	95134510	95134510	+	Intron	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:95134510A>G	uc001kin.2	-						MYOF_uc001kio.2_Intron|MYOF_uc009xue.2_Intron	NM_013451	NP_038479	Q9NZM1	MYOF_HUMAN	myoferlin isoform a						blood circulation|muscle contraction|plasma membrane repair	caveola|cytoplasmic vesicle membrane|integral to membrane|nuclear membrane	phospholipid binding|protein binding			ovary(3)|breast(1)	4						GTGTAGTTTAAAAGTCCTACC	0.433													29	43	---	---	---	---	PASS
CYP2C19	1557	broad.mit.edu	37	10	96602608	96602608	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96602608G>C	uc010qnz.1	+	7	976	c.976G>C	c.(976-978)GAG>CAG	p.E326Q	CYP2C19_uc010qny.1_Missense_Mutation_p.E304Q	NM_000769	NP_000760	P33261	CP2CJ_HUMAN	cytochrome P450, family 2, subfamily C,	326					exogenous drug catabolic process|heterocycle metabolic process|monoterpenoid metabolic process|steroid metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	(S)-limonene 6-monooxygenase activity|(S)-limonene 7-monooxygenase activity|4-hydroxyacetophenone monooxygenase activity|electron carrier activity|enzyme binding|heme binding|oxygen binding|steroid hydroxylase activity			ovary(4)|central_nervous_system(1)|skin(1)	6		Colorectal(252;0.09)		all cancers(201;6.02e-07)|KIRC - Kidney renal clear cell carcinoma(50;0.0672)|Kidney(138;0.0838)	Adinazolam(DB00546)|Aminophenazone(DB01424)|Amitriptyline(DB00321)|Amoxicillin(DB01060)|Arformoterol(DB01274)|Bortezomib(DB00188)|Carisoprodol(DB00395)|Chlorzoxazone(DB00356)|Cilostazol(DB01166)|Citalopram(DB00215)|Clarithromycin(DB01211)|Clobazam(DB00349)|Desipramine(DB01151)|Desloratadine(DB00967)|Diclofenac(DB00586)|Diltiazem(DB00343)|Efavirenz(DB00625)|Esomeprazole(DB00736)|Famotidine(DB00927)|Felbamate(DB00949)|Finasteride(DB01216)|Flunitrazepam(DB01544)|Fluvoxamine(DB00176)|Formoterol(DB00983)|Fosphenytoin(DB01320)|Guanfacine(DB01018)|Imipramine(DB00458)|Indomethacin(DB00328)|Ketoconazole(DB01026)|Lansoprazole(DB00448)|Lapatinib(DB01259)|Loratadine(DB00455)|Melatonin(DB01065)|Mephenytoin(DB00532)|Methadone(DB00333)|Methylphenobarbital(DB00849)|Moclobemide(DB01171)|Modafinil(DB00745)|Nelfinavir(DB00220)|Nicardipine(DB00622)|Nilutamide(DB00665)|Norgestrel(DB00506)|Omeprazole(DB00338)|Oxcarbazepine(DB00776)|Pantoprazole(DB00213)|Pentamidine(DB00738)|Phenobarbital(DB01174)|Phenytoin(DB00252)|Primidone(DB00794)|Progesterone(DB00396)|Proguanil(DB01131)|Promazine(DB00420)|Quinidine(DB00908)|Rabeprazole(DB01129)|Ranitidine(DB00863)|Ritonavir(DB00503)|Selegiline(DB01037)|Sertraline(DB01104)|Temazepam(DB00231)|Teniposide(DB00444)|Terfenadine(DB00342)|Thalidomide(DB01041)|Thioridazine(DB00679)|Ticlopidine(DB00208)|Tolbutamide(DB01124)|Topiramate(DB00273)|Tranylcypromine(DB00752)|Troglitazone(DB00197)|Troleandomycin(DB01361)|Voriconazole(DB00582)	AGTCCAGGAAGAGATTGAACG	0.483													56	98	---	---	---	---	PASS
PPRC1	23082	broad.mit.edu	37	10	103898671	103898671	+	Silent	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:103898671A>G	uc001kum.2	+	4	564	c.525A>G	c.(523-525)CCA>CCG	p.P175P	PPRC1_uc001kun.2_Silent_p.P55P|PPRC1_uc010qqj.1_Silent_p.P175P|PPRC1_uc009xxa.2_5'Flank	NM_015062	NP_055877	Q5VV67	PPRC1_HUMAN	peroxisome proliferator-activated receptor	175					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	nucleotide binding|RNA binding			ovary(1)|central_nervous_system(1)|skin(1)	3		Colorectal(252;0.122)		Epithelial(162;4.97e-08)|all cancers(201;8.99e-07)		GGACACCCCCAGAACGTGACC	0.542													17	65	---	---	---	---	PASS
TRIM8	81603	broad.mit.edu	37	10	104404661	104404661	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:104404661G>A	uc001kvz.2	+	1	410	c.287G>A	c.(286-288)CGC>CAC	p.R96H		NM_030912	NP_112174	Q9BZR9	TRIM8_HUMAN	tripartite motif-containing 8	96	B box-type 1.					cytoplasm|PML body	ligase activity|protein homodimerization activity|zinc ion binding			ovary(1)	1		Colorectal(252;0.122)		Epithelial(162;3.93e-09)|all cancers(201;1.02e-07)|BRCA - Breast invasive adenocarcinoma(275;0.215)		GTGTTCTGCCGCCGCGGCCCC	0.701													3	2	---	---	---	---	PASS
C10orf120	399814	broad.mit.edu	37	10	124457280	124457280	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124457280C>A	uc001lgn.2	-	3	1009	c.977G>T	c.(976-978)CGC>CTC	p.R326L		NM_001010912	NP_001010912	Q5SQS8	CJ120_HUMAN	hypothetical protein LOC399814	326										kidney(1)	1		all_neural(114;0.169)|Glioma(114;0.222)				TTTACGCATGCGCTCTTTCCA	0.438													49	102	---	---	---	---	PASS
OR51A4	401666	broad.mit.edu	37	11	4968319	4968319	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4968319G>T	uc010qys.1	-	1	12	c.12C>A	c.(10-12)ATC>ATA	p.I4I		NM_001005329	NP_001005329	Q8NGJ6	O51A4_HUMAN	olfactory receptor, family 51, subfamily A,	4	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|skin(1)	3		Medulloblastoma(188;0.0075)|all_neural(188;0.0577)|Breast(177;0.086)		Epithelial(150;3.22e-11)|BRCA - Breast invasive adenocarcinoma(625;0.0284)|LUSC - Lung squamous cell carcinoma(625;0.19)		ATGATGTGTTGATAATGGACA	0.383													37	39	---	---	---	---	PASS
OR52A5	390054	broad.mit.edu	37	11	5153430	5153430	+	Missense_Mutation	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5153430A>C	uc010qyx.1	-	1	443	c.443T>G	c.(442-444)CTT>CGT	p.L148R		NM_001005160	NP_001005160	Q9H2C5	O52A5_HUMAN	olfactory receptor, family 52, subfamily A,	148	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|lung(1)|central_nervous_system(1)	4		Medulloblastoma(188;0.0049)|all_neural(188;0.0442)|Breast(177;0.0675)		Epithelial(150;1.74e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)|LUSC - Lung squamous cell carcinoma(625;0.2)		TGTCACCCCAAGTCCAATATG	0.473													12	60	---	---	---	---	PASS
OR56A4	120793	broad.mit.edu	37	11	6023986	6023986	+	Silent	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6023986G>C	uc010qzv.1	-	1	393	c.393C>G	c.(391-393)ACC>ACG	p.T131T		NM_001005179	NP_001005179	Q8NGH8	O56A4_HUMAN	olfactory receptor, family 56, subfamily A,	79	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			central_nervous_system(1)|skin(1)	2		Medulloblastoma(188;0.00776)|all_neural(188;0.0652)|Breast(177;0.114)		Epithelial(150;7.01e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)		TGGGGATGACGGTGAGGCAGA	0.572													34	46	---	---	---	---	PASS
ST5	6764	broad.mit.edu	37	11	8751741	8751741	+	Nonsense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:8751741C>A	uc001mgt.2	-	3	1282	c.1096G>T	c.(1096-1098)GGA>TGA	p.G366*	ST5_uc009yfr.2_Intron|ST5_uc001mgu.2_Intron|ST5_uc001mgv.2_Nonsense_Mutation_p.G366*|ST5_uc010rbq.1_Intron|ST5_uc001mgw.1_Nonsense_Mutation_p.G366*	NM_213618	NP_998783	P78524	ST5_HUMAN	suppression of tumorigenicity 5 isoform 1	366	Pro-rich.				positive regulation of ERK1 and ERK2 cascade		protein binding			upper_aerodigestive_tract(1)	1				Epithelial(150;2.63e-07)|BRCA - Breast invasive adenocarcinoma(625;0.0352)		GGGCTATTTCCAGGGGTCCCG	0.652													44	56	---	---	---	---	PASS
KIF18A	81930	broad.mit.edu	37	11	28080680	28080680	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:28080680T>C	uc001msc.2	-	13	1923	c.1741A>G	c.(1741-1743)AGA>GGA	p.R581G		NM_031217	NP_112494	Q8NI77	KI18A_HUMAN	kinesin family member 18A	581					blood coagulation|microtubule depolymerization|microtubule-based movement|mitotic metaphase plate congression|mitotic prometaphase|protein transport	caveola|cytosol|kinetochore microtubule|microtubule organizing center|nucleus|ruffle	actin binding|ATP binding|microtubule plus-end binding|plus-end-directed microtubule motor activity|tubulin-dependent ATPase activity|ubiquitin binding			ovary(2)	2						TATTGTTTTCTTAGGGTTGGA	0.328													92	185	---	---	---	---	PASS
KCNA4	3739	broad.mit.edu	37	11	30033239	30033239	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:30033239C>A	uc001msk.2	-	2	2139	c.987G>T	c.(985-987)TTG>TTT	p.L329F		NM_002233	NP_002224	P22459	KCNA4_HUMAN	potassium voltage-gated channel, shaker-related	329						voltage-gated potassium channel complex	potassium ion binding|protein binding|voltage-gated potassium channel activity			ovary(2)|central_nervous_system(1)|pancreas(1)	4						TAAACTCAGGCAAGGTTTCCA	0.512													63	129	---	---	---	---	PASS
C1QTNF4	114900	broad.mit.edu	37	11	47612180	47612180	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47612180G>T	uc001ngc.2	-	2	450	c.183C>A	c.(181-183)TTC>TTA	p.F61L		NM_031909	NP_114115	Q9BXJ3	C1QT4_HUMAN	C1q and tumor necrosis factor related protein 4	61	C1q 1.					extracellular region					0						TGGCCACATCGAAGTCGCCCC	0.672													8	19	---	---	---	---	PASS
OR4A5	81318	broad.mit.edu	37	11	51412301	51412301	+	Missense_Mutation	SNP	G	T	T	rs150350902		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:51412301G>T	uc001nhi.1	-	1	95	c.95C>A	c.(94-96)ACA>AAA	p.T32K		NM_001005272	NP_001005272	Q8NH83	OR4A5_HUMAN	olfactory receptor, family 4, subfamily A,	32	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3		all_lung(304;0.236)				CACCAAGTATGTGAGTAAAAA	0.433													16	56	---	---	---	---	PASS
OR4A15	81328	broad.mit.edu	37	11	55135858	55135858	+	Silent	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55135858C>A	uc010rif.1	+	1	499	c.499C>A	c.(499-501)CGA>AGA	p.R167R		NM_001005275	NP_001005275	Q8NGL6	O4A15_HUMAN	olfactory receptor, family 4, subfamily A,	167	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2						CATGAATCGTCGAGTCTGTGT	0.438													77	241	---	---	---	---	PASS
OR5D13	390142	broad.mit.edu	37	11	55541616	55541616	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55541616G>T	uc010ril.1	+	1	703	c.703G>T	c.(703-705)GGG>TGG	p.G235W		NM_001001967	NP_001001967	Q8NGL4	OR5DD_HUMAN	olfactory receptor, family 5, subfamily D,	235	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3		all_epithelial(135;0.196)				ATCTGCAAGTGGGCGCCAGAA	0.408													53	82	---	---	---	---	PASS
OR8H3	390152	broad.mit.edu	37	11	55889844	55889844	+	5'Flank	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55889844T>A	uc001nii.1	+							NM_001005201	NP_001005201	Q8N146	OR8H3_HUMAN	olfactory receptor, family 8, subfamily H,						sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00693)					TTAGAGCAGGTGAACATGATG	0.289													53	75	---	---	---	---	PASS
OR8H3	390152	broad.mit.edu	37	11	55890035	55890035	+	Missense_Mutation	SNP	T	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55890035T>G	uc001nii.1	+	1	187	c.187T>G	c.(187-189)TTC>GTC	p.F63V		NM_001005201	NP_001005201	Q8N146	OR8H3_HUMAN	olfactory receptor, family 8, subfamily H,	63	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00693)					CATGTATTTTTTCCTTACTCA	0.423													36	459	---	---	---	---	PASS
OR5M11	219487	broad.mit.edu	37	11	56310580	56310580	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56310580C>A	uc010rjl.1	-	1	154	c.154G>T	c.(154-156)GAC>TAC	p.D52Y		NM_001005245	NP_001005245	Q96RB7	OR5MB_HUMAN	olfactory receptor, family 5, subfamily M,	52	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						AGGCGAGAGTCCAGTCTCATT	0.468													54	149	---	---	---	---	PASS
OR5AP2	338675	broad.mit.edu	37	11	56409179	56409179	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56409179G>T	uc001njb.1	-	1	737	c.737C>A	c.(736-738)ACC>AAC	p.T246N		NM_001002925	NP_001002925	Q8NGF4	O5AP2_HUMAN	olfactory receptor, family 5, subfamily AP,	246	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|kidney(1)|central_nervous_system(1)|skin(1)	4						AGAGGCACAGGTGGAGAAGGC	0.468													40	122	---	---	---	---	PASS
OR1S2	219958	broad.mit.edu	37	11	57971013	57971013	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57971013A>G	uc010rkb.1	-	1	641	c.641T>C	c.(640-642)ATT>ACT	p.I214T		NM_001004459	NP_001004459	Q8NGQ3	OR1S2_HUMAN	olfactory receptor, family 1, subfamily S,	214	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(21;0.0589)				TAAACCCACAATAAACAACAC	0.448													30	77	---	---	---	---	PASS
OR5A2	219981	broad.mit.edu	37	11	59190101	59190101	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:59190101C>A	uc010rkt.1	-	1	326	c.326G>T	c.(325-327)GGG>GTG	p.G109V		NM_001001954	NP_001001954	Q8NGI9	OR5A2_HUMAN	olfactory receptor, family 5, subfamily A,	109	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						TTCAGTCAGCCCCATCCCACA	0.498													37	48	---	---	---	---	PASS
LRP5	4041	broad.mit.edu	37	11	68204451	68204451	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68204451C>T	uc001ont.2	+	19	4170	c.4095C>T	c.(4093-4095)TCC>TCT	p.S1365S	LRP5_uc009ysg.2_Silent_p.S775S	NM_002335	NP_002326	O75197	LRP5_HUMAN	low density lipoprotein receptor-related protein	1365	LDL-receptor class A 3.|Extracellular (Potential).				adipose tissue development|bone marrow development|bone morphogenesis|canonical Wnt receptor signaling pathway|cholesterol homeostasis|endocytosis|glucose catabolic process|negative regulation of osteoblast differentiation|negative regulation of protein serine/threonine kinase activity|positive regulation of fat cell differentiation|positive regulation of mesenchymal cell proliferation|positive regulation of mitosis|positive regulation of transcription from RNA polymerase II promoter|regulation of blood pressure|regulation of canonical Wnt receptor signaling pathway|retina morphogenesis in camera-type eye|retinal blood vessel morphogenesis|Wnt receptor signaling pathway involved in dorsal/ventral axis specification	endoplasmic reticulum|integral to membrane|plasma membrane|receptor complex	protein binding|receptor activity			lung(2)|skin(2)|ovary(1)|pancreas(1)|breast(1)	7						TCGACGGCTCCGACGAGCTCA	0.627													12	84	---	---	---	---	PASS
KRTAP5-8	57830	broad.mit.edu	37	11	71249616	71249616	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:71249616G>T	uc001oqr.1	+	1	546	c.515G>T	c.(514-516)TGT>TTT	p.C172F		NM_021046	NP_066384	O75690	KRA58_HUMAN	keratin associated protein 5-8	172	9 X 4 AA repeats of C-C-X-P.					extracellular region|keratin filament	structural constituent of epidermis				0						AAGCCCTGCTGTTCCCAGTCC	0.587													72	144	---	---	---	---	PASS
FAT3	120114	broad.mit.edu	37	11	92257851	92257851	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92257851G>C	uc001pdj.3	+	2	3361	c.3344G>C	c.(3343-3345)TGG>TCG	p.W1115S		NM_001008781	NP_001008781	Q8TDW7	FAT3_HUMAN	FAT tumor suppressor homolog 3	1115	Cadherin 10.|Extracellular (Potential).				homophilic cell adhesion|multicellular organismal development	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|pancreas(1)	5		Acute lymphoblastic leukemia(157;3.01e-05)|all_hematologic(158;0.00858)				GGGTCATACTGGCTAACAGTG	0.483										TCGA Ovarian(4;0.039)			8	67	---	---	---	---	PASS
MTNR1B	4544	broad.mit.edu	37	11	92715453	92715453	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:92715453T>A	uc001pdk.1	+	2	1167	c.1064T>A	c.(1063-1065)GTG>GAG	p.V355E		NM_005959	NP_005950	P49286	MTR1B_HUMAN	melatonin receptor 1B	355	Cytoplasmic (Potential).				G-protein signaling, coupled to cyclic nucleotide second messenger|glucose homeostasis|regulation of insulin secretion|synaptic transmission	integral to plasma membrane	melatonin receptor activity			ovary(1)|central_nervous_system(1)	2		Acute lymphoblastic leukemia(157;2.31e-05)|all_hematologic(158;0.00824)			Ramelteon(DB00980)	ATCATTGGTGTGCAGCACCAG	0.582													22	45	---	---	---	---	PASS
MED17	9440	broad.mit.edu	37	11	93529669	93529669	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:93529669A>G	uc001pem.3	+	7	1381	c.1106A>G	c.(1105-1107)TAT>TGT	p.Y369C		NM_004268	NP_004259	Q9NVC6	MED17_HUMAN	mediator complex subunit 17	369					androgen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex|transcription factor complex	ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			ovary(1)	1		Acute lymphoblastic leukemia(157;2.31e-05)|all_hematologic(158;0.00824)				GACCACCTTTATGTCCTAGAG	0.393													40	154	---	---	---	---	PASS
NCAM1	4684	broad.mit.edu	37	11	113102895	113102895	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113102895C>G	uc009yyq.1	+	12	1662	c.968C>G	c.(967-969)GCC>GGC	p.A323G		NM_001076682	NP_001070150	P13591	NCAM1_HUMAN	neural cell adhesion molecule 1 isoform 3	415	Extracellular (Potential).				axon guidance|interferon-gamma-mediated signaling pathway	anchored to membrane|extracellular region|Golgi membrane|integral to membrane				ovary(1)	1		all_cancers(61;5.82e-19)|all_epithelial(67;6.87e-12)|Melanoma(852;1.99e-05)|all_hematologic(158;3.66e-05)|Acute lymphoblastic leukemia(157;0.00119)|Breast(348;0.0109)|all_neural(223;0.0299)|Medulloblastoma(222;0.0458)|Renal(330;0.198)|Prostate(24;0.207)		BRCA - Breast invasive adenocarcinoma(274;1.78e-05)|Epithelial(105;0.000114)|all cancers(92;0.000467)|OV - Ovarian serous cystadenocarcinoma(223;0.212)		ATTGCAGATGCCCCAAAGCTA	0.532													11	29	---	---	---	---	PASS
ZBTB16	7704	broad.mit.edu	37	11	113934218	113934218	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113934218A>G	uc001pop.2	+	2	460	c.196A>G	c.(196-198)AAT>GAT	p.N66D	ZBTB16_uc001poo.1_Missense_Mutation_p.N66D|ZBTB16_uc001poq.2_Missense_Mutation_p.N66D	NM_006006	NP_005997	Q05516	ZBT16_HUMAN	promyelocytic leukemia zinc finger protein	66	BTB.				apoptosis|central nervous system development|mesonephros development|myeloid cell differentiation|negative regulation of myeloid cell differentiation|negative regulation of transcription, DNA-dependent	nuclear speck|PML body|transcriptional repressor complex	protein homodimerization activity|zinc ion binding			central_nervous_system(1)|skin(1)	2		all_cancers(61;3.79e-18)|all_epithelial(67;2.32e-10)|all_hematologic(158;2.96e-05)|Melanoma(852;0.000362)|Acute lymphoblastic leukemia(157;0.00108)|Breast(348;0.0104)|all_neural(223;0.0294)|Prostate(24;0.0318)|Medulloblastoma(222;0.0438)		BRCA - Breast invasive adenocarcinoma(274;6.75e-06)|Epithelial(105;0.000181)|all cancers(92;0.0018)		CTTCCACCGCAATAGTCAACA	0.542													23	56	---	---	---	---	PASS
OR4D5	219875	broad.mit.edu	37	11	123810646	123810646	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123810646G>A	uc001pzk.1	+	1	323	c.323G>A	c.(322-324)GGA>GAA	p.G108E		NM_001001965	NP_001001965	Q8NGN0	OR4D5_HUMAN	olfactory receptor, family 4, subfamily D,	108	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0399)		CACTTCATTGGAGGCATCAAG	0.498													32	106	---	---	---	---	PASS
OR8B2	26595	broad.mit.edu	37	11	124252379	124252379	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124252379G>A	uc010sai.1	-	1	861	c.861C>T	c.(859-861)CTC>CTT	p.L287L		NM_001005468	NP_001005468	Q96RD0	OR8B2_HUMAN	olfactory receptor, family 8, subfamily B,	287	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0		Breast(109;0.0115)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;1.49e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0277)		AACTGTAGATGAGGGGATTGA	0.378													78	126	---	---	---	---	PASS
