Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	filter
KIF1B	23095	broad.mit.edu	37	1	10363881	10363881	+	Intron	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:10363881G>T	uc001aqx.3	+						KIF1B_uc001aqv.3_Missense_Mutation_p.A880S|KIF1B_uc001aqw.3_Intron|KIF1B_uc001aqy.2_Intron|KIF1B_uc001aqz.2_Intron|KIF1B_uc001ara.2_Intron|KIF1B_uc001arb.2_Intron	NM_015074	NP_055889	O60333	KIF1B_HUMAN	kinesin family member 1B isoform b						anterograde axon cargo transport|apoptosis|neuromuscular synaptic transmission|neuron-neuron synaptic transmission	cytoplasmic vesicle membrane|microtubule|microtubule associated complex|mitochondrion	ATP binding|ATPase activity|kinesin binding|microtubule motor activity|protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	Ovarian(185;0.203)	all_lung(284;1.31e-05)|Lung NSC(185;2.2e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0259)|Colorectal(212;9.79e-07)|COAD - Colon adenocarcinoma(227;0.000143)|BRCA - Breast invasive adenocarcinoma(304;0.000413)|Kidney(185;0.00134)|KIRC - Kidney renal clear cell carcinoma(229;0.0037)|STAD - Stomach adenocarcinoma(132;0.0113)|READ - Rectum adenocarcinoma(331;0.0642)		GCCTGTTGGTGCTGGTGTTAG	0.438													17	80	---	---	---	---	PASS
MTHFR	4524	broad.mit.edu	37	1	11855302	11855302	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:11855302C>A	uc001atc.1	-	6	1068	c.884G>T	c.(883-885)CGC>CTC	p.R295L	MTHFR_uc001atb.1_Missense_Mutation_p.R318L	NM_005957	NP_005948	P42898	MTHR_HUMAN	5,10-methylenetetrahydrofolate reductase	295					blood circulation|folic acid metabolic process	cytosol	methylenetetrahydrofolate reductase (NADPH) activity|protein binding				0	Ovarian(185;0.249)	Lung NSC(185;8.69e-05)|all_lung(284;9.87e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00826)|Ovarian(437;0.00965)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;5.66e-06)|COAD - Colon adenocarcinoma(227;0.000261)|BRCA - Breast invasive adenocarcinoma(304;0.000304)|Kidney(185;0.000777)|KIRC - Kidney renal clear cell carcinoma(229;0.00261)|STAD - Stomach adenocarcinoma(313;0.0073)|READ - Rectum adenocarcinoma(331;0.0649)	Benazepril(DB00542)|Cyanocobalamin(DB00115)|Folic Acid(DB00158)|L-Methionine(DB00134)|Menadione(DB00170)|Methotrexate(DB00563)|Pyridoxal Phosphate(DB00114)|Pyridoxine(DB00165)|Raltitrexed(DB00293)|Riboflavin(DB00140)|S-Adenosylmethionine(DB00118)|Tetrahydrofolic acid(DB00116)	GCCATAGTTGCGGATGGCAGC	0.582													11	68	---	---	---	---	PASS
MST1P9	11223	broad.mit.edu	37	1	17085795	17085795	+	Silent	SNP	G	T	T	rs1057379	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:17085795G>T	uc010ock.1	-	8	1026	c.1026C>A	c.(1024-1026)ATC>ATA	p.I342I	CROCC_uc009voy.1_Intron|MST1P9_uc001azp.3_5'UTR	NR_002729				SubName: Full=Hepatocyte growth factor-like protein homolog;												0						TACAACGCCGGATCTGGTAGC	0.687													4	39	---	---	---	---	PASS
HSPG2	3339	broad.mit.edu	37	1	22168731	22168731	+	Splice_Site	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:22168731C>T	uc001bfj.2	-	68	9092	c.9052_splice	c.e68+1	p.R3018_splice	HSPG2_uc009vqd.2_Splice_Site_p.R3019_splice	NM_005529	NP_005520	P98160	PGBM_HUMAN	heparan sulfate proteoglycan 2 precursor						angiogenesis|cell adhesion|lipid metabolic process|lipoprotein metabolic process	basement membrane|extracellular space|plasma membrane	protein C-terminus binding			ovary(5)|large_intestine(2)|central_nervous_system(1)|skin(1)	9		Colorectal(325;3.46e-05)|all_lung(284;7.93e-05)|Lung NSC(340;8.71e-05)|Renal(390;0.000219)|Breast(348;0.00222)|Ovarian(437;0.00308)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0498)|OV - Ovarian serous cystadenocarcinoma(117;1.14e-26)|Colorectal(126;4.18e-07)|COAD - Colon adenocarcinoma(152;1.82e-05)|GBM - Glioblastoma multiforme(114;3.13e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000756)|STAD - Stomach adenocarcinoma(196;0.00656)|KIRC - Kidney renal clear cell carcinoma(1967;0.00942)|READ - Rectum adenocarcinoma(331;0.0721)|Lung(427;0.223)	Becaplermin(DB00102)|Palifermin(DB00039)	GCCATACTCACGGTAGGAAGA	0.652													11	65	---	---	---	---	PASS
ZMYM4	9202	broad.mit.edu	37	1	35857906	35857906	+	Missense_Mutation	SNP	G	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35857906G>C	uc001byt.2	+	16	2761	c.2681G>C	c.(2680-2682)AGT>ACT	p.S894T	ZMYM4_uc009vuu.2_Missense_Mutation_p.S862T|ZMYM4_uc001byu.2_Missense_Mutation_p.S570T|ZMYM4_uc009vuv.2_Missense_Mutation_p.S633T	NM_005095	NP_005086	Q5VZL5	ZMYM4_HUMAN	zinc finger protein 262	894					multicellular organismal development		DNA binding|zinc ion binding			large_intestine(2)|ovary(1)|kidney(1)|skin(1)	5		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)				TCATTGGCAAGTGCCCCTGCT	0.433													21	136	---	---	---	---	PASS
DHCR24	1718	broad.mit.edu	37	1	55331164	55331164	+	Intron	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:55331164C>T	uc001cyc.1	-						DHCR24_uc010ooi.1_5'UTR|DHCR24_uc010ooj.1_Intron|DHCR24_uc010ook.1_Intron	NM_014762	NP_055577	Q15392	DHC24_HUMAN	24-dehydrocholesterol reductase precursor						anti-apoptosis|apoptosis|cell cycle arrest|cholesterol biosynthetic process|negative regulation of caspase activity|neuroprotection|response to oxidative stress|skin development	endoplasmic reticulum membrane|Golgi membrane|integral to membrane|nucleus	delta24-sterol reductase activity|enzyme binding|flavin adenine dinucleotide binding|peptide antigen binding			pancreas(1)	1						GACAAGCGCCCAGCACCATCG	0.289													12	60	---	---	---	---	PASS
NBPF9	400818	broad.mit.edu	37	1	144829067	144829067	+	Intron	SNP	A	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144829067A>G	uc010oye.1	+						NBPF10_uc009wir.2_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|uc001elr.3_RNA			Q3BBV1	NBPFK_HUMAN	RecName: Full=Neuroblastoma breakpoint family member 8;							cytoplasm					0						TAGCTACAAAATTCCTCAGGG	0.443													2	5	---	---	---	---	PASS
TCHH	7062	broad.mit.edu	37	1	152084099	152084099	+	Silent	SNP	A	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152084099A>G	uc001ezp.2	-	2	1594	c.1594T>C	c.(1594-1596)TTG>CTG	p.L532L	TCHH_uc009wne.1_Silent_p.L532L	NM_007113	NP_009044	Q07283	TRHY_HUMAN	trichohyalin	532	9 X 28 AA approximate tandem repeats.				keratinization	cytoskeleton	calcium ion binding			ovary(3)|kidney(1)|central_nervous_system(1)	5	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			TCGCTCCTCAACCGCTGCTGG	0.652													9	177	---	---	---	---	PASS
USF1	7391	broad.mit.edu	37	1	161009657	161009657	+	3'UTR	SNP	T	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161009657T>C	uc001fxi.2	-	11					F11R_uc010pjw.1_5'Flank|F11R_uc001fxf.3_5'Flank|TSTD1_uc010pjx.1_5'Flank|TSTD1_uc009wtw.2_5'Flank|TSTD1_uc001fxh.3_5'Flank|USF1_uc001fxj.2_3'UTR	NM_007122	NP_009053	P22415	USF1_HUMAN	upstream stimulatory factor 1 isoform 1						cellular response to insulin stimulus|glucose homeostasis|late viral mRNA transcription|lipid homeostasis|positive regulation of transcription from RNA polymerase II promoter by glucose|response to hypoxia|response to UV	transcription factor complex	bHLH transcription factor binding|histone deacetylase binding|protein heterodimerization activity|protein homodimerization activity|protein kinase binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity			upper_aerodigestive_tract(1)|ovary(1)|central_nervous_system(1)	3	all_cancers(52;6.73e-18)|Breast(13;0.012)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00122)			GATTAGGCTGTTGCTCCTGGG	0.547													6	43	---	---	---	---	PASS
SELE	6401	broad.mit.edu	37	1	169697008	169697008	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169697008G>A	uc001ggm.3	-	9	1497	c.1340C>T	c.(1339-1341)CCT>CTT	p.P447L	C1orf112_uc001ggj.2_Intron	NM_000450	NP_000441	P16581	LYAM2_HUMAN	selectin E precursor	447	Extracellular (Potential).|Sushi 5.				actin filament-based process|activation of phospholipase C activity|calcium-mediated signaling|heterophilic cell-cell adhesion|leukocyte migration involved in inflammatory response|leukocyte tethering or rolling|positive regulation of receptor internalization|regulation of inflammatory response|response to interleukin-1|response to lipopolysaccharide|response to tumor necrosis factor	caveola|coated pit|cortical cytoskeleton|extracellular space|integral to membrane|perinuclear region of cytoplasm	oligosaccharide binding|phospholipase binding|sialic acid binding|transmembrane receptor activity			ovary(3)|skin(2)	5	all_hematologic(923;0.208)					TTCTCCAATAGGGGAATGAGC	0.488													33	181	---	---	---	---	PASS
RASSF5	83593	broad.mit.edu	37	1	206757773	206757773	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:206757773C>T	uc001hed.2	+	4	802	c.745C>T	c.(745-747)CCT>TCT	p.P249S	RASSF5_uc001hec.1_Missense_Mutation_p.P249S|RASSF5_uc001hee.2_Missense_Mutation_p.P249S|RASSF5_uc001hef.2_Missense_Mutation_p.P96S|RASSF5_uc001heg.1_Missense_Mutation_p.P22S	NM_182663	NP_872604	Q8WWW0	RASF5_HUMAN	Ras association (RalGDS/AF-6) domain family 5	249					apoptosis|intracellular signal transduction	cytoplasm|microtubule	metal ion binding|protein binding			ovary(1)	1	Breast(84;0.183)		BRCA - Breast invasive adenocarcinoma(75;0.166)			ACTCCGGCGGCCTGTGACGGT	0.617											OREG0014174	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	7	132	---	---	---	---	PASS
ZNF496	84838	broad.mit.edu	37	1	247463763	247463763	+	3'UTR	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247463763C>A	uc001ico.2	-	9					ZNF496_uc009xgv.2_3'UTR|ZNF496_uc001icp.2_3'UTR	NM_032752	NP_116141	Q96IT1	ZN496_HUMAN	zinc finger protein 496						positive regulation of transcription, DNA-dependent|viral reproduction		DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2	all_cancers(71;0.000136)|all_epithelial(71;2.62e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0607)|Lung NSC(105;0.0661)		OV - Ovarian serous cystadenocarcinoma(106;0.00703)			GGGCGCTGATCAGTACCAAGG	0.632													6	23	---	---	---	---	PASS
BIRC6	57448	broad.mit.edu	37	2	32689778	32689778	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:32689778G>T	uc010ezu.2	+	25	5277	c.5143G>T	c.(5143-5145)GCA>TCA	p.A1715S		NM_016252	NP_057336	Q9NR09	BIRC6_HUMAN	baculoviral IAP repeat-containing 6	1715					anti-apoptosis|apoptosis	intracellular	acid-amino acid ligase activity|cysteine-type endopeptidase inhibitor activity|protein binding			ovary(5)|skin(4)|lung(2)|central_nervous_system(1)|breast(1)|pancreas(1)	14	Acute lymphoblastic leukemia(172;0.155)					ACCCAATGAAGCAGTTTCCGT	0.458													34	121	---	---	---	---	PASS
SLC9A4	389015	broad.mit.edu	37	2	103120167	103120167	+	Splice_Site	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:103120167G>A	uc002tbz.3	+	3	1437	c.980_splice	c.e3+1	p.A327_splice		NM_001011552	NP_001011552	Q6AI14	SL9A4_HUMAN	solute carrier family 9 (sodium/hydrogen						regulation of pH	apical plasma membrane|basolateral plasma membrane|integral to membrane	sodium:hydrogen antiporter activity			skin(2)|central_nervous_system(1)	3						GCATCCTGGCGTGAGTACAAA	0.433													25	156	---	---	---	---	PASS
IWS1	55677	broad.mit.edu	37	2	128252517	128252517	+	Missense_Mutation	SNP	A	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128252517A>C	uc002ton.2	-	8	2033	c.1730T>G	c.(1729-1731)TTG>TGG	p.L577W	IWS1_uc010yzl.1_RNA	NM_017969	NP_060439	Q96ST2	IWS1_HUMAN	IWS1 homolog	577					transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.0735)		TTGATTGTTCAACTGTCTGTC	0.259													22	136	---	---	---	---	PASS
