Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	filter
ATAD3A	55210	broad.mit.edu	37	1	1469490	1469490	+	3'UTR	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1469490C>T	uc001afz.1	+	16					ATAD3A_uc001aga.1_3'UTR|ATAD3A_uc001agb.1_3'UTR|ATAD3A_uc001agc.1_RNA	NM_018188	NP_060658	Q9NVI7	ATD3A_HUMAN	ATPase family, AAA domain containing 3A								ATP binding|nucleoside-triphosphatase activity|protein binding			skin(1)	1	all_cancers(77;0.00164)|all_epithelial(69;0.000959)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;9.48e-15)|all_lung(118;9.67e-07)|Lung NSC(185;5.59e-05)|Renal(390;0.00571)|Breast(487;0.0183)|Hepatocellular(190;0.0268)|Myeloproliferative disorder(586;0.028)|Ovarian(437;0.127)|Lung SC(97;0.217)		Epithelial(90;1.12e-36)|OV - Ovarian serous cystadenocarcinoma(86;2.18e-22)|Colorectal(212;0.000164)|COAD - Colon adenocarcinoma(227;0.000195)|Kidney(185;0.00233)|BRCA - Breast invasive adenocarcinoma(365;0.00469)|STAD - Stomach adenocarcinoma(132;0.00644)|KIRC - Kidney renal clear cell carcinoma(229;0.0347)|Lung(427;0.147)		AGCCTGGCCGCGGACCCCTCC	0.672													5	16	---	---	---	---	PASS
SLC2A5	6518	broad.mit.edu	37	1	9101954	9101954	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:9101954G>A	uc001apo.2	-	5	753	c.461C>T	c.(460-462)GCC>GTC	p.A154V	SLC2A5_uc010nzy.1_Missense_Mutation_p.A95V|SLC2A5_uc010nzz.1_Missense_Mutation_p.A39V|SLC2A5_uc010oaa.1_Missense_Mutation_p.A110V|SLC2A5_uc010oab.1_Missense_Mutation_p.A154V|SLC2A5_uc010oac.1_Silent_p.G112G|SLC2A5_uc001app.3_Missense_Mutation_p.A154V	NM_003039	NP_003030	P22732	GTR5_HUMAN	solute carrier family 2 (facilitated	154	Cytoplasmic (Potential).				carbohydrate metabolic process	integral to membrane|plasma membrane	fructose transmembrane transporter activity|glucose transmembrane transporter activity			pancreas(2)|ovary(1)	3	Ovarian(185;0.112)|all_lung(157;0.185)	all_epithelial(116;1.34e-15)|all_lung(118;9.46e-05)|Lung NSC(185;0.000172)|Renal(390;0.000469)|Colorectal(325;0.0062)|Breast(348;0.00715)|Hepatocellular(190;0.0228)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.104)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;7.78e-07)|COAD - Colon adenocarcinoma(227;8.83e-05)|Kidney(185;0.000286)|KIRC - Kidney renal clear cell carcinoma(229;0.00103)|STAD - Stomach adenocarcinoma(132;0.0019)|BRCA - Breast invasive adenocarcinoma(304;0.00199)|READ - Rectum adenocarcinoma(331;0.0649)		GTTTTTAGGGGCCAGCTCCCC	0.537													5	16	---	---	---	---	PASS
TMEM54	113452	broad.mit.edu	37	1	33363895	33363895	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:33363895C>G	uc001bwi.1	-	2	156	c.42G>C	c.(40-42)CGG>CGC	p.R14R	TMEM54_uc001bwj.1_Silent_p.R14R|TMEM54_uc001bwk.1_Silent_p.R14R	NM_033504	NP_277039	Q969K7	TMM54_HUMAN	transmembrane protein 54	14						integral to membrane					0		Myeloproliferative disorder(586;0.0393)|all_neural(195;0.186)				TCAGCACCTTCCGGAAGTCGC	0.632													7	45	---	---	---	---	PASS
RLF	6018	broad.mit.edu	37	1	40697236	40697236	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40697236C>G	uc001cfc.3	+	7	1026	c.995C>G	c.(994-996)TCT>TGT	p.S332C	RLF_uc001cfd.3_Missense_Mutation_p.S23C	NM_012421	NP_036553	Q13129	RLF_HUMAN	rearranged L-myc fusion	332					chromosome organization|DNA integration|DNA mediated transformation|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		DNA binding|protein binding|zinc ion binding			ovary(2)|pancreas(1)	3	Lung NSC(20;4.38e-06)|Ovarian(52;0.00167)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;5.87e-19)|Epithelial(16;7.02e-16)|all cancers(16;1.69e-14)|Lung(16;0.0427)|LUSC - Lung squamous cell carcinoma(16;0.0461)			ATTGACCCTTCTTTAGATACT	0.358													19	151	---	---	---	---	PASS
DEM1	64789	broad.mit.edu	37	1	40981078	40981078	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40981078G>T	uc001cfp.2	+	3	1067	c.862G>T	c.(862-864)GAT>TAT	p.D288Y	DEM1_uc001cfq.2_Missense_Mutation_p.D288Y|DEM1_uc001cfr.2_Missense_Mutation_p.D288Y|DEM1_uc001cfs.2_Missense_Mutation_p.D288Y	NM_022774	NP_073611	Q9H790	EXO5_HUMAN	defects in morphology 1 homolog	288							DNA binding|exonuclease activity				0						CCCAGTTATTGATATCTTGAA	0.493													16	362	---	---	---	---	PASS
TIE1	7075	broad.mit.edu	37	1	43782984	43782984	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43782984G>C	uc001ciu.2	+	15	2603	c.2524G>C	c.(2524-2526)GAG>CAG	p.E842Q	TIE1_uc010oke.1_Missense_Mutation_p.E797Q|TIE1_uc009vwq.2_Missense_Mutation_p.E798Q|TIE1_uc010okg.1_Missense_Mutation_p.E487Q	NM_005424	NP_005415	P35590	TIE1_HUMAN	tyrosine kinase with immunoglobulin-like and	842	Cytoplasmic (Potential).|Protein kinase.				mesoderm development	integral to plasma membrane	ATP binding|protein binding|transmembrane receptor protein tyrosine kinase activity			lung(3)|stomach(1)|salivary_gland(1)|ovary(1)|skin(1)	7	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0505)				CATCACCTTTGAGGACCTCAT	0.587													14	162	---	---	---	---	PASS
SLC6A9	6536	broad.mit.edu	37	1	44474198	44474198	+	Silent	SNP	C	T	T	rs144161106		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44474198C>T	uc001cll.2	-	5	828	c.636G>A	c.(634-636)ACG>ACA	p.T212T	SLC6A9_uc009vxe.2_Silent_p.T68T|SLC6A9_uc010okm.1_Silent_p.T139T|SLC6A9_uc001clm.2_Silent_p.T158T|SLC6A9_uc009vxd.2_RNA|SLC6A9_uc010okn.1_Silent_p.T143T|SLC6A9_uc001cln.2_Silent_p.T139T|SLC6A9_uc010oko.1_Silent_p.T28T|SLC6A9_uc010okp.1_RNA	NM_201649	NP_964012	P48067	SC6A9_HUMAN	solute carrier family 6 member 9 isoform 2	212	Extracellular (Potential).					integral to plasma membrane|membrane fraction	glycine:sodium symporter activity|neurotransmitter:sodium symporter activity				0	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0511)			Glycine(DB00145)	GCAGCACGTGCGTCATGGACG	0.572													4	114	---	---	---	---	PASS
C1orf163	65260	broad.mit.edu	37	1	53153747	53153747	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:53153747A>G	uc001cui.1	-	3	381	c.341T>C	c.(340-342)GTT>GCT	p.V114A		NM_023077	NP_075565	Q96BR5	SELR1_HUMAN	hypothetical protein LOC65260	114	Sel1-like 3.						binding				0						CAGGAGGCCAACGTTGTGACA	0.542													5	98	---	---	---	---	PASS
YIPF1	54432	broad.mit.edu	37	1	54343992	54343992	+	Silent	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:54343992G>T	uc001cvu.2	-	6	697	c.360C>A	c.(358-360)CTC>CTA	p.L120L	YIPF1_uc001cvv.2_RNA|YIPF1_uc001cvw.2_RNA|YIPF1_uc001cvx.2_RNA|YIPF1_uc001cvy.2_RNA	NM_018982	NP_061855	Q9Y548	YIPF1_HUMAN	Yip1 domain family, member 1	120	Helical; (Potential).					integral to membrane|transport vesicle				large_intestine(1)|ovary(1)	2						ACATACCATAGAGATCTGGAT	0.423													5	172	---	---	---	---	PASS
PPAP2B	8613	broad.mit.edu	37	1	56990007	56990007	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:56990007C>T	uc001cyj.1	-	4	1018	c.517G>A	c.(517-519)GAA>AAA	p.E173K		NM_177414	NP_803133	O14495	LPP3_HUMAN	phosphatidic acid phosphatase type 2B	173	Lumenal (Potential).				canonical Wnt receptor signaling pathway involved in positive regulation of cell-cell adhesion|canonical Wnt receptor signaling pathway involved in positive regulation of endothelial cell migration|canonical Wnt receptor signaling pathway involved in positive regulation of wound healing|germ cell migration|homotypic cell-cell adhesion|negative regulation of protein phosphorylation|positive regulation of sequence-specific DNA binding transcription factor activity|protein stabilization|sphingolipid metabolic process	adherens junction|Golgi apparatus|integral to membrane	phosphatidate phosphatase activity|phosphoprotein phosphatase activity|protein binding|sphingosine-1-phosphate phosphatase activity				0						ATGTAGCCTTCAGAGCAGTTG	0.537													44	132	---	---	---	---	PASS
PPAP2B	8613	broad.mit.edu	37	1	56990203	56990203	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:56990203C>T	uc001cyj.1	-	4	822	c.321G>A	c.(319-321)CGG>CGA	p.R107R		NM_177414	NP_803133	O14495	LPP3_HUMAN	phosphatidic acid phosphatase type 2B	107	Cytoplasmic (Potential).				canonical Wnt receptor signaling pathway involved in positive regulation of cell-cell adhesion|canonical Wnt receptor signaling pathway involved in positive regulation of endothelial cell migration|canonical Wnt receptor signaling pathway involved in positive regulation of wound healing|germ cell migration|homotypic cell-cell adhesion|negative regulation of protein phosphorylation|positive regulation of sequence-specific DNA binding transcription factor activity|protein stabilization|sphingolipid metabolic process	adherens junction|Golgi apparatus|integral to membrane	phosphatidate phosphatase activity|phosphoprotein phosphatase activity|protein binding|sphingosine-1-phosphate phosphatase activity				0						GGTAATAGATCCGGTAGAATT	0.483													20	78	---	---	---	---	PASS
DAB1	1600	broad.mit.edu	37	1	57480619	57480619	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57480619C>A	uc001cys.1	-	14	2055	c.1381G>T	c.(1381-1383)GAC>TAC	p.D461Y	DAB1_uc001cyt.1_Missense_Mutation_p.D459Y|DAB1_uc001cyq.1_Missense_Mutation_p.D459Y|DAB1_uc001cyr.1_Missense_Mutation_p.D375Y|DAB1_uc009vzw.1_Missense_Mutation_p.D443Y|DAB1_uc009vzx.1_Missense_Mutation_p.D461Y	NM_021080	NP_066566	O75553	DAB1_HUMAN	disabled homolog 1	494					cell differentiation|nervous system development					skin(2)|ovary(1)	3						ATGTCAAAGTCATCACAGTCG	0.522													12	69	---	---	---	---	PASS
DAB1	1600	broad.mit.edu	37	1	57480687	57480687	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57480687C>G	uc001cys.1	-	14	1987	c.1313G>C	c.(1312-1314)TGT>TCT	p.C438S	DAB1_uc001cyt.1_Missense_Mutation_p.C436S|DAB1_uc001cyq.1_Missense_Mutation_p.C436S|DAB1_uc001cyr.1_Missense_Mutation_p.C352S|DAB1_uc009vzw.1_Missense_Mutation_p.C420S|DAB1_uc009vzx.1_Missense_Mutation_p.C438S	NM_021080	NP_066566	O75553	DAB1_HUMAN	disabled homolog 1	471					cell differentiation|nervous system development					skin(2)|ovary(1)	3						CTCTGAGGTACAGGTGAGGGA	0.547													9	56	---	---	---	---	PASS
DAB1	1600	broad.mit.edu	37	1	57480743	57480743	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57480743C>A	uc001cys.1	-	14	1931	c.1257G>T	c.(1255-1257)CAG>CAT	p.Q419H	DAB1_uc001cyt.1_Missense_Mutation_p.Q417H|DAB1_uc001cyq.1_Missense_Mutation_p.Q417H|DAB1_uc001cyr.1_Missense_Mutation_p.Q333H|DAB1_uc009vzw.1_Missense_Mutation_p.Q401H|DAB1_uc009vzx.1_Missense_Mutation_p.Q419H	NM_021080	NP_066566	O75553	DAB1_HUMAN	disabled homolog 1	452					cell differentiation|nervous system development					skin(2)|ovary(1)	3						GCTGGGCCATCTGGAAATCCT	0.597													12	56	---	---	---	---	PASS
DAB1	1600	broad.mit.edu	37	1	57480856	57480856	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57480856C>T	uc001cys.1	-	14	1818	c.1144G>A	c.(1144-1146)GGT>AGT	p.G382S	DAB1_uc001cyt.1_Missense_Mutation_p.G380S|DAB1_uc001cyq.1_Missense_Mutation_p.G380S|DAB1_uc001cyr.1_Missense_Mutation_p.G296S|DAB1_uc009vzw.1_Missense_Mutation_p.G364S|DAB1_uc009vzx.1_Missense_Mutation_p.G382S	NM_021080	NP_066566	O75553	DAB1_HUMAN	disabled homolog 1	415					cell differentiation|nervous system development					skin(2)|ovary(1)	3						GTGAGGGGACCTTGGAACATG	0.602													13	55	---	---	---	---	PASS
DAB1	1600	broad.mit.edu	37	1	57481004	57481004	+	Silent	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57481004C>A	uc001cys.1	-	14	1670	c.996G>T	c.(994-996)GTG>GTT	p.V332V	DAB1_uc001cyt.1_Silent_p.V330V|DAB1_uc001cyq.1_Silent_p.V330V|DAB1_uc001cyr.1_Silent_p.V246V|DAB1_uc009vzw.1_Silent_p.V314V|DAB1_uc009vzx.1_Silent_p.V332V	NM_021080	NP_066566	O75553	DAB1_HUMAN	disabled homolog 1	365					cell differentiation|nervous system development					skin(2)|ovary(1)	3						CCCCCGGCATCACCTGAGCGA	0.667													8	46	---	---	---	---	PASS
LRRC7	57554	broad.mit.edu	37	1	70541913	70541913	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:70541913G>A	uc001dep.2	+	22	4300	c.4270G>A	c.(4270-4272)GGA>AGA	p.G1424R	LRRC7_uc009wbg.2_Missense_Mutation_p.G708R|LRRC7_uc001deq.2_Missense_Mutation_p.G618R	NM_020794	NP_065845	Q96NW7	LRRC7_HUMAN	leucine rich repeat containing 7	1424						centrosome|focal adhesion|nucleolus	protein binding			ovary(9)|breast(2)|central_nervous_system(2)|liver(1)	14						GGCCACCCGGGGACCTCAGCC	0.468													5	89	---	---	---	---	PASS