ROBO3	64221	broad.mit.edu	37	11	124749437	124749437	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:124749437G>T	uc001qbc.2	+	25	3954	c.3762G>T	c.(3760-3762)AAG>AAT	p.K1254N	ROBO3_uc001qbd.2_Missense_Mutation_p.K179N|ROBO3_uc010sar.1_Missense_Mutation_p.K303N|ROBO3_uc001qbe.2_Missense_Mutation_p.K179N|ROBO3_uc001qbf.1_Missense_Mutation_p.K138N	NM_022370	NP_071765	Q96MS0	ROBO3_HUMAN	roundabout, axon guidance receptor, homolog 3	1254	Cytoplasmic (Potential).				axon midline choice point recognition	integral to membrane	receptor activity			breast(1)|central_nervous_system(1)	2	all_hematologic(175;0.215)	Lung NSC(97;0.0177)|all_lung(97;0.0179)|Medulloblastoma(222;0.0425)|Breast(109;0.0481)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.5e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0296)		AGAAACCCAAGGCTCTTCCCT	0.602													18	25	---	---	---	---	PASS
ST3GAL4	6484	broad.mit.edu	37	11	126278334	126278334	+	Silent	SNP	A	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:126278334A>C	uc001qds.2	+	8	789	c.570A>C	c.(568-570)GTA>GTC	p.V190V	ST3GAL4_uc001qdt.2_Silent_p.V186V|ST3GAL4_uc009zcc.2_Silent_p.V26V|ST3GAL4_uc009zcd.2_Silent_p.V179V|ST3GAL4_uc001qdu.2_Silent_p.V186V|ST3GAL4_uc001qdv.2_Silent_p.V190V|ST3GAL4_uc009zce.2_Silent_p.V186V|ST3GAL4_uc001qdw.2_Silent_p.V179V|ST3GAL4_uc001qdx.1_Silent_p.V147V|ST3GAL4_uc001qdy.2_Silent_p.V26V|ST3GAL4_uc001qdz.2_Silent_p.V26V	NM_006278	NP_006269	Q11206	SIA4C_HUMAN	ST3 beta-galactoside alpha-2,3-sialyltransferase	190	Lumenal (Potential).				post-translational protein modification|protein N-linked glycosylation via asparagine	extracellular region|Golgi cisterna membrane|integral to Golgi membrane	beta-galactoside alpha-2,3-sialyltransferase activity				0	all_hematologic(175;0.145)	Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.0739)|all_lung(97;0.0798)|all_neural(223;0.138)		BRCA - Breast invasive adenocarcinoma(274;1.13e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0767)		TCGTCCTGGTAGCTTTCAAGG	0.562													26	75	---	---	---	---	PASS
ZBTB44	29068	broad.mit.edu	37	11	130106942	130106942	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:130106942C>A	uc001qga.2	-	5	1708	c.1314G>T	c.(1312-1314)AGG>AGT	p.R438S	ZBTB44_uc001qgb.3_Missense_Mutation_p.R438S|ZBTB44_uc001qfx.2_RNA|ZBTB44_uc001qfz.2_Missense_Mutation_p.R438S	NM_014155	NP_054874	Q8NCP5	ZBT44_HUMAN	zinc finger and BTB domain containing 44	438	C2H2-type 2.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1	all_hematologic(175;0.0429)	Lung NSC(97;0.000601)|Breast(109;0.000962)|all_lung(97;0.00125)|Medulloblastoma(222;0.0425)|all_neural(223;0.0837)		OV - Ovarian serous cystadenocarcinoma(99;0.0192)|Lung(977;0.235)		GCGAGTAAGCCCTGGTGAACT	0.388													46	81	---	---	---	---	PASS
ADIPOR2	79602	broad.mit.edu	37	12	1895206	1895206	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:1895206G>A	uc001qjm.2	+	8	1326	c.1129G>A	c.(1129-1131)GGC>AGC	p.G377S	ADIPOR2_uc001qjn.2_Missense_Mutation_p.G377S	NM_024551	NP_078827	Q86V24	ADR2_HUMAN	adiponectin receptor 2	377	Extracellular (Potential).				fatty acid oxidation|hormone-mediated signaling pathway	integral to membrane	hormone binding|receptor activity				0	Ovarian(42;0.107)		OV - Ovarian serous cystadenocarcinoma(31;0.000382)			TTTCATGATCGGCGGGGGCTG	0.537													149	103	---	---	---	---	PASS
EFCAB4B	84766	broad.mit.edu	37	12	3782628	3782628	+	Nonsense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:3782628C>A	uc001qmj.2	-	7	1227	c.655G>T	c.(655-657)GAG>TAG	p.E219*	EFCAB4B_uc010sen.1_Nonsense_Mutation_p.E219*|EFCAB4B_uc010seo.1_Nonsense_Mutation_p.E219*|EFCAB4B_uc001qmi.1_RNA	NM_032680	NP_116069	Q9BSW2	EFC4B_HUMAN	EF-hand calcium binding domain 4B isoform c	219	Potential.				activation of store-operated calcium channel activity|store-operated calcium entry	cytoplasm	calcium ion binding|protein binding			ovary(1)|pancreas(1)	2			OV - Ovarian serous cystadenocarcinoma(31;0.00287)|COAD - Colon adenocarcinoma(12;0.0264)			AGGGCACACTCCAGTTCATTC	0.478													78	77	---	---	---	---	PASS
FGF23	8074	broad.mit.edu	37	12	4479706	4479706	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:4479706G>A	uc001qmq.1	-	3	705	c.559C>T	c.(559-561)CGG>TGG	p.R187W		NM_020638	NP_065689	Q9GZV9	FGF23_HUMAN	fibroblast growth factor 23 precursor	187					cell differentiation|insulin receptor signaling pathway|negative regulation of bone mineralization|negative regulation of hormone secretion|negative regulation of osteoblast differentiation|positive regulation of vitamin D 24-hydroxylase activity|regulation of phosphate transport|vitamin D catabolic process	extracellular space	growth factor activity			ovary(2)|breast(1)|skin(1)	4			Colorectal(7;0.00165)|COAD - Colon adenocarcinoma(12;0.0229)|STAD - Stomach adenocarcinoma(119;0.206)			AGGGGGTCCCGCTCCGAGTCG	0.682													39	35	---	---	---	---	PASS
FGF6	2251	broad.mit.edu	37	12	4543478	4543478	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:4543478T>A	uc001qmr.1	-	3	574	c.530A>T	c.(529-531)CAA>CTA	p.Q177L		NM_020996	NP_066276	P10767	FGF6_HUMAN	fibroblast growth factor 6 precursor	177					angiogenesis|cell proliferation|cell-cell signaling|fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|positive regulation of cell division|positive regulation of cell proliferation	extracellular space	growth factor activity			lung(2)|ovary(1)	3			Colorectal(7;0.00165)|COAD - Colon adenocarcinoma(12;0.0229)			GTAGGTCCCTTGGTACAAGTC	0.512													31	156	---	---	---	---	PASS
CHD4	1108	broad.mit.edu	37	12	6703741	6703741	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6703741C>A	uc001qpo.2	-	15	2361	c.2197G>T	c.(2197-2199)GGC>TGC	p.G733C	CHD4_uc001qpn.2_Missense_Mutation_p.G726C|CHD4_uc001qpp.2_Missense_Mutation_p.G730C	NM_001273	NP_001264	Q14839	CHD4_HUMAN	chromodomain helicase DNA binding protein 4	733					chromatin modification|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	microtubule organizing center|NuRD complex	ATP binding|ATP-dependent DNA helicase activity|DNA binding|zinc ion binding			central_nervous_system(2)	2						CAATTCAGGCCCTCCATTTGA	0.522													22	123	---	---	---	---	PASS
FAM90A1	55138	broad.mit.edu	37	12	8374731	8374731	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:8374731C>G	uc001qui.2	-	7	1641	c.1082G>C	c.(1081-1083)CGG>CCG	p.R361P	FAM90A1_uc001quh.2_Missense_Mutation_p.R361P	NM_018088	NP_060558	Q86YD7	F90A1_HUMAN	hypothetical protein LOC55138	361							nucleic acid binding|zinc ion binding			ovary(1)	1				Kidney(36;0.0866)		CGGAGGCTGCCGGTCGCCGCT	0.667													31	29	---	---	---	---	PASS
LST-3TM12	338821	broad.mit.edu	37	12	21196275	21196275	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21196275C>T	uc010sin.1	+	6	594	c.594C>T	c.(592-594)ATC>ATT	p.I198I	SLCO1B3_uc010sil.1_Intron|LST-3TM12_uc010sim.1_Silent_p.I245I	NM_001009562	NP_001009562	Q71QF0	Q71QF0_HUMAN	liver-specific organic anion transporter 3TM12	198						membrane	transporter activity				0						TAGGCACTATCAGGATAACTC	0.373													82	150	---	---	---	---	PASS
PDZRN4	29951	broad.mit.edu	37	12	41587941	41587941	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:41587941G>A	uc010skn.1	+	3	265	c.197G>A	c.(196-198)GGA>GAA	p.G66E		NM_013377	NP_037509	Q6ZMN7	PZRN4_HUMAN	PDZ domain containing RING finger 4 isoform 2	265	PDZ 1.						ubiquitin-protein ligase activity|zinc ion binding			lung(3)|skin(3)|ovary(2)|large_intestine(1)|kidney(1)|pancreas(1)	11	all_cancers(12;0.000673)	Lung NSC(34;0.0205)|all_lung(34;0.0264)				TTAGAAAATGGACCTGCTGAC	0.338													19	32	---	---	---	---	PASS
COL2A1	1280	broad.mit.edu	37	12	48380194	48380194	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48380194G>A	uc001rqu.2	-	23	1633	c.1452C>T	c.(1450-1452)CCC>CCT	p.P484P	COL2A1_uc009zkw.2_RNA|COL2A1_uc001rqv.2_Silent_p.P415P	NM_001844	NP_001835	P02458	CO2A1_HUMAN	collagen, type II, alpha 1 isoform 1 precursor	484	Triple-helical region.				axon guidance|collagen fibril organization|embryonic skeletal joint morphogenesis|sensory perception of sound|visual perception	collagen type II	identical protein binding|platelet-derived growth factor binding			ovary(1)|skin(1)	2		Acute lymphoblastic leukemia(13;0.108)|all_hematologic(14;0.214)			Collagenase(DB00048)	CTTCACCAGCGGGTCCAGGGG	0.612													6	6	---	---	---	---	PASS
TUBA1C	84790	broad.mit.edu	37	12	49666042	49666042	+	Nonsense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49666042C>T	uc001rtt.1	+	4	482	c.382C>T	c.(382-384)CAG>TAG	p.Q128*	TUBA1C_uc001rts.2_Nonsense_Mutation_p.Q93*|TUBA1C_uc010smh.1_Nonsense_Mutation_p.Q198*	NM_032704	NP_116093	Q9BQE3	TBA1C_HUMAN	tubulin alpha 6	128					'de novo' posttranslational protein folding|microtubule-based movement|protein polymerization	cytoplasm|microtubule	GTP binding|GTPase activity|protein binding|structural molecule activity				0						GCAGGCTGACCAGTGCACCGG	0.438													21	99	---	---	---	---	PASS
ACCN2	41	broad.mit.edu	37	12	50471005	50471005	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50471005C>T	uc001rvw.2	+	4	797	c.568C>T	c.(568-570)CGC>TGC	p.R190C	ACCN2_uc001rvv.2_Missense_Mutation_p.R190C|ACCN2_uc009zln.2_Translation_Start_Site|ACCN2_uc009zlo.2_Missense_Mutation_p.R190C	NM_001095	NP_001086	P78348	ACCN2_HUMAN	amiloride-sensitive cation channel 2, neuronal	190	Extracellular (By similarity).				calcium ion transport|response to pH|signal transduction	integral to plasma membrane	ligand-gated sodium channel activity|protein binding			ovary(1)	1					Amiloride(DB00594)	GGTCTTCACACGCTATGGAAA	0.597													23	158	---	---	---	---	PASS
SLC4A8	9498	broad.mit.edu	37	12	51851168	51851168	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51851168A>T	uc001rys.1	+	6	786	c.608A>T	c.(607-609)GAC>GTC	p.D203V	SLC4A8_uc010sni.1_Missense_Mutation_p.D150V|SLC4A8_uc001rym.2_Missense_Mutation_p.D150V|SLC4A8_uc001ryn.2_Missense_Mutation_p.D150V|SLC4A8_uc001ryo.2_Missense_Mutation_p.D150V|SLC4A8_uc001ryp.1_Missense_Mutation_p.D150V|SLC4A8_uc010snj.1_Missense_Mutation_p.D230V|SLC4A8_uc001ryq.3_Missense_Mutation_p.D203V|SLC4A8_uc001ryr.2_Missense_Mutation_p.D203V|SLC4A8_uc010snk.1_Missense_Mutation_p.D150V	NM_001039960	NP_001035049	Q2Y0W8	S4A8_HUMAN	solute carrier family 4, sodium bicarbonate	203	Extracellular (Potential).				bicarbonate transport|sodium ion transport	integral to membrane|plasma membrane	inorganic anion exchanger activity			ovary(3)|pancreas(1)|skin(1)	5				BRCA - Breast invasive adenocarcinoma(357;0.15)		CTGTCCAGTGACCTGAATGAC	0.463													19	75	---	---	---	---	PASS
KRT75	9119	broad.mit.edu	37	12	52818289	52818289	+	3'UTR	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52818289C>T	uc001saj.2	-	9						NM_004693	NP_004684	O95678	K2C75_HUMAN	keratin 75							keratin filament	structural molecule activity				0				BRCA - Breast invasive adenocarcinoma(357;0.192)		TAGAGGGAGCCATGGGGCTCT	0.592													60	223	---	---	---	---	PASS
TENC1	23371	broad.mit.edu	37	12	53449424	53449424	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53449424G>C	uc001sbp.2	+	9	781	c.646G>C	c.(646-648)GAG>CAG	p.E216Q	uc001sbk.1_5'Flank|TENC1_uc001sbl.2_Missense_Mutation_p.E92Q|TENC1_uc001sbm.2_Missense_Mutation_p.E226Q|TENC1_uc001sbn.2_Missense_Mutation_p.E226Q|TENC1_uc001sbo.1_Missense_Mutation_p.E216Q|TENC1_uc001sbq.2_5'Flank|TENC1_uc001sbr.2_5'Flank	NM_170754	NP_736610	Q63HR2	TENC1_HUMAN	tensin like C1 domain containing phosphatase	216	Phosphatase tensin-type.				intracellular signal transduction|negative regulation of cell proliferation	focal adhesion	metal ion binding|phosphoprotein phosphatase activity|protein binding			ovary(1)|pancreas(1)	2						CAAAGCCATGGAGACATGGCT	0.607													36	124	---	---	---	---	PASS
OR10P1	121130	broad.mit.edu	37	12	56030764	56030764	+	Missense_Mutation	SNP	T	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56030764T>G	uc010spq.1	+	1	89	c.89T>G	c.(88-90)GTG>GGG	p.V30G		NM_206899	NP_996782	Q8NGE3	O10P1_HUMAN	olfactory receptor, family 10, subfamily P,	30	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			central_nervous_system(1)|pancreas(1)	2						CTGTTCTGGGTGGTGCTTCTG	0.577													37	158	---	---	---	---	PASS
ESYT1	23344	broad.mit.edu	37	12	56522358	56522358	+	Silent	SNP	C	T	T	rs80169445	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56522358C>T	uc001sjq.2	+	1	305	c.255C>T	c.(253-255)CTC>CTT	p.L85L	ESYT1_uc001sjr.2_Silent_p.L85L	NM_015292	NP_056107	Q9BSJ8	ESYT1_HUMAN	extended synaptotagmin-like protein 1	85						integral to membrane				ovary(4)|skin(1)	5						TCTTCGGCCTCGCCCTCTACC	0.632													16	14	---	---	---	---	PASS
RFX4	5992	broad.mit.edu	37	12	107105298	107105298	+	Intron	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:107105298C>G	uc001tlr.2	+						RFX4_uc010swv.1_Intron|RFX4_uc001tls.2_Intron|RFX4_uc001tlt.2_Intron|RFX4_uc001tlv.2_Intron	NM_213594	NP_998759	Q33E94	RFX4_HUMAN	regulatory factor X4 isoform c						transcription, DNA-dependent	nucleus	DNA binding			upper_aerodigestive_tract(1)	1						AGGTAGCTGTCCTCCATTATG	0.423													17	86	---	---	---	---	PASS
ACAD10	80724	broad.mit.edu	37	12	112174718	112174718	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112174718C>T	uc001tsq.2	+	12	1824	c.1624C>T	c.(1624-1626)CCT>TCT	p.P542S	ACAD10_uc001tsp.2_Missense_Mutation_p.P542S|ACAD10_uc009zvx.2_Missense_Mutation_p.P573S|ACAD10_uc001tss.1_RNA	NM_025247	NP_079523	Q6JQN1	ACD10_HUMAN	acyl-Coenzyme A dehydrogenase family, member 10	542							acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding|hydrolase activity|transferase activity, transferring phosphorus-containing groups			ovary(2)	2						AATGGGGCTCCCTCCCACTGA	0.483													25	96	---	---	---	---	PASS
ACAD10	80724	broad.mit.edu	37	12	112184962	112184962	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112184962G>A	uc001tsq.2	+	15	2566	c.2366G>A	c.(2365-2367)CGC>CAC	p.R789H	ACAD10_uc001tsp.2_Missense_Mutation_p.R789H|ACAD10_uc009zvx.2_Missense_Mutation_p.R820H|ACAD10_uc001tss.1_RNA	NM_025247	NP_079523	Q6JQN1	ACD10_HUMAN	acyl-Coenzyme A dehydrogenase family, member 10	789							acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding|hydrolase activity|transferase activity, transferring phosphorus-containing groups			ovary(2)	2						GGGAAAGCCCGCTCCTGTTTT	0.637													18	48	---	---	---	---	PASS
HSPB8	26353	broad.mit.edu	37	12	119617367	119617367	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:119617367G>C	uc001txb.2	+	1	773	c.250G>C	c.(250-252)GAG>CAG	p.E84Q	HSPB8_uc001txc.2_Missense_Mutation_p.E84Q	NM_014365	NP_055180	Q9UJY1	HSPB8_HUMAN	heat shock 22kDa protein 8	84					cell death|response to heat	cytoplasm|nucleus	identical protein binding|protein serine/threonine kinase activity			central_nervous_system(1)|skin(1)	2	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)					GGTGCCTGCCGAGGGCAGGAC	0.657													12	24	---	---	---	---	PASS
CAMKK2	10645	broad.mit.edu	37	12	121686468	121686468	+	Nonsense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:121686468C>A	uc001tzu.2	-	14	1517	c.1393G>T	c.(1393-1395)GAA>TAA	p.E465*	CAMKK2_uc001tzt.2_Nonsense_Mutation_p.E465*|CAMKK2_uc001tzv.2_Nonsense_Mutation_p.E465*|CAMKK2_uc001tzw.2_Intron|CAMKK2_uc001tzx.2_Nonsense_Mutation_p.E465*|CAMKK2_uc001tzy.2_Intron|CAMKK2_uc001tzz.1_Nonsense_Mutation_p.E252*|CAMKK2_uc001uaa.1_Nonsense_Mutation_p.E465*|CAMKK2_uc001uab.2_Nonsense_Mutation_p.E465*|CAMKK2_uc001uac.2_Intron	NM_006549	NP_006540	Q96RR4	KKCC2_HUMAN	calcium/calmodulin-dependent protein kinase	465					calcium-mediated signaling|MAPKKK cascade|positive regulation of transcription, DNA-dependent|protein autophosphorylation|regulation of protein kinase activity	cytoplasm	ATP binding|calcium ion binding|calmodulin binding|calmodulin-dependent protein kinase activity|protein tyrosine kinase activity			lung(1)|large_intestine(1)|stomach(1)	3	all_neural(191;0.0684)|Medulloblastoma(191;0.0922)					TCAGTCACTTCGACCAGCGTG	0.612													49	136	---	---	---	---	PASS
WDR66	144406	broad.mit.edu	37	12	122359576	122359576	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:122359576C>T	uc009zxk.2	+	2	507	c.365C>T	c.(364-366)TCA>TTA	p.S122L		NM_144668	NP_653269	Q8TBY9	WDR66_HUMAN	WD repeat domain 66	122							calcium ion binding			ovary(1)|skin(1)	2	all_neural(191;0.0496)|Medulloblastoma(191;0.0922)			OV - Ovarian serous cystadenocarcinoma(86;0.000155)|Epithelial(86;0.000634)|BRCA - Breast invasive adenocarcinoma(302;0.248)		TCAATCACATCAGGAATTTTC	0.303													37	86	---	---	---	---	PASS
DHX37	57647	broad.mit.edu	37	12	125434954	125434954	+	Intron	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:125434954C>A	uc001ugy.2	-						DHX37_uc001ugz.1_Intron	NM_032656	NP_116045	Q8IY37	DHX37_HUMAN	DEAH (Asp-Glu-Ala-His) box polypeptide 37								ATP binding|ATP-dependent helicase activity|nucleic acid binding|protein binding			skin(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;8.05e-05)|Epithelial(86;0.000486)|all cancers(50;0.00653)		ACTGCCCCAACTCACAGAACA	0.667													7	22	---	---	---	---	PASS
RASL11A	387496	broad.mit.edu	37	13	27847445	27847445	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:27847445C>G	uc001urd.1	+	4	1161	c.543C>G	c.(541-543)AAC>AAG	p.N181K		NM_206827	NP_996563	Q6T310	RSLBA_HUMAN	RAS-like, family 11, member A	181	Small GTPase-like.				positive regulation of transcription from RNA polymerase I promoter|small GTPase mediated signal transduction|transcription, DNA-dependent	membrane|nucleolus	GTP binding|GTPase activity			breast(1)	1		Lung SC(185;0.0161)	Colorectal(13;0.00042)|READ - Rectum adenocarcinoma(15;0.105)	all cancers(112;0.0173)|GBM - Glioblastoma multiforme(144;0.0557)|OV - Ovarian serous cystadenocarcinoma(117;0.152)|Epithelial(112;0.164)		CTAGCGAAAACTACGAAGATG	0.527													16	36	---	---	---	---	PASS
FLT3	2322	broad.mit.edu	37	13	28623578	28623578	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:28623578A>G	uc001urw.2	-	8	1061	c.979T>C	c.(979-981)TAC>CAC	p.Y327H	FLT3_uc010aao.2_RNA|FLT3_uc010tdn.1_Missense_Mutation_p.Y327H	NM_004119	NP_004110	P36888	FLT3_HUMAN	fms-related tyrosine kinase 3 precursor	327	Extracellular (Potential).|Ig-like C2-type.				positive regulation of cell proliferation	integral to plasma membrane	ATP binding|vascular endothelial growth factor receptor activity			haematopoietic_and_lymphoid_tissue(8536)|lung(7)|ovary(3)|stomach(1)|central_nervous_system(1)|skin(1)	8549	Acute lymphoblastic leukemia(6;0.04)	Lung SC(185;0.0156)|Ovarian(182;0.0392)	Colorectal(13;0.000157)|READ - Rectum adenocarcinoma(15;0.105)	OV - Ovarian serous cystadenocarcinoma(117;0.00154)|all cancers(112;0.00459)|GBM - Glioblastoma multiforme(144;0.00562)|Epithelial(112;0.0959)|Lung(94;0.212)	Sorafenib(DB00398)|Sunitinib(DB01268)	CAAGTGTAGTATCCGGTGTCG	0.408			Mis|O		AML|ALL								171	95	---	---	---	---	PASS