SLC23A3	151295	broad.mit.edu	37	2	220033819	220033819	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220033819G>A	uc010zks.1	-	4	535	c.424C>T	c.(424-426)CTC>TTC	p.L142F	NHEJ1_uc002vjq.3_RNA|SLC23A3_uc010zkr.1_Missense_Mutation_p.L150F|SLC23A3_uc010fwb.2_Missense_Mutation_p.L142F|SLC23A3_uc002vjs.1_5'UTR|SLC23A3_uc002vjt.1_5'UTR	NM_001144889	NP_001138361	Q6PIS1	S23A3_HUMAN	solute carrier family 23 (nucleobase	142	Cytoplasmic (Potential).				transmembrane transport	integral to membrane	protein binding|transporter activity				0		Renal(207;0.0474)		Epithelial(149;9.27e-07)|all cancers(144;0.000156)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		TGCAGCATGAGGGAGGCTAGG	0.562													14	70	---	---	---	---	PASS
PAX3	5077	broad.mit.edu	37	2	223066808	223066808	+	Silent	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:223066808C>A	uc010fwo.2	-	8	1641	c.1275G>T	c.(1273-1275)GTG>GTT	p.V425V	PAX3_uc002vmt.1_Silent_p.V425V|PAX3_uc002vmy.1_Silent_p.V424V|PAX3_uc002vmv.1_Silent_p.V425V|PAX3_uc002vmw.1_Intron|PAX3_uc002vmx.1_Intron	NM_181457	NP_852122	P23760	PAX3_HUMAN	paired box 3 isoform PAX3	425					apoptosis|organ morphogenesis|positive regulation of transcription from RNA polymerase II promoter|sensory perception of sound|transcription from RNA polymerase II promoter	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity		PAX3/FOXO1(749)|PAX3/NCOA1(8)|PAX3/NCOA2(4)	soft_tissue(761)|ovary(4)|skin(1)	766		Renal(207;0.0183)		Epithelial(121;4.13e-10)|all cancers(144;1.85e-07)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		AGCTGGCCGACACCGTGGTGG	0.572			T	FOXO1A|NCOA1	alveolar rhabdomyosarcoma		Waardenburg syndrome; craniofacial-deafness-hand syndrome						12	69	---	---	---	---	PASS
HJURP	55355	broad.mit.edu	37	2	234749963	234749963	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:234749963G>A	uc002vvg.2	-	8	1529	c.1463C>T	c.(1462-1464)CCT>CTT	p.P488L	HJURP_uc010znd.1_Missense_Mutation_p.P427L|HJURP_uc010zne.1_Missense_Mutation_p.P396L	NM_018410	NP_060880	Q8NCD3	HJURP_HUMAN	Holliday junction recognition protein	488					cell cycle|CenH3-containing nucleosome assembly at centromere|centromeric core chromatin assembly|chromosome segregation|regulation of DNA binding|regulation of protein complex assembly	condensed chromosome kinetochore|cytoplasm|nucleolus|nucleoplasm	DNA binding|histone binding			ovary(1)	1		Breast(86;0.00204)|all_lung(227;0.00433)|Renal(207;0.00685)|all_hematologic(139;0.0116)|Acute lymphoblastic leukemia(138;0.0326)|Lung NSC(271;0.0719)|Lung SC(224;0.128)		Epithelial(121;2.01e-18)|BRCA - Breast invasive adenocarcinoma(100;0.000186)|Lung(119;0.00521)|LUSC - Lung squamous cell carcinoma(224;0.00829)		TTTGCTGGAAGGTAAACTCAG	0.527													21	150	---	---	---	---	PASS
VHL	7428	broad.mit.edu	37	3	10188200	10188200	+	Missense_Mutation	SNP	C	T	T	rs5030811		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:10188200C>T	uc003bvc.2	+	2	556	c.343C>T	c.(343-345)CAC>TAC	p.H115Y	VHL_uc003bvd.2_Intron	NM_000551	NP_000542	P40337	VHL_HUMAN	von Hippel-Lindau tumor suppressor isoform 1	115	Involved in binding to CCT complex.		H -> Q (in VHLD; type II).		anti-apoptosis|cell morphogenesis|negative regulation of cell proliferation|negative regulation of transcription from RNA polymerase II promoter|positive regulation of cell differentiation|positive regulation of transcription, DNA-dependent|protein stabilization|protein ubiquitination|proteolysis	cytosol|endoplasmic reticulum|membrane|mitochondrion|nucleus	protein binding|transcription factor binding	p.H115N(5)|p.?(3)|p.H115Y(3)|p.H115fs*44(3)|p.H115D(1)|p.H115fs*41(1)|p.H115fs*42(1)|p.H115P(1)		kidney(1273)|soft_tissue(24)|adrenal_gland(15)|large_intestine(13)|pancreas(5)|endometrium(4)|thyroid(3)|upper_aerodigestive_tract(3)|central_nervous_system(2)|lung(2)|pleura(1)|paratesticular_tissues(1)	1346				Kidney(1;0.000404)|KIRC - Kidney renal clear cell carcinoma(1;0.000569)		CCCGATAGGTCACCTTTGGCT	0.333		1	D|Mis|N|F|S		renal|hemangioma|pheochromocytoma	renal|hemangioma|pheochromocytoma			von_Hippel-Lindau_disease|Chuvash_Polycythemia_|Pheochromocytoma_(Adrenal)_Familial				51	198	---	---	---	---	PASS
SETD2	29072	broad.mit.edu	37	3	47125380	47125380	+	Nonsense_Mutation	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:47125380C>A	uc003cqs.2	-	12	5943	c.5890G>T	c.(5890-5892)GAG>TAG	p.E1964*	SETD2_uc003cqv.2_Nonsense_Mutation_p.E2031*|SETD2_uc003cqt.1_RNA	NM_014159	NP_054878	Q9BYW2	SETD2_HUMAN	SET domain containing 2	1964					regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nucleus	DNA binding|histone-lysine N-methyltransferase activity|oxidoreductase activity|transition metal ion binding			kidney(24)|ovary(5)|skin(1)|central_nervous_system(1)|breast(1)	32		Acute lymphoblastic leukemia(5;0.0169)		BRCA - Breast invasive adenocarcinoma(193;0.000302)|KIRC - Kidney renal clear cell carcinoma(197;0.00732)|Kidney(197;0.00844)		CCGTTGCTCTCTTTGGGCTCT	0.443			N|F|S|Mis		clear cell renal carcinoma								45	235	---	---	---	---	PASS
LAMB2	3913	broad.mit.edu	37	3	49160288	49160288	+	Silent	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49160288G>A	uc003cwe.2	-	27	4721	c.4422C>T	c.(4420-4422)CTC>CTT	p.L1474L	USP19_uc003cvz.3_5'Flank|USP19_uc011bcg.1_5'Flank|USP19_uc003cwb.2_5'Flank|USP19_uc003cwd.1_5'Flank|USP19_uc011bch.1_5'Flank|USP19_uc011bci.1_5'Flank	NM_002292	NP_002283	P55268	LAMB2_HUMAN	laminin, beta 2 precursor	1474	Potential.|Domain I.				cell adhesion	laminin-11 complex|laminin-3 complex	structural molecule activity			ovary(3)	3				BRCA - Breast invasive adenocarcinoma(193;8.01e-05)|Kidney(197;0.00219)|KIRC - Kidney renal clear cell carcinoma(197;0.00245)		CCACTCTGCTGAGGATGCTAC	0.662													8	60	---	---	---	---	PASS
PBRM1	55193	broad.mit.edu	37	3	52595787	52595787	+	Nonsense_Mutation	SNP	A	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52595787A>C	uc003des.2	-	25	4296	c.4284T>G	c.(4282-4284)TAT>TAG	p.Y1428*	PBRM1_uc003dex.2_RNA|PBRM1_uc003deq.2_Nonsense_Mutation_p.Y1428*|PBRM1_uc003der.2_Nonsense_Mutation_p.Y1396*|PBRM1_uc003det.2_Nonsense_Mutation_p.Y1443*|PBRM1_uc003deu.2_Nonsense_Mutation_p.Y1443*|PBRM1_uc003dev.2_RNA|PBRM1_uc003dew.2_Nonsense_Mutation_p.Y1428*|PBRM1_uc010hmk.1_Nonsense_Mutation_p.Y1403*|PBRM1_uc003dey.2_Nonsense_Mutation_p.Y1376*|PBRM1_uc003dez.1_Nonsense_Mutation_p.Y1427*	NM_181042	NP_060635	Q86U86	PB1_HUMAN	polybromo 1 isoform 4	1428	HMG box.				chromatin remodeling|mitosis|negative regulation of cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear chromosome	chromatin binding|DNA binding|protein binding			kidney(136)|breast(4)	140				BRCA - Breast invasive adenocarcinoma(193;1.8e-05)|Kidney(197;0.00105)|KIRC - Kidney renal clear cell carcinoma(197;0.00122)|OV - Ovarian serous cystadenocarcinoma(275;0.0613)		ATTTACCTTCATATTCTGCTT	0.498			Mis|N|F|S|D|O		clear cell renal carcinoma|breast								100	384	---	---	---	---	PASS
ACAD11	84129	broad.mit.edu	37	3	132323956	132323956	+	Missense_Mutation	SNP	C	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132323956C>G	uc003eov.3	-	12	1888	c.1508G>C	c.(1507-1509)TGC>TCC	p.C503S	ACAD11_uc011blr.1_Missense_Mutation_p.C114S	NM_032169	NP_115545	Q709F0	ACD11_HUMAN	putative acyl-CoA dehydrogenase	503						peroxisome	acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding|transferase activity, transferring phosphorus-containing groups			ovary(1)	1						CATACAGAAGCAAGAGGTAAT	0.453													15	151	---	---	---	---	PASS
KPNA4	3840	broad.mit.edu	37	3	160219829	160219829	+	3'UTR	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160219829C>T	uc003fdn.2	-	17						NM_002268	NP_002259	O00629	IMA4_HUMAN	karyopherin alpha 4						NLS-bearing substrate import into nucleus	cytoplasm|nuclear pore	protein binding				0			Lung(72;0.00149)|LUSC - Lung squamous cell carcinoma(72;0.00216)			tatatatatacacacacacat	0.313													11	90	---	---	---	---	PASS
ERCC8	1161	broad.mit.edu	37	5	60188547	60188547	+	Intron	SNP	T	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:60188547T>G	uc003jsm.3	-						ERCC8_uc003jsk.2_RNA|ERCC8_uc003jsl.3_Intron|ERCC8_uc011cqp.1_Intron	NM_000082	NP_000073	Q13216	ERCC8_HUMAN	excision repair cross-complementing rodent						positive regulation of DNA repair|proteasomal ubiquitin-dependent protein catabolic process|protein autoubiquitination|protein polyubiquitination|response to oxidative stress|response to UV|response to UV|transcription-coupled nucleotide-excision repair	Cul4A-RING ubiquitin ligase complex|nuclear matrix|nucleoplasm|nucleotide-excision repair complex|soluble fraction	protein binding|protein complex binding				0		Lung NSC(810;1.51e-06)|Prostate(74;0.0322)|Ovarian(174;0.0481)|Breast(144;0.077)				TGCAGGATGGTGCCCACCTCT	0.557								Direct_reversal_of_damage|NER					3	3	---	---	---	---	PASS
CLINT1	9685	broad.mit.edu	37	5	157232998	157232998	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:157232998G>T	uc003lxj.1	-	7	1008	c.818C>A	c.(817-819)ACC>AAC	p.T273N	CLINT1_uc003lxi.1_Missense_Mutation_p.T255N|CLINT1_uc011ddv.1_Missense_Mutation_p.T273N	NM_014666	NP_055481	Q14677	EPN4_HUMAN	epsin 4	273					endocytosis|post-Golgi vesicle-mediated transport	clathrin-coated vesicle|cytosol|Golgi apparatus|membrane|perinuclear region of cytoplasm	clathrin binding|lipid binding			ovary(2)|pancreas(1)	3	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.138)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)			CTTGTGTCTGGTTGTGGTGGT	0.478													25	127	---	---	---	---	PASS
PRDM13	59336	broad.mit.edu	37	6	100057184	100057184	+	Splice_Site	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:100057184G>A	uc003pqg.1	+	3	658	c.397_splice	c.e3+1	p.G133_splice		NM_021620	NP_067633	Q9H4Q3	PRD13_HUMAN	PR domain containing 13						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		all_cancers(76;1.64e-05)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0128)|Colorectal(196;0.069)|Lung NSC(302;0.186)		BRCA - Breast invasive adenocarcinoma(108;0.0598)		GACGAGAAAGGTACCCATTCC	0.532													3	30	---	---	---	---	PASS
TPST1	8460	broad.mit.edu	37	7	65705680	65705680	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:65705680G>T	uc003tuw.2	+	2	620	c.268G>T	c.(268-270)GAC>TAC	p.D90Y	TPST1_uc010kzy.2_Intron|TPST1_uc010kzz.2_Missense_Mutation_p.D90Y|TPST1_uc010laa.2_Missense_Mutation_p.D90Y	NM_003596	NP_003587	O60507	TPST1_HUMAN	tyrosylprotein sulfotransferase 1	90	Lumenal (Potential).				inflammatory response|peptidyl-tyrosine sulfation	Golgi membrane|integral to membrane|membrane fraction	protein-tyrosine sulfotransferase activity				0						GGCCATGCTGGACGCACATCC	0.502													12	68	---	---	---	---	PASS
ZNF3	7551	broad.mit.edu	37	7	99668973	99668973	+	Silent	SNP	G	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99668973G>C	uc003usq.2	-	6	1441	c.1134C>G	c.(1132-1134)ACC>ACG	p.T378T	ZNF3_uc003usp.2_Intron|ZNF3_uc003usr.2_Silent_p.T378T|ZNF3_uc010lgj.2_Silent_p.T342T|ZNF3_uc003uss.2_Silent_p.T385T|ZNF3_uc003ust.3_Silent_p.T378T	NM_032924	NP_116313	P17036	ZNF3_HUMAN	zinc finger protein 3 isoform 2	378	C2H2-type 7.			GEKPYECNECGKAFSQSSHLYQHQRIHTGEKPYECMECGGK FTYSSGLIQHQ -> EALPTFVTLIRLLPSVDPIVTNEAAF PAESLATIFALIWRLFCVHSLMFKKV (in Ref. 2; BAA91019).	cell differentiation|leukocyte activation|multicellular organismal development	nucleus	DNA binding|identical protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)	Ovarian(593;2.06e-05)|Myeloproliferative disorder(862;0.0122)|Breast(660;0.029)	STAD - Stomach adenocarcinoma(171;0.129)			CTGAACTGTAGGTAAACTTTC	0.502													22	192	---	---	---	---	PASS