ASB17	127247	broad.mit.edu	37	1	76397741	76397741	+	Missense_Mutation	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:76397741T>C	uc001dhe.1	-	1	376	c.236A>G	c.(235-237)TAC>TGC	p.Y79C	ASB17_uc001dhf.1_RNA	NM_080868	NP_543144	Q8WXJ9	ASB17_HUMAN	ankyrin repeat and SOCS box-containing 17	79					intracellular signal transduction					ovary(1)	1						TTCAAAACGGTATCCTGATTT	0.378													15	63	---	---	---	---	PASS
LPHN2	23266	broad.mit.edu	37	1	82432119	82432119	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:82432119G>A	uc001dit.3	+	12	2305	c.2124G>A	c.(2122-2124)CGG>CGA	p.R708R	LPHN2_uc001dis.2_Intron|LPHN2_uc001diu.2_Silent_p.R708R|LPHN2_uc001div.2_Silent_p.R708R|LPHN2_uc009wcd.2_Silent_p.R708R|LPHN2_uc001diw.2_Silent_p.R292R	NM_012302	NP_036434	O95490	LPHN2_HUMAN	latrophilin 2 precursor	721	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity|latrotoxin receptor activity|sugar binding			ovary(3)|lung(3)|breast(2)|central_nervous_system(1)	9				all cancers(265;0.00142)|Epithelial(280;0.00829)|OV - Ovarian serous cystadenocarcinoma(397;0.077)|STAD - Stomach adenocarcinoma(256;0.248)		TCATTTACCGGAGCCTGGGAC	0.373													23	84	---	---	---	---	PASS
CCDC18	343099	broad.mit.edu	37	1	93677790	93677790	+	Silent	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:93677790A>G	uc001dpq.2	+	11	1989	c.1821A>G	c.(1819-1821)GAA>GAG	p.E607E	CCDC18_uc009wdl.1_Silent_p.E168E	NM_206886	NP_996769	Q5T9S5	CCD18_HUMAN	sarcoma antigen NY-SAR-41	489										ovary(2)|breast(2)|pancreas(1)	5		all_lung(203;0.00196)|Lung NSC(277;0.00903)|Melanoma(281;0.099)|all_neural(321;0.185)|Glioma(108;0.203)		all cancers(265;0.00166)|GBM - Glioblastoma multiforme(16;0.00551)|Epithelial(280;0.0967)		TAGAAACAGAACCTGTAAAGC	0.289													34	179	---	---	---	---	PASS
COL11A1	1301	broad.mit.edu	37	1	103544384	103544384	+	Silent	SNP	T	C	C	rs150668398		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103544384T>C	uc001dul.2	-	3	636	c.318A>G	c.(316-318)AAA>AAG	p.K106K	COL11A1_uc001dum.2_Silent_p.K106K|COL11A1_uc001dun.2_Silent_p.K106K|COL11A1_uc009weh.2_Silent_p.K106K	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	106	TSP N-terminal.				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)		CTTTTTTTGGTTTTACTGTAA	0.333													13	39	---	---	---	---	PASS
GSTM2	2946	broad.mit.edu	37	1	110210703	110210703	+	Intron	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:110210703G>A	uc001dyi.2	+						GSTM2_uc001dyj.2_5'UTR|GSTM2_uc010ovt.1_5'UTR|GSTM2_uc009wfk.2_RNA	NM_000848	NP_000839	P28161	GSTM2_HUMAN	glutathione S-transferase mu 2 isoform 1						glutathione metabolic process|xenobiotic catabolic process	cytoplasm	glutathione transferase activity				0		all_epithelial(167;2.5e-05)|all_lung(203;0.000135)|Lung NSC(277;0.000269)|Breast(1374;0.244)		all cancers(265;0.0122)|Colorectal(144;0.0129)|Epithelial(280;0.0146)|Lung(183;0.0422)|COAD - Colon adenocarcinoma(174;0.047)|LUSC - Lung squamous cell carcinoma(189;0.227)	Glutathione(DB00143)	CCGCCCCGCTGAGGCCTGTCT	0.697													5	17	---	---	---	---	PASS
KCND3	3752	broad.mit.edu	37	1	112524482	112524482	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:112524482G>C	uc001ebu.1	-	2	1347	c.867C>G	c.(865-867)CTC>CTG	p.L289L	KCND3_uc001ebv.1_Silent_p.L289L	NM_004980	NP_004971	Q9UK17	KCND3_HUMAN	potassium voltage-gated channel, Shal-related	289	Helical; Voltage-sensor; Name=Segment S4; (Potential).					sarcolemma|voltage-gated potassium channel complex	A-type (transient outward) potassium channel activity|metal ion binding			ovary(2)|large_intestine(1)	3		all_cancers(81;8.52e-06)|all_epithelial(167;5.65e-06)|all_lung(203;2.72e-05)|Lung NSC(69;4.56e-05)		all cancers(265;0.056)|Lung(183;0.0576)|Colorectal(144;0.1)|Epithelial(280;0.104)|COAD - Colon adenocarcinoma(174;0.222)|LUSC - Lung squamous cell carcinoma(189;0.231)		GGAAGACCCGGAGCGTGACGA	0.602													6	54	---	---	---	---	PASS
TTF2	8458	broad.mit.edu	37	1	117640030	117640030	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:117640030C>A	uc001egy.2	+	21	3264	c.3244C>A	c.(3244-3246)CAC>AAC	p.H1082N		NM_003594	NP_003585	Q9UNY4	TTF2_HUMAN	transcription termination factor, RNA polymerase	1082	Helicase C-terminal.				mRNA processing|regulation of transcription, DNA-dependent|RNA splicing|termination of RNA polymerase II transcription	cytoplasm|spliceosomal complex|transcription elongation factor complex	ATP binding|ATP-dependent helicase activity|DNA binding|DNA-dependent ATPase activity|protein binding|zinc ion binding			ovary(1)	1	Lung SC(450;0.225)	all_cancers(81;4.23e-06)|all_epithelial(167;3.65e-07)|all_lung(203;2.81e-06)|Lung NSC(69;1.98e-05)		Lung(183;0.0553)|Colorectal(144;0.179)|LUSC - Lung squamous cell carcinoma(189;0.19)		TGGAGGAAATCACCTCTTTCT	0.463													53	249	---	---	---	---	PASS
PDE4DIP	9659	broad.mit.edu	37	1	144922578	144922578	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144922578G>C	uc001elw.3	-	7	1120	c.829C>G	c.(829-831)CAA>GAA	p.Q277E	NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|PDE4DIP_uc001elx.3_Missense_Mutation_p.Q343E|PDE4DIP_uc001emc.1_Missense_Mutation_p.Q277E|PDE4DIP_uc001emd.1_Missense_Mutation_p.Q277E|PDE4DIP_uc001emb.1_Missense_Mutation_p.Q440E|PDE4DIP_uc001eme.1_5'Flank|PDE4DIP_uc001emf.1_Missense_Mutation_p.Q64E	NM_014644	NP_055459	Q5VU43	MYOME_HUMAN	phosphodiesterase 4D interacting protein isoform	277	Potential.				cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)		TCTTGCTTTTGAGACGACTCC	0.373			T	PDGFRB	MPD								69	762	---	---	---	---	PASS
SV2A	9900	broad.mit.edu	37	1	149879685	149879685	+	Missense_Mutation	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:149879685T>C	uc001etg.2	-	9	1944	c.1453A>G	c.(1453-1455)AAA>GAA	p.K485E	SV2A_uc009wlk.2_5'Flank|SV2A_uc001eth.2_Missense_Mutation_p.K485E	NM_014849	NP_055664	Q7L0J3	SV2A_HUMAN	synaptic vesicle glycoprotein 2	485	Extracellular (Potential).				neurotransmitter transport	cell junction|endoplasmic reticulum|integral to membrane|synaptic vesicle membrane	transmembrane transporter activity			ovary(6)|pancreas(1)	7	Breast(34;0.00769)|all_hematologic(923;0.127)|Colorectal(459;0.171)		LUSC - Lung squamous cell carcinoma(543;0.221)|STAD - Stomach adenocarcinoma(528;0.247)		Levetiracetam(DB01202)	GGGAACACTTTGGTGCGGGAT	0.527													50	168	---	---	---	---	PASS
C1orf51	148523	broad.mit.edu	37	1	150256881	150256881	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150256881G>A	uc001euh.2	+	4	624	c.488G>A	c.(487-489)CGT>CAT	p.R163H	C1orf51_uc001eui.2_Missense_Mutation_p.R75H|C1orf51_uc001euj.2_Missense_Mutation_p.R163H	NM_144697	NP_653298	Q8N365	CA051_HUMAN	hypothetical protein LOC148523	163											0	Lung NSC(24;7.29e-29)|Breast(34;0.00211)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.161)|Colorectal(459;0.171)		LUSC - Lung squamous cell carcinoma(543;0.171)			AGGATCCAGCGTATTGTAGGT	0.468													5	255	---	---	---	---	PASS
TARS2	80222	broad.mit.edu	37	1	150477198	150477198	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150477198C>T	uc001euq.2	+	15	1816	c.1809C>T	c.(1807-1809)TGC>TGT	p.C603C	TARS2_uc001eur.2_Silent_p.C521C|TARS2_uc009wlt.2_Silent_p.C229C|TARS2_uc009wls.2_Silent_p.C473C	NM_025150	NP_079426	Q9BW92	SYTM_HUMAN	threonyl-tRNA synthetase 2, mitochondrial	603					threonyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|threonine-tRNA ligase activity			ovary(1)	1	all_cancers(9;3.13e-53)|all_epithelial(9;3.74e-43)|all_lung(15;2.43e-34)|Lung NSC(24;8.86e-31)|Breast(34;0.000326)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Melanoma(130;0.128)|Colorectal(459;0.171)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0757)|all cancers(9;1.51e-21)|BRCA - Breast invasive adenocarcinoma(12;0.000734)|LUSC - Lung squamous cell carcinoma(543;0.171)|STAD - Stomach adenocarcinoma(528;0.206)		L-Threonine(DB00156)	CAGAAAGCTGCGGGGGGAAAT	0.567													19	203	---	---	---	---	PASS
CTSS	1520	broad.mit.edu	37	1	150727584	150727584	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150727584G>A	uc001evn.2	-	4	425	c.292C>T	c.(292-294)CCC>TCC	p.P98S	CTSS_uc010pcj.1_Intron|CTSS_uc001evo.1_Missense_Mutation_p.P98S	NM_004079	NP_004070	P25774	CATS_HUMAN	cathepsin S preproprotein	98					immune response|proteolysis	extracellular region|lysosome	cysteine-type endopeptidase activity				0	all_cancers(9;6.17e-52)|all_epithelial(9;9.7e-43)|all_lung(15;5.74e-35)|Lung NSC(24;2.09e-31)|Breast(34;0.00146)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Melanoma(130;0.128)|Colorectal(459;0.171)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0485)|Epithelial(6;5.02e-21)|all cancers(9;1.28e-20)|OV - Ovarian serous cystadenocarcinoma(6;1.09e-14)|BRCA - Breast invasive adenocarcinoma(12;0.00501)|LUSC - Lung squamous cell carcinoma(543;0.171)			CACTGGCTGGGAACTCTCAGG	0.333													8	302	---	---	---	---	PASS
FAM63A	55793	broad.mit.edu	37	1	150973046	150973046	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150973046G>T	uc001ewf.2	-	6	2306	c.622C>A	c.(622-624)CTG>ATG	p.L208M	FAM63A_uc001ewc.2_Missense_Mutation_p.L66M|FAM63A_uc010pcm.1_Missense_Mutation_p.L113M|FAM63A_uc001ewd.2_Missense_Mutation_p.L66M|FAM63A_uc001ewe.2_Missense_Mutation_p.L42M|FAM63A_uc010pcn.1_Missense_Mutation_p.L256M|FAM63A_uc001ewg.2_Missense_Mutation_p.L208M	NM_018379	NP_001156731	Q8N5J2	FA63A_HUMAN	hypothetical protein LOC55793 isoform 1	208							protein binding			ovary(1)	1	all_lung(15;1.09e-34)|Lung NSC(24;1.1e-30)|Lung SC(34;0.00202)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.0997)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0486)|LUSC - Lung squamous cell carcinoma(543;0.211)			TTGACATCCAGACCTGTGGCC	0.493													14	130	---	---	---	---	PASS
SCNM1	79005	broad.mit.edu	37	1	151139670	151139670	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151139670G>C	uc001ewz.2	+	4	397	c.285G>C	c.(283-285)TTG>TTC	p.L95F	LYSMD1_uc001ewy.2_5'Flank|LYSMD1_uc010pcr.1_5'Flank|SCNM1_uc010pcs.1_Missense_Mutation_p.L95F|SCNM1_uc009wmn.2_RNA	NM_024041	NP_076946	Q9BWG6	SCNM1_HUMAN	sodium channel modifier 1	95					mRNA processing|RNA splicing	nucleus	metal ion binding|protein binding			upper_aerodigestive_tract(1)|ovary(1)|pancreas(1)|skin(1)	4	Lung SC(34;0.00471)|Ovarian(49;0.0147)|all_hematologic(923;0.0597)|Hepatocellular(266;0.0997)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0486)|LUSC - Lung squamous cell carcinoma(543;0.211)			AGAATGAATTGAGAAGGGAAG	0.483													7	153	---	---	---	---	PASS
SELENBP1	8991	broad.mit.edu	37	1	151338296	151338296	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151338296C>T	uc001exx.2	-	8	917	c.870G>A	c.(868-870)GTG>GTA	p.V290V	SELENBP1_uc010pcy.1_Silent_p.V332V|SELENBP1_uc001exy.2_Silent_p.V187V|SELENBP1_uc001exz.2_Silent_p.V187V|SELENBP1_uc010pcz.1_Silent_p.V228V|SELENBP1_uc009wms.2_Silent_p.V126V|SELENBP1_uc009wmt.2_Silent_p.V187V|SELENBP1_uc001eya.2_Silent_p.V226V|SELENBP1_uc009wmu.2_Silent_p.V187V	NM_003944	NP_003935	Q13228	SBP1_HUMAN	selenium binding protein 1	290					protein transport	cytosol|membrane|nucleolus	protein binding|selenium binding				0	Lung SC(34;0.00471)|Ovarian(49;0.00871)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.112)|LUSC - Lung squamous cell carcinoma(543;0.181)			GCACCTGGATCACCTTCTCCA	0.552													16	219	---	---	---	---	PASS
POGZ	23126	broad.mit.edu	37	1	151378787	151378787	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151378787G>A	uc001eyd.1	-	19	3030	c.2724C>T	c.(2722-2724)CTC>CTT	p.L908L	POGZ_uc001eye.1_Silent_p.L855L|POGZ_uc010pdb.1_Silent_p.L899L|POGZ_uc001eyf.1_Silent_p.L864L|POGZ_uc010pdc.1_Silent_p.L846L|POGZ_uc009wmv.1_Silent_p.L813L|POGZ_uc010pdd.1_Silent_p.L399L	NM_015100	NP_055915	Q7Z3K3	POGZ_HUMAN	pogo transposable element with ZNF domain	908	Pro-rich.				cell division|kinetochore assembly|mitotic sister chromatid cohesion|regulation of transcription, DNA-dependent	cytoplasm|nuclear chromatin	DNA binding|protein binding|zinc ion binding			ovary(3)	3	Lung SC(34;0.00471)|Ovarian(49;0.00672)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.112)|LUSC - Lung squamous cell carcinoma(543;0.181)			CTGGTGATGGGAGTGCTGGGG	0.597													15	61	---	---	---	---	PASS