STARD13	90627	broad.mit.edu	37	13	33684169	33684169	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:33684169G>T	uc001uuw.2	-	12	3014	c.2888C>A	c.(2887-2889)CCC>CAC	p.P963H	STARD13_uc001uuu.2_Missense_Mutation_p.P955H|STARD13_uc001uuv.2_Missense_Mutation_p.P845H|STARD13_uc001uux.2_Missense_Mutation_p.P928H|STARD13_uc010tec.1_RNA	NM_178006	NP_821074	Q9Y3M8	STA13_HUMAN	StAR-related lipid transfer (START) domain	963	START.				regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|lipid particle|mitochondrial membrane	GTPase activator activity|protein binding			ovary(2)|pancreas(1)|skin(1)	4	all_epithelial(80;0.155)	Lung SC(185;0.0367)		all cancers(112;1.31e-05)|Epithelial(112;0.000142)|BRCA - Breast invasive adenocarcinoma(63;0.00936)|OV - Ovarian serous cystadenocarcinoma(117;0.0533)|Lung(94;0.143)|GBM - Glioblastoma multiforme(144;0.143)		GACCACTGAGGGGGGTGCTTC	0.577											OREG0022359	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	62	41	---	---	---	---	PASS
AKAP11	11215	broad.mit.edu	37	13	42875329	42875329	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:42875329C>G	uc001uys.1	+	8	2622	c.2447C>G	c.(2446-2448)TCT>TGT	p.S816C		NM_016248	NP_057332	Q9UKA4	AKA11_HUMAN	A-kinase anchor protein 11	816					intracellular protein kinase cascade	microtubule organizing center	protein kinase A binding|protein phosphatase 1 binding			ovary(1)|central_nervous_system(1)	2		Lung NSC(96;1.86e-05)|Prostate(109;0.0165)|Lung SC(185;0.0262)|Breast(139;0.0707)|Hepatocellular(98;0.114)		OV - Ovarian serous cystadenocarcinoma(117;0.000365)|GBM - Glioblastoma multiforme(144;0.00116)|BRCA - Breast invasive adenocarcinoma(63;0.19)		AATGGTGATTCTGCCCAAGTG	0.408													41	89	---	---	---	---	PASS
ZC3H13	23091	broad.mit.edu	37	13	46549424	46549424	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:46549424T>A	uc010tfw.1	-	11	2468	c.2462A>T	c.(2461-2463)AAA>ATA	p.K821I	ZC3H13_uc001vas.1_Missense_Mutation_p.K821I|ZC3H13_uc001vat.1_Missense_Mutation_p.K821I	NM_015070	NP_055885	Q5T200	ZC3HD_HUMAN	zinc finger CCCH-type containing 13	821	Arg/Glu-rich.						nucleic acid binding|zinc ion binding			ovary(1)|lung(1)	2		Lung NSC(96;7.26e-05)|Breast(56;0.000118)|Prostate(109;0.00217)|Hepatocellular(98;0.0207)|Lung SC(185;0.0262)	KIRC - Kidney renal clear cell carcinoma(16;0.234)	GBM - Glioblastoma multiforme(144;4.18e-05)		TTACTTTGATTTTCTTTCATC	0.333													185	103	---	---	---	---	PASS
KLHL1	57626	broad.mit.edu	37	13	70681661	70681661	+	Silent	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:70681661G>C	uc001vip.2	-	1	965	c.171C>G	c.(169-171)CTC>CTG	p.L57L	KLHL1_uc010thm.1_Silent_p.L57L|ATXN8OS_uc010aej.1_RNA	NM_020866	NP_065917	Q9NR64	KLHL1_HUMAN	kelch-like 1 protein	57	Ser-rich.				actin cytoskeleton organization	cytoplasm|cytoskeleton	actin binding				0		Breast(118;0.000162)		COAD - Colon adenocarcinoma(199;0.000193)|GBM - Glioblastoma multiforme(99;0.000211)		CTTGGCTTTTGAGCAGGCGAC	0.473													44	37	---	---	---	---	PASS
NALCN	259232	broad.mit.edu	37	13	101828722	101828722	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:101828722G>T	uc001vox.1	-	15	1957	c.1768C>A	c.(1768-1770)CTC>ATC	p.L590I	NALCN_uc001voy.2_Missense_Mutation_p.L305I	NM_052867	NP_443099	Q8IZF0	NALCN_HUMAN	voltage gated channel like 1	590	Helical; Name=S6 of repeat II; (Potential).					integral to membrane	sodium channel activity|voltage-gated ion channel activity			ovary(8)|breast(4)|skin(2)|pancreas(1)|central_nervous_system(1)	16	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)					AAACTCAGGAGGATCTATAAA	0.289													65	54	---	---	---	---	PASS
COL4A1	1282	broad.mit.edu	37	13	110853789	110853789	+	Silent	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:110853789T>A	uc001vqw.3	-	19	1202	c.1080A>T	c.(1078-1080)CCA>CCT	p.P360P	COL4A1_uc010agl.2_Intron	NM_001845	NP_001836	P02462	CO4A1_HUMAN	alpha 1 type IV collagen preproprotein	360	Triple-helical region.				angiogenesis|axon guidance		extracellular matrix structural constituent|platelet-derived growth factor binding			ovary(3)|lung(1)|central_nervous_system(1)|pancreas(1)	6	all_cancers(4;9.8e-13)|all_epithelial(4;9.66e-08)|all_lung(23;3.75e-06)|Lung NSC(43;0.000274)|Colorectal(4;0.00178)|all_neural(89;0.00459)|Medulloblastoma(90;0.00596)|Lung SC(71;0.0604)	Breast(118;0.2)	BRCA - Breast invasive adenocarcinoma(86;0.11)|all cancers(43;0.145)			AGCTACCTTTTGGGCCTGGCT	0.343													22	31	---	---	---	---	PASS
HNRNPC	3183	broad.mit.edu	37	14	21681153	21681153	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:21681153C>G	uc001vzy.2	-	6	772	c.528G>C	c.(526-528)AAG>AAC	p.K176N	HNRNPC_uc001vzw.2_Missense_Mutation_p.K163N|HNRNPC_uc001wad.2_Missense_Mutation_p.K96N|HNRNPC_uc001vzx.2_Intron|HNRNPC_uc001vzz.2_Missense_Mutation_p.K163N|HNRNPC_uc001waa.2_Missense_Mutation_p.K176N|HNRNPC_uc010ail.2_Missense_Mutation_p.K176N|HNRNPC_uc010tlq.1_RNA|HNRNPC_uc001wab.2_Missense_Mutation_p.K163N|HNRNPC_uc001wac.2_Intron|HNRNPC_uc010tlr.1_Missense_Mutation_p.K41N|HNRNPC_uc001waf.2_Missense_Mutation_p.K163N|HNRNPC_uc001wae.2_Missense_Mutation_p.K163N	NM_031314	NP_112604	P07910	HNRPC_HUMAN	heterogeneous nuclear ribonucleoprotein C	176						catalytic step 2 spliceosome|nucleoplasm	identical protein binding|nucleotide binding|RNA binding				0	all_cancers(95;0.00176)		Epithelial(56;1.08e-06)|all cancers(55;8.95e-06)	GBM - Glioblastoma multiforme(265;0.00783)		GCTGTCCACTCTTAGAATTGA	0.453													52	103	---	---	---	---	PASS
MYH6	4624	broad.mit.edu	37	14	23855703	23855703	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23855703G>T	uc001wjv.2	-	33	4847	c.4780C>A	c.(4780-4782)CGG>AGG	p.R1594R		NM_002471	NP_002462	P13533	MYH6_HUMAN	myosin heavy chain 6	1594	Potential.				adult heart development|atrial cardiac muscle tissue morphogenesis|cardiac muscle fiber development|in utero embryonic development|muscle filament sliding|regulation of ATPase activity|regulation of blood pressure|regulation of heart rate|regulation of the force of heart contraction|sarcomere organization|striated muscle contraction|ventricular cardiac muscle tissue morphogenesis|visceral muscle development	cytosol|focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|protein kinase binding|structural constituent of muscle			pancreas(2)|ovary(1)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00764)|READ - Rectum adenocarcinoma(4;0.0289)|Colorectal(4;0.0441)		TCCACCACCCGCTGGTGGTTG	0.592													37	214	---	---	---	---	PASS
CPNE6	9362	broad.mit.edu	37	14	24544799	24544799	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24544799C>A	uc001wll.2	+	9	962	c.863C>A	c.(862-864)ACG>AAG	p.T288K	CPNE6_uc010tnv.1_Missense_Mutation_p.T343K|CPNE6_uc001wlm.2_Missense_Mutation_p.T113K|CPNE6_uc001wln.2_5'UTR	NM_006032	NP_006023	O95741	CPNE6_HUMAN	copine 6	288					lipid metabolic process|nervous system development|synaptic transmission|vesicle-mediated transport		calcium ion binding|transporter activity			skin(2)|ovary(1)	3				GBM - Glioblastoma multiforme(265;0.0184)		GCCCAGTGCACGGTAAATTTC	0.532													6	18	---	---	---	---	PASS
HECTD1	25831	broad.mit.edu	37	14	31602498	31602498	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31602498C>G	uc001wrc.1	-	24	4357	c.3868G>C	c.(3868-3870)GAT>CAT	p.D1290H	HECTD1_uc001wrd.1_Missense_Mutation_p.D805H	NM_015382	NP_056197	Q9ULT8	HECD1_HUMAN	HECT domain containing 1	1290	MIB/HERC2.				protein ubiquitination involved in ubiquitin-dependent protein catabolic process	intracellular	metal ion binding|protein binding|ubiquitin-protein ligase activity			ovary(3)|large_intestine(1)|lung(1)	5	Hepatocellular(127;0.0877)|Breast(36;0.176)		LUAD - Lung adenocarcinoma(48;0.00292)|Lung(238;0.0164)|BRCA - Breast invasive adenocarcinoma(188;0.111)|STAD - Stomach adenocarcinoma(7;0.173)	GBM - Glioblastoma multiforme(265;0.00617)		CCATCCTGATCTCGCCATTTC	0.483													10	76	---	---	---	---	PASS
SLC35F4	341880	broad.mit.edu	37	14	58060795	58060795	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:58060795G>A	uc001xdb.1	-	2	259	c.259C>T	c.(259-261)CCC>TCC	p.P87S	SLC35F4_uc010aoz.1_RNA|SLC35F4_uc010apa.1_5'UTR	NM_001080455	NP_001073924			solute carrier family 35, member F4											ovary(2)	2						TGTGAACTGGGGCAGTTGGCT	0.483													24	38	---	---	---	---	PASS
KCNH5	27133	broad.mit.edu	37	14	63483642	63483642	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:63483642A>T	uc001xfx.2	-	2	155	c.104T>A	c.(103-105)ATT>AAT	p.I35N	KCNH5_uc001xfy.2_Missense_Mutation_p.I35N|KCNH5_uc001xfz.1_Translation_Start_Site|KCNH5_uc001xga.2_Translation_Start_Site	NM_139318	NP_647479	Q8NCM2	KCNH5_HUMAN	potassium voltage-gated channel, subfamily H,	35	Cytoplasmic (Potential).|PAS.				regulation of transcription, DNA-dependent	integral to membrane	calmodulin binding|two-component sensor activity|voltage-gated potassium channel activity			ovary(4)|skin(4)|central_nervous_system(1)	9				OV - Ovarian serous cystadenocarcinoma(108;0.00958)|BRCA - Breast invasive adenocarcinoma(234;0.168)		CCAATCCACAATCTGGGCATT	0.378													40	86	---	---	---	---	PASS
GPHB5	122876	broad.mit.edu	37	14	63784564	63784564	+	Splice_Site	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:63784564G>T	uc010apu.2	-	1	1	c.1_splice	c.e1-1	p.M1_splice	GPHB5_uc001xgc.2_Splice_Site	NM_145171	NP_660154	Q86YW7	GPHB5_HUMAN	glycoprotein beta 5							extracellular region	hormone activity			breast(1)	1				OV - Ovarian serous cystadenocarcinoma(108;0.00372)|all cancers(60;0.0226)|BRCA - Breast invasive adenocarcinoma(234;0.0978)		CCAGCTTCATGCTGCTCTTCC	0.562													14	18	---	---	---	---	PASS
PCNX	22990	broad.mit.edu	37	14	71555146	71555146	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:71555146A>T	uc001xmo.2	+	29	5883	c.5437A>T	c.(5437-5439)AGT>TGT	p.S1813C	PCNX_uc010are.1_Missense_Mutation_p.S1702C|PCNX_uc010arf.1_Missense_Mutation_p.S601C	NM_014982	NP_055797	Q96RV3	PCX1_HUMAN	pecanex-like 1	1813						integral to membrane				ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(12;0.206)	all cancers(60;0.00835)|BRCA - Breast invasive adenocarcinoma(234;0.00951)|OV - Ovarian serous cystadenocarcinoma(108;0.0417)		TCATATGTCCAGGTAAAGAAG	0.438													18	62	---	---	---	---	PASS
ALDH6A1	4329	broad.mit.edu	37	14	74539005	74539005	+	Silent	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:74539005A>T	uc001xpo.2	-	4	348	c.249T>A	c.(247-249)ATT>ATA	p.I83I	C14orf45_uc001xpm.1_Intron|ALDH6A1_uc010asa.2_5'UTR|ALDH6A1_uc010tuq.1_Silent_p.I83I	NM_005589	NP_005580	Q02252	MMSA_HUMAN	aldehyde dehydrogenase 6A1 precursor	83						mitochondrial matrix|nucleus	fatty-acyl-CoA binding|malonate-semialdehyde dehydrogenase (acetylating) activity|methylmalonate-semialdehyde dehydrogenase (acylating) activity				0				BRCA - Breast invasive adenocarcinoma(234;0.00354)	NADH(DB00157)	TGCAGGAAGCAATGGCTGCAT	0.488													25	46	---	---	---	---	PASS
EIF2B2	8892	broad.mit.edu	37	14	75471540	75471540	+	Silent	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75471540C>G	uc001xrc.1	+	4	616	c.534C>G	c.(532-534)CTC>CTG	p.L178L		NM_014239	NP_055054	P49770	EI2BB_HUMAN	eukaryotic translation initiation factor 2B,	178					cellular response to stimulus|myelination|oligodendrocyte development|ovarian follicle development|regulation of translational initiation|response to glucose stimulus|response to heat|response to peptide hormone stimulus	cytosol|eukaryotic translation initiation factor 2B complex	ATP binding|GTP binding|protein binding|translation initiation factor activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(234;0.00661)		AGGCCTTCCTCAAAGAGGCTG	0.493													47	68	---	---	---	---	PASS
MLH3	27030	broad.mit.edu	37	14	75513760	75513760	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75513760C>G	uc001xrd.1	-	2	2815	c.2599G>C	c.(2599-2601)GAG>CAG	p.E867Q	MLH3_uc001xre.1_Missense_Mutation_p.E867Q|MLH3_uc010tuy.1_RNA	NM_001040108	NP_001035197	Q9UHC1	MLH3_HUMAN	mutL homolog 3 isoform 1	867					mismatch repair|reciprocal meiotic recombination	chiasma|MutLbeta complex|synaptonemal complex	ATP binding|ATPase activity|mismatched DNA binding|protein binding|satellite DNA binding			ovary(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(234;0.00688)		GATGACTTCTCAAGGTCCAAA	0.393								MMR					42	219	---	---	---	---	PASS
KIAA1409	57578	broad.mit.edu	37	14	94069606	94069606	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94069606A>T	uc001ybv.1	+	23	3148	c.3065A>T	c.(3064-3066)AAT>ATT	p.N1022I	KIAA1409_uc001ybs.1_Missense_Mutation_p.N1022I	NM_020818	NP_065869	Q9P2D8	UNC79_HUMAN	hypothetical protein LOC57578	1199						integral to membrane				ovary(10)|skin(4)|large_intestine(3)	17		all_cancers(154;0.0354)|all_epithelial(191;0.216)		Epithelial(152;0.188)		GTGAGGACCAATGTTGCTAAC	0.463													56	146	---	---	---	---	PASS
CDC42BPB	9578	broad.mit.edu	37	14	103410592	103410592	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103410592C>T	uc001ymi.1	-	30	4276	c.4044G>A	c.(4042-4044)GTG>GTA	p.V1348V	CDC42BPB_uc001ymj.1_Silent_p.V450V	NM_006035	NP_006026	Q9Y5S2	MRCKB_HUMAN	CDC42-binding protein kinase beta	1348	CNH.				actin cytoskeleton reorganization|establishment or maintenance of cell polarity|intracellular signal transduction	cell leading edge|cell-cell junction|cytoplasm|cytoskeleton	ATP binding|magnesium ion binding|protein serine/threonine kinase activity|small GTPase regulator activity			large_intestine(3)|skin(3)|lung(2)|stomach(1)|breast(1)|ovary(1)	11		Melanoma(154;0.155)		Colorectal(3;0.0129)|READ - Rectum adenocarcinoma(2;0.0419)|Epithelial(152;0.0474)|all cancers(159;0.199)		TCAGCCGTTTCACGGCCACAA	0.557													8	62	---	---	---	---	PASS
PPP1R13B	23368	broad.mit.edu	37	14	104251219	104251219	+	Nonsense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:104251219C>A	uc001yof.1	-	3	473	c.190G>T	c.(190-192)GAA>TAA	p.E64*	PPP1R13B_uc001yog.1_5'UTR	NM_015316	NP_056131	Q96KQ4	ASPP1_HUMAN	apoptosis-stimulating protein of p53, 1	64					apoptosis|induction of apoptosis|negative regulation of cell cycle	cytoplasm|nucleus|plasma membrane	protein binding			ovary(1)	1		all_cancers(154;0.173)|all_epithelial(191;0.131)|Melanoma(154;0.155)				TGAAGATGTTCGTACATCATA	0.398													26	93	---	---	---	---	PASS
ADAM6	8755	broad.mit.edu	37	14	106322129	106322129	+	RNA	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:106322129G>T	uc010tyt.1	-	3598		c.55357C>A			uc001yrs.2_Intron|uc001yrt.2_Intron|uc001yrw.1_Intron|uc001yrx.1_Intron|uc001yrz.1_Intron|uc001yse.2_Intron|uc001ysf.2_Intron|uc001ysj.2_Intron|uc001ysk.1_Intron|uc001ysl.1_Intron|uc001ysm.1_Intron|uc001ysn.1_Intron|uc001yso.1_Intron					Parts of antibodies, mostly variable regions.												0						AGGTGGCTGCGTACTTGCCCC	0.557													21	32	---	---	---	---	PASS
GOLGA8E	390535	broad.mit.edu	37	15	23444000	23444000	+	Intron	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:23444000C>A	uc001yvu.2	+							NM_001012423	NP_001012423			golgi autoantigen, golgin subfamily a, 8E											skin(1)	1		all_cancers(20;2.26e-25)|all_epithelial(15;2.1e-22)|Lung NSC(15;3.36e-17)|all_lung(15;1.04e-16)|Breast(32;0.000776)|Colorectal(260;0.0488)		all cancers(64;5.21e-07)|Epithelial(43;5.65e-06)|BRCA - Breast invasive adenocarcinoma(123;0.000614)		CTGGCCACCCCCAACAGGACA	0.622													15	55	---	---	---	---	PASS
MKRN3	7681	broad.mit.edu	37	15	23811655	23811655	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:23811655G>T	uc001ywh.3	+	1	1202	c.726G>T	c.(724-726)CGG>CGT	p.R242R	MKRN3_uc001ywi.2_Intron|MKRN3_uc010ayi.1_Silent_p.R242R	NM_005664	NP_005655	Q13064	MKRN3_HUMAN	makorin ring finger protein 3	242	C3H1-type 2.					ribonucleoprotein complex	ligase activity|nucleic acid binding|zinc ion binding			lung(6)|large_intestine(2)|ovary(2)	10		all_cancers(20;8.44e-25)|all_epithelial(15;3.69e-22)|Lung NSC(15;2.96e-18)|all_lung(15;2.8e-17)|Breast(32;0.000353)|Colorectal(260;0.14)		all cancers(64;3.02e-06)|Epithelial(43;1.94e-05)|BRCA - Breast invasive adenocarcinoma(123;0.0012)		GTGGGTTGCGGTTTTGCTATT	0.587													27	20	---	---	---	---	PASS
NDN	4692	broad.mit.edu	37	15	23931488	23931488	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:23931488G>C	uc001ywk.2	-	1	963	c.877C>G	c.(877-879)CGA>GGA	p.R293G		NM_002487	NP_002478	Q99608	NECD_HUMAN	necdin	293	MAGE.				negative regulation of cell proliferation|regulation of growth|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus|perikaryon	DNA binding				0		all_cancers(20;1.78e-24)|all_epithelial(15;7.75e-22)|Lung NSC(15;2.96e-18)|all_lung(15;2.8e-17)|Breast(32;0.000625)|Colorectal(260;0.14)		all cancers(64;8.37e-11)|Epithelial(43;9.29e-10)|BRCA - Breast invasive adenocarcinoma(123;0.00179)|GBM - Glioblastoma multiforme(186;0.018)|Lung(196;0.153)		TCTCTGTATCGGGAGGGCCAG	0.587									Prader-Willi_syndrome				53	39	---	---	---	---	PASS
NDN	4692	broad.mit.edu	37	15	23931639	23931639	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:23931639C>T	uc001ywk.2	-	1	812	c.726G>A	c.(724-726)ATG>ATA	p.M242I		NM_002487	NP_002478	Q99608	NECD_HUMAN	necdin	242	MAGE.				negative regulation of cell proliferation|regulation of growth|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus|perikaryon	DNA binding				0		all_cancers(20;1.78e-24)|all_epithelial(15;7.75e-22)|Lung NSC(15;2.96e-18)|all_lung(15;2.8e-17)|Breast(32;0.000625)|Colorectal(260;0.14)		all cancers(64;8.37e-11)|Epithelial(43;9.29e-10)|BRCA - Breast invasive adenocarcinoma(123;0.00179)|GBM - Glioblastoma multiforme(186;0.018)|Lung(196;0.153)		TCAGGTAATTCATTTGGACGA	0.592									Prader-Willi_syndrome				30	30	---	---	---	---	PASS
GABRB3	2562	broad.mit.edu	37	15	26812811	26812811	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:26812811T>C	uc001zaz.2	-	7	894	c.752A>G	c.(751-753)TAT>TGT	p.Y251C	GABRB3_uc010uae.1_Missense_Mutation_p.Y166C|GABRB3_uc001zba.2_Missense_Mutation_p.Y251C|GABRB3_uc001zbb.2_Missense_Mutation_p.Y307C	NM_000814	NP_000805	P28472	GBRB3_HUMAN	gamma-aminobutyric acid (GABA) A receptor, beta	251	Helical; (Probable).				synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			upper_aerodigestive_tract(1)|ovary(1)|lung(1)|liver(1)|central_nervous_system(1)	5		all_cancers(20;1.89e-22)|all_lung(180;6.35e-15)|Breast(32;0.000279)|Colorectal(260;0.232)		all cancers(64;1.46e-07)|Epithelial(43;2.89e-07)|BRCA - Breast invasive adenocarcinoma(123;0.0251)|COAD - Colon adenocarcinoma(236;0.235)|Lung(196;0.243)	Ethchlorvynol(DB00189)|Flurazepam(DB00690)|Lorazepam(DB00186)|Midazolam(DB00683)	AGAGGGCATATAAGTCTGAAG	0.433													37	26	---	---	---	---	PASS
RYR3	6263	broad.mit.edu	37	15	33941263	33941263	+	Intron	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:33941263C>G	uc001zhi.2	+						RYR3_uc010bar.2_Intron	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3						cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)		CCTCTGCGGTCTCTCCACAGC	0.567													10	62	---	---	---	---	PASS