AGFG2	3268	broad.mit.edu	37	7	100160277	100160277	+	Silent	SNP	C	T	T	rs146791629		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100160277C>T	uc003uvf.2	+	8	1195	c.1059C>T	c.(1057-1059)GGC>GGT	p.G353G	AGFG2_uc010lgy.2_Missense_Mutation_p.A215V	NM_006076	NP_006067	O95081	AGFG2_HUMAN	ArfGAP with FG repeats 2	353					regulation of ARF GTPase activity		ARF GTPase activator activity|zinc ion binding			central_nervous_system(1)	1						GCGGCGGCGGCGGCAGCAGCA	0.657													6	50	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	7	148979329	148979329	+	Intron	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:148979329C>T	uc003wfr.3	+						uc011kuo.1_5'Flank					Homo sapiens cDNA FLJ36716 fis, clone UTERU2010651.																		TGGCCGTGCACATGCAGACCC	0.731													7	23	---	---	---	---	PASS
SSPO	23145	broad.mit.edu	37	7	149482073	149482073	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:149482073G>T	uc010lpk.2	+	20	2861	c.2861G>T	c.(2860-2862)GGC>GTC	p.G954V	SSPO_uc010lpl.1_Missense_Mutation_p.A290S	NM_198455	NP_940857	A2VEC9	SSPO_HUMAN	SCO-spondin precursor	954					cell adhesion	extracellular space	peptidase inhibitor activity				0	Melanoma(164;0.165)|Ovarian(565;0.177)		OV - Ovarian serous cystadenocarcinoma(82;0.00625)			AGTACTGATGGCTGTGTCTGT	0.627													7	57	---	---	---	---	PASS
SLC4A2	6522	broad.mit.edu	37	7	150771996	150771996	+	Intron	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150771996G>T	uc003wit.3	+						SLC4A2_uc011kve.1_Intron|SLC4A2_uc003wiu.3_Intron|SLC4A2_uc003wiv.3_Intron|uc011kvf.1_3'UTR	NM_003040	NP_003031	P04920	B3A2_HUMAN	solute carrier family 4, anion exchanger, member						bicarbonate transport	integral to membrane|membrane fraction	inorganic anion exchanger activity				0			OV - Ovarian serous cystadenocarcinoma(82;0.0121)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)		ACTCAGCATGGAACCTCCAGC	0.557													4	9	---	---	---	---	PASS
GEM	2669	broad.mit.edu	37	8	95264274	95264274	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:95264274C>A	uc003ygj.2	-	4	835	c.586G>T	c.(586-588)GTG>TTG	p.V196L	GEM_uc003ygi.2_Missense_Mutation_p.V196L	NM_005261	NP_005252	P55040	GEM_HUMAN	GTP-binding mitogen-induced T-cell protein	196					cell surface receptor linked signaling pathway|immune response|small GTPase mediated signal transduction	internal side of plasma membrane	calmodulin binding|GDP binding|GTP binding|GTPase activity|magnesium ion binding			lung(1)	1	Breast(36;4.65e-06)	Myeloproliferative disorder(644;0.204)	BRCA - Breast invasive adenocarcinoma(8;0.00691)			CGGCACCGCACTAAGTCACTT	0.507													6	174	---	---	---	---	PASS
ZNF572	137209	broad.mit.edu	37	8	125989952	125989952	+	Missense_Mutation	SNP	C	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:125989952C>G	uc003yrr.2	+	3	1597	c.1442C>G	c.(1441-1443)GCC>GGC	p.A481G		NM_152412	NP_689625	Q7Z3I7	ZN572_HUMAN	zinc finger protein 572	481	C2H2-type 12.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			large_intestine(1)|ovary(1)	2	Ovarian(258;0.0028)|all_neural(195;0.00294)|Hepatocellular(40;0.108)		STAD - Stomach adenocarcinoma(47;0.000918)|COAD - Colon adenocarcinoma(160;0.205)			AGCAGAAGTGCCTACCTCAGT	0.468										HNSCC(60;0.17)			71	238	---	---	---	---	PASS
CDC123	8872	broad.mit.edu	37	10	12257826	12257826	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:12257826G>T	uc001ill.2	+	5	609	c.325G>T	c.(325-327)GCC>TCC	p.A109S	CDC123_uc009xja.2_Missense_Mutation_p.A109S|CDC123_uc001ilm.2_Missense_Mutation_p.A109S	NM_006023	NP_006014	O75794	CD123_HUMAN	cell division cycle 123	109					cell cycle arrest|cell division|positive regulation of cell proliferation|regulation of mitotic cell cycle	cytoplasm				central_nervous_system(1)	1						TAATTGGAGTGCCCCAAGGGT	0.403													6	96	---	---	---	---	PASS
OR5I1	10798	broad.mit.edu	37	11	55703464	55703464	+	Missense_Mutation	SNP	A	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55703464A>C	uc010ris.1	-	1	413	c.413T>G	c.(412-414)ATG>AGG	p.M138R		NM_006637	NP_006628	Q13606	OR5I1_HUMAN	olfactory receptor, family 5, subfamily I,	138	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1						GCCCCTAGACATCACAACTGT	0.438													17	75	---	---	---	---	PASS
OR10W1	81341	broad.mit.edu	37	11	58034733	58034733	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58034733C>T	uc001nmq.1	-	1	1000	c.598G>A	c.(598-600)GTG>ATG	p.V200M		NM_207374	NP_997257	Q8NGF6	O10W1_HUMAN	olfactory receptor, family 10, subfamily W,	200	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(21;0.0589)				AAGAAAGGCACAGCAATGGCT	0.547													11	51	---	---	---	---	PASS
MALAT1	378938	broad.mit.edu	37	11	65273309	65273309	+	RNA	SNP	A	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65273309A>G	uc010roh.1	+	1		c.8077A>G			uc001ody.2_5'Flank	NR_002819				Homo sapiens clone alpha1 mRNA sequence.												0						CATGTTCAAGAACTGTAATGC	0.398													28	148	---	---	---	---	PASS
PPFIA1	8500	broad.mit.edu	37	11	70218604	70218604	+	Silent	SNP	T	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:70218604T>C	uc001opo.2	+	23	3261	c.3063T>C	c.(3061-3063)ATT>ATC	p.I1021I	PPFIA1_uc001opn.1_Silent_p.I1021I|PPFIA1_uc001opp.2_RNA|PPFIA1_uc001opr.2_Silent_p.I160I|PPFIA1_uc001ops.2_Silent_p.I60I	NM_003626	NP_003617	Q13136	LIPA1_HUMAN	PTPRF interacting protein alpha 1 isoform b	1021	Potential.|SAM 2.				cell-matrix adhesion	cytoplasm	protein binding|signal transducer activity			lung(2)|ovary(1)	3			BRCA - Breast invasive adenocarcinoma(2;1.04e-44)|LUSC - Lung squamous cell carcinoma(11;1.46e-14)|STAD - Stomach adenocarcinoma(18;0.0513)			AGTGTGGAATTATGTGCCTGA	0.323													13	112	---	---	---	---	PASS
CCDC89	220388	broad.mit.edu	37	11	85396828	85396828	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:85396828C>T	uc001pau.1	-	1	493	c.346G>A	c.(346-348)GGT>AGT	p.G116S		NM_152723	NP_689936	Q8N998	CCD89_HUMAN	coiled-coil domain containing 89	116	Potential.					cytoplasm|nucleus					0		Acute lymphoblastic leukemia(157;4.88e-06)|all_hematologic(158;0.00572)				CTGTACTCACCCTGGGCCTTG	0.532													18	140	---	---	---	---	PASS
DDX25	29118	broad.mit.edu	37	11	125786947	125786947	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:125786947C>T	uc001qcz.3	+	9	980	c.839C>T	c.(838-840)GCA>GTA	p.A280V	DDX25_uc010sbk.1_Missense_Mutation_p.A280V	NM_013264	NP_037396	Q9UHL0	DDX25_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 25	280	Helicase ATP-binding.				mRNA export from nucleus|multicellular organismal development|regulation of translation|spermatid development	chromatoid body|nucleus	ATP binding|ATP-dependent RNA helicase activity|RNA binding			ovary(1)	1	all_hematologic(175;0.177)	Breast(109;0.0021)|all_lung(97;0.0203)|Lung NSC(97;0.0203)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;1.14e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.046)		CTCTTTTCAGCAACCTTTGAG	0.493													3	22	---	---	---	---	PASS
ANO2	57101	broad.mit.edu	37	12	6055316	6055316	+	Intron	SNP	C	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6055316C>G	uc001qnm.2	-							NM_020373	NP_065106	Q9NQ90	ANO2_HUMAN	anoctamin 2							chloride channel complex|plasma membrane	intracellular calcium activated chloride channel activity			ovary(4)|large_intestine(2)|central_nervous_system(1)	7						TGATCACTGACCTTCAGGCAT	0.413													12	128	---	---	---	---	PASS
VWF	7450	broad.mit.edu	37	12	6219564	6219564	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6219564C>T	uc001qnn.1	-	5	758	c.508G>A	c.(508-510)GAA>AAA	p.E170K	VWF_uc010set.1_Missense_Mutation_p.E170K|VWF_uc001qno.1_Missense_Mutation_p.E207K	NM_000552	NP_000543	P04275	VWF_HUMAN	von Willebrand factor preproprotein	170	VWFD 1.				blood coagulation, intrinsic pathway|cell-substrate adhesion|platelet activation|platelet degranulation|protein homooligomerization	endoplasmic reticulum|platelet alpha granule lumen|proteinaceous extracellular matrix|Weibel-Palade body	chaperone binding|collagen binding|glycoprotein binding|immunoglobulin binding|integrin binding|protease binding|protein homodimerization activity|protein N-terminus binding			skin(4)|ovary(3)|pancreas(2)|central_nervous_system(1)|haematopoietic_and_lymphoid_tissue(1)|breast(1)	12					Antihemophilic Factor(DB00025)	AAGTCATCTTCAGCAAAGATG	0.453													49	282	---	---	---	---	PASS
CDK17	5128	broad.mit.edu	37	12	96683053	96683053	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:96683053G>A	uc001tep.1	-	11	1499	c.1010C>T	c.(1009-1011)GCC>GTC	p.A337V	CDK17_uc009ztk.2_Missense_Mutation_p.A337V|CDK17_uc010svb.1_Missense_Mutation_p.A284V	NM_002595	NP_002586	Q00537	CDK17_HUMAN	PCTAIRE protein kinase 2	337	Protein kinase.						ATP binding|cyclin-dependent protein kinase activity			ovary(3)|lung(2)|kidney(1)|central_nervous_system(1)	7						AACTGACTTGGCTCGGGCTAG	0.443													28	181	---	---	---	---	PASS
BCL7A	605	broad.mit.edu	37	12	122492742	122492742	+	Silent	SNP	G	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:122492742G>C	uc001ubp.2	+	5	608	c.471G>C	c.(469-471)TCG>TCC	p.S157S	BCL7A_uc001ubo.2_Silent_p.S157S	NM_001024808	NP_001019979	Q4VC05	BCL7A_HUMAN	B-cell CLL/lymphoma 7A isoform b	157					negative regulation of transcription, DNA-dependent					ovary(1)|lung(1)	2	all_neural(191;0.0837)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000202)|Epithelial(86;0.000386)|BRCA - Breast invasive adenocarcinoma(302;0.231)		CACAGTCCTCGATGGAACATT	0.552			T	MYC	BNHL						OREG0022214	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	49	243	---	---	---	---	PASS
KBTBD7	84078	broad.mit.edu	37	13	41768535	41768535	+	5'UTR	SNP	C	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:41768535C>G	uc001uxw.1	-	1					uc001uxv.1_Intron	NM_032138	NP_115514	Q8WVZ9	KBTB7_HUMAN	kelch repeat and BTB (POZ) domain containing 7								protein binding			ovary(1)	1		Lung NSC(96;0.000105)|Breast(139;0.00715)|Prostate(109;0.0233)|Lung SC(185;0.0367)		all cancers(112;6.21e-09)|Epithelial(112;6.99e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.000196)|GBM - Glioblastoma multiforme(144;0.000857)|BRCA - Breast invasive adenocarcinoma(63;0.0669)		GAATTCAGCCCTATCCCGCGG	0.632													2	8	---	---	---	---	PASS
GALK2	2585	broad.mit.edu	37	15	49611861	49611861	+	Missense_Mutation	SNP	T	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:49611861T>C	uc001zxj.1	+	9	1126	c.1028T>C	c.(1027-1029)CTC>CCC	p.L343P	GALK2_uc001zxi.1_Missense_Mutation_p.L332P|GALK2_uc010ufb.1_Missense_Mutation_p.L319P|GALK2_uc001zxk.2_RNA|GALK2_uc010ufc.1_Missense_Mutation_p.L319P	NM_002044	NP_002035	Q01415	GALK2_HUMAN	galactokinase 2 isoform 1	343					galactose metabolic process	cytoplasm	ATP binding|galactokinase activity|N-acetylgalactosamine kinase activity			breast(1)	1		all_lung(180;0.000325)		all cancers(107;3.71e-08)|GBM - Glioblastoma multiforme(94;7e-05)		GCGCGAGTGCTCCAGTTTAAG	0.507													13	77	---	---	---	---	PASS