CGN	57530	broad.mit.edu	37	1	151506505	151506505	+	Silent	SNP	C	A	A	rs142498835		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151506505C>A	uc009wmw.2	+	15	2941	c.2797C>A	c.(2797-2799)CGG>AGG	p.R933R	CGN_uc010pde.1_5'Flank	NM_020770	NP_065821	Q9P2M7	CING_HUMAN	cingulin	927	Potential.					myosin complex|tight junction	actin binding|motor activity			ovary(2)|pancreas(1)	3	Ovarian(49;0.0273)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		LUSC - Lung squamous cell carcinoma(543;0.181)			GGACACAGCCCGGCTGGACAA	0.637													4	50	---	---	---	---	PASS
RORC	6097	broad.mit.edu	37	1	151801935	151801935	+	Splice_Site	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151801935C>T	uc001ezh.2	-	2	149	c.41_splice	c.e2-1	p.E14_splice	RORC_uc010pdo.1_Splice_Site_p.E68_splice|RORC_uc010pdp.1_Splice_Site_p.E14_splice	NM_005060	NP_005051	P51449	RORG_HUMAN	RAR-related orphan receptor C isoform a						regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(1)|skin(1)	2	Hepatocellular(266;0.0877)|all_hematologic(923;0.127)|Melanoma(130;0.14)		LUSC - Lung squamous cell carcinoma(543;0.181)			GCCAGCAGCTCTGTAAAGACA	0.532													24	99	---	---	---	---	PASS
FLG	2312	broad.mit.edu	37	1	152281252	152281252	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152281252C>T	uc001ezu.1	-	3	6146	c.6110G>A	c.(6109-6111)CGA>CAA	p.R2037Q		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	2037	Ser-rich.|Filaggrin 12.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			ACTGTACCCTCGGTGTCCACT	0.557									Ichthyosis				20	853	---	---	---	---	PASS
FLG	2312	broad.mit.edu	37	1	152287037	152287037	+	Missense_Mutation	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152287037T>C	uc001ezu.1	-	3	361	c.325A>G	c.(325-327)AAA>GAA	p.K109E	uc001ezv.2_Intron	NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	109					keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			TCTTCATGTTTATCATGATGA	0.358									Ichthyosis				15	253	---	---	---	---	PASS
LCE1F	353137	broad.mit.edu	37	1	152749146	152749146	+	Nonsense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152749146C>G	uc010pdv.1	+	1	299	c.299C>G	c.(298-300)TCA>TGA	p.S100*		NM_178354	NP_848131	Q5T754	LCE1F_HUMAN	late cornified envelope 1F	100					keratinization						0	Hepatocellular(266;0.0877)|all_hematologic(923;0.127)|Melanoma(130;0.242)		LUSC - Lung squamous cell carcinoma(543;0.206)			AGCCAGCCCTCAGCGGGCTCC	0.642													6	47	---	---	---	---	PASS
C1orf77	26097	broad.mit.edu	37	1	153615626	153615626	+	Intron	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153615626A>G	uc001fcm.1	+						C1orf77_uc001fcn.1_Intron|C1orf77_uc001fco.1_Intron|C1orf77_uc001fcp.2_5'Flank|C1orf77_uc009woj.1_3'UTR	NM_015607	NP_056422	Q9Y3Y2	CHTOP_HUMAN	small protein rich in arginine and glycine						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus	protein binding|RNA binding				0	all_lung(78;1.84e-32)|Lung NSC(65;6.67e-31)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.171)			TTTAACCCTCACCGCCTTCCT	0.413													9	176	---	---	---	---	PASS
INTS3	65123	broad.mit.edu	37	1	153724860	153724860	+	Nonsense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:153724860C>T	uc009wom.2	+	9	1056	c.835C>T	c.(835-837)CAG>TAG	p.Q279*	INTS3_uc001fct.2_Nonsense_Mutation_p.Q279*|INTS3_uc001fcu.2_5'UTR|INTS3_uc001fcv.2_Nonsense_Mutation_p.Q73*|INTS3_uc010peb.1_Nonsense_Mutation_p.Q73*|INTS3_uc001fcw.2_5'UTR	NM_023015	NP_075391	Q68E01	INT3_HUMAN	integrator complex subunit 3	280					DNA repair|G2/M transition checkpoint|response to ionizing radiation|snRNA processing	integrator complex|SOSS complex	protein binding			ovary(2)|upper_aerodigestive_tract(1)	3	all_lung(78;3.75e-32)|Lung NSC(65;1.37e-30)|Hepatocellular(266;0.0877)|Melanoma(130;0.199)		LUSC - Lung squamous cell carcinoma(543;0.151)			CCATAATCCTCAGGCCTTGAG	0.433													17	470	---	---	---	---	PASS
PBXIP1	57326	broad.mit.edu	37	1	154924271	154924271	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154924271C>T	uc001ffr.2	-	3	237	c.178G>A	c.(178-180)GGG>AGG	p.G60R	PBXIP1_uc001ffs.2_Missense_Mutation_p.G31R|PBXIP1_uc010pep.1_Intron|PBXIP1_uc009woy.1_RNA	NM_020524	NP_065385	Q96AQ6	PBIP1_HUMAN	pre-B-cell leukemia homeobox interacting protein	60					cell differentiation|multicellular organismal development|negative regulation of transcription, DNA-dependent	cytosol|microtubule|nucleus	protein binding|transcription corepressor activity			large_intestine(1)	1	all_epithelial(22;4.9e-30)|all_lung(78;4.1e-28)|all_hematologic(923;0.0359)|Hepatocellular(266;0.0877)|all_neural(408;0.245)		BRCA - Breast invasive adenocarcinoma(34;0.00034)			GGCCCAGTACCTTCTCCATCC	0.522													12	457	---	---	---	---	PASS
DAP3	7818	broad.mit.edu	37	1	155695275	155695275	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155695275C>G	uc001flq.2	+	5	542	c.373C>G	c.(373-375)CTT>GTT	p.L125V	DAP3_uc001flr.2_Missense_Mutation_p.L125V|DAP3_uc001fls.2_Missense_Mutation_p.L125V|DAP3_uc010pgl.1_Missense_Mutation_p.L84V|DAP3_uc001flt.2_Missense_Mutation_p.L91V|DAP3_uc001flu.2_Missense_Mutation_p.L125V|DAP3_uc010pgm.1_Missense_Mutation_p.L91V	NM_033657	NP_387506	P51398	RT29_HUMAN	death-associated protein 3	125					induction of apoptosis by extracellular signals	mitochondrial ribosome|nucleolus|small ribosomal subunit	protein binding			ovary(1)	1	Hepatocellular(266;0.0997)|all_hematologic(923;0.145)					TATACGATATCTTCTGTGTAT	0.418													25	141	---	---	---	---	PASS
HAPLN2	60484	broad.mit.edu	37	1	156593922	156593922	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156593922G>A	uc001fpn.1	+	4	816	c.409G>A	c.(409-411)GAG>AAG	p.E137K	HAPLN2_uc010phq.1_Missense_Mutation_p.E137K	NM_021817	NP_068589	Q9GZV7	HPLN2_HUMAN	brain link protein-1 precursor	137	Ig-like V-type.				cell adhesion	proteinaceous extracellular matrix	hyaluronic acid binding				0	all_hematologic(923;0.088)|Hepatocellular(266;0.158)					CATCGAGGACGAGAGCGTGGC	0.697													4	26	---	---	---	---	PASS
NES	10763	broad.mit.edu	37	1	156642464	156642464	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156642464C>G	uc001fpq.2	-	4	1649	c.1516G>C	c.(1516-1518)GAG>CAG	p.E506Q		NM_006617	NP_006608	P48681	NEST_HUMAN	nestin	506	Tail.				brain development|embryonic camera-type eye development|G2/M transition of mitotic cell cycle|negative regulation of apoptosis|positive regulation of intermediate filament depolymerization|positive regulation of neural precursor cell proliferation|stem cell proliferation	cytoplasm|intermediate filament	intermediate filament binding|structural molecule activity			ovary(6)	6	all_hematologic(923;0.088)|Hepatocellular(266;0.158)					GTTTCTTTCTCTACCAACCCC	0.502													31	267	---	---	---	---	PASS
CD1D	912	broad.mit.edu	37	1	158152166	158152166	+	Intron	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158152166G>C	uc001frr.2	+						CD1D_uc009wsr.1_Missense_Mutation_p.G225R|CD1D_uc009wss.2_Intron|CD1D_uc009wst.1_Missense_Mutation_p.G121R	NM_001766	NP_001757	P15813	CD1D_HUMAN	CD1D antigen precursor						antigen processing and presentation, endogenous lipid antigen via MHC class Ib|detection of bacterium|innate immune response|interspecies interaction between organisms|positive regulation of innate immune response|T cell selection	endosome membrane|integral to plasma membrane|lysosomal membrane	beta-2-microglobulin binding|exogenous lipid antigen binding|histone binding			ovary(1)	1	all_hematologic(112;0.0378)					TCCATTCCAGGGTTCTCATCC	0.453													3	67	---	---	---	---	PASS
CD1D	912	broad.mit.edu	37	1	158152167	158152167	+	Intron	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158152167G>T	uc001frr.2	+						CD1D_uc009wsr.1_Missense_Mutation_p.G225V|CD1D_uc009wss.2_Intron|CD1D_uc009wst.1_Missense_Mutation_p.G121V	NM_001766	NP_001757	P15813	CD1D_HUMAN	CD1D antigen precursor						antigen processing and presentation, endogenous lipid antigen via MHC class Ib|detection of bacterium|innate immune response|interspecies interaction between organisms|positive regulation of innate immune response|T cell selection	endosome membrane|integral to plasma membrane|lysosomal membrane	beta-2-microglobulin binding|exogenous lipid antigen binding|histone binding			ovary(1)	1	all_hematologic(112;0.0378)					CCATTCCAGGGTTCTCATCCC	0.448													4	64	---	---	---	---	PASS
ALDH9A1	223	broad.mit.edu	37	1	165649774	165649774	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:165649774G>A	uc001gdh.1	-	5	844	c.739C>T	c.(739-741)CCC>TCC	p.P247S	ALDH9A1_uc010pky.1_Missense_Mutation_p.P153S|ALDH9A1_uc010pkz.1_Missense_Mutation_p.P237S|ALDH9A1_uc010pla.1_Missense_Mutation_p.P153S	NM_000696	NP_000687	P49189	AL9A1_HUMAN	aldehyde dehydrogenase 9A1	223					carnitine biosynthetic process|cellular aldehyde metabolic process|hormone metabolic process|neurotransmitter biosynthetic process	cytosol|plasma membrane	3-chloroallyl aldehyde dehydrogenase activity|4-trimethylammoniobutyraldehyde dehydrogenase activity|aldehyde dehydrogenase (NAD) activity|aminobutyraldehyde dehydrogenase activity				0	all_hematologic(923;0.0773)|Acute lymphoblastic leukemia(8;0.155)				NADH(DB00157)	GCCACATCGGGATGCTGACAC	0.532													39	186	---	---	---	---	PASS
TBX19	9095	broad.mit.edu	37	1	168278089	168278089	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:168278089C>G	uc001gfl.2	+	7	1077	c.1026C>G	c.(1024-1026)ACC>ACG	p.T342T	TBX19_uc001gfj.3_Silent_p.T210T|TBX19_uc001gfm.2_Silent_p.T45T	NM_005149	NP_005140	O60806	TBX19_HUMAN	T-box 19	342					anatomical structure morphogenesis	nucleus	DNA binding				0	all_hematologic(923;0.215)					TACCCCACACCAACGGACCAA	0.507													11	156	---	---	---	---	PASS
SCYL3	57147	broad.mit.edu	37	1	169847899	169847899	+	Missense_Mutation	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169847899T>A	uc001ggs.2	-	3	425	c.227A>T	c.(226-228)GAT>GTT	p.D76V	SCYL3_uc001ggt.2_Missense_Mutation_p.D76V|SCYL3_uc001ggu.2_RNA	NM_181093	NP_851607	Q8IZE3	PACE1_HUMAN	SCY1-like 3 isoform 2	76	Protein kinase.				cell migration	Golgi apparatus|lamellipodium	ATP binding|protein binding|protein kinase activity			ovary(1)|skin(1)	2	all_hematologic(923;0.0922)|Acute lymphoblastic leukemia(37;0.181)					ATGAATGCCATCCGCTTCCAC	0.443													54	193	---	---	---	---	PASS
TOR1AIP2	163590	broad.mit.edu	37	1	179834235	179834235	+	Intron	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:179834235T>A	uc001gnk.2	-						TOR1AIP2_uc001gnl.2_Intron|TOR1AIP2_uc001gnn.2_Missense_Mutation_p.Y26F|TOR1AIP2_uc001gnm.2_Missense_Mutation_p.Y26F	NM_145034	NP_659471	Q8NFQ8	TOIP2_HUMAN	torsin A interacting protein 2							endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(1)	1						TTCAGTTTGGTACAACCAGTG	0.393													10	171	---	---	---	---	PASS
PRG4	10216	broad.mit.edu	37	1	186273374	186273374	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186273374G>C	uc001gru.3	+	5	505	c.454G>C	c.(454-456)GAG>CAG	p.E152Q	PRG4_uc001grt.3_Missense_Mutation_p.E111Q|PRG4_uc009wyl.2_Intron|PRG4_uc009wym.2_Intron|PRG4_uc010poo.1_RNA	NM_005807	NP_005798	Q92954	PRG4_HUMAN	proteoglycan 4 isoform A	152					cell proliferation|immune response	extracellular region	polysaccharide binding|protein binding|scavenger receptor activity			skin(1)	1						TATAGAATCAGAGGAAATAAC	0.398													6	73	---	---	---	---	PASS
CFHR3	10878	broad.mit.edu	37	1	196749062	196749062	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:196749062C>T	uc001gtl.2	+	3	476	c.389C>T	c.(388-390)ACG>ATG	p.T130M	CFHR3_uc001gtk.2_Missense_Mutation_p.T130M|CFHR3_uc010poy.1_Missense_Mutation_p.T130M|CFHR1_uc001gtm.2_Intron	NM_021023	NP_066303	Q02985	FHR3_HUMAN	complement factor H-related 3 precursor	130	Sushi 2.					extracellular space					0						GTTACATGTACGGAGAAAGGC	0.473													4	74	---	---	---	---	PASS