FBN1	2200	broad.mit.edu	37	15	48717693	48717693	+	Intron	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48717693G>A	uc001zwx.1	-						FBN1_uc010beo.1_Intron	NM_000138	NP_000129	P35555	FBN1_HUMAN	fibrillin 1 precursor						heart development|negative regulation of BMP signaling pathway by extracellular sequestering of BMP|negative regulation of transforming growth factor beta receptor signaling pathway by extracellular sequestering of TGFbeta|skeletal system development	basement membrane|extracellular space|microfibril	calcium ion binding|extracellular matrix structural constituent|protein binding			ovary(2)|large_intestine(1)	3		all_lung(180;0.00279)		all cancers(107;4.24e-07)|GBM - Glioblastoma multiforme(94;1.41e-05)		TCAGATCTATGATCAAAGAAA	0.423													35	24	---	---	---	---	PASS
FBXL22	283807	broad.mit.edu	37	15	63893515	63893515	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63893515C>A	uc002amn.2	+	2	370	c.356C>A	c.(355-357)CCA>CAA	p.P119Q	uc002amj.2_5'Flank|uc002amk.2_5'Flank|uc002aml.2_5'Flank	NM_203373	NP_976307	Q6P050	FXL22_HUMAN	F-box and leucine-rich repeat protein 22	119											0						GTGCGCTCCCCACGGAGGCGG	0.612													30	27	---	---	---	---	PASS
MAP2K1	5604	broad.mit.edu	37	15	66727571	66727571	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:66727571G>A	uc010bhq.2	+	2	762	c.287G>A	c.(286-288)AGA>AAA	p.R96K	MAP2K1_uc010ujp.1_Missense_Mutation_p.R74K	NM_002755	NP_002746	Q02750	MP2K1_HUMAN	mitogen-activated protein kinase kinase 1	96	Protein kinase.				activation of MAPK activity|activation of MAPKK activity|axon guidance|cell cycle arrest|cellular senescence|epidermal growth factor receptor signaling pathway|innate immune response|insulin receptor signaling pathway|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of cell proliferation|nerve growth factor receptor signaling pathway|Ras protein signal transduction|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|plasma membrane	ATP binding|MAP kinase kinase activity|protein serine/threonine kinase activity|protein tyrosine kinase activity				0						GTCATGGCCAGAAAGGTGAGT	0.493									Cardiofaciocutaneous_syndrome				67	66	---	---	---	---	PASS
LASS3	204219	broad.mit.edu	37	15	101009683	101009683	+	Nonsense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:101009683T>A	uc002bvz.2	-	11	1247	c.745A>T	c.(745-747)AAG>TAG	p.K249*	LASS3_uc002bwa.2_Nonsense_Mutation_p.K260*|LASS3_uc002bwb.2_Nonsense_Mutation_p.K249*	NM_178842	NP_849164	Q8IU89	CERS3_HUMAN	LAG1 longevity assurance homolog 3	249	TLC.					endoplasmic reticulum membrane|integral to membrane|nuclear membrane	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|sphingosine N-acyltransferase activity			ovary(2)|pancreas(1)|skin(1)	4	Lung NSC(78;0.0018)|all_lung(78;0.00278)|Melanoma(26;0.00852)		OV - Ovarian serous cystadenocarcinoma(32;0.000867)|LUSC - Lung squamous cell carcinoma(107;0.132)|Lung(145;0.161)			GAAAACATCTTAGCAGACTGC	0.308													46	59	---	---	---	---	PASS
TSC2	7249	broad.mit.edu	37	16	2106196	2106196	+	Splice_Site	SNP	G	T	T	rs45517117		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2106196G>T	uc002con.2	+	7	706	c.600_splice	c.e7-1	p.Q200_splice	TSC2_uc010bsd.2_Splice_Site_p.Q200_splice|TSC2_uc002coo.2_Splice_Site_p.Q200_splice|TSC2_uc010uvv.1_Splice_Site_p.Q163_splice|TSC2_uc010uvw.1_Splice_Site_p.Q151_splice|TSC2_uc002cop.2_Splice_Site	NM_000548	NP_000539	P49815	TSC2_HUMAN	tuberous sclerosis 2 isoform 1						cell cycle arrest|endocytosis|heart development|insulin receptor signaling pathway|insulin-like growth factor receptor signaling pathway|negative regulation of cell size|negative regulation of phosphatidylinositol 3-kinase cascade|negative regulation of protein kinase B signaling cascade|negative regulation of TOR signaling cascade|negative regulation of Wnt receptor signaling pathway|nerve growth factor receptor signaling pathway|neural tube closure|phosphatidylinositol-mediated signaling|positive chemotaxis|protein import into nucleus|protein kinase B signaling cascade|regulation of endocytosis|regulation of insulin receptor signaling pathway|regulation of small GTPase mediated signal transduction	Golgi apparatus|nucleus|perinuclear region of cytoplasm|TSC1-TSC2 complex	GTPase activator activity|protein homodimerization activity			central_nervous_system(4)|lung(3)|ovary(2)|pancreas(1)	10		Hepatocellular(780;0.0202)				GCTCCCTGCAGGATGATCTGT	0.607			D|Mis|N|F|S			hamartoma|renal cell			Tuberous_Sclerosis				20	30	---	---	---	---	PASS
CORO7	79585	broad.mit.edu	37	16	4391372	4391372	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:4391372C>T	uc002cwf.2	-	29	3434	c.2991G>A	c.(2989-2991)CAG>CAA	p.Q997Q	CORO7_uc002cwe.2_RNA|TIMM16_uc002cwd.2_Silent_p.Q74Q	NM_024535	NP_078811	P57737	CORO7_HUMAN	coronin 7	Error:Variant_position_missing_in_P57737_after_alignment						cytoplasmic membrane-bounded vesicle|cytosol|Golgi membrane|integral to membrane of membrane fraction|soluble fraction					0						GCCTCACCTTCTGGACCTCCT	0.637													5	5	---	---	---	---	PASS
ACSM3	6296	broad.mit.edu	37	16	20803421	20803421	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20803421C>T	uc002dhr.2	+	11	1611	c.1424C>T	c.(1423-1425)GCA>GTA	p.A475V	ACSM3_uc010vba.1_Missense_Mutation_p.A504V|ERI2_uc002dhs.2_Intron	NM_005622	NP_005613	Q53FZ2	ACSM3_HUMAN	SA hypertension-associated homolog isoform 1	475					regulation of blood pressure	mitochondrial matrix	ATP binding|butyrate-CoA ligase activity|metal ion binding			ovary(1)	1						TGGTTTGTTGCAAGAGCAGAT	0.393													86	123	---	---	---	---	PASS
ITFG1	81533	broad.mit.edu	37	16	47493054	47493054	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:47493054T>C	uc002eet.2	-	2	303	c.241A>G	c.(241-243)AAT>GAT	p.N81D	ITFG1_uc010vgh.1_5'UTR|PHKB_uc010vgi.1_5'Flank|PHKB_uc002eeu.3_5'Flank|PHKB_uc002eev.3_5'Flank|ITFG1_uc010cbf.1_5'UTR	NM_030790	NP_110417	Q8TB96	TIP_HUMAN	integrin alpha FG-GAP repeat containing 1	81						extracellular region|integral to membrane				ovary(1)|central_nervous_system(1)	2		all_cancers(37;0.0613)|all_lung(18;0.0543)|Lung NSC(13;0.227)				TAGGGTGCATTCTGGTCTGCC	0.269													27	135	---	---	---	---	PASS
SALL1	6299	broad.mit.edu	37	16	51173329	51173329	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:51173329G>C	uc010vgs.1	-	2	2835	c.2804C>G	c.(2803-2805)ACG>AGG	p.T935R	SALL1_uc010vgr.1_Missense_Mutation_p.T838R|SALL1_uc010cbv.2_Intron	NM_002968	NP_002959	Q9NSC2	SALL1_HUMAN	sal-like 1 isoform a	935					adrenal gland development|branching involved in ureteric bud morphogenesis|embryonic digestive tract development|embryonic digit morphogenesis|gonad development|histone deacetylation|inductive cell-cell signaling|mesenchymal to epithelial transition involved in metanephros morphogenesis|negative regulation of transcription from RNA polymerase II promoter|olfactory bulb interneuron differentiation|olfactory bulb mitral cell layer development|olfactory nerve development|outer ear morphogenesis|pituitary gland development|positive regulation of transcription from RNA polymerase II promoter|positive regulation of Wnt receptor signaling pathway|ureteric bud invasion|ventricular septum development	chromocenter|cytoplasm|heterochromatin|nucleus	beta-catenin binding|DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(5)|ovary(3)	8		all_cancers(37;0.0322)	COAD - Colon adenocarcinoma(2;0.24)			GAACTCCTGCGTGCTGTTGGA	0.567													58	77	---	---	---	---	PASS
DUS2L	54920	broad.mit.edu	37	16	68090271	68090271	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68090271A>T	uc002evi.2	+	7	462	c.313A>T	c.(313-315)AAT>TAT	p.N105Y	DUS2L_uc002evj.2_Missense_Mutation_p.N105Y|DUS2L_uc010vkk.1_Intron|DUS2L_uc010cez.2_Missense_Mutation_p.N18Y	NM_017803	NP_060273	Q9NX74	DUS2L_HUMAN	dihydrouridine synthase 2-like, SMM1 homolog	105					tRNA processing	endoplasmic reticulum	double-stranded RNA binding|flavin adenine dinucleotide binding|tRNA dihydrouridine synthase activity				0		Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0131)|Epithelial(162;0.0564)		TTCCAGAGAAAATGATGTGGC	0.378													67	84	---	---	---	---	PASS
NFATC3	4775	broad.mit.edu	37	16	68224873	68224873	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68224873G>T	uc002evo.1	+	9	2511	c.2301G>T	c.(2299-2301)TTG>TTT	p.L767F	NFATC3_uc010vkl.1_Missense_Mutation_p.L288F|NFATC3_uc010vkm.1_Missense_Mutation_p.L288F|NFATC3_uc010vkn.1_Missense_Mutation_p.L288F|NFATC3_uc010vko.1_Missense_Mutation_p.L288F|NFATC3_uc010vkp.1_Missense_Mutation_p.L288F|NFATC3_uc010vkq.1_Missense_Mutation_p.L288F|NFATC3_uc002evl.2_Missense_Mutation_p.L288F|NFATC3_uc002evk.2_Missense_Mutation_p.L767F|NFATC3_uc002evm.1_Missense_Mutation_p.L767F|NFATC3_uc002evn.1_Missense_Mutation_p.L767F|NFATC3_uc010vkr.1_Missense_Mutation_p.L288F|NFATC3_uc010vks.1_Missense_Mutation_p.L288F|NFATC3_uc010vkt.1_Missense_Mutation_p.L288F|NFATC3_uc010vku.1_Missense_Mutation_p.L288F|NFATC3_uc010vkv.1_Missense_Mutation_p.L288F|NFATC3_uc010vkw.1_Missense_Mutation_p.L288F|NFATC3_uc010vkx.1_Missense_Mutation_p.L288F|NFATC3_uc010vky.1_Missense_Mutation_p.L288F|NFATC3_uc010vkz.1_Missense_Mutation_p.L288F|NFATC3_uc010vla.1_Missense_Mutation_p.L288F|NFATC3_uc010vlb.1_Missense_Mutation_p.L288F|NFATC3_uc010vlc.1_Missense_Mutation_p.L288F	NM_173165	NP_775188	Q12968	NFAC3_HUMAN	nuclear factor of activated T-cells,	767					inflammatory response|transcription from RNA polymerase II promoter	nucleolus|plasma membrane	DNA binding			upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	3		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0119)|Epithelial(162;0.0452)|all cancers(182;0.24)		TGCCACAGTTGCAGTGTAGAG	0.458													35	183	---	---	---	---	PASS
PRMT7	54496	broad.mit.edu	37	16	68373738	68373738	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68373738G>T	uc002evy.1	+	9	1070	c.794G>T	c.(793-795)AGG>ATG	p.R265M	PRMT7_uc002evx.1_Missense_Mutation_p.R265M|PRMT7_uc010vlg.1_Missense_Mutation_p.R215M|PRMT7_uc002evz.1_Missense_Mutation_p.R111M	NM_019023	NP_061896	Q9NVM4	ANM7_HUMAN	protein arginine methyltransferase 7	265					cell differentiation|DNA methylation involved in gamete generation|regulation of gene expression by genetic imprinting|regulation of transcription, DNA-dependent|spliceosomal snRNP assembly|transcription, DNA-dependent	cytosol|nucleus	[myelin basic protein]-arginine N-methyltransferase activity|histone methyltransferase activity (H4-R3 specific)|protein-arginine omega-N monomethyltransferase activity|protein-arginine omega-N symmetric methyltransferase activity|ribonucleoprotein binding				0		Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0155)|Epithelial(162;0.0629)		TGCCATAGCAGGCGGTTTGAA	0.507													29	116	---	---	---	---	PASS
PRMT7	54496	broad.mit.edu	37	16	68373740	68373740	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:68373740C>T	uc002evy.1	+	9	1072	c.796C>T	c.(796-798)CGG>TGG	p.R266W	PRMT7_uc002evx.1_Missense_Mutation_p.R266W|PRMT7_uc010vlg.1_Missense_Mutation_p.R216W|PRMT7_uc002evz.1_Missense_Mutation_p.R112W	NM_019023	NP_061896	Q9NVM4	ANM7_HUMAN	protein arginine methyltransferase 7	266					cell differentiation|DNA methylation involved in gamete generation|regulation of gene expression by genetic imprinting|regulation of transcription, DNA-dependent|spliceosomal snRNP assembly|transcription, DNA-dependent	cytosol|nucleus	[myelin basic protein]-arginine N-methyltransferase activity|histone methyltransferase activity (H4-R3 specific)|protein-arginine omega-N monomethyltransferase activity|protein-arginine omega-N symmetric methyltransferase activity|ribonucleoprotein binding				0		Ovarian(137;0.192)		OV - Ovarian serous cystadenocarcinoma(108;0.0155)|Epithelial(162;0.0629)		CCATAGCAGGCGGTTTGAACC	0.507													31	116	---	---	---	---	PASS
C16orf46	123775	broad.mit.edu	37	16	81095228	81095228	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:81095228A>T	uc002fgc.3	-	4	985	c.726T>A	c.(724-726)GAT>GAA	p.D242E	C16orf46_uc010chf.2_Missense_Mutation_p.D242E|C16orf46_uc010vno.1_5'UTR	NM_152337	NP_689550	Q6P387	CP046_HUMAN	chromosome 16 open reading frame 46 isoform 2	242											0						CCTTTTCCACATCCAGCACCT	0.463													51	274	---	---	---	---	PASS
BANP	54971	broad.mit.edu	37	16	88066787	88066787	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:88066787A>G	uc002fkr.2	+	9	1333	c.1109A>G	c.(1108-1110)TAC>TGC	p.Y370C	BANP_uc002fkp.2_Missense_Mutation_p.Y340C|BANP_uc002fkq.2_Missense_Mutation_p.Y340C|BANP_uc010vow.1_Missense_Mutation_p.Y378C|BANP_uc002fks.3_Missense_Mutation_p.Y339C|BANP_uc002fko.1_Missense_Mutation_p.Y276C|BANP_uc010vov.1_Missense_Mutation_p.Y345C	NM_079837	NP_524576	Q8N9N5	BANP_HUMAN	BTG3 associated nuclear protein isoform b	371	DNA-binding (By similarity).|Gln-rich.				cell cycle|chromatin modification|multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding				0				BRCA - Breast invasive adenocarcinoma(80;0.00551)		GCCCTGCACTACGCGCTGGCC	0.642													10	10	---	---	---	---	PASS
TP53	7157	broad.mit.edu	37	17	7578457	7578457	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7578457C>A	uc002gim.2	-	5	667	c.473G>T	c.(472-474)CGC>CTC	p.R158L	TP53_uc002gig.1_Missense_Mutation_p.R158L|TP53_uc002gih.2_Missense_Mutation_p.R158L|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Missense_Mutation_p.R26L|TP53_uc010cng.1_Missense_Mutation_p.R26L|TP53_uc002gii.1_Missense_Mutation_p.R26L|TP53_uc010cnh.1_Missense_Mutation_p.R158L|TP53_uc010cni.1_Missense_Mutation_p.R158L|TP53_uc002gij.2_Missense_Mutation_p.R158L|TP53_uc010cnj.1_RNA|TP53_uc002gin.2_Missense_Mutation_p.R65L|TP53_uc002gio.2_Missense_Mutation_p.R26L|TP53_uc010vug.1_Missense_Mutation_p.R119L	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	158	Required for interaction with FBXO42.||Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).		R -> F (in a sporadic cancer; somatic mutation; requires 2 nucleotide substitutions).|R -> H (in LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> C (in sporadic cancers; somatic mutation).|R -> P (in sporadic cancers; somatic mutation).|R -> S (in sporadic cancers; somatic mutation).|R -> Q (in a sporadic cancer; somatic mutation).|R -> G (in LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> L (in sporadic cancers; somatic mutation).|R -> Y (in a sporadic cancer; somatic mutation; requires 2 nucleotide substitutions).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.R158H(58)|p.R158L(55)|p.R158C(17)|p.R158G(10)|p.R158P(9)|p.0?(7)|p.R158R(6)|p.R158fs*12(5)|p.R158_A159insX(4)|p.R158_A159delRA(2)|p.R156_I162delRVRAMAI(2)|p.V157fs*9(2)|p.P153fs*22(2)|p.R158fs*11(2)|p.V157fs*22(2)|p.V157_C176del20(1)|p.R156_A161delRVRAMA(1)|p.R158F(1)|p.P151_V173del23(1)|p.R158fs*24(1)|p.R65L(1)|p.R156_R158delRVR(1)|p.R156fs*18(1)|p.R156_A161del(1)|p.R158_A159insXX(1)|p.V157_M160delVRAM(1)|p.V157_R158delVR(1)|p.S149fs*72(1)|p.A159fs*21(1)|p.T155_A161delTRVRAMA(1)|p.G154fs*22(1)|p.R156fs*20(1)|p.V157_I162delVRAMAI(1)|p.R26L(1)|p.V157fs*21(1)|p.R158fs*8(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)		GGCCATGGCGCGGACGCGGGT	0.627		111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			37	37	---	---	---	---	PASS
PFAS	5198	broad.mit.edu	37	17	8161209	8161209	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8161209A>G	uc002gkr.2	+	10	1301	c.1160A>G	c.(1159-1161)AAT>AGT	p.N387S	PFAS_uc010vuv.1_5'UTR	NM_012393	NP_036525	O15067	PUR4_HUMAN	phosphoribosylformylglycinamidine synthase	387					'de novo' IMP biosynthetic process|glutamine metabolic process|purine base metabolic process	cytosol	ATP binding|phosphoribosylformylglycinamidine synthase activity|protein binding			ovary(2)|central_nervous_system(2)|pancreas(1)	5					L-Glutamic Acid(DB00142)|L-Glutamine(DB00130)	GAAGCCAGTAATGGAGCTTCT	0.572													48	33	---	---	---	---	PASS
PIK3R5	23533	broad.mit.edu	37	17	8793402	8793402	+	Silent	SNP	G	T	T	rs150952108	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:8793402G>T	uc002glt.2	-	8	766	c.699C>A	c.(697-699)ACC>ACA	p.T233T	PIK3R5_uc010vuz.1_Silent_p.T233T|PIK3R5_uc002glu.3_5'UTR|PIK3R5_uc010coa.1_Intron|PIK3R5_uc010cob.1_5'UTR	NM_014308	NP_055123	Q8WYR1	PI3R5_HUMAN	phosphoinositide-3-kinase, regulatory subunit 5	233				AKTLAELEDIFTETAEAQELASGIGDAAEARRWLRTKLQAV GEKAGFPGVLDTAKPGKLHTIPIPVARCYTYSWSQDS -> TLQNQGSSIPSPSLSPGATPTAGARTALTSCRKSCSRNRSC SSQGSWEMMKRRKRRRRRWRRTWKLMGTVPREIPCSP (in Ref. 6; AAW63122).	platelet activation	cytosol|membrane|nucleus				breast(2)|large_intestine(1)|central_nervous_system(1)|skin(1)	5						GTGCCTCTGCGGTCTCCGTGA	0.627													44	43	---	---	---	---	PASS
MYH4	4622	broad.mit.edu	37	17	10352044	10352044	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10352044G>T	uc002gmn.2	-	32	4533	c.4422C>A	c.(4420-4422)TCC>TCA	p.S1474S	uc002gml.1_Intron	NM_017533	NP_060003	Q9Y623	MYH4_HUMAN	myosin, heavy polypeptide 4, skeletal muscle	1474	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(10)|skin(2)|central_nervous_system(1)	13						ACTCCTTCTGGGAGGCCTCAA	0.443													49	46	---	---	---	---	PASS
MYH4	4622	broad.mit.edu	37	17	10352088	10352088	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10352088A>T	uc002gmn.2	-	32	4489	c.4378T>A	c.(4378-4380)TGG>AGG	p.W1460R	uc002gml.1_Intron	NM_017533	NP_060003	Q9Y623	MYH4_HUMAN	myosin, heavy polypeptide 4, skeletal muscle	1460	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(10)|skin(2)|central_nervous_system(1)	13						TTCTGTTTCCATTCTGCCAGA	0.478													34	40	---	---	---	---	PASS
MYH3	4621	broad.mit.edu	37	17	10551951	10551951	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10551951G>C	uc002gmq.1	-	7	735	c.658C>G	c.(658-660)CAA>GAA	p.Q220E		NM_002470	NP_002461	P11055	MYH3_HUMAN	myosin, heavy chain 3, skeletal muscle,	220	Myosin head-like.				muscle filament sliding|muscle organ development	cytosol|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|microfilament motor activity			ovary(4)|central_nervous_system(2)|pancreas(1)	7						CTGATGATTTGATCTTCCAGA	0.353													51	39	---	---	---	---	PASS
KCNJ12	3768	broad.mit.edu	37	17	21319870	21319870	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:21319870C>T	uc002gyv.1	+	3	1921	c.1216C>T	c.(1216-1218)CCC>TCC	p.P406S		NM_021012	NP_066292	Q14500	IRK12_HUMAN	potassium inwardly-rectifying channel, subfamily	406	Cytoplasmic (By similarity).				blood circulation|muscle contraction|regulation of heart contraction|synaptic transmission	integral to membrane	inward rectifier potassium channel activity|ion channel inhibitor activity|potassium channel regulator activity			ovary(3)|skin(1)	4				Colorectal(15;0.0183)|COAD - Colon adenocarcinoma(3;0.0732)	Dofetilide(DB00204)	CGGCCTCAGCCCCCAGGCCAG	0.662										Prostate(3;0.18)			9	30	---	---	---	---	PASS
TAOK1	57551	broad.mit.edu	37	17	27794157	27794157	+	Intron	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27794157C>G	uc002hdz.1	+						TAOK1_uc010wbe.1_Intron|TAOK1_uc010wbf.1_Intron	NM_020791	NP_065842	Q7L7X3	TAOK1_HUMAN	TAO kinase 1						mitotic prometaphase	cytosol|intracellular membrane-bounded organelle	ATP binding|protein serine/threonine kinase activity			upper_aerodigestive_tract(1)|lung(1)|central_nervous_system(1)|skin(1)	4			Colorectal(6;0.198)			TTTCTTTCTTCTTTAGGCACG	0.353													40	84	---	---	---	---	PASS