A2BP1	54715	broad.mit.edu	37	16	7568337	7568337	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:7568337C>A	uc002cys.2	+	5	1204	c.216C>A	c.(214-216)CAC>CAA	p.H72Q	A2BP1_uc010buf.1_Missense_Mutation_p.H72Q|A2BP1_uc002cyr.1_Missense_Mutation_p.H72Q|A2BP1_uc002cyt.2_Missense_Mutation_p.H72Q|A2BP1_uc010uxz.1_Missense_Mutation_p.H115Q|A2BP1_uc010uya.1_Missense_Mutation_p.H108Q|A2BP1_uc002cyv.1_Missense_Mutation_p.H72Q|A2BP1_uc010uyb.1_Missense_Mutation_p.H72Q|A2BP1_uc002cyw.2_Missense_Mutation_p.H92Q|A2BP1_uc002cyy.2_Missense_Mutation_p.H92Q|A2BP1_uc002cyx.2_Missense_Mutation_p.H92Q|A2BP1_uc010uyc.1_Missense_Mutation_p.H92Q	NM_018723	NP_061193	Q9NWB1	RFOX1_HUMAN	ataxin 2-binding protein 1 isoform 4	72					mRNA processing|RNA splicing|RNA transport	nucleus|trans-Golgi network	nucleotide binding|protein C-terminus binding|RNA binding				0		all_cancers(2;4.54e-52)|Colorectal(2;6.95e-44)|all_epithelial(2;1.15e-37)|Lung NSC(2;0.000289)|all_lung(2;0.00148)|Myeloproliferative disorder(2;0.0122)|Medulloblastoma(2;0.0354)|all_neural(2;0.0381)|all_hematologic(2;0.0749)|Renal(2;0.0758)|Melanoma(2;0.211)		Colorectal(1;3.55e-51)|COAD - Colon adenocarcinoma(2;1.92e-46)|all cancers(1;5.36e-16)|Epithelial(1;3.98e-15)|READ - Rectum adenocarcinoma(2;3.71e-05)|GBM - Glioblastoma multiforme(1;0.0499)		CCCAGACGCACTCCGAGCAGA	0.652													36	174	---	---	---	---	PASS
USP31	57478	broad.mit.edu	37	16	23079995	23079995	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23079995G>T	uc002dll.2	-	16	3431	c.3431C>A	c.(3430-3432)CCT>CAT	p.P1144H	USP31_uc002dlk.2_Missense_Mutation_p.P416H|USP31_uc010vca.1_Missense_Mutation_p.P447H|USP31_uc010bxm.2_Missense_Mutation_p.P432H	NM_020718	NP_065769	Q70CQ4	UBP31_HUMAN	ubiquitin specific peptidase 31	1144	Ser-rich.				ubiquitin-dependent protein catabolic process		cysteine-type peptidase activity|ubiquitin thiolesterase activity			ovary(3)|lung(3)|breast(2)|pancreas(1)|skin(1)	10				GBM - Glioblastoma multiforme(48;0.0187)		GCTCTTCCCAGGTGGGAAAGG	0.587													14	91	---	---	---	---	PASS
ABCC12	94160	broad.mit.edu	37	16	48173117	48173117	+	Missense_Mutation	SNP	G	A	A	rs141109408	byFrequency	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:48173117G>A	uc002efc.1	-	5	1134	c.788C>T	c.(787-789)GCT>GTT	p.A263V	ABCC12_uc002eey.1_RNA|ABCC12_uc002eez.1_RNA|ABCC12_uc002efa.1_RNA|ABCC12_uc002efb.1_RNA|ABCC12_uc002efd.1_RNA|ABCC12_uc002efe.1_Missense_Mutation_p.A263V|ABCC12_uc010vgj.1_RNA	NM_033226	NP_150229	Q96J65	MRP9_HUMAN	ATP-binding cassette protein C12	263	ABC transmembrane type-1 1.|Helical; (Potential).					integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(2)|skin(1)	3		all_cancers(37;0.0474)|all_lung(18;0.047)				CCCGATGAGAGCTGTGGGCCC	0.473													34	182	---	---	---	---	PASS
CES7	221223	broad.mit.edu	37	16	55907817	55907817	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:55907817G>A	uc002eip.2	-	2	355	c.206C>T	c.(205-207)TCC>TTC	p.S69F	CES7_uc002eio.2_Missense_Mutation_p.S69F|CES7_uc002eiq.2_5'UTR|CES7_uc002eir.2_5'UTR	NM_001143685	NP_001137157	Q6NT32	EST5A_HUMAN	carboxylesterase 7 isoform 1	69						extracellular region	carboxylesterase activity|methyl indole-3-acetate esterase activity|methyl jasmonate esterase activity|methyl salicylate esterase activity				0				all cancers(182;0.229)|Epithelial(162;0.231)		AAATCGCAGGGATCCCAGCGG	0.602													7	27	---	---	---	---	PASS
BCAR1	9564	broad.mit.edu	37	16	75269312	75269312	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:75269312C>A	uc002fdv.2	-	5	1608	c.1485G>T	c.(1483-1485)GAG>GAT	p.E495D	BCAR1_uc002fdt.2_5'UTR|BCAR1_uc002fdu.2_Missense_Mutation_p.E285D|BCAR1_uc010cgu.2_Missense_Mutation_p.E484D|BCAR1_uc010vna.1_Missense_Mutation_p.E493D|BCAR1_uc010vnb.1_Missense_Mutation_p.E541D|BCAR1_uc002fdw.2_Missense_Mutation_p.E495D|BCAR1_uc010vnc.1_Missense_Mutation_p.E347D|BCAR1_uc010vnd.1_Missense_Mutation_p.E513D|BCAR1_uc002fdx.2_Missense_Mutation_p.E513D	NM_014567	NP_055382	P56945	BCAR1_HUMAN	breast cancer anti-estrogen resistance 1	495	Ser-rich.				actin filament organization|B cell receptor signaling pathway|blood coagulation|cell adhesion|cell division|cell migration|cell proliferation|epidermal growth factor receptor signaling pathway|G-protein coupled receptor protein signaling pathway|insulin receptor signaling pathway|integrin-mediated signaling pathway|nerve growth factor receptor signaling pathway|platelet-derived growth factor receptor signaling pathway|positive regulation of cell migration|regulation of apoptosis|regulation of cell growth|T cell receptor signaling pathway	cytosol|focal adhesion|membrane fraction|ruffle	protein kinase binding|protein phosphatase binding|SH3 domain binding|signal transducer activity			central_nervous_system(5)|breast(2)|prostate(1)	8				BRCA - Breast invasive adenocarcinoma(221;0.169)		GCTCCTGTGGCTCAGAGGGGC	0.697													9	17	---	---	---	---	PASS
TNK1	8711	broad.mit.edu	37	17	7291994	7291994	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7291994G>T	uc002ggi.3	+	11	1922	c.1762G>T	c.(1762-1764)GAT>TAT	p.D588Y	TNK1_uc002ggj.3_Missense_Mutation_p.D583Y|TNK1_uc010cmf.2_RNA|TNK1_uc002ggk.3_Intron	NM_003985	NP_003976	Q13470	TNK1_HUMAN	tyrosine kinase, non-receptor, 1	588					protein autophosphorylation	membrane	ATP binding|non-membrane spanning protein tyrosine kinase activity|protein binding|signal transducer activity			lung(1)|central_nervous_system(1)|pancreas(1)	3		Prostate(122;0.157)				CCTCTTGTCCGATCCTGAGTT	0.592													9	53	---	---	---	---	PASS
DNAH9	1770	broad.mit.edu	37	17	11757612	11757612	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:11757612C>A	uc002gne.2	+	50	9868	c.9800C>A	c.(9799-9801)TCC>TAC	p.S3267Y	DNAH9_uc010coo.2_Missense_Mutation_p.S2561Y	NM_001372	NP_001363	Q9NYC9	DYH9_HUMAN	dynein, axonemal, heavy chain 9 isoform 2	3267	Stalk (By similarity).				cell projection organization|cellular component movement|microtubule-based movement|spermatogenesis	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			skin(10)|ovary(4)|breast(3)|central_nervous_system(2)|pancreas(1)	20		Breast(5;0.0122)|all_epithelial(5;0.131)		Colorectal(4;6.88e-05)|COAD - Colon adenocarcinoma(4;0.000813)|READ - Rectum adenocarcinoma(10;0.157)		GGCCTCTGCTCCTGGGTCATC	0.547													51	279	---	---	---	---	PASS
FLJ36000	284124	broad.mit.edu	37	17	21904197	21904197	+	RNA	SNP	C	T	T	rs9904223	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:21904197C>T	uc002gza.2	+	1		c.136C>T				NR_027084				Homo sapiens cDNA FLJ36000 fis, clone TESTI2015180.												0						ctcaggcctgccaggacggtg	0.000													4	116	---	---	---	---	PASS
SMURF2	64750	broad.mit.edu	37	17	62541851	62541851	+	3'UTR	SNP	A	G	G	rs59188589		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:62541851A>G	uc002jep.1	-	19					SMURF2_uc002jeq.1_3'UTR|SMURF2_uc002jer.1_3'UTR	NM_022739	NP_073576	Q9HAU4	SMUF2_HUMAN	SMAD specific E3 ubiquitin protein ligase 2						BMP signaling pathway|negative regulation of transcription, DNA-dependent|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|regulation of transforming growth factor beta receptor signaling pathway|transforming growth factor beta receptor signaling pathway|ubiquitin-dependent SMAD protein catabolic process	cytosol|membrane raft|nucleus|plasma membrane|ubiquitin ligase complex	identical protein binding|SMAD binding|ubiquitin-protein ligase activity			skin(3)|lung(1)	4	Breast(5;1.32e-14)		BRCA - Breast invasive adenocarcinoma(8;9.88e-12)			AAAAAAAAAAAGGGGGGGGGG	0.393													5	8	---	---	---	---	PASS
LOC651250	651250	broad.mit.edu	37	17	66123801	66123801	+	RNA	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66123801C>A	uc002jgq.2	+	6		c.2924C>A			LOC651250_uc002kit.2_RNA|LOC651250_uc002jgo.1_Intron	NR_027418				Homo sapiens cDNA FLJ33831 fis, clone CTONG2003937.												0						TTTGAAGGGCCTTTTCTGGAT	0.537													14	72	---	---	---	---	PASS
SDK2	54549	broad.mit.edu	37	17	71344797	71344797	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:71344797G>A	uc010dfm.2	-	44	6106	c.6106C>T	c.(6106-6108)CTC>TTC	p.L2036F	SDK2_uc002jjt.3_Missense_Mutation_p.L1176F	NM_001144952	NP_001138424	Q58EX2	SDK2_HUMAN	sidekick 2	2036	Cytoplasmic (Potential).				cell adhesion	integral to membrane				ovary(2)	2						GCAGGGATGAGGTCGTTGTAT	0.647													9	55	---	---	---	---	PASS
UBE2O	63893	broad.mit.edu	37	17	74392798	74392798	+	Silent	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74392798G>A	uc002jrm.3	-	14	2285	c.2220C>T	c.(2218-2220)AGC>AGT	p.S740S	UBE2O_uc002jrn.3_Silent_p.S740S|UBE2O_uc002jrl.3_Silent_p.S344S	NM_022066	NP_071349	Q9C0C9	UBE2O_HUMAN	ubiquitin-conjugating enzyme E2O	740							ATP binding|ubiquitin-protein ligase activity			breast(2)|skin(2)|lung(1)	5						CCGTCTCCCAGCTGTCACTAT	0.587													41	246	---	---	---	---	PASS
KIAA0802	23255	broad.mit.edu	37	18	8786001	8786001	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:8786001G>T	uc002knr.2	+	7	1941	c.1799G>T	c.(1798-1800)CGC>CTC	p.R600L	KIAA0802_uc002knq.2_Missense_Mutation_p.R600L|KIAA0802_uc010dkw.1_Missense_Mutation_p.R438L	NM_015210	NP_056025	Q9Y4B5	CC165_HUMAN	hypothetical protein LOC23255	951											0						GAGAGCCTGCGCCTCCGAGCC	0.692													2	3	---	---	---	---	PASS
ALPK2	115701	broad.mit.edu	37	18	56202373	56202373	+	Silent	SNP	T	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:56202373T>C	uc002lhj.3	-	5	5260	c.5046A>G	c.(5044-5046)AAA>AAG	p.K1682K	ALPK2_uc002lhk.1_Silent_p.K1013K	NM_052947	NP_443179	Q86TB3	ALPK2_HUMAN	heart alpha-kinase	1682							ATP binding|protein serine/threonine kinase activity			ovary(7)|skin(5)|lung(1)|central_nervous_system(1)	14						CCCTGGACTTTTTCGCACAGC	0.547													29	140	---	---	---	---	PASS
SERPINB8	5271	broad.mit.edu	37	18	61654513	61654513	+	3'UTR	SNP	A	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:61654513A>G	uc002ljv.2	+	7					SERPINB8_uc002lju.2_3'UTR|SERPINB8_uc010xex.1_3'UTR	NM_198833	NP_942130	P50452	SPB8_HUMAN	serine (or cysteine) proteinase inhibitor, clade						regulation of proteolysis	cytosol	protein binding|serine-type endopeptidase inhibitor activity			skin(1)	1		Esophageal squamous(42;0.129)				TTCTCCGTAAAGAGGAGCAAT	0.448													23	97	---	---	---	---	PASS
TJP3	27134	broad.mit.edu	37	19	3746567	3746567	+	Missense_Mutation	SNP	A	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3746567A>G	uc010xhv.1	+	16	2194	c.2194A>G	c.(2194-2196)ATC>GTC	p.I732V	TJP3_uc010xhs.1_Missense_Mutation_p.I699V|TJP3_uc010xht.1_Missense_Mutation_p.I663V|TJP3_uc010xhu.1_Missense_Mutation_p.I708V|TJP3_uc010xhw.1_Missense_Mutation_p.I718V	NM_014428	NP_055243	O95049	ZO3_HUMAN	tight junction protein 3	713	Guanylate kinase-like.					tight junction	protein binding			ovary(1)|central_nervous_system(1)|skin(1)	3				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0118)|STAD - Stomach adenocarcinoma(1328;0.18)		GGTCTTCTTCATCCCCGAGAG	0.677													3	65	---	---	---	---	PASS
MUC16	94025	broad.mit.edu	37	19	9067792	9067792	+	Missense_Mutation	SNP	T	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9067792T>C	uc002mkp.2	-	3	19858	c.19654A>G	c.(19654-19656)ACC>GCC	p.T6552A		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	6554	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57						ATATCTGTGGTCTTCACTAGG	0.478													15	94	---	---	---	---	PASS