RNPEP	6051	broad.mit.edu	37	1	201972454	201972454	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201972454G>A	uc001gxd.2	+	9	1545	c.1516G>A	c.(1516-1518)GAA>AAA	p.E506K	RNPEP_uc001gxe.2_Missense_Mutation_p.E207K|RNPEP_uc001gxf.2_Missense_Mutation_p.E375K	NM_020216	NP_064601	Q9H4A4	AMPB_HUMAN	arginyl aminopeptidase	506					leukotriene biosynthetic process		epoxide hydrolase activity|zinc ion binding			upper_aerodigestive_tract(1)	1				KIRC - Kidney renal clear cell carcinoma(1967;3.23e-08)|Colorectal(1306;0.005)		GAAGCCTGCTGAAGAGCTAGC	0.582													14	16	---	---	---	---	PASS
ELF3	1999	broad.mit.edu	37	1	201981201	201981201	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:201981201C>G	uc001gxg.3	+	2	3472	c.280C>G	c.(280-282)CGA>GGA	p.R94G	ELF3_uc001gxi.3_Missense_Mutation_p.R94G|ELF3_uc001gxh.3_Missense_Mutation_p.R94G	NM_004433	NP_004424	P78545	ELF3_HUMAN	E74-like factor 3 (ets domain transcription	94	PNT.				epidermis development|epithelial cell differentiation|inflammatory response|mammary gland involution|negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	Golgi apparatus|nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity				0						TGACTTCTCACGATGTGACAT	0.582													7	83	---	---	---	---	PASS
PTPN14	5784	broad.mit.edu	37	1	214656740	214656740	+	Intron	SNP	A	G	G	rs78564084		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:214656740A>G	uc001hkk.1	-						PTPN14_uc010pty.1_Intron|uc010ptz.1_RNA	NM_005401	NP_005392	Q15678	PTN14_HUMAN	protein tyrosine phosphatase, non-receptor type						lymphangiogenesis	cytoplasm|cytoskeleton	protein tyrosine phosphatase activity|receptor tyrosine kinase binding			breast(2)|ovary(1)|kidney(1)|skin(1)	5				OV - Ovarian serous cystadenocarcinoma(81;0.00181)|all cancers(67;0.00194)|Epithelial(68;0.0157)|GBM - Glioblastoma multiforme(131;0.155)		TGGCTGTGCCAGGCCGACCGG	0.607													8	16	---	---	---	---	PASS
USH2A	7399	broad.mit.edu	37	1	215812566	215812566	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:215812566C>G	uc001hku.1	-	69	15370	c.14983G>C	c.(14983-14985)GTC>CTC	p.V4995L		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	4995	Fibronectin type-III 35.|Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)		GTGCAGATGACCTGGAAAAAG	0.403										HNSCC(13;0.011)			6	144	---	---	---	---	PASS
DISP1	84976	broad.mit.edu	37	1	223177617	223177617	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223177617G>C	uc001hnu.1	+	8	3025	c.2878G>C	c.(2878-2880)GAA>CAA	p.E960Q		NM_032890	NP_116279	Q96F81	DISP1_HUMAN	dispatched A	960					diaphragm development|protein homotrimerization|regulation of protein secretion|smoothened signaling pathway	basolateral plasma membrane|integral to membrane	hedgehog receptor activity|peptide transporter activity				0				GBM - Glioblastoma multiforme(131;0.102)		TTCGGCCCCTGAAGGCCTCAG	0.507													3	47	---	---	---	---	PASS
TLR5	7100	broad.mit.edu	37	1	223285979	223285979	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223285979G>C	uc001hnv.1	-	4	841	c.395C>G	c.(394-396)TCT>TGT	p.S132C	TLR5_uc001hnw.1_Missense_Mutation_p.S132C	NM_003268	NP_003259	O60602	TLR5_HUMAN	toll-like receptor 5 precursor	132	Extracellular (Potential).				cellular response to mechanical stimulus|inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway|positive regulation of interleukin-8 production|positive regulation of toll-like receptor signaling pathway	integral to membrane|plasma membrane	interleukin-1 receptor binding|transmembrane receptor activity			ovary(2)|lung(1)|skin(1)	4				GBM - Glioblastoma multiforme(131;0.0851)		TACAGCATCAGAGAGACCACA	0.383													7	91	---	---	---	---	PASS
SLC35F3	148641	broad.mit.edu	37	1	234367379	234367379	+	Missense_Mutation	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:234367379T>C	uc001hwa.1	+	2	521	c.293T>C	c.(292-294)TTC>TCC	p.F98S	SLC35F3_uc001hvy.1_Missense_Mutation_p.F167S	NM_173508	NP_775779	Q8IY50	S35F3_HUMAN	solute carrier family 35, member F3	98	Helical; (Potential).				transport	integral to membrane				ovary(2)	2	Ovarian(103;0.0454)	all_cancers(173;0.145)|Prostate(94;0.0885)	OV - Ovarian serous cystadenocarcinoma(106;0.00531)			GACGCGCCCTTCACCCTCACG	0.587													17	134	---	---	---	---	PASS
CNST	163882	broad.mit.edu	37	1	246754982	246754982	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:246754982G>C	uc001ibp.2	+	2	496	c.118G>C	c.(118-120)GAA>CAA	p.E40Q	CNST_uc001ibo.3_Missense_Mutation_p.E40Q	NM_152609	NP_689822	Q6PJW8	CNST_HUMAN	hypothetical protein LOC163882 isoform 1	40					positive regulation of Golgi to plasma membrane protein transport	integral to membrane|plasma membrane|protein complex|trans-Golgi network|transport vesicle	connexin binding				0						AGATGAAAATGAAAATCAGCT	0.478													7	77	---	---	---	---	PASS
CNST	163882	broad.mit.edu	37	1	246829073	246829073	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:246829073G>A	uc001ibp.2	+	11	2422	c.2044G>A	c.(2044-2046)GGA>AGA	p.G682R		NM_152609	NP_689822	Q6PJW8	CNST_HUMAN	hypothetical protein LOC163882 isoform 1	682	Helical; (Potential).				positive regulation of Golgi to plasma membrane protein transport	integral to membrane|plasma membrane|protein complex|trans-Golgi network|transport vesicle	connexin binding				0						CAGTGTTGGAGGAACTGCATT	0.443													5	100	---	---	---	---	PASS
OR11L1	391189	broad.mit.edu	37	1	248004359	248004359	+	Silent	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248004359C>A	uc001idn.1	-	1	840	c.840G>T	c.(838-840)GTG>GTT	p.V280V		NM_001001959	NP_001001959	Q8NGX0	O11L1_HUMAN	olfactory receptor, family 11, subfamily L,	280	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3	all_cancers(71;8.78e-05)|all_epithelial(71;9.15e-06)|Breast(184;0.0117)|Ovarian(71;0.0377)|all_lung(81;0.0786)|Lung NSC(105;0.0858)		OV - Ovarian serous cystadenocarcinoma(106;0.0319)			GTGGTGTGACCACAGTGTAGA	0.443													23	65	---	---	---	---	PASS
TPO	7173	broad.mit.edu	37	2	1480894	1480894	+	Missense_Mutation	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1480894T>A	uc002qww.2	+	8	947	c.856T>A	c.(856-858)TGT>AGT	p.C286S	TPO_uc010ewj.2_Intron|TPO_uc002qwu.2_Missense_Mutation_p.C286S|TPO_uc002qwr.2_Missense_Mutation_p.C286S|TPO_uc002qwx.2_Missense_Mutation_p.C286S|TPO_uc010yio.1_Intron|TPO_uc010yip.1_Missense_Mutation_p.C286S	NM_000547	NP_000538	P07202	PERT_HUMAN	thyroid peroxidase isoform a	286	Extracellular (Potential).				cellular nitrogen compound metabolic process|hormone biosynthetic process|hydrogen peroxide catabolic process	cell surface|cytoplasm|integral to plasma membrane	calcium ion binding|heme binding|iodide peroxidase activity			ovary(7)|pancreas(6)|skin(5)|lung(1)|kidney(1)	20	all_hematologic(175;0.0487)|Acute lymphoblastic leukemia(172;0.0627)	all_cancers(51;0.0338)		all cancers(51;0.0356)|OV - Ovarian serous cystadenocarcinoma(76;0.0748)|Epithelial(75;0.12)	Carbimazole(DB00389)|Methimazole(DB00763)|Propylthiouracil(DB00550)	GGGCACCGCCTGTCTGCCCTT	0.692													4	7	---	---	---	---	PASS
LPIN1	23175	broad.mit.edu	37	2	11944642	11944642	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:11944642C>G	uc010yjn.1	+	16	2273	c.1999C>G	c.(1999-2001)CTG>GTG	p.L667V	LPIN1_uc010yjm.1_Missense_Mutation_p.L752V|LPIN1_uc002rbt.2_Missense_Mutation_p.L667V|LPIN1_uc010yjo.1_Missense_Mutation_p.L168V	NM_145693	NP_663731	Q14693	LPIN1_HUMAN	lipin 1	667	C-LIP.				fatty acid catabolic process|transcription, DNA-dependent|triglyceride biosynthetic process|triglyceride mobilization	cytosol|endoplasmic reticulum membrane	phosphatidate phosphatase activity			ovary(2)|large_intestine(1)|skin(1)	4	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.11)|OV - Ovarian serous cystadenocarcinoma(76;0.173)		CACCATCTATCTGTGGAACTG	0.478													11	103	---	---	---	---	PASS
NCOA1	8648	broad.mit.edu	37	2	24929441	24929441	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:24929441C>T	uc002rfk.2	+	11	1360	c.1102C>T	c.(1102-1104)CAC>TAC	p.H368Y	NCOA1_uc010eye.2_Missense_Mutation_p.H368Y|NCOA1_uc002rfi.2_Missense_Mutation_p.H217Y|NCOA1_uc002rfj.2_Missense_Mutation_p.H368Y|NCOA1_uc002rfl.2_Missense_Mutation_p.H368Y	NM_003743	NP_003734	Q15788	NCOA1_HUMAN	nuclear receptor coactivator 1 isoform 1	368	Interaction with STAT3.								PAX3/NCOA1(8)	soft_tissue(8)|ovary(1)|lung(1)|skin(1)	11	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					CCCTAGGGAGCACAGTGGGCT	0.378			T	PAX3	alveolar rhadomyosarcoma								4	63	---	---	---	---	PASS
KCNK3	3777	broad.mit.edu	37	2	26950989	26950989	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:26950989C>T	uc002rhn.2	+	2	901	c.738C>T	c.(736-738)TTC>TTT	p.F246F		NM_002246	NP_002237	O14649	KCNK3_HUMAN	potassium channel, subfamily K, member 3	246	Cytoplasmic (Potential).				synaptic transmission	integral to plasma membrane				ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					TGCTGCGCTTCATGACCATGA	0.697													6	4	---	---	---	---	PASS
C2orf63	130162	broad.mit.edu	37	2	55407837	55407837	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:55407837G>C	uc002ryi.2	-	11	1539	c.1193C>G	c.(1192-1194)TCT>TGT	p.S398C	C2orf63_uc002ryh.2_5'UTR|C2orf63_uc002ryj.2_Missense_Mutation_p.S276C	NM_152385	NP_689598	Q8NHS4	CB063_HUMAN	hypothetical protein LOC130162 isoform 1	398							binding			ovary(2)|central_nervous_system(1)	3			LUSC - Lung squamous cell carcinoma(58;0.179)|Lung(47;0.189)			AGCCTCCTCAGAAAATGTCAG	0.418													15	73	---	---	---	---	PASS
ALMS1	7840	broad.mit.edu	37	2	73677492	73677492	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73677492G>A	uc002sje.1	+	10	3952	c.3841G>A	c.(3841-3843)GCT>ACT	p.A1281T	ALMS1_uc002sjf.1_Missense_Mutation_p.A1237T|ALMS1_uc002sjg.2_Missense_Mutation_p.A667T|ALMS1_uc002sjh.1_Missense_Mutation_p.A667T	NM_015120	NP_055935	Q8TCU4	ALMS1_HUMAN	Alstrom syndrome 1	1279	16.|34 X 47 AA approximate tandem repeat.				G2/M transition of mitotic cell cycle	centrosome|cilium|cytosol|microtubule basal body|spindle pole				skin(3)|ovary(2)|breast(2)|pancreas(1)|lung(1)	9						TGGCACACCAGCTGTAACCTC	0.433													4	141	---	---	---	---	PASS
CCDC142	84865	broad.mit.edu	37	2	74709901	74709901	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74709901G>C	uc002slr.2	-	1	457	c.64C>G	c.(64-66)CAA>GAA	p.Q22E	TTC31_uc002sls.2_5'Flank|TTC31_uc010yrv.1_5'Flank|TTC31_uc002slt.2_5'Flank|TTC31_uc002slu.2_5'Flank|CCDC142_uc002slo.2_RNA|CCDC142_uc002slq.2_Missense_Mutation_p.Q22E|CCDC142_uc002slp.2_Missense_Mutation_p.Q22E	NM_032779	NP_116168	Q17RM4	CC142_HUMAN	coiled-coil domain containing 142	22										central_nervous_system(1)	1						CCCCCGGGTTGCGCCCTCAGC	0.672													7	63	---	---	---	---	PASS
C2orf89	129293	broad.mit.edu	37	2	85097589	85097589	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:85097589G>A	uc010ysl.1	-	2	518	c.429C>T	c.(427-429)CGC>CGT	p.R143R	C2orf89_uc002sou.3_Silent_p.R143R|C2orf89_uc010fgc.1_Silent_p.R143R	NM_001080824	NP_001074293	Q86V40	CB089_HUMAN	hypothetical protein LOC129293 precursor	143	Extracellular (Potential).					integral to membrane				ovary(1)	1						GCCCCTTGCCGCGCTGGTCTG	0.582													27	49	---	---	---	---	PASS
C2orf89	129293	broad.mit.edu	37	2	85097649	85097649	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:85097649G>A	uc010ysl.1	-	2	458	c.369C>T	c.(367-369)CTC>CTT	p.L123L	C2orf89_uc002sou.3_Silent_p.L123L|C2orf89_uc010fgc.1_Silent_p.L123L	NM_001080824	NP_001074293	Q86V40	CB089_HUMAN	hypothetical protein LOC129293 precursor	123	Extracellular (Potential).					integral to membrane				ovary(1)	1						GGTGGCGCTTGAGGCGGCAGT	0.572													17	26	---	---	---	---	PASS