AATF	26574	broad.mit.edu	37	17	35307502	35307502	+	Intron	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:35307502C>T	uc002hni.2	+						AATF_uc002hnj.2_Intron	NM_012138	NP_036270	Q9NY61	AATF_HUMAN	apoptosis antagonizing transcription factor						anti-apoptosis|apoptosis|induction of apoptosis by extracellular signals|negative regulation of superoxide anion generation|nerve growth factor receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|response to DNA damage stimulus	centrosome|focal adhesion|nucleolus	leucine zipper domain binding|sequence-specific DNA binding transcription factor activity				0		Breast(25;0.00607)				ACTTTTCCCTCTCCCCCGACA	0.284													69	176	---	---	---	---	PASS
AATF	26574	broad.mit.edu	37	17	35343921	35343921	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:35343921A>G	uc002hni.2	+	5	1089	c.838A>G	c.(838-840)AAG>GAG	p.K280E	AATF_uc002hnj.2_RNA	NM_012138	NP_036270	Q9NY61	AATF_HUMAN	apoptosis antagonizing transcription factor	280	POLR2J binding.				anti-apoptosis|apoptosis|induction of apoptosis by extracellular signals|negative regulation of superoxide anion generation|nerve growth factor receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|response to DNA damage stimulus	centrosome|focal adhesion|nucleolus	leucine zipper domain binding|sequence-specific DNA binding transcription factor activity				0		Breast(25;0.00607)				CCCAGGTCACAAGGCACTTAA	0.423													106	114	---	---	---	---	PASS
WNK4	65266	broad.mit.edu	37	17	40937114	40937114	+	Splice_Site	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40937114G>C	uc002ibj.2	+	5	1192	c.1171_splice	c.e5-1	p.G391_splice	WNK4_uc010wgx.1_Intron|WNK4_uc002ibk.1_Splice_Site_p.G163_splice|WNK4_uc010wgy.1_5'Flank	NM_032387	NP_115763	Q96J92	WNK4_HUMAN	WNK lysine deficient protein kinase 4						intracellular protein kinase cascade	tight junction	ATP binding|protein serine/threonine kinase activity			ovary(3)|skin(3)|stomach(1)	7		Breast(137;0.000143)		BRCA - Breast invasive adenocarcinoma(366;0.0749)		CCCTTCCCCAGGGCAGAAAGC	0.552													8	18	---	---	---	---	PASS
HLF	3131	broad.mit.edu	37	17	53342907	53342907	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:53342907T>C	uc002iug.1	+	1	587	c.62T>C	c.(61-63)GTG>GCG	p.V21A	HLF_uc010dce.1_5'Flank|HLF_uc002iuh.2_5'Flank|HLF_uc010wni.1_5'Flank	NM_002126	NP_002117	Q16534	HLF_HUMAN	hepatic leukemia factor	21					multicellular organismal development|rhythmic process|transcription from RNA polymerase II promoter	nucleus	double-stranded DNA binding|protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)	2						CCCTACGGCGTGCTCAGGTCC	0.607			T	TCF3	ALL								7	61	---	---	---	---	PASS
COIL	8161	broad.mit.edu	37	17	55027410	55027410	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:55027410T>C	uc002iuu.2	-	2	1224	c.1193A>G	c.(1192-1194)GAA>GGA	p.E398G		NM_004645	NP_004636	P38432	COIL_HUMAN	coilin	398	2 X 4 AA repeats of S-L-P-A.					Cajal body|nucleolus	protein C-terminus binding			ovary(1)	1	Breast(9;6.15e-08)					AAGGTTCTCTTCTCTACCCCA	0.547													65	163	---	---	---	---	PASS
TANC2	26115	broad.mit.edu	37	17	61396404	61396404	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61396404G>A	uc002jal.3	+	9	1329	c.1306G>A	c.(1306-1308)GAA>AAA	p.E436K	TANC2_uc010wpe.1_Missense_Mutation_p.E346K	NM_025185	NP_079461	Q9HCD6	TANC2_HUMAN	tetratricopeptide repeat, ankyrin repeat and	436							binding			ovary(2)	2						AGGAACTCCGGAAATGCGCAG	0.512													18	58	---	---	---	---	PASS
FAM100B	283991	broad.mit.edu	37	17	74261643	74261643	+	Silent	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74261643G>A	uc010wsy.1	+	1	358	c.57G>A	c.(55-57)CTG>CTA	p.L19L		NM_182565	NP_872371	Q8IYN6	F100B_HUMAN	hypothetical protein LOC283991	19										central_nervous_system(1)	1			LUSC - Lung squamous cell carcinoma(166;0.187)			AGTTCGTGCTGGCCGCGGGCT	0.448													8	31	---	---	---	---	PASS
NOTUM	147111	broad.mit.edu	37	17	79914950	79914950	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79914950G>T	uc010wvg.1	-	7	968	c.696C>A	c.(694-696)AGC>AGA	p.S232R		NM_178493	NP_848588	Q6P988	NOTUM_HUMAN	notum pectinacetylesterase homolog precursor	232		Charge relay system (By similarity).				extracellular region	hydrolase activity				0	all_neural(118;0.0878)|Ovarian(332;0.12)		BRCA - Breast invasive adenocarcinoma(99;0.0114)|OV - Ovarian serous cystadenocarcinoma(97;0.0382)			TGCCCCCCGCGCTGCAAGGAG	0.697													16	14	---	---	---	---	PASS
RAB40B	10966	broad.mit.edu	37	17	80618872	80618872	+	Silent	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80618872C>A	uc002kft.2	-	3	381	c.255G>T	c.(253-255)CGG>CGT	p.R85R	RAB40B_uc002kfs.2_RNA	NM_006822	NP_006813	Q12829	RB40B_HUMAN	RAB40B, member RAS oncogene family	85					protein transport|small GTPase mediated signal transduction	plasma membrane	GTP binding			central_nervous_system(1)	1	Breast(20;0.00132)|all_neural(118;0.0952)	all_cancers(8;0.072)|all_epithelial(8;0.139)	BRCA - Breast invasive adenocarcinoma(99;0.0262)|OV - Ovarian serous cystadenocarcinoma(97;0.061)			CCTGTGCGCCCCGGGAGTAGG	0.448													27	36	---	---	---	---	PASS
CEP192	55125	broad.mit.edu	37	18	13048922	13048922	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13048922C>G	uc010xac.1	+	16	2212	c.2132C>G	c.(2131-2133)TCT>TGT	p.S711C	CEP192_uc010dlf.1_RNA|CEP192_uc010xad.1_Missense_Mutation_p.S236C|CEP192_uc002kru.2_RNA|CEP192_uc002krs.1_Missense_Mutation_p.S452C	NM_032142	NP_115518	E9PF99	E9PF99_HUMAN	centrosomal protein 192kDa	711										ovary(4)|pancreas(1)	5						AGTGGTGATTCTATGCTTAGG	0.388													26	60	---	---	---	---	PASS
ZNF519	162655	broad.mit.edu	37	18	14124406	14124406	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:14124406G>C	uc002kst.1	-	2	226	c.73C>G	c.(73-75)CAA>GAA	p.Q25E	ZNF519_uc002ksq.1_RNA|ZNF519_uc002ksr.1_Intron|ZNF519_uc010dlm.1_RNA	NM_145287	NP_660330	Q8TB69	ZN519_HUMAN	zinc finger protein 519	25	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						AAATTCTGTTGGGCAGGGTCT	0.423													69	135	---	---	---	---	PASS
CDH2	1000	broad.mit.edu	37	18	25565543	25565543	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:25565543G>T	uc002kwg.2	-	12	2383	c.1924C>A	c.(1924-1926)CCT>ACT	p.P642T	CDH2_uc010xbn.1_Missense_Mutation_p.P611T	NM_001792	NP_001783	P19022	CADH2_HUMAN	cadherin 2, type 1 preproprotein	642	Extracellular (Potential).|Cadherin 5.				adherens junction organization|cell junction assembly|positive regulation of muscle cell differentiation	catenin complex|integral to membrane	alpha-catenin binding|beta-catenin binding|calcium ion binding|gamma-catenin binding			ovary(3)|lung(1)	4						GGAGATAAAGGAAGATCAAAA	0.368													32	103	---	---	---	---	PASS
RNF138	51444	broad.mit.edu	37	18	29693742	29693742	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:29693742C>G	uc002kxg.2	+	4	750	c.311C>G	c.(310-312)TCT>TGT	p.S104C	RNF138_uc002kxh.2_Intron	NM_016271	NP_057355	Q8WVD3	RN138_HUMAN	ring finger protein 138 isoform 1	104					Wnt receptor signaling pathway	intracellular	ligase activity|protein kinase binding|zinc ion binding				0						CATTACAAATCTTGTAAGAAG	0.294													22	73	---	---	---	---	PASS
SETBP1	26040	broad.mit.edu	37	18	42532904	42532904	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:42532904T>C	uc010dni.2	+	4	3895	c.3599T>C	c.(3598-3600)GTG>GCG	p.V1200A		NM_015559	NP_056374	Q9Y6X0	SETBP_HUMAN	SET binding protein 1 isoform a	1200						nucleus	DNA binding			upper_aerodigestive_tract(2)|large_intestine(1)	3				Colorectal(1;0.0622)|COAD - Colon adenocarcinoma(74;0.201)		CTCCCGCTGGTGAGTGAGAAG	0.532									Schinzel-Giedion_syndrome				37	83	---	---	---	---	PASS
CXXC1	30827	broad.mit.edu	37	18	47813213	47813213	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:47813213C>G	uc002leq.3	-	2	752	c.19G>C	c.(19-21)GAC>CAC	p.D7H	CXXC1_uc002lep.3_5'UTR|CXXC1_uc002ler.3_Missense_Mutation_p.D7H|CXXC1_uc010doy.2_Missense_Mutation_p.D7H|CXXC1_uc002les.2_Missense_Mutation_p.D7H	NM_014593	NP_055408	Q9P0U4	CXXC1_HUMAN	CXXC finger 1 (PHD domain) isoform 2	7					histone H3-K4 methylation|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear speck|Set1C/COMPASS complex	protein binding|unmethylated CpG binding|zinc ion binding			upper_aerodigestive_tract(1)|ovary(1)	2						GGCTCTGGGTCTGAACCATCT	0.597													18	111	---	---	---	---	PASS
CPLX4	339302	broad.mit.edu	37	18	56963953	56963953	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:56963953C>G	uc002lhy.2	-	3	647	c.460G>C	c.(460-462)GAG>CAG	p.E154Q		NM_181654	NP_857637	Q7Z7G2	CPLX4_HUMAN	complexin 4 precursor	154					exocytosis|neurotransmitter transport	cell junction|synapse	syntaxin binding			ovary(1)	1		Colorectal(73;0.175)				CACTTCTGCTCCGCTGTCTGC	0.502													28	19	---	---	---	---	PASS
CDH19	28513	broad.mit.edu	37	18	64197172	64197172	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:64197172C>T	uc002lkc.1	-	9	1506	c.1368G>A	c.(1366-1368)CTG>CTA	p.L456L	CDH19_uc010dql.1_RNA|CDH19_uc010xey.1_Silent_p.L456L	NM_021153	NP_066976	Q9H159	CAD19_HUMAN	cadherin 19, type 2 preproprotein	456	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(1)|skin(1)	2		Esophageal squamous(42;0.0132)				CTTGCACATACAGTGGGATCG	0.318													30	152	---	---	---	---	PASS
CCDC102B	79839	broad.mit.edu	37	18	66678309	66678309	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:66678309C>A	uc002lkk.2	+	9	1625	c.1402C>A	c.(1402-1404)CTA>ATA	p.L468I	CCDC102B_uc002lki.2_Missense_Mutation_p.L468I	NM_001093729	NP_001087198	Q68D86	C102B_HUMAN	coiled-coil domain containing 102B	468	Potential.									ovary(1)|lung(1)|skin(1)	3		Esophageal squamous(42;0.0559)|Colorectal(73;0.0604)				AGTGGAAGAACTAAAGCAGGG	0.373													25	29	---	---	---	---	PASS
TSHZ1	10194	broad.mit.edu	37	18	72999377	72999377	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:72999377C>A	uc002lly.2	+	2	2443	c.1880C>A	c.(1879-1881)CCC>CAC	p.P627H		NM_005786	NP_005777	Q6ZSZ6	TSH1_HUMAN	teashirt family zinc finger 1	672						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Esophageal squamous(42;0.129)|Prostate(75;0.142)|Melanoma(33;0.211)		Colorectal(1;0.000501)|READ - Rectum adenocarcinoma(2;0.00226)|BRCA - Breast invasive adenocarcinoma(31;0.246)		GCTGCGTCCCCCATAGCAAAA	0.557													42	47	---	---	---	---	PASS
TMPRSS9	360200	broad.mit.edu	37	19	2422036	2422036	+	Missense_Mutation	SNP	C	T	T	rs139183825		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2422036C>T	uc010xgx.1	+	13	2237	c.2237C>T	c.(2236-2238)TCG>TTG	p.S746L		NM_182973	NP_892018	Q7Z410	TMPS9_HUMAN	transmembrane protease, serine 9	746	Extracellular (Potential).				proteolysis	integral to plasma membrane	serine-type endopeptidase activity			ovary(1)|central_nervous_system(1)	2				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		TCTCCCCCCTCGACCACAAGG	0.662													45	68	---	---	---	---	PASS
FSD1	79187	broad.mit.edu	37	19	4311905	4311905	+	Nonsense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4311905G>A	uc002lzy.2	+	7	710	c.557G>A	c.(556-558)TGG>TAG	p.W186*	FSD1_uc002lzz.2_Nonsense_Mutation_p.W186*|FSD1_uc002maa.2_5'UTR	NM_024333	NP_077309	Q9BTV5	FSD1_HUMAN	fibronectin type III and SPRY domain containing	186	Fibronectin type-III.				cell division|mitosis	cleavage furrow|microtubule|microtubule organizing center|nucleus				skin(1)	1				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.034)|STAD - Stomach adenocarcinoma(1328;0.18)		ACCCTGGTGTGGCGCATGCCG	0.637													35	72	---	---	---	---	PASS
NDUFA7	4701	broad.mit.edu	37	19	8385731	8385731	+	Intron	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8385731G>C	uc002mjm.1	-						RPS28_uc002mjn.2_5'Flank	NM_005001	NP_004992	O95182	NDUA7_HUMAN	NADH dehydrogenase (ubiquinone) 1 alpha						mitochondrial electron transport, NADH to ubiquinone|transport	mitochondrial respiratory chain complex I	NADH dehydrogenase (ubiquinone) activity				0					NADH(DB00157)	AGCGAGCGGGGCCTGCTCACC	0.602													36	148	---	---	---	---	PASS
MYO1F	4542	broad.mit.edu	37	19	8590351	8590351	+	Intron	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8590351G>A	uc002mkg.2	-							NM_012335	NP_036467	O00160	MYO1F_HUMAN	myosin IF							unconventional myosin complex	actin binding|ATP binding|calmodulin binding|motor activity			ovary(2)|skin(1)	3						AGCAAGGGACGCAGCTCCTCA	0.552													17	79	---	---	---	---	PASS
COL5A3	50509	broad.mit.edu	37	19	10080291	10080291	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10080291C>A	uc002mmq.1	-	56	4144	c.4058G>T	c.(4057-4059)CGT>CTT	p.R1353L		NM_015719	NP_056534	P25940	CO5A3_HUMAN	collagen, type V, alpha 3 preproprotein	1353	Triple-helical region.				collagen fibril organization|skin development	collagen type V	collagen binding|extracellular matrix structural constituent			ovary(7)|lung(1)|central_nervous_system(1)|skin(1)	10			Epithelial(33;7.11e-05)			AGGCCCCACACGTCCAGGGGG	0.682													17	23	---	---	---	---	PASS
ZNF763	284390	broad.mit.edu	37	19	12089390	12089390	+	Silent	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12089390C>T	uc002msw.2	+	4	806	c.651C>T	c.(649-651)ATC>ATT	p.I217I	ZNF763_uc010xmf.1_Silent_p.I237I|ZNF763_uc002msv.2_Silent_p.I220I|ZNF763_uc010xmg.1_Silent_p.I95I	NM_001012753	NP_001012771	Q0D2J5	ZN763_HUMAN	zinc finger protein 763	217	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			central_nervous_system(1)	1						TATATCTTATCCATGAAAGAA	0.383													9	94	---	---	---	---	PASS
TNPO2	30000	broad.mit.edu	37	19	12817544	12817544	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12817544C>G	uc002muo.2	-	13	1521	c.1336G>C	c.(1336-1338)GAT>CAT	p.D446H	TNPO2_uc002mup.2_Missense_Mutation_p.D538H|TNPO2_uc002muq.2_Missense_Mutation_p.D446H|TNPO2_uc002mur.2_Missense_Mutation_p.D446H|SNORD41_uc002mut.1_5'Flank	NM_001136196	NP_001129668	O14787	TNPO2_HUMAN	transportin 2 (importin 3, karyopherin beta 2b)	446	HEAT 7.				intracellular protein transport	cytoplasm|nucleus	nuclear localization sequence binding|protein binding|protein transporter activity			ovary(1)	1						GCCTTCTTATCCGACAGGCAC	0.617													10	16	---	---	---	---	PASS
ZNF486	90649	broad.mit.edu	37	19	20296798	20296798	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:20296798A>T	uc002nou.2	+	3	217	c.160A>T	c.(160-162)ATT>TTT	p.I54F		NM_052852	NP_443084	Q96H40	ZN486_HUMAN	zinc finger protein 486	54	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1						TGAAACAGGTATTATTGTCTC	0.358													16	56	---	---	---	---	PASS
ZNF208	7757	broad.mit.edu	37	19	22154685	22154685	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22154685G>T	uc002nqp.2	-	6	2916	c.2767C>A	c.(2767-2769)CAT>AAT	p.H923N	ZNF208_uc002nqo.1_Intron	NM_007153	NP_009084			zinc finger protein 208											ovary(5)|skin(2)	7		all_lung(12;0.0961)|Lung NSC(12;0.103)				TCTCCAGCATGAGTTGCCTTA	0.458													35	154	---	---	---	---	PASS
ZNF676	163223	broad.mit.edu	37	19	22364023	22364023	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22364023C>T	uc002nqs.1	-	3	814	c.496G>A	c.(496-498)GAG>AAG	p.E166K		NM_001001411	NP_001001411	Q8N7Q3	ZN676_HUMAN	zinc finger protein 676	166					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Lung NSC(12;0.0207)|all_lung(12;0.0214)|all_epithelial(12;0.114)				TAGGAATTCTCTCTAGTATAA	0.343													53	75	---	---	---	---	PASS
ZNF675	171392	broad.mit.edu	37	19	23836897	23836897	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:23836897C>G	uc002nri.2	-	4	1020	c.838G>C	c.(838-840)GGA>CGA	p.G280R		NM_138330	NP_612203	Q8TD23	ZN675_HUMAN	zinc finger protein 675	280					bone resorption|cytokine-mediated signaling pathway|hemopoiesis|I-kappaB kinase/NF-kappaB cascade|negative regulation of JNK cascade|negative regulation of osteoclast differentiation|negative regulation of protein kinase activity|negative regulation of transcription, DNA-dependent|regulation of ossification|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)|kidney(1)	2		all_lung(12;0.11)|Lung NSC(12;0.163)|all_epithelial(12;0.206)				GGTTTCTCTCCTGTATGAATT	0.363													40	61	---	---	---	---	PASS
KIAA0355	9710	broad.mit.edu	37	19	34791812	34791812	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:34791812A>G	uc002nvd.3	+	2	1293	c.434A>G	c.(433-435)GAA>GGA	p.E145G	KIAA0355_uc010edk.1_Missense_Mutation_p.E135G	NM_014686	NP_055501	O15063	K0355_HUMAN	hypothetical protein LOC9710	145										ovary(1)	1	Esophageal squamous(110;0.162)					ATGCTAATGGAACTTAGTGCT	0.473													32	80	---	---	---	---	PASS
RYR1	6261	broad.mit.edu	37	19	38968482	38968482	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38968482G>T	uc002oit.2	+	30	4556	c.4426G>T	c.(4426-4428)GGG>TGG	p.G1476W	RYR1_uc002oiu.2_Missense_Mutation_p.G1476W	NM_000540	NP_000531	P21817	RYR1_HUMAN	skeletal muscle ryanodine receptor isoform 1	1476	Cytoplasmic.|B30.2/SPRY 3.|6 X approximate repeats.				muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)	GGTGACCATGGGGGATGAACA	0.672													23	277	---	---	---	---	PASS
FCGBP	8857	broad.mit.edu	37	19	40411910	40411910	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40411910C>G	uc002omp.3	-	7	3726	c.3718G>C	c.(3718-3720)GGC>CGC	p.G1240R		NM_003890	NP_003881	Q9Y6R7	FCGBP_HUMAN	Fc fragment of IgG binding protein precursor	1240						extracellular region	protein binding			ovary(4)|skin(4)|central_nervous_system(1)	9	all_cancers(60;6.03e-06)|all_lung(34;5.58e-08)|Lung NSC(34;6.62e-08)|Ovarian(47;0.06)		Epithelial(26;6.25e-23)|all cancers(26;1.13e-20)			CCCAAGCTGCCACCGGATGGC	0.672													24	17	---	---	---	---	PASS
ZNF574	64763	broad.mit.edu	37	19	42584936	42584936	+	Silent	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42584936A>G	uc002osm.3	+	2	2347	c.2178A>G	c.(2176-2178)ACA>ACG	p.T726T	ZNF574_uc002osk.3_Silent_p.T816T	NM_022752	NP_073589	Q6ZN55	ZN574_HUMAN	zinc finger protein 574	726	Ala-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Prostate(69;0.059)				GCACTGCTACAGCATCCCCTG	0.677													56	54	---	---	---	---	PASS
LILRA1	11024	broad.mit.edu	37	19	55107968	55107968	+	Intron	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55107968G>A	uc002qgh.1	+						LILRA1_uc010yfh.1_Intron	NM_006863	NP_006854	O75019	LIRA1_HUMAN	leukocyte immunoglobulin-like receptor,						cell surface receptor linked signaling pathway|defense response|regulation of immune response	integral to membrane|plasma membrane	antigen binding|transmembrane receptor activity			skin(2)|ovary(1)	3				GBM - Glioblastoma multiforme(193;0.0348)		TGAGGGCCCTGACCCTGTCCT	0.557													49	42	---	---	---	---	PASS