YIF1B	90522	broad.mit.edu	37	19	38799931	38799931	+	Missense_Mutation	SNP	T	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:38799931T>A	uc002ohz.2	-	3	384	c.335A>T	c.(334-336)TAC>TTC	p.Y112F	YIF1B_uc002ohw.2_Missense_Mutation_p.Y81F|YIF1B_uc002ohx.2_Missense_Mutation_p.Y97F|YIF1B_uc010xtx.1_Missense_Mutation_p.Y95F|YIF1B_uc010xty.1_Missense_Mutation_p.Y81F|YIF1B_uc002oia.2_Missense_Mutation_p.Y109F|YIF1B_uc002ohy.2_Missense_Mutation_p.Y109F|YIF1B_uc002oib.2_Missense_Mutation_p.Y109F	NM_001039672	NP_001034761	Q5BJH7	YIF1B_HUMAN	Yip1 interacting factor homolog B isoform 5	112	Cytoplasmic (Potential).					integral to membrane					0	all_cancers(60;1.07e-06)		Lung(45;0.000246)|LUSC - Lung squamous cell carcinoma(53;0.000292)			CACAGCAAAGTAATACTTGAG	0.592													40	249	---	---	---	---	PASS
DACT3	147906	broad.mit.edu	37	19	47151645	47151645	+	3'UTR	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:47151645C>T	uc010ekq.2	-	4						NM_145056	NP_659493	Q96B18	DACT3_HUMAN	thymus expressed gene 3-like												0		Ovarian(192;0.0798)|all_neural(266;0.107)		OV - Ovarian serous cystadenocarcinoma(262;0.000173)|all cancers(93;0.000464)|Epithelial(262;0.02)|GBM - Glioblastoma multiforme(486;0.0325)		GCAGAGAAAACGATGGTCTTT	0.502													7	108	---	---	---	---	PASS
GRLF1	2909	broad.mit.edu	37	19	47424189	47424189	+	Nonsense_Mutation	SNP	C	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:47424189C>T	uc010ekv.2	+	1	2257	c.2257C>T	c.(2257-2259)CAA>TAA	p.Q753*		NM_004491	NP_004482	Q9NRY4	RHG35_HUMAN	glucocorticoid receptor DNA binding factor 1	753					axon guidance|negative regulation of transcription, DNA-dependent|small GTPase mediated signal transduction|transcription, DNA-dependent	cytosol	DNA binding|Rho GTPase activator activity|transcription corepressor activity			central_nervous_system(1)	1		all_cancers(25;1.51e-09)|all_epithelial(76;1.87e-07)|all_lung(116;7.86e-06)|Lung NSC(112;2.31e-05)|Ovarian(192;0.0129)|all_neural(266;0.026)|Breast(70;0.077)		all cancers(93;2.03e-05)|OV - Ovarian serous cystadenocarcinoma(262;2.57e-05)|Epithelial(262;0.00135)|GBM - Glioblastoma multiforme(486;0.0289)		GCAAATCAGTCAAGTTTTGAA	0.428													17	79	---	---	---	---	PASS
TPX2	22974	broad.mit.edu	37	20	30365398	30365398	+	Missense_Mutation	SNP	A	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:30365398A>C	uc002wwp.1	+	9	1537	c.839A>C	c.(838-840)GAA>GCA	p.E280A	TPX2_uc010gdv.1_Missense_Mutation_p.E280A	NM_012112	NP_036244	Q9ULW0	TPX2_HUMAN	TPX2, microtubule-associated protein homolog	280					activation of protein kinase activity|apoptosis|cell division|cell proliferation|mitosis|regulation of mitotic spindle organization	cytoplasm|microtubule|nucleus|spindle pole	ATP binding|GTP binding|protein kinase binding			large_intestine(1)|ovary(1)	2			Epithelial(4;0.000771)|Colorectal(19;0.00306)|all cancers(5;0.004)|COAD - Colon adenocarcinoma(19;0.0347)|OV - Ovarian serous cystadenocarcinoma(3;0.0656)			GAATATAAGGAAGTGAACTTT	0.388													15	175	---	---	---	---	PASS
MYL9	10398	broad.mit.edu	37	20	35177531	35177531	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:35177531G>A	uc002xfl.1	+	4	492	c.398G>A	c.(397-399)CGC>CAC	p.R133H	uc002xfk.3_Intron|MYL9_uc002xfm.1_Missense_Mutation_p.R79H	NM_006097	NP_006088	P24844	MYL9_HUMAN	myosin regulatory light chain 9 isoform a	133	EF-hand 2.				axon guidance|muscle contraction|regulation of muscle contraction	cytosol|muscle myosin complex	calcium ion binding|structural constituent of muscle				0	Breast(12;0.0192)	Myeloproliferative disorder(115;0.00878)				ATGGGTGACCGCTTCACAGAT	0.572													9	99	---	---	---	---	PASS
WFDC3	140686	broad.mit.edu	37	20	44402939	44402939	+	3'UTR	SNP	A	G	G			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44402939A>G	uc002xpf.1	-	7					WFDC3_uc002xpj.1_RNA|WFDC3_uc002xph.1_RNA|WFDC3_uc010ghh.1_RNA	NM_080614	NP_542181	Q8IUB2	WFDC3_HUMAN	WAP four-disulfide core domain 3 precursor							extracellular region	serine-type endopeptidase inhibitor activity				0		Myeloproliferative disorder(115;0.0122)				CAGCGGCAGGAGGAGAAGCAG	0.547													6	20	---	---	---	---	PASS
NTSR1	4923	broad.mit.edu	37	20	61341142	61341142	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61341142G>A	uc002ydf.2	+	1	954	c.583G>A	c.(583-585)GCC>ACC	p.A195T		NM_002531	NP_002522	P30989	NTR1_HUMAN	neurotensin receptor 1	195	Helical; Name=4; (Potential).					endoplasmic reticulum|Golgi apparatus|integral to plasma membrane	neurotensin receptor activity, G-protein coupled			skin(2)|lung(1)|central_nervous_system(1)	4	Breast(26;3.65e-08)		BRCA - Breast invasive adenocarcinoma(19;3.63e-06)			CATCTGGCTCGCCTCGGCCCT	0.667													15	74	---	---	---	---	PASS
DSCR10	259234	broad.mit.edu	37	21	39580489	39580489	+	RNA	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:39580489G>A	uc010gnt.1	+	3		c.611G>A				NR_027695				Homo sapiens DSCR10 mRNA, complete cds.												0						GTCACTGTGTGTCACCTTCAA	0.507													89	403	---	---	---	---	PASS
GSPT2	23708	broad.mit.edu	37	X	51488138	51488138	+	Silent	SNP	T	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:51488138T>A	uc004dpl.2	+	1	1642	c.1416T>A	c.(1414-1416)GTT>GTA	p.V472V		NM_018094	NP_060564	Q8IYD1	ERF3B_HUMAN	peptide chain release factor 3	472					cell cycle|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|translational termination	cytoplasm	GTP binding|GTPase activity|protein binding			ovary(1)	1	Ovarian(276;0.236)					ATGTAGAAGTTCTTGGAATAC	0.433													25	38	---	---	---	---	PASS
KDM5C	8242	broad.mit.edu	37	X	53228213	53228213	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:53228213C>A	uc004drz.2	-	15	2722	c.2189G>T	c.(2188-2190)TGC>TTC	p.C730F	KDM5C_uc011moc.1_RNA|KDM5C_uc011mod.1_Missense_Mutation_p.C663F|KDM5C_uc004dsa.2_Missense_Mutation_p.C729F	NM_004187	NP_004178	P41229	KDM5C_HUMAN	jumonji, AT rich interactive domain 1C isoform	730					chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|zinc ion binding			kidney(9)|ovary(5)|salivary_gland(1)|autonomic_ganglia(1)|haematopoietic_and_lymphoid_tissue(1)|oesophagus(1)	18						GTGGGAAAGGCAGACAAGGCC	0.572			N|F|S		clear cell renal carcinoma								15	32	---	---	---	---	PASS
FAM122C	159091	broad.mit.edu	37	X	133941717	133941717	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:133941717C>A	uc004exz.1	+	1	494	c.89C>A	c.(88-90)GCC>GAC	p.A30D	FAM122C_uc010nru.1_Missense_Mutation_p.A66D|FAM122C_uc004exw.2_Missense_Mutation_p.A30D|FAM122C_uc004exx.2_RNA|FAM122C_uc011mvq.1_RNA|FAM122C_uc004exy.1_Missense_Mutation_p.A30D	NM_138819	NP_620174	Q6P4D5	F222C_HUMAN	hypothetical protein LOC159091	30											0	Acute lymphoblastic leukemia(192;0.000127)					GTCAACAGTGCCCCTTTGATC	0.532													20	50	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	M	12736	12736	+	RNA	SNP	G	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrM:12736G>A	uc004cox.3	+	1		c.400G>A			uc004coy.2_5'Flank					Homo sapiens NADH dehydrogenase subunit 5 (MTND5) mRNA, RNA 5, complete cds; mitochondrial gene for mitochondrial product.																		TCTTAGTTACCGCTAACAACC	0.388													6	4	---	---	---	---	PASS
SRM	6723	broad.mit.edu	37	1	11115324	11115324	+	Intron	DEL	T	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:11115324delT	uc001arz.1	-						SRM_uc001ary.1_Intron	NM_003132	NP_003123	P19623	SPEE_HUMAN	spermidine synthase						spermidine biosynthetic process	cytosol	protein homodimerization activity|spermidine synthase activity				0	Ovarian(185;0.249)	Lung NSC(185;1.74e-05)|all_lung(284;2.05e-05)|Renal(390;0.000147)|Colorectal(325;0.00205)|Breast(348;0.00262)|Hepatocellular(190;0.00913)|Ovarian(437;0.00965)|Myeloproliferative disorder(586;0.0255)	STAD - Stomach adenocarcinoma(5;0.228)	UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;3.14e-07)|COAD - Colon adenocarcinoma(227;7.11e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000294)|Kidney(185;0.000728)|KIRC - Kidney renal clear cell carcinoma(229;0.00258)|READ - Rectum adenocarcinoma(331;0.0487)|STAD - Stomach adenocarcinoma(313;0.192)	S-Adenosylmethionine(DB00118)|Spermine(DB00127)	gcccggctaattttttttttt	0.000													4	2	---	---	---	---	
SPEN	23013	broad.mit.edu	37	1	16265061	16265062	+	Intron	DEL	TT	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16265061_16265062delTT	uc001axk.1	+						SPEN_uc010obp.1_Intron	NM_015001	NP_055816	Q96T58	MINT_HUMAN	spen homolog, transcriptional regulator						interspecies interaction between organisms|negative regulation of transcription, DNA-dependent|Notch signaling pathway	nucleus	nucleotide binding|protein binding|RNA binding			ovary(6)|breast(3)|lung(2)|skin(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	15		Colorectal(325;0.000258)|Breast(348;0.000278)|Lung NSC(340;0.000419)|Renal(390;0.000518)|all_lung(284;0.000567)|Ovarian(437;0.0129)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0185)|Colorectal(212;5.96e-07)|COAD - Colon adenocarcinoma(227;3.11e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000115)|Kidney(64;0.000212)|KIRC - Kidney renal clear cell carcinoma(64;0.003)|STAD - Stomach adenocarcinoma(313;0.013)|READ - Rectum adenocarcinoma(331;0.0681)		GAAAAAAAGCTTTTTTTTTTTT	0.361													5	3	---	---	---	---	
ST3GAL3	6487	broad.mit.edu	37	1	44360318	44360318	+	Intron	DEL	T	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44360318delT	uc001ckc.2	+						ST3GAL3_uc010okj.1_Intron|ST3GAL3_uc001cjz.2_Intron|ST3GAL3_uc001cka.2_Intron|ST3GAL3_uc001ckb.2_Intron|ST3GAL3_uc001ckd.2_Intron|ST3GAL3_uc001cke.2_Intron|ST3GAL3_uc001ckf.2_Intron|ST3GAL3_uc001ckg.2_Intron|ST3GAL3_uc001ckh.2_Intron|ST3GAL3_uc001cki.2_Intron|ST3GAL3_uc009vwv.2_Intron|ST3GAL3_uc001ckj.2_Intron|ST3GAL3_uc009vww.2_Intron|ST3GAL3_uc001ckk.2_Intron|ST3GAL3_uc009vwy.2_Intron|ST3GAL3_uc009vwx.2_Intron|ST3GAL3_uc001ckm.2_Intron|ST3GAL3_uc001ckl.2_Intron|ST3GAL3_uc009vwz.2_Intron|ST3GAL3_uc001ckn.2_Intron|ST3GAL3_uc001ckp.2_Intron|ST3GAL3_uc001cko.2_Intron|ST3GAL3_uc009vxa.2_Intron|ST3GAL3_uc001ckq.2_Intron|ST3GAL3_uc001ckr.2_Intron|ST3GAL3_uc009vxb.2_Intron	NM_006279	NP_006270	Q11203	SIAT6_HUMAN	sialyltransferase 6 isoform j						protein glycosylation	extracellular region|Golgi cisterna membrane|integral to Golgi membrane	N-acetyllactosaminide alpha-2,3-sialyltransferase activity			ovary(3)	3	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0518)				tgtttgtttgttttttttttt	0.189													5	3	---	---	---	---	
MGST3	4259	broad.mit.edu	37	1	165623279	165623281	+	Intron	DEL	AGG	-	-	rs140199766		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:165623279_165623281delAGG	uc001gdf.2	+						MGST3_uc001gdg.2_Intron	NM_004528	NP_004519	O14880	MGST3_HUMAN	microsomal glutathione S-transferase 3						leukotriene biosynthetic process|leukotriene production involved in inflammatory response|signal transduction|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glutathione peroxidase activity|glutathione transferase activity				0	all_hematologic(923;0.0773)|Acute lymphoblastic leukemia(8;0.155)				Glutathione(DB00143)	CCACCTGTCTAGGAGAAGGCCAA	0.488													3	4	---	---	---	---	
KIFAP3	22920	broad.mit.edu	37	1	169930005	169930006	+	Intron	INS	-	A	A	rs140237252	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169930005_169930006insA	uc001ggv.2	-						KIFAP3_uc010plx.1_Intron	NM_014970	NP_055785	Q92845	KIFA3_HUMAN	kinesin-associated protein 3						blood coagulation|plus-end-directed vesicle transport along microtubule|protein complex assembly|signal transduction	centrosome|condensed nuclear chromosome|cytosol|endoplasmic reticulum|kinesin II complex|spindle microtubule	kinesin binding			skin(1)	1	all_hematologic(923;0.0922)|Acute lymphoblastic leukemia(37;0.181)					GACTAACTTGGAAAAAAAAATG	0.292													3	4	---	---	---	---	