MRPL35	51318	broad.mit.edu	37	2	86437695	86437695	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:86437695C>T	uc002srg.3	+	4	529	c.471C>T	c.(469-471)CTC>CTT	p.L157L	MRPL35_uc002srf.3_Silent_p.L157L	NM_016622	NP_057706	Q9NZE8	RM35_HUMAN	mitochondrial ribosomal protein L35 isoform a	157					translation	mitochondrial ribosome	structural constituent of ribosome				0						AGAGTAAACTCTTAGATAAAA	0.388													10	104	---	---	---	---	PASS
SLC9A2	6549	broad.mit.edu	37	2	103318920	103318920	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:103318920C>G	uc002tca.2	+	9	1946	c.1804C>G	c.(1804-1806)CGA>GGA	p.R602G		NM_003048	NP_003039	Q9UBY0	SL9A2_HUMAN	solute carrier family 9 (sodium/hydrogen	602	Cytoplasmic (Potential).					integral to membrane|plasma membrane	sodium:hydrogen antiporter activity			central_nervous_system(3)|skin(3)|breast(2)	8						TGATGAAATTCGAGAACTCTT	0.328													6	97	---	---	---	---	PASS
CHCHD5	84269	broad.mit.edu	37	2	113343831	113343831	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:113343831G>C	uc002thz.1	+	3	387	c.198G>C	c.(196-198)GAG>GAC	p.E66D	CHCHD5_uc002tia.2_Missense_Mutation_p.E66D	NM_032309	NP_115685	Q9BSY4	CHCH5_HUMAN	coiled-coil-helix-coiled-coil-helix domain	66	CHCH.										0						AGGCCTTCGAGGAGTGTCTTC	0.632													3	42	---	---	---	---	PASS
LIMS2	55679	broad.mit.edu	37	2	128412051	128412051	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128412051G>A	uc002tpa.2	-	4	472	c.306C>T	c.(304-306)TGC>TGT	p.C102C	LIMS2_uc002tox.2_Silent_p.C126C|LIMS2_uc010fmb.2_Silent_p.C12C|LIMS2_uc002toy.2_Silent_p.C97C|LIMS2_uc010yzm.1_Silent_p.C124C|LIMS2_uc002toz.2_Silent_p.C97C|LIMS2_uc002tpb.2_Silent_p.C97C	NM_001161403	NP_001154875	Q7Z4I7	LIMS2_HUMAN	LIM and senescent cell antigen-like domains 2	102	LIM zinc-binding 2.				cell junction assembly	cytosol|focal adhesion|nucleus	zinc ion binding				0	Colorectal(110;0.1)			BRCA - Breast invasive adenocarcinoma(221;0.0681)		CACACAGCTCGCAGCGGAAGC	0.617													33	73	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141128375	141128375	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141128375G>A	uc002tvj.1	-	71	11884	c.10912C>T	c.(10912-10914)CGG>TGG	p.R3638W		NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	3638	Extracellular (Potential).|LDL-receptor class A 29.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		TTTTTGCACCGAAACTGATCT	0.383										TSP Lung(27;0.18)			4	139	---	---	---	---	PASS
LY75	4065	broad.mit.edu	37	2	160738705	160738705	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:160738705G>C	uc002ubc.3	-	7	1245	c.1176C>G	c.(1174-1176)TTC>TTG	p.F392L	LY75_uc002ubb.3_Missense_Mutation_p.F392L|LY75_uc010fos.2_Missense_Mutation_p.F392L|LY75_uc010fot.1_Missense_Mutation_p.F392L	NM_002349	NP_002340	O60449	LY75_HUMAN	lymphocyte antigen 75 precursor	392	C-type lectin 2.|Extracellular (Potential).				endocytosis|immune response|inflammatory response	integral to plasma membrane	receptor activity|sugar binding				0				COAD - Colon adenocarcinoma(177;0.132)		GGTCACTACTGAAGGCTTTGC	0.423													15	121	---	---	---	---	PASS
GAD1	2571	broad.mit.edu	37	2	171709254	171709254	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:171709254G>C	uc002ugi.2	+	13	1637	c.1215G>C	c.(1213-1215)AAG>AAC	p.K405N	GAD1_uc010fqc.2_Missense_Mutation_p.K24N	NM_000817	NP_000808	Q99259	DCE1_HUMAN	glutamate decarboxylase 1 isoform GAD67	405					glutamate decarboxylation to succinate|neurotransmitter biosynthetic process|neurotransmitter secretion|protein-pyridoxal-5-phosphate linkage	clathrin sculpted gamma-aminobutyric acid transport vesicle membrane|plasma membrane	glutamate decarboxylase activity|protein binding|pyridoxal phosphate binding			ovary(1)	1					L-Glutamic Acid(DB00142)|Pyridoxal Phosphate(DB00114)	ACCCTCACAAGATGATGGGCG	0.507													5	28	---	---	---	---	PASS
SP3	6670	broad.mit.edu	37	2	174819648	174819648	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:174819648G>A	uc002uig.2	-	4	1756	c.1592C>T	c.(1591-1593)TCT>TTT	p.S531F	SP3_uc002uie.2_Missense_Mutation_p.S463F|SP3_uc002uif.2_Missense_Mutation_p.S478F|SP3_uc010zel.1_Missense_Mutation_p.S528F	NM_003111	NP_003102	Q02447	SP3_HUMAN	Sp3 transcription factor isoform 1	531					negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	PML body	protein binding|zinc ion binding		EWSR1/SP3(3)	soft_tissue(3)|upper_aerodigestive_tract(1)|ovary(1)|skin(1)	6			OV - Ovarian serous cystadenocarcinoma(117;0.185)			TATACCAGCAGAATCTATAGA	0.433													5	122	---	---	---	---	PASS
GPR155	151556	broad.mit.edu	37	2	175311382	175311382	+	Missense_Mutation	SNP	C	T	T	rs111563303		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:175311382C>T	uc002uit.2	-	13	2361	c.1970G>A	c.(1969-1971)CGA>CAA	p.R657Q	GPR155_uc002uiu.2_Missense_Mutation_p.R657Q|GPR155_uc002uiv.2_Missense_Mutation_p.R657Q|GPR155_uc010fqs.2_Missense_Mutation_p.R629Q	NM_001033045	NP_001028217	Q7Z3F1	GP155_HUMAN	G protein-coupled receptor 155 isoform 9	657					intracellular signal transduction|transmembrane transport	integral to membrane				ovary(1)	1						CAACACATGTCGGGTCAGTTG	0.423													8	125	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179474576	179474576	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179474576C>T	uc010zfg.1	-	221	44094	c.43870G>A	c.(43870-43872)GAA>AAA	p.E14624K	uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.E8319K|TTN_uc010zfi.1_Missense_Mutation_p.E8252K|TTN_uc010zfj.1_Missense_Mutation_p.E8127K	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	15551							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			TTCCACCTTTCTTCACCCTTA	0.463													50	486	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179629030	179629030	+	Splice_Site	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179629030C>G	uc010zfg.1	-	43	10213	c.9989_splice	c.e43-1	p.V3330_splice	TTN_uc010zfh.1_Splice_Site_p.V3284_splice|TTN_uc010zfi.1_Splice_Site_p.V3284_splice|TTN_uc010zfj.1_Splice_Site_p.V3284_splice|TTN_uc002umz.1_Splice_Site|TTN_uc002unb.2_Splice_Site_p.V3330_splice	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A								ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			ACTTCTGGAACTAAAGAAAGA	0.458													4	41	---	---	---	---	PASS
ORMDL1	94101	broad.mit.edu	37	2	190636562	190636562	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:190636562G>C	uc002urb.3	-	3	1180	c.393C>G	c.(391-393)CTC>CTG	p.L131L	ORMDL1_uc002urc.3_Silent_p.L131L|ORMDL1_uc002urd.3_Silent_p.L131L|ORMDL1_uc002ure.3_Silent_p.L131L	NM_016467	NP_057551	Q9P0S3	ORML1_HUMAN	ORM1-like 1	131					ceramide metabolic process	endoplasmic reticulum membrane|integral to membrane					0			OV - Ovarian serous cystadenocarcinoma(117;0.00177)|Epithelial(96;0.0317)|all cancers(119;0.0889)			GTACACTCAGGAGAGAAGCTG	0.313													13	88	---	---	---	---	PASS
SGOL2	151246	broad.mit.edu	37	2	201436243	201436243	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:201436243G>C	uc002uvw.2	+	7	1287	c.1174G>C	c.(1174-1176)GAA>CAA	p.E392Q	SGOL2_uc010zhd.1_Missense_Mutation_p.E392Q|SGOL2_uc010zhe.1_Missense_Mutation_p.E392Q	NM_152524	NP_689737	Q562F6	SGOL2_HUMAN	shugoshin-like 2 isoform 1	392					cell division|mitotic prometaphase	condensed chromosome kinetochore|cytosol|mitotic cohesin complex	protein binding			ovary(2)|skin(2)	4						AAAAACAAATGAACATGGAAT	0.318													8	46	---	---	---	---	PASS
BMPR2	659	broad.mit.edu	37	2	203420419	203420419	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:203420419C>G	uc002uzf.3	+	12	3179	c.2031C>G	c.(2029-2031)CTC>CTG	p.L677L	BMPR2_uc010ftr.2_Intron	NM_001204	NP_001195	Q13873	BMPR2_HUMAN	bone morphogenetic protein receptor type II	677	Cytoplasmic (Potential).				anterior/posterior pattern formation|BMP signaling pathway|cellular response to starvation|lung alveolus development|mesoderm formation|negative regulation of cell growth|negative regulation of systemic arterial blood pressure|negative regulation of vasoconstriction|positive regulation of BMP signaling pathway|positive regulation of bone mineralization|positive regulation of endothelial cell migration|positive regulation of endothelial cell proliferation|positive regulation of epithelial cell migration|positive regulation of osteoblast differentiation|positive regulation of pathway-restricted SMAD protein phosphorylation|regulation of lung blood pressure|transcription from RNA polymerase II promoter|vascular endothelial growth factor receptor signaling pathway	integral to plasma membrane	ATP binding|metal ion binding|transforming growth factor beta receptor activity			ovary(4)|breast(2)|large_intestine(1)|stomach(1)|pancreas(1)	9						ATAAGAACCTCAAGGAAAGCT	0.463													10	68	---	---	---	---	PASS
ICA1L	130026	broad.mit.edu	37	2	203650667	203650667	+	Nonsense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:203650667G>C	uc002uzh.1	-	13	1471	c.1307C>G	c.(1306-1308)TCA>TGA	p.S436*	ICA1L_uc002uzi.1_Nonsense_Mutation_p.S436*	NM_138468	NP_612477	Q8NDH6	ICA1L_HUMAN	islet cell autoantigen 1,69kDa-like isoform 1	436											0						TGGACTCTGTGAAGGCACTGG	0.323													14	74	---	---	---	---	PASS
CPS1	1373	broad.mit.edu	37	2	211481249	211481249	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:211481249C>G	uc002vee.3	+	21	2803	c.2671C>G	c.(2671-2673)CTG>GTG	p.L891V	CPS1_uc010fur.2_Missense_Mutation_p.L897V|CPS1_uc010fus.2_Missense_Mutation_p.L440V|LOC29034_uc002vef.2_5'Flank	NM_001875	NP_001866	P31327	CPSM_HUMAN	carbamoyl-phosphate synthetase 1 isoform b	891					carbamoyl phosphate biosynthetic process|citrulline biosynthetic process|glutamine metabolic process|glycogen catabolic process|nitric oxide metabolic process|positive regulation of vasodilation|response to lipopolysaccharide|triglyceride catabolic process|urea cycle	mitochondrial nucleoid	ATP binding|carbamoyl-phosphate synthase (ammonia) activity			ovary(8)|central_nervous_system(3)|breast(1)|skin(1)	13				Epithelial(149;0.00697)|Lung(261;0.0521)|LUSC - Lung squamous cell carcinoma(261;0.0544)|all cancers(144;0.0843)		GGAAAAGACACTGAAAGGCCT	0.398													4	107	---	---	---	---	PASS
ERBB4	2066	broad.mit.edu	37	2	212530179	212530179	+	Nonsense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:212530179G>T	uc002veg.1	-	15	1838	c.1740C>A	c.(1738-1740)TGC>TGA	p.C580*	ERBB4_uc002veh.1_Nonsense_Mutation_p.C580*|ERBB4_uc010zji.1_Nonsense_Mutation_p.C580*|ERBB4_uc010zjj.1_Nonsense_Mutation_p.C580*|ERBB4_uc010fut.1_Nonsense_Mutation_p.C580*	NM_005235	NP_005226	Q15303	ERBB4_HUMAN	v-erb-a erythroblastic leukemia viral oncogene	580	Extracellular (Potential).|Cys-rich.				cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent|transmembrane receptor protein tyrosine kinase signaling pathway	basolateral plasma membrane|cytoplasm|integral to membrane|nucleus	ATP binding|protein binding|receptor signaling protein tyrosine kinase activity|transmembrane receptor protein tyrosine kinase activity			lung(21)|skin(5)|stomach(2)|breast(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	33		Renal(323;0.06)|Lung NSC(271;0.197)		UCEC - Uterine corpus endometrioid carcinoma (47;0.214)|Epithelial(149;5.86e-06)|all cancers(144;2.95e-05)|Lung(261;0.00244)|LUSC - Lung squamous cell carcinoma(224;0.00266)		TAAAATGAGAGCACTTTGTAC	0.393										TSP Lung(8;0.080)			7	59	---	---	---	---	PASS
WDR69	164781	broad.mit.edu	37	2	228754637	228754637	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:228754637C>T	uc002vpn.1	+	3	258	c.179C>T	c.(178-180)ACA>ATA	p.T60I	WDR69_uc010zlw.1_Missense_Mutation_p.T45I|WDR69_uc002vpo.1_RNA	NM_178821	NP_849143	Q8N136	WDR69_HUMAN	WD repeat domain 69	60										breast(1)	1		Renal(207;0.025)|all_hematologic(139;0.15)|all_lung(227;0.204)|Acute lymphoblastic leukemia(138;0.205)|Esophageal squamous(248;0.23)		Epithelial(121;1.22e-10)|all cancers(144;8.11e-08)|Lung(261;0.011)|LUSC - Lung squamous cell carcinoma(224;0.0148)		GCTTCACGAACAGAGCAAGTC	0.383													14	56	---	---	---	---	PASS