NCR1	9437	broad.mit.edu	37	19	55421426	55421426	+	Splice_Site	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55421426G>T	uc002qib.2	+	5	720	c.682_splice	c.e5+1	p.A228_splice	NCR1_uc002qic.2_Splice_Site_p.D228_splice|NCR1_uc002qie.2_Splice_Site_p.D228_splice|NCR1_uc002qid.2_Splice_Site_p.A133_splice|NCR1_uc002qif.2_Splice_Site_p.D133_splice|NCR1_uc010esj.2_Splice_Site_p.A121_splice	NM_004829	NP_004820	O76036	NCTR1_HUMAN	natural cytotoxicity triggering receptor 1						cellular defense response|natural killer cell activation|regulation of natural killer cell mediated cytotoxicity	integral to plasma membrane|SWI/SNF complex	receptor activity|receptor signaling protein activity			large_intestine(1)|ovary(1)	2				GBM - Glioblastoma multiforme(193;0.0449)		ACCTTTCCTGGTGAGTAACTG	0.433													110	123	---	---	---	---	PASS
SNRPB	6628	broad.mit.edu	37	20	2444418	2444418	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:2444418C>A	uc002wfz.1	-	4	558	c.395G>T	c.(394-396)CGT>CTT	p.R132L	SNRPB_uc002wga.1_Missense_Mutation_p.R132L|SNRPB_uc010zpv.1_Missense_Mutation_p.R53L|SNRPB_uc002wgb.2_Missense_Mutation_p.R132L|SNORD119_uc010gam.1_5'Flank	NM_198216	NP_937859	P14678	RSMB_HUMAN	small nuclear ribonucleoprotein polypeptide B/B'	132					histone mRNA metabolic process|ncRNA metabolic process|spliceosomal snRNP assembly|termination of RNA polymerase II transcription	catalytic step 2 spliceosome|cytosol|nucleoplasm|U12-type spliceosomal complex|U7 snRNP	protein binding|protein binding|RNA binding			ovary(1)	1						GCCAACCCCACGGACTGGCCC	0.617													111	181	---	---	---	---	PASS
TMX4	56255	broad.mit.edu	37	20	7980393	7980393	+	Silent	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:7980393G>T	uc002wmx.1	-	4	586	c.453C>A	c.(451-453)TCC>TCA	p.S151S		NM_021156	NP_066979	Q9H1E5	TMX4_HUMAN	thioredoxin-related transmembrane protein 4	151					cell redox homeostasis|electron transport chain|transport	integral to membrane					0						GAGAAGCCGGGGATTTCCAGC	0.418													16	57	---	---	---	---	PASS
DYNLRB1	83658	broad.mit.edu	37	20	33122575	33122575	+	Missense_Mutation	SNP	A	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33122575A>G	uc002xal.2	+	3	283	c.223A>G	c.(223-225)AAA>GAA	p.K75E	DYNLRB1_uc010zuk.1_Missense_Mutation_p.K75E|DYNLRB1_uc002xam.2_RNA|DYNLRB1_uc002xan.2_RNA	NM_014183	NP_054902	Q9NP97	DLRB1_HUMAN	Roadblock-1	75					microtubule-based movement|transport|visual behavior	centrosome|cytoplasmic dynein complex|microtubule	microtubule motor activity				0						TCGCTCCAAGAAAAATGAAAT	0.527													10	65	---	---	---	---	PASS
MANBAL	63905	broad.mit.edu	37	20	35944790	35944790	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35944790C>T	uc002xgu.2	+	4	442	c.230C>T	c.(229-231)CCC>CTC	p.P77L	MANBAL_uc002xgv.2_Missense_Mutation_p.P77L|MANBAL_uc002xgw.2_RNA|MANBAL_uc010gfx.2_RNA|MANBAL_uc010gfy.2_RNA	NM_022077	NP_071360	Q9NQG1	MANBL_HUMAN	mannosidase, beta A, lysosomal-like	77						integral to membrane					0		Myeloproliferative disorder(115;0.00878)				AACAAGAGGCCCAAGAAAGAG	0.562													16	86	---	---	---	---	PASS
VSTM2L	128434	broad.mit.edu	37	20	36561994	36561994	+	Intron	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:36561994G>C	uc002xhk.3	+							NM_080607	NP_542174	Q96N03	VTM2L_HUMAN	V-set and transmembrane domain containing 2 like											ovary(1)|central_nervous_system(1)	2		Myeloproliferative disorder(115;0.00878)				AAATAAGTGTGAGTTTTGATA	0.498													12	62	---	---	---	---	PASS
TOP1	7150	broad.mit.edu	37	20	39704921	39704921	+	Missense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:39704921G>A	uc002xjl.2	+	4	512	c.266G>A	c.(265-267)CGA>CAA	p.R89Q	TOP1_uc010gge.1_RNA	NM_003286	NP_003277	P11387	TOP1_HUMAN	DNA topoisomerase I	89	Lys-rich.				DNA topological change|interspecies interaction between organisms|phosphorylation|programmed cell death|response to drug	chromosome|nucleolus|nucleoplasm	ATP binding|chromatin DNA binding|DNA topoisomerase (ATP-hydrolyzing) activity|DNA topoisomerase type I activity|protein binding			breast(3)|ovary(2)|central_nervous_system(1)|kidney(1)	7		Myeloproliferative disorder(115;0.00878)			Irinotecan(DB00762)|Lucanthone(DB04967)|Topotecan(DB01030)	aaggaaaaacgaaaaGAGGAA	0.199			T	NUP98	AML*								24	73	---	---	---	---	PASS
PRIC285	85441	broad.mit.edu	37	20	62195014	62195014	+	Nonsense_Mutation	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62195014G>A	uc002yfm.2	-	9	6053	c.5161C>T	c.(5161-5163)CAG>TAG	p.Q1721*	PRIC285_uc002yfl.1_Nonsense_Mutation_p.Q1152*	NM_001037335	NP_001032412	Q9BYK8	PR285_HUMAN	PPAR-alpha interacting complex protein 285	1721					cellular lipid metabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm	ATP binding|DNA binding|helicase activity|ribonuclease activity|RNA binding|transcription coactivator activity|zinc ion binding			central_nervous_system(2)	2	all_cancers(38;2.51e-11)|all_epithelial(29;8.27e-13)		Epithelial(9;1.27e-08)|all cancers(9;7.32e-08)|BRCA - Breast invasive adenocarcinoma(10;5.15e-06)			GCCCGCCGCTGATAGCTCTGG	0.692													5	7	---	---	---	---	PASS
ZBTB46	140685	broad.mit.edu	37	20	62421809	62421809	+	Missense_Mutation	SNP	T	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62421809T>A	uc002ygv.1	-	2	503	c.302A>T	c.(301-303)AAC>ATC	p.N101I	ZBTB46_uc002ygu.2_RNA	NM_025224	NP_079500	Q86UZ6	ZBT46_HUMAN	zinc finger and BTB domain containing 46	101					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	nucleic acid binding|zinc ion binding			large_intestine(1)|ovary(1)	2	all_cancers(38;2.09e-12)|all_epithelial(29;3.8e-14)|Lung NSC(23;7.61e-10)|all_lung(23;2.64e-09)					CTCGATGACGTTCCTGCTGGT	0.607													15	44	---	---	---	---	PASS
MYT1	4661	broad.mit.edu	37	20	62853343	62853343	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62853343C>T	uc002yii.2	+	14	2703	c.2339C>T	c.(2338-2340)ACC>ATC	p.T780I	MYT1_uc002yih.2_Missense_Mutation_p.T482I|MYT1_uc002yij.2_Missense_Mutation_p.T439I	NM_004535	NP_004526	Q01538	MYT1_HUMAN	myelin transcription factor 1	780					cell differentiation|nervous system development	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)	2	all_cancers(38;1.82e-11)|all_epithelial(29;3.3e-13)|Lung NSC(23;5.21e-10)|all_lung(23;1.92e-09)					GGGGAAGTCACCCTGACCAAC	0.517													40	73	---	---	---	---	PASS
POTEH	23784	broad.mit.edu	37	22	16287519	16287519	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:16287519G>C	uc010gqp.2	-	1	419	c.367C>G	c.(367-369)CAC>GAC	p.H123D	POTEH_uc002zlg.1_5'Flank|POTEH_uc002zlh.1_5'Flank|POTEH_uc002zlj.1_Intron	NM_001136213	NP_001129685	Q6S545	POTEH_HUMAN	ANKRD26-like family C, member 3	123										skin(1)	1						GAGTCGTCGTGGTCTCCAGAA	0.602													96	525	---	---	---	---	PASS
POTEH	23784	broad.mit.edu	37	22	16287598	16287598	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:16287598G>T	uc010gqp.2	-	1	340	c.288C>A	c.(286-288)AGC>AGA	p.S96R	POTEH_uc002zlg.1_5'Flank|POTEH_uc002zlh.1_5'Flank|POTEH_uc002zlj.1_5'UTR	NM_001136213	NP_001129685	Q6S545	POTEH_HUMAN	ANKRD26-like family C, member 3	96										skin(1)	1						TGCCCATCTTGCTCCTGAGTG	0.602													68	374	---	---	---	---	PASS
CECR2	27443	broad.mit.edu	37	22	18028483	18028483	+	Missense_Mutation	SNP	A	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:18028483A>T	uc010gqw.1	+	16	3566	c.3440A>T	c.(3439-3441)CAT>CTT	p.H1147L	CECR2_uc010gqv.1_Missense_Mutation_p.H1005L|CECR2_uc002zml.2_Missense_Mutation_p.H1006L|CECR2_uc002zmo.2_RNA	NM_031413	NP_113601	Q9BXF3	CECR2_HUMAN	cat eye syndrome chromosome region, candidate 2	1189					chromatin modification|cytokinesis|cytoskeleton organization|DNA fragmentation involved in apoptotic nuclear change|vesicle-mediated transport		protein binding			ovary(1)|skin(1)	2		all_epithelial(15;0.139)		Lung(27;0.146)		AACCACCCACATTCTGGAGGC	0.592													23	33	---	---	---	---	PASS
CRKL	1399	broad.mit.edu	37	22	21288386	21288386	+	Missense_Mutation	SNP	C	G	G			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21288386C>G	uc002ztf.2	+	2	1140	c.631C>G	c.(631-633)CAG>GAG	p.Q211E	CRKL_uc002ztg.1_RNA	NM_005207	NP_005198	P46109	CRKL_HUMAN	v-crk sarcoma virus CT10 oncogene homolog	211					JNK cascade|Ras protein signal transduction	cytosol	protein tyrosine kinase activity|SH3/SH2 adaptor activity|signal transducer activity				0	all_cancers(11;1.16e-25)|all_epithelial(7;3.37e-24)|Lung NSC(8;7.25e-16)|all_lung(8;1.37e-14)|Melanoma(16;0.000465)|Ovarian(15;0.00167)|Colorectal(54;0.0332)|all_neural(72;0.142)	Lung SC(17;0.0262)	LUSC - Lung squamous cell carcinoma(15;0.000204)|Lung(15;0.00494)|Epithelial(17;0.176)			CGCTCAACCTCAGACCACAAC	0.502													55	125	---	---	---	---	PASS
LZTR1	8216	broad.mit.edu	37	22	21350124	21350124	+	Missense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21350124C>T	uc002zto.2	+	17	2135	c.2032C>T	c.(2032-2034)CGG>TGG	p.R678W	LZTR1_uc002ztn.2_Missense_Mutation_p.R637W|LZTR1_uc011ahy.1_Missense_Mutation_p.R659W|LZTR1_uc002ztp.2_5'Flank	NM_006767	NP_006758	Q8N653	LZTR1_HUMAN	leucine-zipper-like transcription regulator 1	678	BTB 2.				anatomical structure morphogenesis		sequence-specific DNA binding transcription factor activity			ovary(2)|lung(2)	4	all_cancers(11;1.83e-25)|all_epithelial(7;9.19e-23)|Lung NSC(8;3.06e-15)|all_lung(8;5.05e-14)|Melanoma(16;0.000465)|Ovarian(15;0.0028)|Colorectal(54;0.0332)|all_neural(72;0.142)	Lung SC(17;0.0262)	LUSC - Lung squamous cell carcinoma(15;0.000204)|Lung(15;0.00494)|Epithelial(17;0.195)			CGGGCACCCACGGCCAGCCCA	0.647													41	65	---	---	---	---	PASS
CHEK2	11200	broad.mit.edu	37	22	29091746	29091746	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:29091746T>C	uc003adu.1	-	11	1283	c.1211A>G	c.(1210-1212)TAT>TGT	p.Y404C	CHEK2_uc003ads.1_Missense_Mutation_p.Y183C|CHEK2_uc010gvh.1_Missense_Mutation_p.Y313C|CHEK2_uc010gvi.1_Intron|CHEK2_uc010gvj.1_Intron|CHEK2_uc003adr.1_RNA|CHEK2_uc010gvk.1_RNA|CHEK2_uc003adt.1_Missense_Mutation_p.Y447C|CHEK2_uc003adv.1_Missense_Mutation_p.Y375C|CHEK2_uc003adw.1_Missense_Mutation_p.Y404C|CHEK2_uc003adx.1_Missense_Mutation_p.Y183C|CHEK2_uc003ady.1_Missense_Mutation_p.Y404C|CHEK2_uc003adz.1_Missense_Mutation_p.Y208C	NM_007194	NP_009125	O96017	CHK2_HUMAN	protein kinase CHK2 isoform a	404	Protein kinase.				cell cycle|DNA damage checkpoint|DNA damage response, signal transduction resulting in induction of apoptosis|replicative senescence	PML body	ATP binding|metal ion binding|protein binding|protein serine/threonine kinase activity			central_nervous_system(17)|stomach(1)|ovary(1)|lung(1)	20						AGCACGGTTATACCCAGCAGT	0.453			F			breast 		Direct_reversal_of_damage|Other_conserved_DNA_damage_response_genes	Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|CHEK2-associated_cancer				31	91	---	---	---	---	PASS
CACNA1I	8911	broad.mit.edu	37	22	40061520	40061520	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:40061520C>A	uc003ayc.2	+	22	3869	c.3869C>A	c.(3868-3870)CCG>CAG	p.P1290Q	CACNA1I_uc003ayd.2_Missense_Mutation_p.P1255Q|CACNA1I_uc003aye.2_Missense_Mutation_p.P1205Q|CACNA1I_uc003ayf.2_Missense_Mutation_p.P1170Q	NM_021096	NP_066919	Q9P0X4	CAC1I_HUMAN	calcium channel, voltage-dependent, T type,	1290	III.|Helical; Name=S4 of repeat III; (Potential).				axon guidance|signal transduction	voltage-gated calcium channel complex	low voltage-gated calcium channel activity|protein binding			breast(1)|central_nervous_system(1)	2	Melanoma(58;0.0749)				Flunarizine(DB04841)|Paramethadione(DB00617)|Verapamil(DB00661)	AGCCGGGCGCCGGGCCTGAAG	0.617													25	55	---	---	---	---	PASS
ACO2	50	broad.mit.edu	37	22	41907949	41907949	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41907949C>A	uc003bac.2	+	4	524	c.502C>A	c.(502-504)CCT>ACT	p.P168T	ACO2_uc003bad.2_Missense_Mutation_p.P168T	NM_001098	NP_001089	Q99798	ACON_HUMAN	aconitase 2, mitochondrial precursor	168					citrate metabolic process|tricarboxylic acid cycle	mitochondrial matrix|nucleus	4 iron, 4 sulfur cluster binding|aconitate hydratase activity|citrate hydro-lyase (cis-aconitate-forming) activity|iron ion binding|isocitrate hydro-lyase (cis-aconitate-forming) activity			breast(2)|ovary(1)|lung(1)	4						CTTCTGGAAGCCTGGATCTGG	0.512													15	45	---	---	---	---	PASS
TTLL1	25809	broad.mit.edu	37	22	43435822	43435822	+	Missense_Mutation	SNP	G	A	A	rs116153895		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:43435822G>A	uc003bdi.2	-	11	1473	c.1232C>T	c.(1231-1233)TCG>TTG	p.S411L	TTLL1_uc010gzh.2_Missense_Mutation_p.S382L|TTLL1_uc003bdj.2_Missense_Mutation_p.S297L|TTLL1_uc003bdh.2_Missense_Mutation_p.S373L	NM_012263	NP_036395	O95922	TTLL1_HUMAN	tubulin tyrosine ligase-like family, member 1	411					protein polyglutamylation	cytoplasm|microtubule	ATP binding|tubulin-glutamic acid ligase activity|tubulin-tyrosine ligase activity			skin(1)	1		Ovarian(80;0.0694)		BRCA - Breast invasive adenocarcinoma(115;0.00461)		CGAGTCTCTCGATCGGCCTGC	0.602													21	203	---	---	---	---	PASS
TUBGCP6	85378	broad.mit.edu	37	22	50664511	50664511	+	Missense_Mutation	SNP	T	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50664511T>C	uc003bkb.1	-	9	2313	c.1801A>G	c.(1801-1803)ACC>GCC	p.T601A	TUBGCP6_uc010har.1_Missense_Mutation_p.T601A|TUBGCP6_uc010has.1_RNA|TUBGCP6_uc010hat.1_5'Flank|TUBGCP6_uc003bkd.1_5'UTR	NM_020461	NP_065194	Q96RT7	GCP6_HUMAN	tubulin, gamma complex associated protein 6	601					G2/M transition of mitotic cell cycle|microtubule nucleation	centrosome|cytosol|gamma-tubulin ring complex|microtubule|spindle pole	microtubule binding			ovary(2)|central_nervous_system(2)	4		all_cancers(38;5.79e-13)|all_epithelial(38;1.71e-11)|all_lung(38;3.89e-05)|Breast(42;0.000523)|Lung NSC(38;0.000992)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		LUAD - Lung adenocarcinoma(64;0.109)|BRCA - Breast invasive adenocarcinoma(115;0.21)		AGGTTAATGGTCTTTCCGCAG	0.582													98	202	---	---	---	---	PASS
DMD	1756	broad.mit.edu	37	X	31838129	31838129	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:31838129C>A	uc004dda.1	-	50	7516	c.7272G>T	c.(7270-7272)CAG>CAT	p.Q2424H	DMD_uc004dcr.1_5'UTR|DMD_uc004dcs.1_5'UTR|DMD_uc004dct.1_5'UTR|DMD_uc004dcu.1_5'UTR|DMD_uc004dcv.1_5'UTR|DMD_uc004dcw.2_Missense_Mutation_p.Q1080H|DMD_uc004dcx.2_Missense_Mutation_p.Q1083H|DMD_uc004dcz.2_Missense_Mutation_p.Q2301H|DMD_uc004dcy.1_Missense_Mutation_p.Q2420H|DMD_uc004ddb.1_Missense_Mutation_p.Q2416H|DMD_uc004ddd.1_Intron	NM_004006	NP_003997	P11532	DMD_HUMAN	dystrophin Dp427m isoform	2424					muscle filament sliding|peptide biosynthetic process	cell surface|costamere|cytoskeleton|cytosol|dystrophin-associated glycoprotein complex|sarcolemma	actin binding|dystroglycan binding|nitric-oxide synthase binding|protein binding|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(3)|pancreas(2)|large_intestine(1)	6		all_cancers(2;1.22e-16)|Acute lymphoblastic leukemia(2;4.65e-06)|all_hematologic(2;0.00108)|all_epithelial(3;0.00626)|all_neural(2;0.0189)|all_lung(315;0.182)|Glioma(3;0.203)				CTAGGTCAGGCTGCTTTGCCC	0.438													25	34	---	---	---	---	PASS
CXorf59	286464	broad.mit.edu	37	X	36116911	36116911	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:36116911G>T	uc004ddk.1	+	6	829	c.643G>T	c.(643-645)GCT>TCT	p.A215S		NM_173695	NP_775966	Q8N9S7	CX059_HUMAN	hypothetical protein LOC286464	215						integral to membrane				central_nervous_system(1)	1						TAATTTTAGTGCTCAAGGAGG	0.264													16	9	---	---	---	---	PASS
PAGE2B	389860	broad.mit.edu	37	X	55103864	55103864	+	Missense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:55103864G>T	uc004due.2	+	4	278	c.226G>T	c.(226-228)GCT>TCT	p.A76S		NM_001015038	NP_001015038	Q5JRK9	GGEE3_HUMAN	P antigen family, member 2B	76											0						ACAGGAACTGGCTCTGCTTAA	0.403													85	29	---	---	---	---	PASS
MAGEE1	57692	broad.mit.edu	37	X	75650397	75650397	+	Nonsense_Mutation	SNP	G	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:75650397G>T	uc004ecm.1	+	1	2281	c.2074G>T	c.(2074-2076)GAA>TAA	p.E692*		NM_020932	NP_065983	Q9HCI5	MAGE1_HUMAN	melanoma antigen family E, 1	692						dendrite|nucleus|perinuclear region of cytoplasm|postsynaptic membrane				breast(3)|ovary(1)|pancreas(1)|skin(1)	6						CGAAGCTCTGGAAGAAGATGC	0.473													12	10	---	---	---	---	PASS
PCDH11X	27328	broad.mit.edu	37	X	91132563	91132563	+	Missense_Mutation	SNP	G	C	C			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:91132563G>C	uc004efk.1	+	2	2169	c.1324G>C	c.(1324-1326)GGC>CGC	p.G442R	PCDH11X_uc004efl.1_Missense_Mutation_p.G442R|PCDH11X_uc004efo.1_Missense_Mutation_p.G442R|PCDH11X_uc010nmv.1_Missense_Mutation_p.G442R|PCDH11X_uc004efm.1_Missense_Mutation_p.G442R|PCDH11X_uc004efn.1_Missense_Mutation_p.G442R|PCDH11X_uc004efh.1_Missense_Mutation_p.G442R|PCDH11X_uc004efj.1_Missense_Mutation_p.G442R	NM_032968	NP_116750	Q9BZA7	PC11X_HUMAN	protocadherin 11 X-linked isoform c	442	Cadherin 4.|Extracellular (Potential).				homophilic cell adhesion	integral to plasma membrane	calcium ion binding			large_intestine(2)	2						TGCAGATGCTGGCAAACCTCC	0.408													44	28	---	---	---	---	PASS
DCAF12L1	139170	broad.mit.edu	37	X	125686402	125686402	+	Missense_Mutation	SNP	C	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:125686402C>A	uc004eul.2	-	1	441	c.190G>T	c.(190-192)GGC>TGC	p.G64C		NM_178470	NP_848565	Q5VU92	DC121_HUMAN	DDB1 and CUL4 associated factor 12-like 1	64										skin(3)|ovary(1)	4						CTGGCGGGGCCCCACCCGCCT	0.697													35	23	---	---	---	---	PASS
XPNPEP2	7512	broad.mit.edu	37	X	128887225	128887225	+	Splice_Site	SNP	G	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:128887225G>A	uc004eut.1	+	11	1351	c.1107_splice	c.e11+1	p.H369_splice		NM_003399	NP_003390	O43895	XPP2_HUMAN	X-prolyl aminopeptidase 2, membrane-bound						cellular process|proteolysis	anchored to membrane|plasma membrane	aminopeptidase activity|metal ion binding|metalloexopeptidase activity				0						GGCCAGCCACGTAAGTCCACG	0.532													66	29	---	---	---	---	PASS
BRCC3	79184	broad.mit.edu	37	X	154299830	154299830	+	Nonsense_Mutation	SNP	C	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:154299830C>T	uc004fna.2	+	1	121	c.28C>T	c.(28-30)CAG>TAG	p.Q10*	MTCP1NB_uc004fmy.2_5'Flank|MTCP1_uc004fmz.2_5'Flank|BRCC3_uc011mzy.1_Nonsense_Mutation_p.Q10*|BRCC3_uc011mzz.1_RNA|BRCC3_uc004fnb.2_Nonsense_Mutation_p.Q10*	NM_024332	NP_077308	P46736	BRCC3_HUMAN	BRCA1/BRCA2-containing complex, subunit 3	10					double-strand break repair|G2/M transition DNA damage checkpoint|histone H2A K63-linked deubiquitination|positive regulation of DNA repair|response to X-ray	BRCA1-A complex|BRISC complex|nuclear ubiquitin ligase complex	enzyme regulator activity|metal ion binding|metallopeptidase activity|polyubiquitin binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			lung(3)|ovary(1)|large_intestine(1)|breast(1)	6	all_cancers(53;1.86e-17)|all_epithelial(53;2.71e-11)|all_lung(58;1.84e-07)|Lung NSC(58;5.62e-07)|all_hematologic(71;2.45e-06)|Acute lymphoblastic leukemia(192;6.56e-05)|Breast(217;0.176)|Renal(33;0.214)					gcaggcggtgcaggcggtTCA	0.507													6	2	---	---	---	---	PASS