RABGAP1L	9910	broad.mit.edu	37	1	174221888	174221888	+	Intron	DEL	T	-	-	rs11351373		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:174221888delT	uc001gjx.2	+						RABGAP1L_uc009wwq.1_Intron|RABGAP1L_uc001gjw.2_Intron|RABGAP1L_uc001gjy.2_Intron	NM_014857	NP_055672	Q5R372	RBG1L_HUMAN	RAB GTPase activating protein 1-like isoform A						regulation of protein localization	early endosome|Golgi apparatus|nucleus	Rab GTPase activator activity			ovary(2)|lung(1)|kidney(1)	4						Atgtaactggtttcattgaaa	0.129													3	3	---	---	---	---	
AIDA	64853	broad.mit.edu	37	1	222843058	222843059	+	3'UTR	DEL	GT	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222843058_222843059delGT	uc001hnn.2	-	10					AIDA_uc001hno.2_RNA|AIDA_uc010pus.1_3'UTR	NM_022831	NP_073742	Q96BJ3	AIDA_HUMAN	axin interactor, dorsalization associated						dorsal/ventral pattern formation|negative regulation of JNK cascade|negative regulation of JUN kinase activity|regulation of protein homodimerization activity						0						CTATACGTCAGTGTGATGTGCT	0.411													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	10356283	10356284	+	IGR	INS	-	GGAA	GGAA			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:10356283_10356284insGGAA								C2orf48 (4427 upstream) : HPCAL1 (86756 downstream)																							gaaaaggaaagggaaggaagga	0.139													7	6	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	51568088	51568091	+	IGR	DEL	TGTG	-	-	rs147382828		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:51568088_51568091delTGTG								NRXN1 (308414 upstream) : None (None downstream)																							TACATGCTTTtgtgtgtgtgtgtg	0.181													4	2	---	---	---	---	
PTCD3	55037	broad.mit.edu	37	2	86359746	86359746	+	Intron	DEL	T	-	-	rs67035952		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:86359746delT	uc002sqw.2	+						PTCD3_uc002sqx.1_Intron	NM_017952	NP_060422	Q96EY7	PTCD3_HUMAN	pentatricopeptide repeat domain 3 precursor							mitochondrion	protein binding			ovary(1)	1						CCTTTAAGGGTTTTTTTTTTT	0.343													2	4	---	---	---	---	
ACMSD	130013	broad.mit.edu	37	2	135625400	135625401	+	Intron	DEL	TA	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:135625400_135625401delTA	uc002ttz.2	+						ACMSD_uc002tua.2_Intron|uc010zbe.1_Intron	NM_138326	NP_612199	Q8TDX5	ACMSD_HUMAN	aminocarboxymuconate semialdehyde decarboxylase						quinolinate metabolic process|tryptophan catabolic process	cytosol	aminocarboxymuconate-semialdehyde decarboxylase activity|metal ion binding			skin(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.115)		ggattaatgctatatatatata	0.079													8	4	---	---	---	---	
GIGYF2	26058	broad.mit.edu	37	2	233674690	233674693	+	Intron	DEL	ATTT	-	-	rs72305584		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233674690_233674693delATTT	uc002vti.3	+						GIGYF2_uc010zmj.1_Intron|GIGYF2_uc002vtg.2_Intron|GIGYF2_uc002vtj.3_Intron|GIGYF2_uc002vtk.3_Intron|GIGYF2_uc002vth.3_Intron|GIGYF2_uc010zmk.1_Intron|GIGYF2_uc010zml.1_Intron|GIGYF2_uc002vtq.3_5'Flank	NM_015575	NP_056390	Q6Y7W6	PERQ2_HUMAN	GRB10 interacting GYF protein 2 isoform b						cell death		protein binding			ovary(4)|central_nervous_system(3)	7		Breast(86;0.00279)|all_hematologic(139;0.00793)|Renal(207;0.0112)|Acute lymphoblastic leukemia(138;0.0182)|all_lung(227;0.0271)|Lung NSC(271;0.0839)		Epithelial(121;7.37e-16)|BRCA - Breast invasive adenocarcinoma(100;0.000472)|LUSC - Lung squamous cell carcinoma(224;0.00902)|Lung(119;0.0118)|GBM - Glioblastoma multiforme(43;0.0145)		TAGTGTTGTCatttatttatttat	0.225													7	4	---	---	---	---	
GBE1	2632	broad.mit.edu	37	3	81541828	81541829	+	Intron	INS	-	TTCTCCCT	TTCTCCCT	rs149554537	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:81541828_81541829insTTCTCCCT	uc003dqg.2	-							NM_000158	NP_000149	Q04446	GLGB_HUMAN	glucan (1,4-alpha-), branching enzyme 1						glucose metabolic process|glycogen biosynthetic process	cytosol	1,4-alpha-glucan branching enzyme activity|cation binding|hydrolase activity, hydrolyzing O-glycosyl compounds			ovary(3)	3		Lung NSC(201;0.0117)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0654)|Epithelial(33;0.00305)|LUSC - Lung squamous cell carcinoma(29;0.00646)|BRCA - Breast invasive adenocarcinoma(55;0.00813)|Lung(72;0.0129)|KIRC - Kidney renal clear cell carcinoma(39;0.212)|Kidney(39;0.247)		cccttctcccattctccctttc	0.045									Glycogen_Storage_Disease_type_IV				8	8	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	103257382	103257383	+	IGR	DEL	TT	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:103257382_103257383delTT								None (None upstream) : None (None downstream)																							TTTACACAGCTTTTTTTTTTTT	0.351													5	3	---	---	---	---	
ZDHHC19	131540	broad.mit.edu	37	3	195937314	195937315	+	Intron	INS	-	TAAAG	TAAAG	rs59406858		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195937314_195937315insTAAAG	uc003fwc.2	-						ZDHHC19_uc010hzz.2_Intron|ZDHHC19_uc010iaa.2_Intron|ZDHHC19_uc010iab.2_Intron	NM_001039617	NP_001034706	Q8WVZ1	ZDH19_HUMAN	zinc finger, DHHC domain containing 19							integral to membrane	acyltransferase activity|zinc ion binding			ovary(3)	3	all_cancers(143;1.68e-08)|Ovarian(172;0.0634)|Breast(254;0.206)		Epithelial(36;1.89e-25)|all cancers(36;1.46e-23)|OV - Ovarian serous cystadenocarcinoma(49;2.1e-19)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.0022)		agagaaagaaagaaagaaaaga	0.233													4	3	---	---	---	---	
CEP135	9662	broad.mit.edu	37	4	56890992	56890992	+	Intron	DEL	T	-	-	rs113118558		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:56890992delT	uc003hbi.2	+						CEP135_uc003hbj.2_Intron	NM_025009	NP_079285	Q66GS9	CP135_HUMAN	centrosome protein 4						centriole replication|centriole-centriole cohesion|G2/M transition of mitotic cell cycle	centriole|cytosol	protein C-terminus binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5	Glioma(25;0.08)|all_neural(26;0.101)					cagtgtatgcttttttttttt	0.000													4	2	---	---	---	---	
OTUD4	54726	broad.mit.edu	37	4	146067653	146067654	+	Intron	INS	-	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:146067653_146067654insA	uc003ika.3	-						OTUD4_uc003ijz.3_Intron	NM_001102653	NP_001096123	Q01804	OTUD4_HUMAN	OTU domain containing 4 protein isoform 3								protein binding			ovary(2)|breast(1)	3	all_hematologic(180;0.151)					ACATTCTTGTCAAAAAAAAAAA	0.238													8	5	---	---	---	---	
ACCN5	51802	broad.mit.edu	37	4	156773623	156773624	+	Intron	INS	-	T	T	rs71600397		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:156773623_156773624insT	uc003ipe.1	-							NM_017419	NP_059115	Q9NY37	ACCN5_HUMAN	amiloride-sensitive cation channel 5,							integral to membrane|plasma membrane				ovary(2)|skin(1)	3	all_hematologic(180;0.24)	Renal(120;0.0458)		KIRC - Kidney renal clear cell carcinoma(143;0.0464)|Kidney(143;0.058)|COAD - Colon adenocarcinoma(41;0.141)		TTCAGTGATAGTTTTTTTTTTT	0.257													11	5	---	---	---	---	
C4orf45	152940	broad.mit.edu	37	4	159956042	159956043	+	Intron	INS	-	A	A	rs79629884		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:159956042_159956043insA	uc003iqf.1	-						C4orf45_uc010iqt.1_Intron	NM_152543	NP_689756	Q96LM5	CD045_HUMAN	hypothetical protein LOC152940												0						gactctgtctcaaaaaaaaaaa	0.084													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	4	182980098	182980099	+	Intron	INS	-	GT	GT	rs148738142	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:182980098_182980099insGT	uc003iva.1	-											Homo sapiens cDNA FLJ31634 fis, clone NT2RI2003419.																		AGTCATAGCTCgtgtgtgtgtg	0.292													6	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	5	178510272	178510273	+	IGR	DEL	AT	-	-	rs147516432		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:178510272_178510273delAT								ZNF354C (2583 upstream) : ADAMTS2 (30578 downstream)																							tgggtagtagataatgtggtat	0.000													4	2	---	---	---	---	
SYNGAP1	8831	broad.mit.edu	37	6	33408466	33408467	+	Intron	DEL	TC	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33408466_33408467delTC	uc011dri.1	+						SYNGAP1_uc010juy.2_Intron|SYNGAP1_uc010juz.2_Intron	NM_006772	NP_006763	Q96PV0	SYGP1_HUMAN	synaptic Ras GTPase activating protein 1						negative regulation of Ras protein signal transduction|signal transduction	cytoplasm|intrinsic to internal side of plasma membrane	Ras GTPase activator activity|SH3 domain binding			ovary(4)	4						tctctctctttctctctctctc	0.554													5	4	---	---	---	---	
RNGTT	8732	broad.mit.edu	37	6	89614281	89614282	+	Intron	INS	-	A	A	rs113231405		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:89614281_89614282insA	uc003pmr.2	-						RNGTT_uc003pms.2_Intron|RNGTT_uc011dzu.1_Intron|RNGTT_uc003pmt.2_Intron	NM_003800	NP_003791	O60942	MCE1_HUMAN	RNA guanylyltransferase and 5'-phosphatase						interspecies interaction between organisms|mRNA capping|transcription from RNA polymerase II promoter|viral reproduction	nucleoplasm	GTP binding|mRNA guanylyltransferase activity|polynucleotide 5'-phosphatase activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			upper_aerodigestive_tract(1)	1		all_cancers(76;4.07e-09)|Prostate(29;1.16e-10)|Acute lymphoblastic leukemia(125;1.49e-10)|all_hematologic(105;7.79e-07)|all_epithelial(107;6.86e-05)		BRCA - Breast invasive adenocarcinoma(108;0.151)		actttctctccaaaaaaaaaaa	0.129													10	5	---	---	---	---	
PEX3	8504	broad.mit.edu	37	6	143793658	143793658	+	Intron	DEL	T	-	-	rs76840055		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:143793658delT	uc003qjl.2	+							NM_003630	NP_003621	P56589	PEX3_HUMAN	peroxisomal biogenesis factor 3						protein import into peroxisome membrane|transmembrane transport	integral to peroxisomal membrane	protein binding			ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(155;5.73e-06)|GBM - Glioblastoma multiforme(68;0.0117)		CACTTAACAATTTTAGATATT	0.299													2	4	---	---	---	---	
WBSCR17	64409	broad.mit.edu	37	7	71142502	71142502	+	Intron	DEL	T	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:71142502delT	uc003tvy.2	+						WBSCR17_uc003tvz.2_Intron	NM_022479	NP_071924	Q6IS24	GLTL3_HUMAN	UDP-GalNAc:polypeptide							Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			skin(3)|upper_aerodigestive_tract(1)|ovary(1)|pancreas(1)|central_nervous_system(1)	7		all_cancers(73;0.2)|Lung NSC(55;0.094)|all_lung(88;0.125)				AGCATGCAGAttttttttttt	0.169													4	2	---	---	---	---	
GTF2IRD2P1	401375	broad.mit.edu	37	7	72662348	72662349	+	Intron	INS	-	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72662348_72662349insA	uc003txs.1	-						FKBP6_uc003twz.2_Intron	NR_002164				RecName: Full=General transcription factor II-I repeat domain-containing protein 2B; AltName: Full=GTF2I repeat domain-containing protein 2B; AltName: Full=Transcription factor GTF2IRD2-beta;												0						actctgtctccaaaaaaaaaaa	0.183													9	4	---	---	---	---	