DIS3L2	129563	broad.mit.edu	37	2	233075107	233075107	+	Missense_Mutation	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233075107T>A	uc010fxz.2	+	10	1472	c.1196T>A	c.(1195-1197)CTC>CAC	p.L399H	DIS3L2_uc002vsm.3_RNA|DIS3L2_uc002vso.2_RNA	NM_152383	NP_689596	Q8IYB7	DI3L2_HUMAN	DIS3 mitotic control homolog (S.	399							exonuclease activity|ribonuclease activity|RNA binding			ovary(1)|breast(1)|central_nervous_system(1)	3		all_hematologic(139;0.00809)|Renal(207;0.0113)|Acute lymphoblastic leukemia(138;0.0195)|all_lung(227;0.0465)|Lung NSC(271;0.136)		Epithelial(121;1.6e-13)|BRCA - Breast invasive adenocarcinoma(100;0.00104)|LUSC - Lung squamous cell carcinoma(224;0.0109)|Lung(119;0.0149)		TGCAAGCCACTCGCTGACGGT	0.512													3	31	---	---	---	---	PASS
GPR35	2859	broad.mit.edu	37	2	241569480	241569480	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:241569480C>G	uc002vzs.1	+	1	686	c.111C>G	c.(109-111)CTC>CTG	p.L37L	GPR35_uc010fzh.1_Silent_p.L68L|GPR35_uc010fzi.1_Silent_p.L68L	NM_005301	NP_005292	Q9HC97	GPR35_HUMAN	G protein-coupled receptor 35	37	Helical; Name=1; (Potential).					integral to plasma membrane	G-protein coupled receptor activity			skin(2)|pancreas(1)	3		all_epithelial(40;7.49e-12)|Breast(86;0.000148)|Renal(207;0.00571)|Ovarian(221;0.104)|all_neural(83;0.107)|all_hematologic(139;0.182)|all_lung(227;0.186)|Melanoma(123;0.238)		Epithelial(32;5.29e-32)|all cancers(36;1.38e-29)|OV - Ovarian serous cystadenocarcinoma(60;2.13e-15)|Kidney(56;3.04e-09)|KIRC - Kidney renal clear cell carcinoma(57;3.23e-08)|BRCA - Breast invasive adenocarcinoma(100;5.02e-06)|Lung(119;0.00163)|Colorectal(34;0.00463)|LUSC - Lung squamous cell carcinoma(224;0.008)|COAD - Colon adenocarcinoma(134;0.031)		GCCTGCTGCTCAACAGCCTGG	0.642													5	38	---	---	---	---	PASS
CRELD1	78987	broad.mit.edu	37	3	9979321	9979321	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:9979321G>A	uc003bug.2	+	4	451	c.333G>A	c.(331-333)CTG>CTA	p.L111L	CIDEC_uc003bto.2_Intron|CRELD1_uc003buf.2_Silent_p.L111L|CRELD1_uc003buh.2_Silent_p.L111L|CRELD1_uc003bui.2_Silent_p.L111L|CRELD1_uc003buj.2_RNA	NM_001077415	NP_001070883	Q96HD1	CREL1_HUMAN	cysteine-rich with EGF-like domains 1 isoform 3	111	Extracellular (Potential).				cardiac septum development|endocardial cushion development	integral to membrane	calcium ion binding			ovary(1)	1						TGCTGGAGCTGAGTGAGGAGC	0.602													3	10	---	---	---	---	PASS
VGLL4	9686	broad.mit.edu	37	3	11643348	11643348	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:11643348G>C	uc003bwf.2	-	3	579	c.213C>G	c.(211-213)AAC>AAG	p.N71K	VGLL4_uc010hdx.1_Missense_Mutation_p.N77K|VGLL4_uc003bwg.2_Missense_Mutation_p.N76K|VGLL4_uc011aun.1_Missense_Mutation_p.N12K	NM_014667	NP_055482	Q14135	VGLL4_HUMAN	vestigial like 4 isoform b	71					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(1)	1				LUSC - Lung squamous cell carcinoma(1;0.089)|Lung(1;0.111)		AGACGTGGTCGTTGTCACAGT	0.557													20	84	---	---	---	---	PASS
XPC	7508	broad.mit.edu	37	3	14212042	14212042	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:14212042G>T	uc011ave.1	-	3	412	c.308C>A	c.(307-309)CCA>CAA	p.P103Q	XPC_uc011avf.1_5'UTR|XPC_uc011avg.1_Missense_Mutation_p.P103Q	NM_004628	NP_004619	Q01831	XPC_HUMAN	xeroderma pigmentosum, complementation group C	103	Glu-rich (acidic).				nucleotide-excision repair, DNA damage recognition|nucleotide-excision repair, DNA damage removal	cytoplasm|nucleoplasm|XPC complex	bubble DNA binding|damaged DNA binding|loop DNA binding|protein binding|single-stranded DNA binding			ovary(2)|breast(1)	3						GAGGTCACTTGGAAAGTCCCT	0.423			Mis|N|F|S			skin basal cell|skin squamous cell|melanoma		NER	Xeroderma_Pigmentosum				11	178	---	---	---	---	PASS
C3orf35	339883	broad.mit.edu	37	3	37458815	37458815	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:37458815G>C	uc003cha.3	+	5	722	c.58G>C	c.(58-60)GAA>CAA	p.E20Q	C3orf35_uc003chb.2_Missense_Mutation_p.E20Q	NM_178339	NP_848029	Q8IVJ8	APRG1_HUMAN	AP20 region protein isoform B	20						integral to membrane				central_nervous_system(1)	1						CCCAGAATTTGAAAATGTGAT	0.398													7	116	---	---	---	---	PASS
NKTR	4820	broad.mit.edu	37	3	42679619	42679619	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:42679619C>T	uc003clo.2	+	13	2570	c.2423C>T	c.(2422-2424)TCT>TTT	p.S808F	NKTR_uc003clm.1_Missense_Mutation_p.S555F|NKTR_uc003clp.2_Missense_Mutation_p.S555F|NKTR_uc011azp.1_Intron|NKTR_uc003clq.1_Missense_Mutation_p.S698F|NKTR_uc003clr.1_Missense_Mutation_p.S555F|NKTR_uc003cls.2_Missense_Mutation_p.S508F	NM_005385	NP_005376	P30414	NKTR_HUMAN	natural killer-tumor recognition sequence	808	Arg/Ser-rich.				protein folding	membrane	cyclosporin A binding|peptidyl-prolyl cis-trans isomerase activity			ovary(2)|skin(1)	3				KIRC - Kidney renal clear cell carcinoma(284;0.24)		TTAGATTATTCTTCAGACAGT	0.408													17	78	---	---	---	---	PASS
KIF15	56992	broad.mit.edu	37	3	44846547	44846547	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:44846547G>C	uc003cnx.3	+	15	1865	c.1716G>C	c.(1714-1716)CAG>CAC	p.Q572H	KIF15_uc010hiq.2_Missense_Mutation_p.Q475H|KIF15_uc003cny.1_Missense_Mutation_p.Q207H	NM_020242	NP_064627	Q9NS87	KIF15_HUMAN	kinesin family member 15	572	Potential.				blood coagulation|cell proliferation|microtubule-based movement|mitosis	centrosome|cytosol|microtubule|plus-end kinesin complex|spindle	ATP binding|DNA binding|microtubule motor activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.0099)|KIRC - Kidney renal clear cell carcinoma(197;0.0564)|Kidney(197;0.0707)		CTAAAGCTCAGAAAGAGCCAT	0.274													15	59	---	---	---	---	PASS
STAB1	23166	broad.mit.edu	37	3	52556921	52556921	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52556921C>T	uc003dej.2	+	62	6949	c.6875C>T	c.(6874-6876)TCA>TTA	p.S2292L	STAB1_uc003dek.1_Missense_Mutation_p.S307L|STAB1_uc003del.2_Missense_Mutation_p.S179L	NM_015136	NP_055951	Q9NY15	STAB1_HUMAN	stabilin 1 precursor	2292	Extracellular (Potential).|Link.				cell adhesion|cell-cell signaling|defense response to bacterium|inflammatory response|negative regulation of angiogenesis|receptor-mediated endocytosis	integral to plasma membrane	bacterial cell surface binding|hyaluronic acid binding|low-density lipoprotein receptor activity|protein disulfide oxidoreductase activity|scavenger receptor activity			large_intestine(3)|upper_aerodigestive_tract(2)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	9				BRCA - Breast invasive adenocarcinoma(193;1.73e-05)|Kidney(197;0.00182)|KIRC - Kidney renal clear cell carcinoma(197;0.00205)|OV - Ovarian serous cystadenocarcinoma(275;0.0482)		AAGAACCTCTCAGAACGCTGG	0.617													4	46	---	---	---	---	PASS
PTPRG	5793	broad.mit.edu	37	3	62267314	62267314	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:62267314G>A	uc003dlb.2	+	27	4561	c.3842G>A	c.(3841-3843)AGC>AAC	p.S1281N	PTPRG_uc003dlc.2_Missense_Mutation_p.S1252N|PTPRG_uc011bfi.1_Missense_Mutation_p.S527N|uc010hno.2_Intron|uc003dld.3_Intron|uc010hnp.2_Intron|uc003dle.3_Intron	NM_002841	NP_002832	P23470	PTPRG_HUMAN	protein tyrosine phosphatase, receptor type, G	1281	Cytoplasmic (Potential).|Tyrosine-protein phosphatase 2.				transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	identical protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(5)|lung(2)	7				BRCA - Breast invasive adenocarcinoma(55;0.000376)|KIRC - Kidney renal clear cell carcinoma(10;0.0499)|Kidney(10;0.065)		ACCCTTATCAGCAAAGACAGA	0.403													4	93	---	---	---	---	PASS
ADAMTS9	56999	broad.mit.edu	37	3	64644236	64644236	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:64644236C>A	uc003dmg.2	-	4	943	c.911G>T	c.(910-912)AGA>ATA	p.R304I	ADAMTS9_uc011bfo.1_Missense_Mutation_p.R304I|ADAMTS9_uc003dmh.1_Missense_Mutation_p.R133I|ADAMTS9_uc003dmk.1_Missense_Mutation_p.R304I	NM_182920	NP_891550	Q9P2N4	ATS9_HUMAN	ADAM metallopeptidase with thrombospondin type 1	304	Peptidase M12B.				glycoprotein catabolic process|multicellular organismal development|proteolysis	proteinaceous extracellular matrix	metalloendopeptidase activity|zinc ion binding			ovary(2)|urinary_tract(1)|skin(1)	4		Lung NSC(201;0.00682)		BRCA - Breast invasive adenocarcinoma(55;0.00142)|Kidney(15;0.00202)|KIRC - Kidney renal clear cell carcinoma(15;0.00221)		TGAAACCATTCTGTTGTCTGC	0.368													24	572	---	---	---	---	PASS
LRIG1	26018	broad.mit.edu	37	3	66436782	66436782	+	Intron	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:66436782G>T	uc003dmx.2	-						SLC25A26_uc011bft.1_RNA|LRIG1_uc011bfu.1_Intron|LRIG1_uc003dmw.2_Intron|LRIG1_uc010hnz.2_Intron|LRIG1_uc010hoa.2_Intron	NM_015541	NP_056356	Q96JA1	LRIG1_HUMAN	leucine-rich repeats and immunoglobulin-like							integral to membrane				skin(3)|ovary(2)	5		Lung NSC(201;0.0101)		BRCA - Breast invasive adenocarcinoma(55;0.00047)		AGAGGAACCAGCTGCTGTTCA	0.537													15	216	---	---	---	---	PASS
ARL6IP5	10550	broad.mit.edu	37	3	69153637	69153637	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:69153637G>A	uc003dnr.2	+	3	526	c.417G>A	c.(415-417)TTG>TTA	p.L139L		NM_006407	NP_006398	O75915	PRAF3_HUMAN	ADP-ribosylation-like factor 6 interacting	139	Cytoplasmic (By similarity).|Targeting to endoplasmic reticulum membrane (By similarity).				L-glutamate transport	endoplasmic reticulum membrane|integral to membrane				ovary(1)	1		Lung NSC(201;0.0193)|Prostate(884;0.174)		BRCA - Breast invasive adenocarcinoma(55;7.78e-05)|Epithelial(33;0.000818)|LUSC - Lung squamous cell carcinoma(21;0.0118)|Lung(16;0.0189)|KIRC - Kidney renal clear cell carcinoma(39;0.203)|Kidney(39;0.238)		ATGCATCGTTGAGACTTCGGA	0.443													23	759	---	---	---	---	PASS
CNTN3	5067	broad.mit.edu	37	3	74313531	74313531	+	3'UTR	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:74313531A>T	uc003dpm.1	-	22						NM_020872	NP_065923	Q9P232	CNTN3_HUMAN	contactin 3 precursor						cell adhesion	anchored to membrane|plasma membrane	protein binding			breast(3)|ovary(1)|skin(1)	5		Lung NSC(201;0.138)|Lung SC(41;0.21)		Epithelial(33;0.00212)|BRCA - Breast invasive adenocarcinoma(55;0.00258)|LUSC - Lung squamous cell carcinoma(21;0.00461)|Lung(16;0.01)		CTTTCCAATAAATAATAAAAA	0.303													8	239	---	---	---	---	PASS
CEP97	79598	broad.mit.edu	37	3	101481386	101481386	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:101481386C>G	uc003dvk.1	+	10	1902	c.1875C>G	c.(1873-1875)TTC>TTG	p.F625L	CEP97_uc011bhf.1_Missense_Mutation_p.F566L|CEP97_uc003dvl.1_Missense_Mutation_p.F321L|CEP97_uc003dvm.1_Missense_Mutation_p.F463L	NM_024548	NP_078824	Q8IW35	CEP97_HUMAN	centrosomal protein 97kDa	625	CEP110 binding.					centrosome|nucleus	protein binding			ovary(2)	2						AAGAAGCTTTCAGATTCCTTT	0.328													17	123	---	---	---	---	PASS
CD200	4345	broad.mit.edu	37	3	112054854	112054854	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:112054854A>G	uc003dyw.2	+	2	221	c.77A>G	c.(76-78)AAT>AGT	p.N26S	CD200_uc010hqd.1_Intron|CD200_uc003dyx.2_Intron|CD200_uc003dyy.2_Intron|CD200_uc003dyz.2_Intron	NM_001004196	NP_001004196	P41217	OX2G_HUMAN	CD200 antigen isoform b	Error:Variant_position_missing_in_P41217_after_alignment					regulation of immune response	integral to plasma membrane					0		Acute lymphoblastic leukemia(4;1.7e-08)|all_hematologic(4;8.82e-05)				ACCACCATCAATGATTACCAG	0.338													33	68	---	---	---	---	PASS
C3orf1	51300	broad.mit.edu	37	3	119217621	119217621	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:119217621G>A	uc003ecn.2	+	1	254	c.41G>A	c.(40-42)AGA>AAA	p.R14K	C3orf1_uc003eco.2_RNA|C3orf1_uc003ecp.2_5'Flank	NM_016589	NP_057673	Q9NPL8	TIDC1_HUMAN	hypothetical protein LOC51300	14						integral to membrane|mitochondrial inner membrane	protein transporter activity				0				GBM - Glioblastoma multiforme(114;0.186)		TTTCTCTGTAGAGCATTGTGC	0.592													27	196	---	---	---	---	PASS
GOLGB1	2804	broad.mit.edu	37	3	121410632	121410632	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121410632G>C	uc003eei.3	-	14	7690	c.7564C>G	c.(7564-7566)CTC>GTC	p.L2522V	GOLGB1_uc010hrc.2_Missense_Mutation_p.L2527V|GOLGB1_uc003eej.3_Missense_Mutation_p.L2488V	NM_004487	NP_004478	Q14789	GOGB1_HUMAN	golgi autoantigen, golgin subfamily b,	2522	Cytoplasmic (Potential).|Potential.				Golgi organization	ER-Golgi intermediate compartment|Golgi membrane|Golgi stack|integral to membrane	protein binding			ovary(6)|breast(2)|skin(2)	10				GBM - Glioblastoma multiforme(114;0.0989)		TCAGAATTGAGATCATCCATA	0.393													9	357	---	---	---	---	PASS