MEGF6	1953	broad.mit.edu	37	1	3414818	3414820	+	Intron	DEL	ACA	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:3414818_3414820delACA	uc001akl.2	-						MEGF6_uc001akk.2_Intron	NM_001409	NP_001400	O75095	MEGF6_HUMAN	EGF-like-domain, multiple 3 precursor							extracellular region	calcium ion binding			large_intestine(1)	1	all_cancers(77;0.00681)|all_epithelial(69;0.00301)|Ovarian(185;0.0634)|Lung NSC(156;0.0969)|all_lung(157;0.105)	all_epithelial(116;7.41e-22)|all_lung(118;8.3e-09)|Lung NSC(185;3.55e-06)|Breast(487;0.000659)|Renal(390;0.00121)|Hepatocellular(190;0.00308)|Myeloproliferative disorder(586;0.0255)|Lung SC(97;0.0262)|Ovarian(437;0.0308)|Medulloblastoma(700;0.211)		Epithelial(90;3.78e-37)|OV - Ovarian serous cystadenocarcinoma(86;6.86e-22)|GBM - Glioblastoma multiforme(42;1.96e-12)|Colorectal(212;6.15e-05)|COAD - Colon adenocarcinoma(227;0.000241)|Kidney(185;0.000448)|BRCA - Breast invasive adenocarcinoma(365;0.000779)|KIRC - Kidney renal clear cell carcinoma(229;0.00645)|STAD - Stomach adenocarcinoma(132;0.00669)|Lung(427;0.213)		CATTCACAGGACAACAGGTCCCC	0.635													6	4	---	---	---	---	
BCAR3	8412	broad.mit.edu	37	1	94242969	94242970	+	Intron	INS	-	CTCCTCCTT	CTCCTCCTT	rs141390468	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:94242969_94242970insCTCCTCCTT	uc001dqb.2	-						uc001dqd.1_5'Flank	NM_003567	NP_003558	O75815	BCAR3_HUMAN	breast cancer antiestrogen resistance 3						response to drug|small GTPase mediated signal transduction	intracellular	guanyl-nucleotide exchange factor activity|protein binding			ovary(1)|lung(1)|central_nervous_system(1)	3		all_lung(203;0.00145)|Lung NSC(277;0.00662)		all cancers(265;0.0126)|GBM - Glioblastoma multiforme(16;0.0467)|Epithelial(280;0.166)		tcctcctcctcttcctcctcct	0.000													3	3	---	---	---	---	
NUP133	55746	broad.mit.edu	37	1	229631436	229631436	+	Intron	DEL	A	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229631436delA	uc001htn.2	-							NM_018230	NP_060700	Q8WUM0	NU133_HUMAN	nucleoporin 133kDa						carbohydrate metabolic process|glucose transport|mitotic prometaphase|mRNA export from nucleus|nuclear pore organization|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytosol|Nup107-160 complex	nucleocytoplasmic transporter activity|protein binding			breast(4)|skin(2)|ovary(1)	7	Breast(184;0.104)|Ovarian(103;0.249)	Prostate(94;0.167)				TGTATACATTAAAAAAAAAAT	0.169													4	2	---	---	---	---	
C1orf150	148823	broad.mit.edu	37	1	247719615	247719616	+	Intron	INS	-	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247719615_247719616insT	uc001idf.2	+						C1orf150_uc009xgw.2_Intron|C1orf150_uc001ida.3_Intron|C1orf150_uc001idb.3_Intron|C1orf150_uc009xgx.2_Intron	NM_145278	NP_660321	Q5JQS6	CA150_HUMAN	hypothetical protein LOC148823												0	all_cancers(71;3.24e-05)|all_epithelial(71;1.3e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)		OV - Ovarian serous cystadenocarcinoma(106;0.0241)			GAAAAGTCAGGTTTGGTTTTAA	0.366													17	14	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	113103935	113103935	+	IGR	DEL	C	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:113103935delC								ZC3H6 (6295 upstream) : RGPD8 (22031 downstream)																							tcaccaccatcaccactgcca	0.000													3	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	122067665	122067666	+	IGR	DEL	GT	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:122067665_122067666delGT								TFCP2L1 (24887 upstream) : CLASP1 (27688 downstream)																							CCACATGAACgtgtgtgtgtgt	0.401													4	3	---	---	---	---	
NBEAL1	65065	broad.mit.edu	37	2	203905531	203905532	+	Intron	INS	-	T	T	rs115821271	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:203905531_203905532insT	uc002uzt.3	+						NBEAL1_uc002uzq.3_Intron|NBEAL1_uc010zid.1_Intron|NBEAL1_uc010zie.1_Intron	NM_001114132	NP_001107604	Q6ZS30	NBEL1_HUMAN	neurobeachin-like 1 isoform 3								binding			ovary(1)|skin(1)	2						cctccacTATATACCAAAAATA	0.351													5	3	---	---	---	---	
ACCN4	55515	broad.mit.edu	37	2	220379559	220379559	+	Frame_Shift_Del	DEL	C	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220379559delC	uc002vma.2	+	1	508	c.494delC	c.(493-495)GCCfs	p.A165fs	ACCN4_uc010fwi.1_Frame_Shift_Del_p.A165fs|ACCN4_uc010fwj.1_Frame_Shift_Del_p.A165fs|ACCN4_uc002vly.1_Frame_Shift_Del_p.A165fs|ACCN4_uc002vlz.2_Frame_Shift_Del_p.A165fs|ACCN4_uc002vmb.2_5'Flank	NM_182847	NP_878267	Q96FT7	ACCN4_HUMAN	amiloride-sensitive cation channel 4 isoform 2	165	Cytoplasmic (Potential).					integral to plasma membrane	sodium channel activity|sodium ion transmembrane transporter activity			ovary(2)	2		Renal(207;0.0183)		Epithelial(149;5.47e-10)|all cancers(144;9e-08)|LUSC - Lung squamous cell carcinoma(224;0.00813)|Lung(261;0.0086)|READ - Rectum adenocarcinoma(5;0.156)		CCTGGAGCAGCCCCCCGAGAC	0.642													53	29	---	---	---	---	
FARSB	10056	broad.mit.edu	37	2	223512162	223512163	+	Intron	INS	-	A	A	rs147059558	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:223512162_223512163insA	uc002vne.1	-						FARSB_uc010zlq.1_Intron|FARSB_uc002vnf.1_Intron|FARSB_uc002vng.1_Intron	NM_005687	NP_005678	Q9NSD9	SYFB_HUMAN	phenylalanyl-tRNA synthetase, beta subunit						phenylalanyl-tRNA aminoacylation	cytosol|soluble fraction	ATP binding|magnesium ion binding|phenylalanine-tRNA ligase activity|RNA binding			ovary(1)	1		Renal(207;0.0183)		Epithelial(121;3.47e-10)|all cancers(144;1.86e-07)|LUSC - Lung squamous cell carcinoma(224;0.00871)|Lung(261;0.011)	L-Phenylalanine(DB00120)	GACCAGCTTTCAGTTTTACTGA	0.450													4	4	---	---	---	---	
SEPT2	4735	broad.mit.edu	37	2	242287488	242287488	+	Intron	DEL	G	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:242287488delG	uc002wbc.2	+						SEPT2_uc002wbd.2_Intron|SEPT2_uc002wbf.2_Intron|SEPT2_uc002wbg.2_Intron|SEPT2_uc002wbh.2_Intron|SEPT2_uc010zop.1_Intron	NM_001008491	NP_001008491	Q15019	SEPT2_HUMAN	septin 2						cell division|mitosis	actin cytoskeleton|cleavage furrow|condensed chromosome kinetochore|midbody|nucleolus|septin complex|spindle	GTP binding			central_nervous_system(1)	1		all_cancers(19;7.62e-41)|all_epithelial(40;1.71e-18)|Breast(86;1.53e-05)|Renal(207;0.00179)|all_lung(227;0.00338)|Ovarian(221;0.00556)|Lung NSC(271;0.012)|Esophageal squamous(248;0.129)|all_hematologic(139;0.158)|Melanoma(123;0.16)|all_neural(83;0.243)|Hepatocellular(293;0.244)		Epithelial(32;1.24e-34)|all cancers(36;7.15e-32)|OV - Ovarian serous cystadenocarcinoma(60;1.21e-15)|Kidney(56;3.21e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;3.16e-06)|Lung(119;7.81e-05)|LUSC - Lung squamous cell carcinoma(224;0.000742)|Colorectal(34;0.0129)|COAD - Colon adenocarcinoma(134;0.0889)		AGAATTTTTTGGGGGGGTAGC	0.224													126	64	---	---	---	---	
TBC1D5	9779	broad.mit.edu	37	3	17469888	17469889	+	Intron	DEL	TG	-	-	rs35081140		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:17469888_17469889delTG	uc003cbf.2	-						TBC1D5_uc010hev.2_Intron|TBC1D5_uc003cbe.2_Intron	NM_014744	NP_055559	Q92609	TBCD5_HUMAN	TBC1 domain family, member 5 isoform b							intracellular	protein binding|Rab GTPase activator activity			ovary(1)	1						TAATATTAtatgtgtgtgtgtg	0.228													6	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	115529089	115529092	+	IGR	DEL	TCTG	-	-	rs113567470		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:115529089_115529092delTCTG								LSAMP (5071 upstream) : LOC285194 (899543 downstream)																							tctctctctctctgtctctctctc	0.265													4	2	---	---	---	---	
PPM1L	151742	broad.mit.edu	37	3	160672744	160672745	+	Intron	INS	-	T	T	rs142883004	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160672744_160672745insT	uc003fdr.2	+						PPM1L_uc003fds.2_Intron|PPM1L_uc003fdt.2_Intron|PPM1L_uc010hwf.2_Intron	NM_139245	NP_640338	Q5SGD2	PPM1L_HUMAN	protein phosphatase 1 (formerly 2C)-like						protein dephosphorylation|sphingolipid metabolic process	endoplasmic reticulum membrane|integral to membrane|protein serine/threonine phosphatase complex	metal ion binding|protein serine/threonine phosphatase activity			breast(1)	1			Lung(72;0.00149)|LUSC - Lung squamous cell carcinoma(72;0.00216)			tccttccttccttcctttcctt	0.020													5	10	---	---	---	---	
NMD3	51068	broad.mit.edu	37	3	160958626	160958626	+	Intron	DEL	T	-	-	rs141601797		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160958626delT	uc003feb.1	+						NMD3_uc003fec.2_Intron|NMD3_uc003fed.1_Intron|NMD3_uc010hwh.2_Intron	NM_015938	NP_057022	Q96D46	NMD3_HUMAN	NMD3 homolog						protein transport	cytoplasm|nucleolus|nucleoplasm				ovary(1)	1			Lung(72;0.00111)|LUSC - Lung squamous cell carcinoma(72;0.00156)			tcagccAGGATTTTTTTTTTT	0.134													3	3	---	---	---	---	
ABCC5	10057	broad.mit.edu	37	3	183729803	183729806	+	Intron	DEL	ACAC	-	-	rs72084118		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183729803_183729806delACAC	uc003fmg.2	-						ABCC5_uc011bqt.1_Intron|ABCC5_uc010hxl.2_Intron|ABCC5_uc003fmh.2_Intron|ABCC5_uc010hxm.2_Intron|ABCC5_uc010hxn.2_Intron|ABCC5_uc010hxo.2_Intron|ABCC5_uc003fmi.3_Intron	NM_005688	NP_005679	O15440	MRP5_HUMAN	ATP-binding cassette, sub-family C, member 5							integral to plasma membrane|membrane fraction	ATP binding|ATPase activity, coupled to transmembrane movement of substances|organic anion transmembrane transporter activity			ovary(2)|large_intestine(1)|central_nervous_system(1)	4	all_cancers(143;1.85e-10)|Ovarian(172;0.0303)		Epithelial(37;1.74e-35)|OV - Ovarian serous cystadenocarcinoma(80;6.48e-22)			atagaacacaacacacacacacac	0.000													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	193731918	193731919	+	IGR	DEL	CA	-	-	rs66514639		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:193731918_193731919delCA								LOC100128023 (19891 upstream) : HES1 (122015 downstream)																							TTCACTCTATcacacacacaca	0.351													2	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	4	43749393	43749395	+	IGR	DEL	TGG	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:43749393_43749395delTGG								GRXCR1 (716720 upstream) : KCTD8 (426527 downstream)																							gaacaaggtatggtggtggtggt	0.000													4	2	---	---	---	---	
PDGFC	56034	broad.mit.edu	37	4	157684516	157684516	+	Intron	DEL	A	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:157684516delA	uc003iph.1	-						PDGFC_uc003ipi.1_Intron|PDGFC_uc011cis.1_Intron|PDGFC_uc011cir.1_Intron	NM_016205	NP_057289	Q9NRA1	PDGFC_HUMAN	platelet-derived growth factor C precursor						central nervous system development|platelet-derived growth factor receptor signaling pathway|positive regulation of cell division|positive regulation of DNA replication|positive regulation of fibroblast proliferation|vascular endothelial growth factor receptor signaling pathway	endoplasmic reticulum lumen|extracellular space|Golgi membrane|nucleus	cell surface binding|growth factor activity|platelet-derived growth factor receptor binding|protein homodimerization activity			ovary(1)|lung(1)|skin(1)	3	all_hematologic(180;0.24)	Renal(120;0.0458)		KIRC - Kidney renal clear cell carcinoma(143;0.08)|Kidney(143;0.0977)|COAD - Colon adenocarcinoma(41;0.212)		CTCTCCCACCaaaaaaaaaaa	0.174													3	3	---	---	---	---	
CAST	831	broad.mit.edu	37	5	96079103	96079104	+	Intron	DEL	GA	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:96079103_96079104delGA	uc003klz.1	+						CAST_uc003klt.2_Intron|CAST_uc003klu.2_Intron|CAST_uc003klv.2_Intron|CAST_uc003klw.2_Intron|CAST_uc003klx.2_Intron|CAST_uc003kly.2_Intron|CAST_uc011cuo.1_Intron|CAST_uc011cuq.1_Intron|CAST_uc011cur.1_Intron|CAST_uc011cus.1_Intron|CAST_uc003kma.1_Intron|CAST_uc011cut.1_Intron|CAST_uc003kmb.2_Intron|CAST_uc003kmc.2_Intron|CAST_uc003kmd.2_Intron|CAST_uc003kme.2_Intron|CAST_uc003kmf.2_Intron|CAST_uc003kmh.2_Intron|CAST_uc010jbj.2_Intron|CAST_uc010jbk.2_Intron|CAST_uc010jbl.1_5'Flank|CAST_uc003kmi.2_5'Flank|CAST_uc003kmj.2_5'Flank	NM_001042443	NP_001035908	P20810	ICAL_HUMAN	calpastatin isoform i								calcium-dependent cysteine-type endopeptidase inhibitor activity|protein binding			central_nervous_system(3)|ovary(1)|kidney(1)	5		all_cancers(142;5.27e-07)|all_epithelial(76;8.21e-10)|all_lung(232;0.000396)|Lung NSC(167;0.000539)|Ovarian(225;0.024)|Colorectal(57;0.0341)|Breast(839;0.244)		all cancers(79;6.85e-15)		GGAAGGAAAGGAGAGAGTTGCC	0.426													6	4	---	---	---	---	
HLA-A	3105	broad.mit.edu	37	6	29912653	29912655	+	Intron	DEL	AGA	-	-	rs9278467		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29912653_29912655delAGA	uc003nol.2	+						HLA-G_uc011dmb.1_Intron|HCG4P6_uc003nog.1_5'Flank|HLA-A_uc003nok.2_Intron|HLA-A_uc003non.2_Intron|HLA-A_uc003noo.2_Intron|HLA-A_uc010jrr.2_Intron|HLA-A_uc003nom.2_Intron|HLA-A_uc010klp.2_Intron|HLA-A_uc011dmc.1_Intron|HLA-A_uc011dmd.1_3'UTR	NM_002116	NP_002107	P30443	1A01_HUMAN	major histocompatibility complex, class I, A						antigen processing and presentation of peptide antigen via MHC class I|interferon-gamma-mediated signaling pathway|interspecies interaction between organisms|regulation of immune response|type I interferon-mediated signaling pathway	integral to plasma membrane|MHC class I protein complex	MHC class I receptor activity			upper_aerodigestive_tract(1)|ovary(1)	2						CCCTGAGGACAGACCTCAGGAGG	0.527									Melanoma_Familial_Clustering_of|Lichen_Sclerosis_et_Atrophicus_Familial_Clustering_of|Osteosarcoma_Familial_Clustering_of|Naso-/Oropharyngeal/Laryngeal_Cancer_Familial_Clustering_of	Multiple Myeloma(9;0.094)			6	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	6	108607903	108607904	+	IGR	DEL	CA	-	-	rs147089247		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:108607903_108607904delCA								SNX3 (25439 upstream) : LACE1 (8194 downstream)																							cacgtgcgtgcacacacacaca	0.015													4	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	6	151546282	151546289	+	Intron	DEL	CTTCCTTT	-	-	rs72359904	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151546282_151546289delCTTCCTTT	uc003qod.2	-											Homo sapiens cDNA clone IMAGE:4838370.																		tccttccttccttcctttctttctttcc	0.000													4	2	---	---	---	---	
TTC26	79989	broad.mit.edu	37	7	138857972	138857973	+	Intron	DEL	TT	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138857972_138857973delTT	uc003vus.2	+						TTC26_uc011kqn.1_Intron|TTC26_uc011kqo.1_Intron|TTC26_uc011kqp.1_Intron|TTC26_uc003vut.2_Intron|TTC26_uc011kqq.1_Intron	NM_024926	NP_079202	A0AVF1	TTC26_HUMAN	tetratricopeptide repeat domain 26 isoform 1								binding			ovary(1)	1						CAAAGTCACCtttttttttttt	0.203													4	2	---	---	---	---	
GALNT11	63917	broad.mit.edu	37	7	151791701	151791701	+	Intron	DEL	C	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151791701delC	uc010lqg.1	+						GALNT11_uc011kvm.1_Intron|GALNT11_uc003wku.2_Intron|GALNT11_uc003wkv.1_Intron|GALNT11_uc011kvn.1_Intron	NM_022087	NP_071370	Q8NCW6	GLT11_HUMAN	N-acetylgalactosaminyltransferase 11							Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding				0	all_neural(206;0.187)	all_hematologic(28;0.0592)|Prostate(32;0.214)	OV - Ovarian serous cystadenocarcinoma(82;0.00168)	UCEC - Uterine corpus endometrioid carcinoma (81;0.177)|BRCA - Breast invasive adenocarcinoma(188;0.0932)		AATGCTGCATCATTTTTTCCC	0.338													10	9	---	---	---	---	
FLJ43860	389690	broad.mit.edu	37	8	142477454	142477463	+	Intron	DEL	CCTGGCCCTT	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142477454_142477463delCCTGGCCCTT	uc003ywi.2	-						FLJ43860_uc011ljs.1_Intron|FLJ43860_uc010meu.1_Intron	NM_207414	NP_997297	Q6ZUA9	Q6ZUA9_HUMAN	hypothetical protein LOC389690								binding				0	all_cancers(97;7.79e-15)|all_epithelial(106;4.52e-13)|Lung NSC(106;2.07e-05)|all_lung(105;2.89e-05)|Ovarian(258;0.0303)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0493)			CCCTCCGCCCcctggcccttcctggccctt	0.571													4	2	---	---	---	---	
INSL6	11172	broad.mit.edu	37	9	5185131	5185131	+	Intron	DEL	A	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:5185131delA	uc003zix.2	-							NM_007179	NP_009110	Q9Y581	INSL6_HUMAN	insulin-like 6 precursor							extracellular region	hormone activity				0	all_hematologic(13;0.137)	Breast(48;0.147)|Acute lymphoblastic leukemia(23;0.158)		GBM - Glioblastoma multiforme(50;0.0128)|Lung(218;0.145)		CCTCCAAGTTAAAAAAAAAAG	0.219													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	36409243	36409246	+	IGR	DEL	GAAG	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:36409243_36409246delGAAG								RNF38 (8048 upstream) : MELK (163659 downstream)																							tggaaggaaagaaggaaggaagga	0.005													9	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	133834069	133834077	+	IGR	DEL	CACTGTCAT	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:133834069_133834077delCACTGTCAT								FIBCD1 (19614 upstream) : LAMC3 (50427 downstream)																							ccatcaccaccactgtcatcaccatcacc	0.000													4	2	---	---	---	---	
VAV2	7410	broad.mit.edu	37	9	136795480	136795481	+	Intron	DEL	TT	-	-	rs147849602		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136795480_136795481delTT	uc004ces.2	-						VAV2_uc004cer.2_Intron	NM_001134398	NP_001127870	P52735	VAV2_HUMAN	vav 2 guanine nucleotide exchange factor isoform						angiogenesis|apoptosis|axon guidance|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|platelet activation|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol	metal ion binding|Rho guanyl-nucleotide exchange factor activity			central_nervous_system(3)|ovary(2)|lung(2)|breast(1)	8				OV - Ovarian serous cystadenocarcinoma(145;3.9e-07)|Epithelial(140;2.07e-06)|all cancers(34;9.39e-06)		tcctggcctcttcactaccctc	0.238													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	138016448	138016451	+	IGR	DEL	AAGA	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:138016448_138016451delAAGA								OLFM1 (3417 upstream) : KIAA0649 (355197 downstream)																							ggaaggaaggaagaaagaaagaaa	0.000													6	6	---	---	---	---	
ABCA2	20	broad.mit.edu	37	9	139917547	139917548	+	Intron	DEL	GA	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:139917547_139917548delGA	uc011mem.1	-						ABCA2_uc011mel.1_Intron|ABCA2_uc004ckl.1_Intron|ABCA2_uc004ckm.1_Intron|ABCA2_uc004cko.1_5'Flank|ABCA2_uc010nca.2_5'UTR	NM_001606	NP_001597	Q9BZC7	ABCA2_HUMAN	ATP-binding cassette, sub-family A, member 2						cholesterol homeostasis|lipid metabolic process|regulation of intracellular cholesterol transport|regulation of transcription from RNA polymerase II promoter|response to drug|response to steroid hormone stimulus	ATP-binding cassette (ABC) transporter complex|cytoplasmic membrane-bounded vesicle|endosome|integral to membrane|microtubule organizing center	ATP binding|ATPase activity, coupled to transmembrane movement of substances				0	all_cancers(76;0.16)	Myeloproliferative disorder(178;0.0511)	STAD - Stomach adenocarcinoma(284;0.123)	OV - Ovarian serous cystadenocarcinoma(145;2.94e-05)|Epithelial(140;0.00048)		ggtgaaaggggagagagagaga	0.248													4	2	---	---	---	---	