PEX1	5189	broad.mit.edu	37	7	92136560	92136560	+	Intron	DEL	T	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92136560delT	uc003uly.2	-						PEX1_uc011khr.1_Intron|PEX1_uc010ley.2_Intron|PEX1_uc011khs.1_Intron|PEX1_uc011kht.1_Intron	NM_000466	NP_000457	O43933	PEX1_HUMAN	peroxin1						microtubule-based peroxisome localization|protein import into peroxisome matrix	cytosol|nucleus|peroxisomal membrane	ATP binding|ATPase activity, coupled|protein C-terminus binding|protein complex binding			ovary(1)|central_nervous_system(1)	2	all_cancers(62;9.35e-11)|all_epithelial(64;4.59e-10)|Breast(17;0.00201)|all_lung(186;0.0438)|Lung NSC(181;0.0592)	Breast(660;0.000932)|all_neural(109;0.00391)|Myeloproliferative disorder(862;0.0122)|Ovarian(593;0.023)|Medulloblastoma(109;0.123)	GBM - Glioblastoma multiforme(5;4.06e-06)|STAD - Stomach adenocarcinoma(4;4.51e-05)|all cancers(6;5.32e-05)|LUSC - Lung squamous cell carcinoma(200;0.225)|Lung(22;0.23)			Attttttatcttttttttttt	0.114													3	5	---	---	---	---	
PKHD1L1	93035	broad.mit.edu	37	8	110491661	110491662	+	Intron	INS	-	T	T	rs140832904	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110491661_110491662insT	uc003yne.2	+							NM_177531	NP_803875	Q86WI1	PKHL1_HUMAN	fibrocystin L precursor						immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)			CAAAGCGTGCATTTTTTTTCTT	0.376										HNSCC(38;0.096)			3	4	---	---	---	---	
HAUS6	54801	broad.mit.edu	37	9	19056596	19056596	+	Intron	DEL	T	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:19056596delT	uc003znk.2	-						HAUS6_uc011lmz.1_Intron	NM_017645	NP_060115	Q7Z4H7	HAUS6_HUMAN	HAUS augmin-like complex, subunit 6						cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|nucleus|spindle				ovary(2)	2						CCCAGAGTACttttttttttt	0.169													4	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	68380404	68380405	+	IGR	INS	-	G	G	rs144187147		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:68380404_68380405insG								FAM27B (586215 upstream) : MIR1299 (621834 downstream)																							CTCCTTTGCCAGGGGCTGGGCA	0.728													4	3	---	---	---	---	
C9orf102	375748	broad.mit.edu	37	9	98678837	98678838	+	Intron	INS	-	A	A	rs144815828	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:98678837_98678838insA	uc004avt.3	+						C9orf102_uc010mrx.1_Intron|C9orf102_uc011lum.1_Intron|C9orf102_uc010mry.1_Intron|C9orf102_uc010mrz.2_Intron	NM_001010895	NP_001010895	Q5T890	RAD26_HUMAN	RAD26L hypothetical protein						DNA repair	nucleus	ATP binding|ATP-dependent helicase activity|DNA binding				0		Acute lymphoblastic leukemia(62;0.0559)				ATTCTGTATGGAAAAAATTGTT	0.297													7	4	---	---	---	---	
NCS1	23413	broad.mit.edu	37	9	132985259	132985259	+	Intron	DEL	C	-	-	rs68053432		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:132985259delC	uc004bzi.2	+						NCS1_uc010myz.1_Intron	NM_014286	NP_055101	P62166	NCS1_HUMAN	frequenin homolog isoform 1						negative regulation of calcium ion transport via voltage-gated calcium channel activity|regulation of neuron projection development	cell junction|Golgi cisterna membrane|perinuclear region of cytoplasm|postsynaptic density|postsynaptic membrane	calcium ion binding|protein binding				0						AAGAGGGGGGCGGCCCTCATC	0.657													8	5	---	---	---	---	
REXO4	57109	broad.mit.edu	37	9	136272788	136272788	+	Intron	DEL	T	-	-	rs35694504		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:136272788delT	uc004cdm.2	-						REXO4_uc011mde.1_Intron|REXO4_uc011mdf.1_Intron|REXO4_uc004cdn.2_Intron|REXO4_uc004cdo.2_Intron	NM_020385	NP_065118	Q9GZR2	REXO4_HUMAN	XPMC2 prevents mitotic catastrophe 2 homolog							nucleolus	exonuclease activity|nucleic acid binding|sequence-specific DNA binding transcription factor activity				0				OV - Ovarian serous cystadenocarcinoma(145;8.58e-08)|Epithelial(140;9.55e-07)|all cancers(34;1.05e-05)		cgctctaccattttttttttt	0.189											OREG0019587	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	21741094	21741095	+	IGR	INS	-	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:21741094_21741095insA								NEBL (277978 upstream) : C10orf114 (42327 downstream)																							gactccgtctcaaaaaaaaaaa	0.163													4	2	---	---	---	---	
POLR2L	5441	broad.mit.edu	37	11	840578	840578	+	Intron	DEL	A	-	-	rs143525015	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:840578delA	uc001lsc.2	-						TSPAN4_uc001lsd.1_5'Flank|TSPAN4_uc001lse.1_5'Flank|TSPAN4_uc001lsf.1_5'Flank|TSPAN4_uc001lsg.1_5'Flank|TSPAN4_uc001lsh.1_5'Flank	NM_021128	NP_066951	P62875	RPAB5_HUMAN	DNA directed RNA polymerase II polypeptide L						mRNA capping|nuclear mRNA splicing, via spliceosome|positive regulation of viral transcription|protein phosphorylation|regulation of transcription from RNA polymerase I promoter|termination of RNA polymerase III transcription|transcription elongation from RNA polymerase II promoter|transcription elongation from RNA polymerase III promoter|transcription initiation from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair|viral reproduction	DNA-directed RNA polymerase II, core complex	DNA binding|DNA-directed RNA polymerase activity|zinc ion binding				0		all_cancers(49;2.31e-08)|all_epithelial(84;3.72e-05)|Breast(177;0.000307)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.179)|all_lung(207;0.227)		all cancers(45;4.1e-25)|Epithelial(43;3.15e-24)|BRCA - Breast invasive adenocarcinoma(625;4.23e-05)|Lung(200;0.0576)|LUSC - Lung squamous cell carcinoma(625;0.0703)		TGCTGGCCTCACCCCCCCCGC	0.607													11	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	12	6403425	6403426	+	IGR	INS	-	GGAG	GGAG	rs145216262	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6403425_6403426insGGAG								CD9 (55998 upstream) : PLEKHG6 (16176 downstream)																							gagggagggaaggagggaggga	0.134													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	12	56775570	56775571	+	IGR	INS	-	A	A	rs34141208		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56775570_56775571insA								APOF (18987 upstream) : TIMELESS (34586 downstream)																							gactccatctcaaaaaaaaaaa	0.124													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	12	77054687	77054687	+	IGR	DEL	T	-	-	rs2369296	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:77054687delT								OSBPL8 (101098 upstream) : ZDHHC17 (103167 downstream)																							aaaaaaaaaataaataaaGGA	0.358													10	5	---	---	---	---	
C12orf26	84190	broad.mit.edu	37	12	82832292	82832293	+	Intron	DEL	TT	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:82832292_82832293delTT	uc001szq.2	+							NM_032230	NP_115606	Q8N6Q8	CL026_HUMAN	hypothetical protein LOC84190												0						TTATGGTTTCTTTTTTTTTTTT	0.302													4	2	---	---	---	---	
MPHOSPH9	10198	broad.mit.edu	37	12	123682631	123682631	+	Intron	DEL	A	-	-	rs72059632		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123682631delA	uc001uel.2	-						MPHOSPH9_uc010tal.1_Intron|MPHOSPH9_uc010tam.1_Intron|MPHOSPH9_uc001uem.2_Intron	NM_022782	NP_073619	Q99550	MPP9_HUMAN	M-phase phosphoprotein 9						M phase of mitotic cell cycle	centriole|Golgi membrane					0	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000182)|Epithelial(86;0.00046)|BRCA - Breast invasive adenocarcinoma(302;0.169)		actccgtctcaaaaaaaaaaa	0.129													3	3	---	---	---	---	
C14orf21	161424	broad.mit.edu	37	14	24772593	24772593	+	Intron	DEL	T	-	-	rs112529240		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:24772593delT	uc001wol.1	+						C14orf21_uc001wom.1_Intron	NM_174913	NP_777573	Q86U38	CN021_HUMAN	hypothetical protein LOC161424								RNA binding			breast(2)|central_nervous_system(1)|skin(1)	4				GBM - Glioblastoma multiforme(265;0.0185)		ACCCAGCTAAttttttttttt	0.313													5	3	---	---	---	---	
TRIP11	9321	broad.mit.edu	37	14	92487733	92487733	+	Intron	DEL	A	-	-	rs35038594		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:92487733delA	uc001xzy.2	-							NM_004239	NP_004230	Q15643	TRIPB_HUMAN	thyroid hormone receptor interactor 11						transcription from RNA polymerase II promoter	cytoskeleton|Golgi apparatus|membrane|nucleus	protein binding|transcription coactivator activity			ovary(6)|skin(2)|kidney(2)|central_nervous_system(1)|lung(1)|breast(1)	13				COAD - Colon adenocarcinoma(157;0.223)		attctgtctcaaaaaaaaaaa	0.030			T	PDGFRB	AML								6	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	45756006	45756008	+	Intron	DEL	AAT	-	-	rs62025173		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45756006_45756008delAAT	uc001zvi.1	+											Homo sapiens cDNA FLJ32124 fis, clone PEBLM1000180.																		caccatcaccaataccaccacca	0.000													4	2	---	---	---	---	
SEMA6D	80031	broad.mit.edu	37	15	48058484	48058484	+	Intron	DEL	G	-	-	rs528882	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48058484delG	uc010bek.2	+						SEMA6D_uc001zvw.2_Intron|SEMA6D_uc001zvy.2_Intron|SEMA6D_uc001zvz.2_Intron|SEMA6D_uc001zwa.2_Intron|SEMA6D_uc001zwb.2_Intron|SEMA6D_uc001zwc.2_Intron	NM_153618	NP_705871	Q8NFY4	SEM6D_HUMAN	semaphorin 6D isoform 4 precursor						axon guidance	cytoplasm|integral to membrane|plasma membrane	receptor activity			skin(3)|breast(1)	4		all_lung(180;0.000635)|Myeloproliferative disorder(241;0.116)|Melanoma(134;0.18)		all cancers(107;1.2e-11)|GBM - Glioblastoma multiforme(94;1.2e-06)		CTTTTTTTTTGTTGTTATGGG	0.358													7	4	---	---	---	---	
SLC24A5	283652	broad.mit.edu	37	15	48428659	48428659	+	Intron	DEL	A	-	-	rs146154262		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:48428659delA	uc001zwe.2	+						SLC24A5_uc010bel.2_Intron|uc001zwf.1_RNA	NM_205850	NP_995322	Q71RS6	NCKX5_HUMAN	solute carrier family 24, member 5 precursor						response to stimulus	integral to membrane|melanosome|plasma membrane	calcium, potassium:sodium antiporter activity|symporter activity				0		all_lung(180;0.00217)		all cancers(107;3.29e-10)|GBM - Glioblastoma multiforme(94;7.32e-07)		TCTTGTTTTTAAAAAAAAAAA	0.259													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	78675656	78675656	+	IGR	DEL	T	-	-	rs112849950		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:78675656delT								CRABP1 (35084 upstream) : IREB2 (54862 downstream)																							ATAAGGAGAAttttttttttt	0.209													5	3	---	---	---	---	
SLCO3A1	28232	broad.mit.edu	37	15	92638333	92638333	+	Intron	DEL	T	-	-	rs67561474		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:92638333delT	uc002bqx.2	+						SLCO3A1_uc002bqy.2_Intron|SLCO3A1_uc010boc.1_Intron|SLCO3A1_uc002bqz.1_Intron	NM_013272	NP_037404	Q9UIG8	SO3A1_HUMAN	solute carrier organic anion transporter family,						sodium-independent organic anion transport	integral to membrane|plasma membrane	sodium-independent organic anion transmembrane transporter activity			skin(1)	1	Lung NSC(78;0.0158)|all_lung(78;0.0255)		BRCA - Breast invasive adenocarcinoma(143;0.0841)			CCTGCCTCTGTAGCTGGGGCT	0.328													10	6	---	---	---	---	
SCNN1B	6338	broad.mit.edu	37	16	23354834	23354835	+	Intron	INS	-	A	A			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23354834_23354835insA	uc002dln.2	+							NM_000336	NP_000327	P51168	SCNNB_HUMAN	sodium channel, nonvoltage-gated 1, beta						excretion|sensory perception of taste	apical plasma membrane	ligand-gated sodium channel activity|WW domain binding			ovary(3)|breast(2)|large_intestine(1)|pancreas(1)	7				GBM - Glioblastoma multiforme(48;0.0465)	Amiloride(DB00594)|Triamterene(DB00384)	gaaggaaaaggaaggaaggaag	0.010													4	3	---	---	---	---	