MYLK	4638	broad.mit.edu	37	3	123452592	123452592	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:123452592C>G	uc003ego.2	-	10	1533	c.1251G>C	c.(1249-1251)GAG>GAC	p.E417D	MYLK_uc011bjw.1_Missense_Mutation_p.E417D|MYLK_uc003egp.2_Missense_Mutation_p.E417D|MYLK_uc003egq.2_Missense_Mutation_p.E417D|MYLK_uc003egr.2_Missense_Mutation_p.E417D|MYLK_uc003egs.2_Missense_Mutation_p.E241D	NM_053025	NP_444253	Q15746	MYLK_HUMAN	myosin light chain kinase isoform 1	417	Ig-like C2-type 3.				aorta smooth muscle tissue morphogenesis|muscle contraction	cytosol	actin binding|ATP binding|calmodulin binding|metal ion binding|myosin light chain kinase activity			ovary(6)|skin(2)|stomach(1)	9		Lung NSC(201;0.0496)		GBM - Glioblastoma multiforme(114;0.0736)		GGGGCTTGCTCTCAAATTTGG	0.517													12	143	---	---	---	---	PASS
KALRN	8997	broad.mit.edu	37	3	124413264	124413264	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124413264G>A	uc003ehg.2	+	53	7618	c.7491G>A	c.(7489-7491)CGG>CGA	p.R2497R	KALRN_uc003ehk.2_Silent_p.R800R	NM_001024660	NP_001019831	O60229	KALRN_HUMAN	kalirin, RhoGEF kinase isoform 1	2496	Ig-like C2-type.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|nervous system development|regulation of Rho protein signal transduction|small GTPase mediated signal transduction|vesicle-mediated transport	actin cytoskeleton|cytosol	ATP binding|GTPase activator activity|metal ion binding|protein binding|protein serine/threonine kinase activity|Rho guanyl-nucleotide exchange factor activity			large_intestine(2)|ovary(2)|central_nervous_system(1)|skin(1)	6						TCTGTGGGCGGCCAAAGCCCA	0.532													4	117	---	---	---	---	PASS
ZBTB38	253461	broad.mit.edu	37	3	141162247	141162247	+	Silent	SNP	T	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:141162247T>G	uc003etw.2	+	8	1999	c.1017T>G	c.(1015-1017)CCT>CCG	p.P339P	ZBTB38_uc010hun.2_Silent_p.P336P|ZBTB38_uc010huo.2_Silent_p.P339P|ZBTB38_uc003ety.2_Silent_p.P339P|ZBTB38_uc010hup.2_Silent_p.P340P	NM_001080412	NP_001073881	Q8NAP3	ZBT38_HUMAN	zinc finger and BTB domain containing 38	339					positive regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(3)	3						AGGTTCCACCTCTGGTGTACA	0.498													7	137	---	---	---	---	PASS
GMPS	8833	broad.mit.edu	37	3	155632331	155632331	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:155632331G>C	uc003faq.2	+	8	1345	c.1010G>C	c.(1009-1011)AGA>ACA	p.R337T	GMPS_uc011bom.1_Missense_Mutation_p.R238T	NM_003875	NP_003866	P49915	GUAA_HUMAN	guanine monophosphate synthetase	337					glutamine metabolic process|purine base biosynthetic process	cytosol	ATP binding|GMP synthase (glutamine-hydrolyzing) activity|GMP synthase activity			ovary(2)|lung(1)	3			Lung(72;0.11)|LUSC - Lung squamous cell carcinoma(72;0.114)		L-Glutamic Acid(DB00142)|L-Glutamine(DB00130)	GAAGAGAAAAGAAAAATCATT	0.328			T	MLL	AML								8	92	---	---	---	---	PASS
KCNAB1	7881	broad.mit.edu	37	3	156232888	156232888	+	Splice_Site	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:156232888G>T	uc003far.2	+	10	809	c.745_splice	c.e10-1	p.E249_splice	KCNAB1_uc011bon.1_Splice_Site_p.E220_splice|KCNAB1_uc003fas.2_Splice_Site_p.E238_splice|KCNAB1_uc003fat.2_Splice_Site_p.E231_splice|KCNAB1_uc010hvt.1_Splice_Site_p.E202_splice|KCNAB1_uc011boo.1_Splice_Site_p.E125_splice	NM_172160	NP_751892	Q14722	KCAB1_HUMAN	potassium voltage-gated channel, shaker-related							cytoplasm|integral to membrane	oxidoreductase activity|potassium channel regulator activity|voltage-gated potassium channel activity			ovary(3)|skin(1)	4			LUSC - Lung squamous cell carcinoma(72;0.0461)|Lung(72;0.0465)			TTCCTCCCTAGGAAGCCTATT	0.413													11	127	---	---	---	---	PASS
SKIL	6498	broad.mit.edu	37	3	170078501	170078501	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:170078501C>G	uc003fgu.2	+	2	1094	c.382C>G	c.(382-384)CAG>GAG	p.Q128E	SKIL_uc011bps.1_Missense_Mutation_p.Q108E|SKIL_uc003fgv.2_Missense_Mutation_p.Q128E|SKIL_uc003fgw.2_Missense_Mutation_p.Q128E	NM_005414	NP_005405	P12757	SKIL_HUMAN	SKI-like isoform 1	128					cell cycle arrest|negative regulation of cell differentiation|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transforming growth factor beta receptor signaling pathway|positive regulation of axonogenesis|protein heterotrimerization|protein homotrimerization|regulation of apoptosis|regulation of apoptosis|response to antibiotic|response to growth factor stimulus|skeletal muscle tissue development	cytoplasm|PML body	chromatin binding|nucleotide binding|protein complex binding|protein domain specific binding|SMAD binding|transcription corepressor activity|transcription repressor activity			ovary(2)|skin(1)	3	all_cancers(22;7.13e-23)|all_epithelial(15;9.95e-28)|all_lung(20;1.23e-16)|Lung NSC(18;5.15e-16)|Ovarian(172;0.000337)|Breast(254;0.137)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.197)			TCCATCACCTCAGGTTCTTCC	0.488													27	353	---	---	---	---	PASS
MCF2L2	23101	broad.mit.edu	37	3	183013209	183013209	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183013209C>G	uc003fli.1	-	13	1644	c.1554G>C	c.(1552-1554)AAG>AAC	p.K518N	MCF2L2_uc003flj.1_Missense_Mutation_p.K518N|MCF2L2_uc011bqr.1_RNA|uc003fln.1_Intron|uc003flo.2_5'Flank	NM_015078	NP_055893	Q86YR7	MF2L2_HUMAN	Rho family guanine-nucleotide exchange factor	518					regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			ovary(2)|large_intestine(2)|breast(1)	5	all_cancers(143;1.26e-12)|Ovarian(172;0.0355)		all cancers(12;3.35e-44)|Epithelial(37;6.48e-38)|LUSC - Lung squamous cell carcinoma(7;7.12e-25)|Lung(8;6.39e-23)|OV - Ovarian serous cystadenocarcinoma(80;6.75e-21)			TCACTTGCCTCTTGTGAAATA	0.458													4	99	---	---	---	---	PASS
MAGEF1	64110	broad.mit.edu	37	3	184429334	184429334	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184429334C>T	uc003fpa.2	-	1	503	c.276G>A	c.(274-276)AAG>AAA	p.K92K		NM_022149	NP_071432	Q9HAY2	MAGF1_HUMAN	melanoma antigen family F, 1	92	MAGE.									ovary(1)	1	all_cancers(143;4.61e-11)|Ovarian(172;0.0339)|Breast(254;0.247)		Epithelial(37;5.64e-35)|OV - Ovarian serous cystadenocarcinoma(80;2.56e-22)			GACTCTTCTTCTTGTCTTTCA	0.582													5	176	---	---	---	---	PASS
ATP13A5	344905	broad.mit.edu	37	3	193029620	193029620	+	Silent	SNP	G	A	A	rs112958471		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:193029620G>A	uc011bsq.1	-	20	2430	c.2430C>T	c.(2428-2430)AAC>AAT	p.N810N		NM_198505	NP_940907	Q4VNC0	AT135_HUMAN	ATPase type 13A5	810					ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			ovary(5)|skin(4)|large_intestine(2)	11	all_cancers(143;1.08e-08)|Ovarian(172;0.0386)		OV - Ovarian serous cystadenocarcinoma(49;5.56e-18)|LUSC - Lung squamous cell carcinoma(58;6.08e-06)|Lung(62;6.49e-06)	GBM - Glioblastoma multiforme(46;0.000307)		GAAGCAAGCTGTTGAAATGCT	0.423													13	79	---	---	---	---	PASS
ATP13A3	79572	broad.mit.edu	37	3	194176633	194176633	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194176633G>C	uc003fty.3	-	7	1021	c.619C>G	c.(619-621)CTA>GTA	p.L207V		NM_024524	NP_078800	Q9H7F0	AT133_HUMAN	ATPase type 13A3	207	Helical; (Potential).				ATP biosynthetic process|cation transport	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|metal ion binding			ovary(1)	1	all_cancers(143;6.01e-09)|Ovarian(172;0.0634)	Melanoma(1037;0.211)	OV - Ovarian serous cystadenocarcinoma(49;3.83e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;5.98e-05)		TCTTTAATTAGAAGCTTAAAA	0.274													7	197	---	---	---	---	PASS
WFS1	7466	broad.mit.edu	37	4	6303952	6303952	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:6303952C>A	uc003giy.2	+	8	2596	c.2430C>A	c.(2428-2430)TTC>TTA	p.F810L	WFS1_uc003gix.2_Missense_Mutation_p.F810L|WFS1_uc003giz.2_Missense_Mutation_p.F628L	NM_001145853	NP_001139325	O76024	WFS1_HUMAN	wolframin	810					endoplasmic reticulum calcium ion homeostasis|endoplasmic reticulum unfolded protein response|ER overload response|ER-associated protein catabolic process|glucose homeostasis|kidney development|negative regulation of neuron apoptosis|negative regulation of sequence-specific DNA binding transcription factor activity|polyubiquitinated misfolded protein transport|positive regulation of calcium ion transport|positive regulation of growth|positive regulation of protein ubiquitination|positive regulation of proteolysis|protein stabilization|renal water homeostasis|sensory perception of sound|visual perception	dendrite|integral to endoplasmic reticulum membrane	activating transcription factor binding|ATPase binding|transporter activity|ubiquitin protein ligase binding			central_nervous_system(2)	2				Colorectal(103;0.0512)		GCAGCGAGTTCAAGAGCGTGC	0.662													4	18	---	---	---	---	PASS
ADAMTS3	9508	broad.mit.edu	37	4	73169735	73169735	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73169735G>A	uc003hgk.1	-	17	2360	c.2323C>T	c.(2323-2325)CGG>TGG	p.R775W	ADAMTS3_uc003hgl.2_Missense_Mutation_p.R116W	NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	775	Spacer.				collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)			ATGAAGGTCCGCGACTTGGCT	0.393													92	161	---	---	---	---	PASS
AFF1	4299	broad.mit.edu	37	4	88012958	88012958	+	Missense_Mutation	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:88012958T>A	uc003hqj.3	+	6	1591	c.1184T>A	c.(1183-1185)GTC>GAC	p.V395D	AFF1_uc003hqh.1_Missense_Mutation_p.V401D|AFF1_uc011ccy.1_Missense_Mutation_p.V373D|AFF1_uc011ccz.1_Missense_Mutation_p.V402D|AFF1_uc003hqk.3_Missense_Mutation_p.V395D|AFF1_uc011cda.1_Missense_Mutation_p.V33D	NM_005935	NP_005926	P51825	AFF1_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	395						nucleus	sequence-specific DNA binding transcription factor activity			breast(1)	1		Acute lymphoblastic leukemia(40;0.0935)|all_hematologic(202;0.111)|Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;0.000233)		TCTCAGCATGTCAGTTCTGTA	0.284													6	9	---	---	---	---	PASS
SYNPO2	171024	broad.mit.edu	37	4	119979019	119979019	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:119979019C>G	uc010inb.2	+	5	3912	c.3716C>G	c.(3715-3717)TCT>TGT	p.S1239C	SYNPO2_uc011cgh.1_3'UTR|SYNPO2_uc010inc.2_Missense_Mutation_p.S1109C	NM_133477	NP_597734	Q9UMS6	SYNP2_HUMAN	synaptopodin 2 isoform a	Error:Variant_position_missing_in_Q9UMS6_after_alignment						nucleus|Z disc	14-3-3 protein binding|actin binding|muscle alpha-actinin binding			ovary(2)	2						GAAACCAGGTCTGATTACTGT	0.443													6	58	---	---	---	---	PASS
ZNF827	152485	broad.mit.edu	37	4	146686170	146686170	+	Missense_Mutation	SNP	T	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:146686170T>G	uc003ikn.2	-	13	3248	c.3200A>C	c.(3199-3201)AAA>ACA	p.K1067T	ZNF827_uc003ikm.2_Missense_Mutation_p.K1067T|ZNF827_uc010iox.2_Missense_Mutation_p.K717T|ZNF827_uc003ikl.2_Missense_Mutation_p.K152T	NM_178835	NP_849157	Q17R98	ZN827_HUMAN	zinc finger protein 827	1067	C2H2-type 9.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_hematologic(180;0.151)					AGTGTGGCATTTCTTATGCTC	0.498													5	133	---	---	---	---	PASS
NPY2R	4887	broad.mit.edu	37	4	156136153	156136153	+	Silent	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:156136153C>A	uc003ioq.2	+	2	1557	c.1062C>A	c.(1060-1062)TCC>TCA	p.S354S	NPY2R_uc003ior.2_Silent_p.S354S	NM_000910	NP_000901	P49146	NPY2R_HUMAN	neuropeptide Y receptor Y2	354	Cytoplasmic (Potential).				cardiac left ventricle morphogenesis|inhibition of adenylate cyclase activity by G-protein signaling pathway|locomotory behavior|outflow tract morphogenesis	integral to plasma membrane	calcium channel regulator activity			lung(2)|skin(1)	3	all_hematologic(180;0.24)	Renal(120;0.0854)				CTGAGGTGTCCGTGACATTCA	0.507													18	75	---	---	---	---	PASS