PRKG1	5592	broad.mit.edu	37	10	53387678	53387679	+	Intron	INS	-	TTC	TTC			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:53387678_53387679insTTC	uc001jjm.2	+						PRKG1_uc001jjn.2_Intron|PRKG1_uc001jjo.2_Intron	NM_001098512	NP_001091982	Q13976	KGP1_HUMAN	protein kinase, cGMP-dependent, type I isoform						actin cytoskeleton organization|platelet activation|signal transduction	cytosol	ATP binding|cGMP binding|cGMP-dependent protein kinase activity			lung(2)|stomach(1)|ovary(1)|central_nervous_system(1)|skin(1)	6		all_cancers(4;2.13e-08)|all_epithelial(4;2.44e-08)|all_lung(4;0.000173)		all cancers(4;1.18e-05)|GBM - Glioblastoma multiforme(4;0.000359)|Epithelial(53;0.00532)|Lung(62;0.0606)		cttcccttccttcccttccttt	0.015													8	6	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	134206066	134206068	+	IGR	DEL	TGG	-	-	rs72458419		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:134206066_134206068delTGG								LRRC27 (11056 upstream) : PWWP2B (4634 downstream)																							gtggtggtaatggtgatgatggt	0.000													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	135455791	135455792	+	IGR	DEL	TG	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:135455791_135455792delTG								FRG2B (15492 upstream) : LOC653544 (34487 downstream)																							TTGGAGACACTGTGTTATCTTA	0.381													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	11	42554869	42554870	+	IGR	DEL	GT	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:42554869_42554870delGT								None (None upstream) : API5 (778635 downstream)																							ctatccttcAGTGtgtgtgtgt	0.064													5	3	---	---	---	---	
FGF3	2248	broad.mit.edu	37	11	69628661	69628664	+	Intron	DEL	TGGC	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:69628661_69628664delTGGC	uc001oph.2	-							NM_005247	NP_005238	P11487	FGF3_HUMAN	fibroblast growth factor 3 precursor						fibroblast growth factor receptor signaling pathway|insulin receptor signaling pathway|negative regulation of cardiac muscle tissue development|positive regulation of cell division|positive regulation of cell proliferation	extracellular region	growth factor activity			ovary(1)|lung(1)	2			LUSC - Lung squamous cell carcinoma(11;5.05e-15)|STAD - Stomach adenocarcinoma(18;0.0278)			gatgggtggatggctggatggatg	0.000													4	2	---	---	---	---	
MAGOHB	55110	broad.mit.edu	37	12	10763420	10763427	+	Intron	DEL	TAGACATG	-	-	rs140380366		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10763420_10763427delTAGACATG	uc001qyq.1	-						MAGOHB_uc001qyr.1_Intron	NM_018048	NP_060518	Q96A72	MGN2_HUMAN	mago-nashi homolog B						mRNA processing|mRNA transport|RNA splicing	nucleus	RNA binding			breast(1)	1						AGATCATTGCTAGACATGTAGACAATAA	0.312													3	3	---	---	---	---	
RACGAP1	29127	broad.mit.edu	37	12	50395874	50395874	+	Intron	DEL	G	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:50395874delG	uc001rvt.2	-						RACGAP1_uc009zlm.1_Intron|RACGAP1_uc001rvs.2_Intron|RACGAP1_uc001rvu.2_Intron	NM_013277	NP_037409	Q9H0H5	RGAP1_HUMAN	Rac GTPase activating protein 1						blood coagulation|cytokinesis, actomyosin contractile ring assembly|cytokinesis, initiation of separation|embryo development|microtubule-based movement|neuroblast proliferation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction|spermatogenesis|sulfate transport	acrosomal vesicle|cytosol|microtubule|midbody|nucleus|spindle	alpha-tubulin binding|beta-tubulin binding|gamma-tubulin binding|GTPase activator activity|metal ion binding			kidney(1)	1						aaaaaaaaaagaaTATCAATA	0.194													4	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	12	55018753	55018754	+	IGR	INS	-	TTCCTTCC	TTCCTTCC	rs28433810	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:55018753_55018754insTTCCTTCC								GLYCAM1 (14507 upstream) : LACRT (5869 downstream)																							tccgtccttctttccttccttc	0.005													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	13	80680379	80680398	+	IGR	DEL	GAAGGAAGGAAGGAAGGAAA	-	-	rs12857535		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:80680379_80680398delGAAGGAAGGAAGGAAGGAAA								NDFIP2 (550174 upstream) : SPRY2 (229716 downstream)																							aggaaggaaggaaggaaggaaggaaggaaagaaggaagga	0.055													4	2	---	---	---	---	
FARP1	10160	broad.mit.edu	37	13	98965567	98965568	+	Intron	INS	-	AC	AC	rs142657701	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:98965567_98965568insAC	uc001vnj.2	+						FARP1_uc001vnh.2_Intron	NM_005766	NP_005757	Q9Y4F1	FARP1_HUMAN	FERM, RhoGEF, and pleckstrin domain protein 1						regulation of Rho protein signal transduction	cytoplasm|cytoskeleton|extrinsic to membrane	cytoskeletal protein binding|Rho guanyl-nucleotide exchange factor activity			breast(2)	2	all_neural(89;0.0982)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)		BRCA - Breast invasive adenocarcinoma(86;0.233)			CCTTCCCCCAAacacacacaca	0.188													4	2	---	---	---	---	
C14orf93	60686	broad.mit.edu	37	14	23457344	23457344	+	Intron	DEL	T	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23457344delT	uc001wib.1	-						C14orf93_uc001wic.1_Intron|C14orf93_uc001wid.1_Intron|C14orf93_uc001wig.2_Intron|C14orf93_uc001wih.2_Intron|C14orf93_uc001wie.2_Intron|C14orf93_uc001wia.3_Intron|C14orf93_uc001wif.2_Intron	NM_021944	NP_068763	Q9H972	CN093_HUMAN	hypothetical protein LOC60686 precursor							extracellular region				ovary(1)	1	all_cancers(95;3.3e-05)			GBM - Glioblastoma multiforme(265;0.0127)		AGATGAGGGCttttttttttt	0.269													9	4	---	---	---	---	
MYH6	4624	broad.mit.edu	37	14	23868034	23868035	+	Frame_Shift_Ins	INS	-	T	T			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23868034_23868035insT	uc001wjv.2	-	15	1860_1861	c.1793_1794insA	c.(1792-1794)AACfs	p.N598fs		NM_002471	NP_002462	P13533	MYH6_HUMAN	myosin heavy chain 6	598	Myosin head-like.				adult heart development|atrial cardiac muscle tissue morphogenesis|cardiac muscle fiber development|in utero embryonic development|muscle filament sliding|regulation of ATPase activity|regulation of blood pressure|regulation of heart rate|regulation of the force of heart contraction|sarcomere organization|striated muscle contraction|ventricular cardiac muscle tissue morphogenesis|visceral muscle development	cytosol|focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|protein kinase binding|structural constituent of muscle			pancreas(2)|ovary(1)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00764)|READ - Rectum adenocarcinoma(4;0.0289)|Colorectal(4;0.0441)		GAGGATCCTTGTTTTTTTCCAG	0.550													88	42	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	20263577	20263578	+	IGR	INS	-	A	A	rs58110116		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:20263577_20263578insA								None (None upstream) : GOLGA6L6 (473516 downstream)																							aggaaggaaggaggaaggaagg	0.000													6	3	---	---	---	---	
CAPN3	825	broad.mit.edu	37	15	42676608	42676609	+	Intron	INS	-	A	A			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42676608_42676609insA	uc001zpn.1	+						CAPN3_uc001zpk.1_Intron|CAPN3_uc001zpl.1_Intron|CAPN3_uc010udf.1_Intron|CAPN3_uc010udg.1_Intron|CAPN3_uc001zpo.1_Intron|CAPN3_uc001zpp.1_Intron	NM_000070	NP_000061	P20807	CAN3_HUMAN	calpain 3 isoform a						muscle organ development|proteolysis	cytoplasm	calcium ion binding|calcium-dependent cysteine-type endopeptidase activity|signal transducer activity			central_nervous_system(1)	1		all_cancers(109;1.65e-16)|all_epithelial(112;8.34e-15)|Lung NSC(122;3.56e-09)|all_lung(180;1.68e-08)|Melanoma(134;0.0574)|Colorectal(260;0.152)		GBM - Glioblastoma multiforme(94;7.36e-07)		gactccgtctcaaaaaaatacc	0.124													12	15	---	---	---	---	
WHAMM	123720	broad.mit.edu	37	15	83502439	83502439	+	3'UTR	DEL	T	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:83502439delT	uc002bje.2	+	10						NM_001080435	NP_001073904	Q8TF30	WHAMM_HUMAN	WAS protein homolog associated with actin, golgi							cytoplasmic vesicle membrane|ER-Golgi intermediate compartment|Golgi apparatus	actin binding				0						TGCTGCAGCAttttttttttt	0.259													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	16	25031511	25031512	+	IGR	INS	-	GGAAGGAA	GGAAGGAA	rs7498498	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:25031511_25031512insGGAAGGAA								ARHGAP17 (4836 upstream) : LCMT1 (91535 downstream)																							gaaggaaggacggaaggaagga	0.144													3	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	16	33123748	33123748	+	5'Flank	DEL	G	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:33123748delG	uc010vfz.1	-											H.sapiens mRNA sequence (16p11.2).																		AGGTGACAGTGGGGACAGGCC	0.458													35	19	---	---	---	---	
ELMO3	79767	broad.mit.edu	37	16	67235116	67235118	+	Intron	DEL	TTT	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67235116_67235118delTTT	uc002esa.2	+						ELMO3_uc002esb.2_Intron|ELMO3_uc002esc.2_Intron	NM_024712	NP_078988	Q96BJ8	ELMO3_HUMAN	engulfment and cell motility 3						apoptosis|phagocytosis	cytoplasm|cytoskeleton	SH3 domain binding				0		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.00067)|Epithelial(162;0.00442)|all cancers(182;0.0417)		gcccagctgattttttttttttt	0.000													4	2	---	---	---	---	
KLHL36	79786	broad.mit.edu	37	16	84690289	84690290	+	Intron	INS	-	A	A	rs145652017	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84690289_84690290insA	uc002fig.2	+						KLHL36_uc010chl.2_Intron	NM_024731	NP_079007	Q8N4N3	KLH36_HUMAN	kelch-like 36											skin(2)	2						ATAAGAGAAGGAAAAAAAAAAC	0.114													4	4	---	---	---	---	
KIAA0182	23199	broad.mit.edu	37	16	85682268	85682268	+	Frame_Shift_Del	DEL	G	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:85682268delG	uc002fix.2	+	3	411	c.337delG	c.(337-339)GGGfs	p.G113fs	KIAA0182_uc002fiw.2_Frame_Shift_Del_p.G9fs|KIAA0182_uc002fiy.2_Frame_Shift_Del_p.G40fs	NM_014615	NP_055430	Q14687	GSE1_HUMAN	genetic suppressor element 1 isoform 1	113							protein binding			large_intestine(3)|ovary(1)|skin(1)	5						CGTCCCCCCTGGGGGCCACAG	0.687													105	83	---	---	---	---	
Unknown	0	broad.mit.edu	37	17	5620680	5620691	+	IGR	DEL	CTTCCTTCCTTC	-	-	rs61057456		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:5620680_5620691delCTTCCTTCCTTC								NLRP1 (132848 upstream) : WSCD1 (351746 downstream)																							ctttctctttcttccttccttccttccttcct	0.000													3	4	---	---	---	---	
LASP1	3927	broad.mit.edu	37	17	37070931	37070938	+	Intron	DEL	ACACACAC	-	-	rs68023823		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37070931_37070938delACACACAC	uc002hra.2	+						LASP1_uc010cvq.2_Intron|LASP1_uc010wdz.1_Intron	NM_006148	NP_006139	Q14847	LASP1_HUMAN	LIM and SH3 protein 1							cortical actin cytoskeleton	ion transmembrane transporter activity|SH3/SH2 adaptor activity|zinc ion binding			lung(1)	1						CGAGAGacagacacacacacacacacac	0.428			T	MLL	AML								4	2	---	---	---	---	
SPAG9	9043	broad.mit.edu	37	17	49084472	49084473	+	Intron	DEL	GT	-	-	rs35415974		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:49084472_49084473delGT	uc002itc.2	-						SPAG9_uc002itb.2_Intron|SPAG9_uc002itd.2_Intron|SPAG9_uc002itf.2_Intron|SPAG9_uc002ita.2_Intron|SPAG9_uc002ite.2_Intron	NM_001130528	NP_001124000	O60271	JIP4_HUMAN	sperm associated antigen 9 isoform 1						positive regulation of cell migration|positive regulation of muscle cell differentiation|retrograde transport, endosome to Golgi|spermatogenesis	acrosomal vesicle|integral to membrane|perinuclear region of cytoplasm				lung(4)|breast(1)	5			BRCA - Breast invasive adenocarcinoma(22;4.24e-07)			CAACATTAGGgtgtgtgtgtgt	0.356													10	5	---	---	---	---	
TBX2	6909	broad.mit.edu	37	17	59482166	59482166	+	Intron	DEL	C	-	-	rs66504335		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59482166delC	uc010wox.1	+						TBX2_uc002ize.2_Frame_Shift_Del_p.R353fs|TBX2_uc002izg.2_Intron	NM_005994	NP_005985	Q13207	TBX2_HUMAN	T-box 2						cell aging|positive regulation of cell proliferation		sequence-specific DNA binding				0						AGGGAGGTGGCGGCGGGGGGT	0.706													6	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	17	62932555	62932556	+	IGR	DEL	GT	-	-	rs35142297		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:62932555_62932556delGT								LRRC37A3 (16969 upstream) : AMZ2P1 (30112 downstream)																							gtgtgtgttcgtgtgtgtgtgt	0.238													11	5	---	---	---	---	
CCDC46	201134	broad.mit.edu	37	17	64025826	64025829	+	Intron	DEL	AAAC	-	-	rs67867456		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:64025826_64025829delAAAC	uc002jfl.2	-						CCDC46_uc010deo.2_Intron|CCDC46_uc002jfm.2_Intron|CCDC46_uc010dep.2_Intron	NM_145036	NP_659473	Q8N8E3	CE112_HUMAN	coiled-coil domain containing 46 isoform a							centrosome					0			BRCA - Breast invasive adenocarcinoma(6;1.53e-06)			gtctctaaataaacaaacaaacaa	0.123													6	3	---	---	---	---	
BPTF	2186	broad.mit.edu	37	17	65905565	65905565	+	Intron	DEL	T	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:65905565delT	uc002jgf.2	+						BPTF_uc002jge.2_Intron	NM_182641	NP_872579	Q12830	BPTF_HUMAN	bromodomain PHD finger transcription factor						brain development|chromatin remodeling|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|NURF complex	sequence-specific DNA binding|transcription factor binding|zinc ion binding			ovary(2)|skin(2)	4	all_cancers(12;6e-11)		BRCA - Breast invasive adenocarcinoma(8;7.48e-08)|Colorectal(3;0.0984)|LUSC - Lung squamous cell carcinoma(166;0.24)			GACCTTTGTCTTTTTTTTTTT	0.299													6	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	18	58331469	58331469	+	IGR	DEL	G	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:58331469delG								MC4R (291468 upstream) : CDH20 (669519 downstream)																							AGGACTTCCCGCAGCCACAGA	0.562													7	8	---	---	---	---	
PLIN5	440503	broad.mit.edu	37	19	4529622	4529623	+	Intron	INS	-	ACAC	ACAC	rs147345372	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4529622_4529623insACAC	uc002mas.2	-						PLIN5_uc002mat.1_3'UTR	NM_001013706	NP_001013728	Q00G26	PLIN5_HUMAN	lipid storage droplet protein 5							lipid particle					0						catatatgtatacacacacaca	0.045													9	4	---	---	---	---	
TYK2	7297	broad.mit.edu	37	19	10477410	10477411	+	Intron	DEL	AA	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10477410_10477411delAA	uc002moc.3	-						TYK2_uc010dxe.2_Intron|TYK2_uc002mod.2_Intron	NM_003331	NP_003322	P29597	TYK2_HUMAN	tyrosine kinase 2						intracellular protein kinase cascade|regulation of type I interferon-mediated signaling pathway|type I interferon-mediated signaling pathway	cytoskeleton|cytosol|membrane|nucleus	ATP binding|growth hormone receptor binding|non-membrane spanning protein tyrosine kinase activity			lung(5)|large_intestine(2)|ovary(1)|breast(1)	9			OV - Ovarian serous cystadenocarcinoma(20;1.77e-09)|Epithelial(33;3.92e-06)|all cancers(31;8.95e-06)			ctgatgagctaaaaaaaaaaaa	0.015													6	3	---	---	---	---	
ZNF321	399669	broad.mit.edu	37	19	53431606	53431606	+	3'UTR	DEL	A	-	-	rs35140094		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53431606delA	uc010eqj.2	-	4					ZNF321_uc002qaj.1_3'UTR|ZNF321_uc002qak.1_3'UTR	NM_203307	NP_976052			zinc finger protein 321												0				GBM - Glioblastoma multiforme(134;0.0305)		ACTCCGTCTTAAAAAAAAAAA	0.149													4	2	---	---	---	---	
PTGIS	5740	broad.mit.edu	37	20	48164142	48164143	+	Intron	INS	-	CAAA	CAAA	rs143547104	by1000genomes	TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:48164142_48164143insCAAA	uc002xut.2	-						PTGIS_uc010zyi.1_Intron	NM_000961	NP_000952	Q16647	PTGIS_HUMAN	prostaglandin I2 synthase						hormone biosynthetic process|prostaglandin biosynthetic process|xenobiotic metabolic process	endoplasmic reticulum lumen|endoplasmic reticulum membrane|integral to membrane	electron carrier activity|heme binding|monooxygenase activity|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen|prostaglandin-I synthase activity			skin(2)|ovary(1)	3			BRCA - Breast invasive adenocarcinoma(12;2.37e-05)|COAD - Colon adenocarcinoma(4;0.14)|Colorectal(8;0.166)		Phenylbutazone(DB00812)	agggctgcctccaaacaaacaa	0.129													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	20	49650266	49650269	+	IGR	DEL	TGTG	-	-	rs72096329		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:49650266_49650269delTGTG								KCNG1 (10591 upstream) : NFATC2 (357497 downstream)																							aattttatgttgtgtgtgtgtgtg	0.049													4	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	21	9676853	9676854	+	IGR	DEL	CG	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:9676853_9676854delCG								None (None upstream) : None (None downstream)																							taatatataccgtgtgtgtgtg	0.010													4	2	---	---	---	---	
MYO18B	84700	broad.mit.edu	37	22	26413051	26413054	+	Intron	DEL	CTCC	-	-	rs144669857		TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26413051_26413054delCTCC	uc003abz.1	+						MYO18B_uc003aca.1_Intron|MYO18B_uc010guy.1_Intron|MYO18B_uc010guz.1_Intron|MYO18B_uc011aka.1_Intron|MYO18B_uc011akb.1_Intron|MYO18B_uc010gva.1_Intron	NM_032608	NP_115997	Q8IUG5	MY18B_HUMAN	myosin XVIIIB							nucleus|sarcomere|unconventional myosin complex	actin binding|ATP binding|motor activity			ovary(5)|central_nervous_system(3)|large_intestine(2)|breast(2)	12						ctctgtgcctctccctccctccct	0.078													4	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	X	24447607	24447607	+	IGR	DEL	T	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:24447607delT								FAM48B1 (64067 upstream) : PDK3 (35737 downstream)																							attaaacctcttttttttTTT	0.164													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	X	44492766	44492766	+	IGR	DEL	C	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:44492766delC								FUNDC1 (90545 upstream) : DUSP21 (210483 downstream)																							GGAAAATCATCCCCCCCGGAG	0.488													8	11	---	---	---	---	
NRK	203447	broad.mit.edu	37	X	105167042	105167042	+	Intron	DEL	G	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:105167042delG	uc004emd.2	+						NRK_uc010npc.1_Intron	NM_198465	NP_940867	Q7Z2Y5	NRK_HUMAN	Nik related kinase								ATP binding|protein serine/threonine kinase activity|small GTPase regulator activity			breast(7)|ovary(3)|lung(2)|large_intestine(1)|central_nervous_system(1)	14						TTGTCAGCTTGGAAACTTTCC	0.338										HNSCC(51;0.14)			20	51	---	---	---	---	
MAGEC1	9947	broad.mit.edu	37	X	140994683	140994683	+	Frame_Shift_Del	DEL	C	-	-			TCGA-63-5131-01A-01D-1441-08	TCGA-63-5131-10A-01D-1441-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:140994683delC	uc004fbt.2	+	4	1779	c.1493delC	c.(1492-1494)TCCfs	p.S498fs	MAGEC1_uc010nsl.1_Intron	NM_005462	NP_005453	O60732	MAGC1_HUMAN	melanoma antigen family C, 1	498							protein binding			ovary(1)|kidney(1)|central_nervous_system(1)|skin(1)	4	Acute lymphoblastic leukemia(192;6.56e-05)					TTCCAGAGTTCCCCTGAGTGT	0.498										HNSCC(15;0.026)			64	140	---	---	---	---	