COG7	91949	broad.mit.edu	37	16	23445141	23445141	+	Intron	DEL	A	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23445141delA	uc002dlo.2	-							NM_153603	NP_705831	P83436	COG7_HUMAN	component of oligomeric golgi complex 7						intracellular protein transport|protein glycosylation|protein localization in Golgi apparatus|protein stabilization|retrograde vesicle-mediated transport, Golgi to ER	Golgi membrane|Golgi transport complex	protein binding				0				GBM - Glioblastoma multiforme(48;0.0401)		GAAAGGCAGGAAAAAAAAAAA	0.473											OREG0023684	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	6	3	---	---	---	---	
CNOT1	23019	broad.mit.edu	37	16	58577316	58577316	+	Intron	DEL	A	-	-	rs34232342		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:58577316delA	uc002env.2	-						CNOT1_uc002enw.2_Intron|CNOT1_uc002enu.3_Intron|CNOT1_uc002enx.2_Frame_Shift_Del_p.F1543fs|CNOT1_uc010vik.1_Intron	NM_016284	NP_057368	A5YKK6	CNOT1_HUMAN	CCR4-NOT transcription complex, subunit 1						nuclear-transcribed mRNA poly(A) tail shortening|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol				ovary(4)|central_nervous_system(2)	6				Kidney(780;0.0722)|OV - Ovarian serous cystadenocarcinoma(108;0.173)|Epithelial(162;0.239)		aatataacagaaaaaaaaaaa	0.040													4	3	---	---	---	---	
MTSS1L	92154	broad.mit.edu	37	16	70714812	70714812	+	Intron	DEL	G	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70714812delG	uc002ezj.2	-						MTSS1L_uc002ezk.1_5'Flank	NM_138383	NP_612392	Q765P7	MTSSL_HUMAN	metastasis suppressor 1-like						filopodium assembly|signal transduction		actin binding|cytoskeletal adaptor activity|SH3 domain binding			central_nervous_system(1)	1						GTGGTTGGGCGGGGGGGGGGC	0.667													6	3	---	---	---	---	
GLG1	2734	broad.mit.edu	37	16	74526738	74526738	+	Intron	DEL	G	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:74526738delG	uc002fcy.3	-						GLG1_uc002fcx.2_Intron|GLG1_uc002fcw.3_Intron|GLG1_uc002fcz.3_Intron	NM_001145667	NP_001139139	Q92896	GSLG1_HUMAN	golgi apparatus protein 1 isoform 3							Golgi membrane|integral to membrane	receptor binding			ovary(1)|breast(1)	2						aaaaaaaaaagaaaaaTACTC	0.129													13	6	---	---	---	---	
TAC4	255061	broad.mit.edu	37	17	47925054	47925055	+	Intron	INS	-	AC	AC	rs150685532	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:47925054_47925055insAC	uc002ipo.1	-						TAC4_uc002ipp.1_Intron|TAC4_uc002ipq.1_Intron|TAC4_uc002ipr.1_Intron|TAC4_uc002ips.1_Intron|TAC4_uc002ipt.2_Intron|TAC4_uc002ipu.2_Intron	NM_170685	NP_733786	Q86UU9	TKN4_HUMAN	tachykinin 4 isoform alpha						regulation of blood pressure	extracellular region				breast(1)	1						cacacacacagacacacacaca	0.183													6	3	---	---	---	---	
BAHCC1	57597	broad.mit.edu	37	17	79419160	79419185	+	Intron	DEL	GGGAGGGTCGCAGCACCCCCACCCCC	-	-	rs67000403		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79419160_79419185delGGGAGGGTCGCAGCACCCCCACCCCC	uc002kaf.2	+						BAHCC1_uc002kae.2_Intron|hsa-mir-3186|MI0014229_5'Flank	NM_001080519	NP_001073988	Q9P281	BAHC1_HUMAN	BAH domain and coiled-coil containing 1								DNA binding			ovary(1)	1	all_neural(118;0.0804)|Melanoma(429;0.242)		BRCA - Breast invasive adenocarcinoma(99;0.0224)|OV - Ovarian serous cystadenocarcinoma(97;0.116)			GGGGGGGCCTGGGAGGGTCGCAGCACCCCCACCCCCGGGAGGCGCC	0.726													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	19	9962106	9962107	+	IGR	DEL	GT	-	-	rs56192126		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:9962106_9962107delGT								PIN1 (1748 upstream) : OLFM2 (2288 downstream)																							AGCTCTGAGCgtgtgtgtgtgt	0.411													3	3	---	---	---	---	
SFRS16	11129	broad.mit.edu	37	19	45563442	45563443	+	Intron	INS	-	T	T			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:45563442_45563443insT	uc002pak.2	+						SFRS16_uc002pal.2_Intron|SFRS16_uc010xxh.1_Intron|SFRS16_uc002pam.2_Intron|SFRS16_uc002pan.1_Intron	NM_007056	NP_008987	Q8N2M8	CLASR_HUMAN	splicing factor, arginine/serine-rich 16						mRNA processing|RNA splicing	nucleus					0		Ovarian(192;0.0728)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.0102)		gaggatttctgttttttttttt	0.050											OREG0025548	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	6	3	---	---	---	---	
ZNF766	90321	broad.mit.edu	37	19	52789441	52789442	+	Intron	INS	-	C	C	rs149933354	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52789441_52789442insC	uc002pyr.1	+						ZNF766_uc002pys.1_Intron|ZNF766_uc002pyt.1_Intron	NM_001010851	NP_001010851	Q5HY98	ZN766_HUMAN	zinc finger protein 766						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.00236)|OV - Ovarian serous cystadenocarcinoma(262;0.00871)		AGTGGGCTTTTCCCCcctaatt	0.168													4	4	---	---	---	---	
ZCCHC3	85364	broad.mit.edu	37	20	278688	278690	+	In_Frame_Del	DEL	CGG	-	-	rs5839847		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:278688_278690delCGG	uc002wdf.2	+	1	485_487	c.461_463delCGG	c.(460-465)CCGGCG>CCG	p.A158del	ZCCHC3_uc002wdg.2_Intron	NM_033089	NP_149080	Q9NUD5	ZCHC3_HUMAN	zinc finger, CCHC domain containing 3	158	Poly-Ala.						nucleic acid binding|zinc ion binding				0		all_cancers(10;0.000209)|Lung NSC(37;0.0417)|all_lung(30;0.0713)|all_epithelial(17;0.0748)|Breast(17;0.231)	OV - Ovarian serous cystadenocarcinoma(29;0.149)			CAGGATGAgccggcggcggcggc	0.635													6	4	---	---	---	---	
PHF20	51230	broad.mit.edu	37	20	34484004	34484005	+	Intron	DEL	TG	-	-	rs35800229		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34484004_34484005delTG	uc002xek.1	+						PHF20_uc002xei.1_Intron|PHF20_uc010gfo.1_Intron|PHF20_uc002xej.1_Intron	NM_016436	NP_057520	Q9BVI0	PHF20_HUMAN	PHD finger protein 20						regulation of transcription, DNA-dependent|transcription, DNA-dependent	MLL1 complex	DNA binding|zinc ion binding			ovary(1)	1	Breast(12;0.00631)|all_lung(11;0.0145)					TGCTTTGGGAtgtgtgtgtgtg	0.267													4	2	---	---	---	---	
ZNFX1	57169	broad.mit.edu	37	20	47870567	47870573	+	Intron	DEL	TTTTTTT	-	-	rs11353174	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47870567_47870573delTTTTTTT	uc002xui.2	-							NM_021035	NP_066363	Q9P2E3	ZNFX1_HUMAN	zinc finger, NFX1-type containing 1								metal ion binding			ovary(2)	2			BRCA - Breast invasive adenocarcinoma(12;0.00173)|COAD - Colon adenocarcinoma(4;0.14)|Colorectal(8;0.166)			ttcttttttctttttttttttttcttt	0.188													9	5	---	---	---	---	
PRPF6	24148	broad.mit.edu	37	20	62626969	62626969	+	Intron	DEL	T	-	-	rs113295997		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:62626969delT	uc002yho.2	+						PRPF6_uc002yhp.2_Intron	NM_012469	NP_036601	O94906	PRP6_HUMAN	PRP6 pre-mRNA processing factor 6 homolog						assembly of spliceosomal tri-snRNP|positive regulation of transcription from RNA polymerase II promoter|spliceosome assembly	catalytic step 2 spliceosome|nucleoplasm|U4/U6 snRNP|U4/U6 x U5 tri-snRNP complex|U5 snRNP	androgen receptor binding|ribonucleoprotein binding|transcription coactivator activity			ovary(2)	2	all_cancers(38;6.47e-12)|all_epithelial(29;1.26e-13)|Lung NSC(23;9.37e-10)|all_lung(23;3.23e-09)					ctccttctccttttttttttt	0.100													5	3	---	---	---	---	
BAGE2	85319	broad.mit.edu	37	21	11085863	11085864	+	Intron	INS	-	C	C			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:11085863_11085864insC	uc002yit.1	-						BAGE_uc002yix.2_Intron	NM_182482	NP_872288			B melanoma antigen family, member 2 precursor												0			Colorectal(6;3.44e-05)|COAD - Colon adenocarcinoma(6;0.00727)|READ - Rectum adenocarcinoma(6;0.0723)	UCEC - Uterine corpus endometrioid carcinoma (6;0.0974)|all cancers(6;2.54e-22)|Epithelial(6;4.21e-19)|OV - Ovarian serous cystadenocarcinoma(6;1.16e-09)|BRCA - Breast invasive adenocarcinoma(6;7.72e-05)|Lung(8;0.000189)|LUSC - Lung squamous cell carcinoma(6;0.00379)|GBM - Glioblastoma multiforme(6;0.00391)|Kidney(17;0.0773)|LUAD - Lung adenocarcinoma(8;0.247)		catcaccaccaccaccatcacc	0.000													6	3	---	---	---	---	
GABPA	2551	broad.mit.edu	37	21	27130161	27130165	+	Intron	DEL	TTTTT	-	-	rs143159574		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:27130161_27130165delTTTTT	uc002ylx.3	+						GABPA_uc002yly.3_Intron	NM_002040	NP_002031	Q06546	GABPA_HUMAN	GA binding protein transcription factor, alpha						positive regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	nucleus	protein heterodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription regulatory region DNA binding			ovary(1)|central_nervous_system(1)	2						TACAGCATAAttttttttttttttt	0.307													4	2	---	---	---	---	
TRAPPC10	7109	broad.mit.edu	37	21	45466404	45466404	+	Intron	DEL	G	-	-	rs66490209		TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45466404delG	uc002zea.2	+						TRAPPC10_uc010gpo.2_Intron|TRAPPC10_uc002zdz.2_Intron	NM_003274	NP_003265	P48553	TPC10_HUMAN	trafficking protein particle complex 10						vesicle-mediated transport	Golgi apparatus|integral to membrane	binding|sodium ion transmembrane transporter activity			ovary(1)|skin(1)	2						ttttttttttggggggaggat	0.194													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	22	16920274	16920275	+	IGR	DEL	AT	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:16920274_16920275delAT								OR11H1 (470470 upstream) : CCT8L2 (151373 downstream)																							TTATAGTGACATGTATGAAAAC	0.267													6	6	---	---	---	---	
CLTCL1	8218	broad.mit.edu	37	22	19214071	19214072	+	Intron	INS	-	G	G	rs150400931	by1000genomes	TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19214071_19214072insG	uc002zpb.2	-						CLTCL1_uc011agv.1_Intron|CLTCL1_uc011agw.1_Intron	NM_007098	NP_009029	P53675	CLH2_HUMAN	clathrin, heavy polypeptide-like 1 isoform 1						anatomical structure morphogenesis|intracellular protein transport|mitosis|positive regulation of glucose import|receptor-mediated endocytosis	clathrin coat of coated pit|clathrin coat of trans-Golgi network vesicle|spindle|trans-Golgi network	protein binding|signal transducer activity|structural molecule activity			ovary(4)|central_nervous_system(1)	5	Colorectal(54;0.0993)					GTGGGTCCCAAATCCCTGGCTG	0.569			T	?	ALCL								8	5	---	---	---	---	
LMF2	91289	broad.mit.edu	37	22	50942956	50942956	+	Intron	DEL	C	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50942956delC	uc003blp.2	-						LMF2_uc010hba.2_Intron|LMF2_uc003blo.2_Intron	NM_033200	NP_149977	Q9BU23	LMF2_HUMAN	lipase maturation factor 2							endoplasmic reticulum membrane|integral to membrane				breast(1)	1		all_cancers(38;1.31e-09)|all_epithelial(38;1.81e-08)|all_lung(38;0.000817)|Breast(42;0.00387)|Lung NSC(38;0.0124)|Ovarian(80;0.104)|Lung SC(80;0.162)|Hepatocellular(38;0.178)		BRCA - Breast invasive adenocarcinoma(115;0.205)|LUAD - Lung adenocarcinoma(64;0.247)		tccaccccagcccactccacA	0.498													7	5	---	---	---	---	
UBE2A	7319	broad.mit.edu	37	X	118716913	118716913	+	Intron	DEL	A	-	-			TCGA-BP-5169-01A-01D-1429-08	TCGA-BP-5169-11A-01D-1429-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:118716913delA	uc004erl.2	+						UBE2A_uc004erm.2_Intron|UBE2A_uc004ern.2_Intron|UBE2A_uc004ero.2_Intron|UBE2A_uc004erp.2_Intron	NM_003336	NP_003327	P49459	UBE2A_HUMAN	ubiquitin-conjugating enzyme E2A isoform 1						histone H2A ubiquitination|positive regulation of cell proliferation|postreplication repair|protein autoubiquitination|protein K11-linked ubiquitination|protein K48-linked ubiquitination|response to UV|ubiquitin-dependent protein catabolic process		ATP binding|ubiquitin protein ligase binding|ubiquitin-protein ligase activity				0						cttctcccttaaaaaaaaaaa	0.169								Direct_reversal_of_damage|Rad6_pathway					4	3	---	---	---	---	