NEIL3	55247	broad.mit.edu	37	4	178281777	178281777	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:178281777C>T	uc003iut.2	+	9	1698	c.1581C>T	c.(1579-1581)GGC>GGT	p.G527G		NM_018248	NP_060718	Q8TAT5	NEIL3_HUMAN	nei endonuclease VIII-like 3	527					base-excision repair|nucleotide-excision repair	nucleus	bubble DNA binding|damaged DNA binding|DNA N-glycosylase activity|DNA-(apurinic or apyrimidinic site) lyase activity|double-stranded DNA binding|single-stranded DNA binding|zinc ion binding			lung(2)|ovary(1)|central_nervous_system(1)	4		Breast(14;6.27e-05)|Melanoma(52;0.00102)|Renal(120;0.00988)|Prostate(90;0.00996)|all_hematologic(60;0.014)|all_neural(102;0.164)		all cancers(43;1.96e-23)|Epithelial(43;2.52e-20)|OV - Ovarian serous cystadenocarcinoma(60;1.89e-11)|GBM - Glioblastoma multiforme(59;9.49e-05)|Colorectal(24;0.00013)|COAD - Colon adenocarcinoma(29;0.000696)|STAD - Stomach adenocarcinoma(60;0.00308)|LUSC - Lung squamous cell carcinoma(193;0.0398)|READ - Rectum adenocarcinoma(43;0.191)		AAAACAAGGGCAGGCAGTTTT	0.443								BER_DNA_glycosylases					6	102	---	---	---	---	PASS
AHRR	57491	broad.mit.edu	37	5	432877	432877	+	Intron	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:432877C>G	uc003jav.2	+						AHRR_uc003jaw.2_Intron|AHRR_uc010isy.2_Intron|AHRR_uc010isz.2_Intron|AHRR_uc003jax.2_Intron|AHRR_uc003jay.2_Intron|AHRR_uc003jaz.2_5'UTR	NM_020731	NP_065782	A9YTQ3	AHRR_HUMAN	arylhydrocarbon receptor repressor						regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|signal transducer activity			breast(2)	2			Epithelial(17;0.0011)|OV - Ovarian serous cystadenocarcinoma(19;0.00353)|all cancers(22;0.00354)|Lung(60;0.0863)			AGGAGCTCCTCAGCTCGCACC	0.607													5	77	---	---	---	---	PASS
EXOC3	11336	broad.mit.edu	37	5	462321	462321	+	Nonsense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:462321G>T	uc003jba.2	+	9	1680	c.1552G>T	c.(1552-1554)GAG>TAG	p.E518*		NM_007277	NP_009208	O60645	EXOC3_HUMAN	Sec6 protein	529					exocytosis|protein transport						0		Ovarian(839;0.0563)	Epithelial(17;0.000529)|OV - Ovarian serous cystadenocarcinoma(19;0.00153)|all cancers(22;0.00186)|Lung(60;0.0863)			TGAAGTGGAAGAGGGTGTGTC	0.547													12	249	---	---	---	---	PASS
SLC9A3	6550	broad.mit.edu	37	5	476396	476396	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:476396G>T	uc003jbe.2	-	13	2100	c.1988C>A	c.(1987-1989)TCC>TAC	p.S663Y	SLC9A3_uc011clx.1_Missense_Mutation_p.S654Y|uc011cly.1_5'Flank	NM_004174	NP_004165	P48764	SL9A3_HUMAN	solute carrier family 9 (sodium/hydrogen	663	Interaction with PDZD3 (By similarity).|Cytoplasmic (Potential).					cell surface|integral to membrane	sodium:hydrogen antiporter activity				0			Epithelial(17;0.000529)|OV - Ovarian serous cystadenocarcinoma(19;0.00153)|all cancers(22;0.00186)|Lung(60;0.0863)			CGACTTGAAGGACTCCAGGCG	0.602													9	240	---	---	---	---	PASS
CDH6	1004	broad.mit.edu	37	5	31317512	31317512	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:31317512G>C	uc003jhe.1	+	10	1869	c.1543G>C	c.(1543-1545)GAT>CAT	p.D515H	CDH6_uc003jhd.1_Missense_Mutation_p.D515H	NM_004932	NP_004923	P55285	CADH6_HUMAN	cadherin 6, type 2 preproprotein	515	Extracellular (Potential).|Cadherin 5.				adherens junction organization|cell junction assembly|homophilic cell adhesion	cytoplasm|integral to membrane|nucleus|plasma membrane	calcium ion binding			ovary(4)|skin(2)|large_intestine(1)	7						TGTTGACAAGGATGACCCTTA	0.398													20	246	---	---	---	---	PASS
SPEF2	79925	broad.mit.edu	37	5	35753786	35753786	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35753786C>T	uc003jjo.2	+	24	3502	c.3391C>T	c.(3391-3393)CGG>TGG	p.R1131W	SPEF2_uc003jjp.1_Missense_Mutation_p.R617W	NM_024867	NP_079143	Q9C093	SPEF2_HUMAN	KPL2 protein isoform 1	1131					nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		ATP binding|nucleobase, nucleoside, nucleotide kinase activity|protein dimerization activity			skin(2)|ovary(1)|central_nervous_system(1)	4	all_lung(31;7.56e-05)		Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Colorectal(62;0.202)			GGAGCAGGAGCGGCTTGACAT	0.483													10	377	---	---	---	---	PASS
CAPSL	133690	broad.mit.edu	37	5	35910144	35910144	+	Missense_Mutation	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35910144T>A	uc003jjt.1	-	4	444	c.349A>T	c.(349-351)ATG>TTG	p.M117L	CAPSL_uc003jju.1_Missense_Mutation_p.M117L	NM_001042625	NP_001036090	Q8WWF8	CAPSL_HUMAN	calcyphosine-like	117	EF-hand 3.					cytoplasm	calcium ion binding			skin(1)	1	all_lung(31;0.000268)		Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Epithelial(62;0.167)|Colorectal(62;0.202)			AAAGCTTGCATGATTACCTCT	0.373													21	290	---	---	---	---	PASS
PAIP1	10605	broad.mit.edu	37	5	43547975	43547975	+	Nonsense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:43547975G>C	uc003job.2	-	3	723	c.476C>G	c.(475-477)TCA>TGA	p.S159*	PAIP1_uc003joa.2_Nonsense_Mutation_p.S80*|PAIP1_uc010ivp.2_Nonsense_Mutation_p.S80*|PAIP1_uc010ivo.2_RNA|PAIP1_uc003joc.2_Nonsense_Mutation_p.S47*	NM_006451	NP_006442	Q9H074	PAIP1_HUMAN	poly(A) binding protein interacting protein 1	159	MIF4G.				mRNA stabilization|nuclear-transcribed mRNA poly(A) tail shortening|translational initiation	cytosol	protein binding|RNA binding|translation activator activity			ovary(1)	1	Lung NSC(6;2.07e-05)					AACATATTCTGATAGAGTAGG	0.368													14	175	---	---	---	---	PASS
BDP1	55814	broad.mit.edu	37	5	70786810	70786810	+	Splice_Site	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:70786810G>C	uc003kbp.1	+	11	1756	c.1493_splice	c.e11-1	p.N498_splice	BDP1_uc003kbn.1_Splice_Site_p.N498_splice|BDP1_uc003kbo.2_Splice_Site_p.N498_splice	NM_018429	NP_060899	A6H8Y1	BDP1_HUMAN	transcription factor-like nuclear regulator						regulation of transcription, DNA-dependent|transcription from RNA polymerase III promoter	nucleoplasm	DNA binding			skin(2)	2		Lung NSC(167;0.000422)|Prostate(74;0.00815)|Ovarian(174;0.0176)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;5.28e-56)|Epithelial(20;2.31e-50)		TGTATTTGTAGATAAATGTCA	0.363													12	42	---	---	---	---	PASS
PCSK1	5122	broad.mit.edu	37	5	95743998	95743998	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:95743998C>G	uc003kls.1	-	9	1331	c.1125G>C	c.(1123-1125)ACG>ACC	p.T375T	PCSK1_uc010jbi.1_Silent_p.T65T	NM_000439	NP_000430	P29120	NEC1_HUMAN	proprotein convertase subtilisin/kexin type 1	375	Catalytic.				cell-cell signaling|cellular nitrogen compound metabolic process|energy reserve metabolic process|hormone biosynthetic process|peptide biosynthetic process|peptide hormone processing|regulation of insulin secretion	extracellular space|stored secretory granule|transport vesicle	serine-type endopeptidase activity			ovary(2)	2		all_cancers(142;2.67e-06)|all_epithelial(76;6.92e-09)|all_lung(232;0.00307)|Lung NSC(167;0.00452)|Ovarian(225;0.0112)|Colorectal(57;0.0341)|Breast(839;0.244)		all cancers(79;3.44e-16)	Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)	TGTGCGTCTCCGTGCAGTCAT	0.577													6	20	---	---	---	---	PASS
MCC	4163	broad.mit.edu	37	5	112421001	112421001	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:112421001C>T	uc003kqj.3	-	7	1365	c.835G>A	c.(835-837)GAG>AAG	p.E279K	MCC_uc003kqk.3_RNA|MCC_uc003kql.3_Missense_Mutation_p.E469K|MCC_uc011cwb.1_Missense_Mutation_p.E279K|MCC_uc010jcd.1_Missense_Mutation_p.E241K	NM_002387	NP_002378	P23508	CRCM_HUMAN	mutated in colorectal cancers isoform 2	279					negative regulation of canonical Wnt receptor signaling pathway|negative regulation of epithelial cell migration|negative regulation of epithelial cell proliferation|Wnt receptor signaling pathway	cytoplasm|nucleus|plasma membrane	protein binding|receptor activity			ovary(1)	1		all_cancers(142;5.89e-08)|all_epithelial(76;3.57e-11)|all_lung(232;0.000605)|Lung NSC(810;0.000697)|Colorectal(10;0.00146)|Prostate(80;0.00174)|Ovarian(225;0.0175)|Breast(839;0.198)		OV - Ovarian serous cystadenocarcinoma(64;2.04e-54)|Epithelial(69;9.69e-49)|all cancers(49;6.25e-44)|COAD - Colon adenocarcinoma(37;0.0432)|Colorectal(14;0.0766)		GTTTGAAGCTCTCTGACCTGA	0.532													27	103	---	---	---	---	PASS
MRPL22	29093	broad.mit.edu	37	5	154346442	154346442	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:154346442C>T	uc003lvy.3	+	7	644	c.606C>T	c.(604-606)ATC>ATT	p.I202I	MRPL22_uc003lvz.3_Silent_p.I122I	NM_014180	NP_054899	Q9NWU5	RM22_HUMAN	mitochondrial ribosomal protein L22 isoform a	202					translation	large ribosomal subunit|mitochondrion	structural constituent of ribosome				0	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.147)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)			GCCGGACCATCGTTCACACTC	0.438													4	20	---	---	---	---	PASS
MED7	9443	broad.mit.edu	37	5	156565803	156565803	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:156565803G>C	uc010jik.2	-	2	1032	c.640C>G	c.(640-642)CAG>GAG	p.Q214E	MED7_uc003lwm.3_Missense_Mutation_p.Q214E	NM_001100816	NP_001094286	O43513	MED7_HUMAN	mediator complex subunit 7	214					regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex|transcription factor complex	protein binding|transcription coactivator activity				0	Renal(175;0.00212)	Medulloblastoma(196;0.0354)|all_neural(177;0.0999)	Kidney(164;0.000171)|KIRC - Kidney renal clear cell carcinoma(164;0.000785)			TCTATAATCTGATCTCTCCTA	0.348													43	223	---	---	---	---	PASS
STK10	6793	broad.mit.edu	37	5	171523528	171523528	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:171523528G>T	uc003mbo.1	-	8	1207	c.907C>A	c.(907-909)CTG>ATG	p.L303M		NM_005990	NP_005981	O94804	STK10_HUMAN	serine/threonine kinase 10	303							ATP binding|protein serine/threonine kinase activity			ovary(3)|lung(2)|testis(1)|breast(1)|pancreas(1)	8	Renal(175;0.000159)|Lung NSC(126;0.0056)|all_lung(126;0.0094)	Medulloblastoma(196;0.00868)|all_neural(177;0.026)	Kidney(164;7.24e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000516)			AGCTCCCGCAGAGCCTTGTTA	0.627													6	124	---	---	---	---	PASS
HK3	3101	broad.mit.edu	37	5	176323070	176323070	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176323070C>T	uc003mfa.2	-	2	183	c.91G>A	c.(91-93)GAG>AAG	p.E31K		NM_002115	NP_002106	P52790	HXK3_HUMAN	hexokinase 3	31	Regulatory.				glucose transport|glycolysis|transmembrane transport	cytosol|membrane	ATP binding|glucokinase activity			ovary(3)|large_intestine(1)|haematopoietic_and_lymphoid_tissue(1)|breast(1)|skin(1)	7	all_cancers(89;0.000104)|Renal(175;0.000269)|Lung NSC(126;0.00696)|all_lung(126;0.0115)	Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)			CTTACCAGCTCTGAGCTGTCT	0.587													19	57	---	---	---	---	PASS
ZNF354C	30832	broad.mit.edu	37	5	178506306	178506306	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:178506306G>C	uc003mju.2	+	5	988	c.873G>C	c.(871-873)CTG>CTC	p.L291L		NM_014594	NP_055409	Q86Y25	Z354C_HUMAN	zinc finger protein 354C	291	C2H2-type 3.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1	all_cancers(89;0.00065)|all_epithelial(37;0.000153)|Renal(175;0.000159)|Lung NSC(126;0.00175)|all_lung(126;0.00309)	all_cancers(40;0.19)|all_neural(177;0.00802)|Medulloblastoma(196;0.0145)|all_hematologic(541;0.248)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	all cancers(165;0.247)		TCAAACATCTGAGAGTGCATA	0.418													62	97	---	---	---	---	PASS
TBC1D9B	23061	broad.mit.edu	37	5	179292339	179292339	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:179292339G>A	uc003mlh.2	-	21	3024	c.2987C>T	c.(2986-2988)CCG>CTG	p.P996L	TBC1D9B_uc003mli.2_Missense_Mutation_p.P979L|TBC1D9B_uc003mlj.2_Missense_Mutation_p.P978L|TBC1D9B_uc003mlf.2_Missense_Mutation_p.P70L|TBC1D9B_uc003mlg.2_Missense_Mutation_p.P155L|TBC1D9B_uc011dgv.1_Missense_Mutation_p.P155L	NM_198868	NP_942568	Q66K14	TBC9B_HUMAN	TBC1 domain family, member 9B (with GRAM domain)	996						integral to membrane|intracellular	calcium ion binding|Rab GTPase activator activity			breast(1)|skin(1)	2	all_cancers(89;0.000197)|all_epithelial(37;6.84e-05)|Renal(175;0.000159)|Lung NSC(126;0.00136)|all_lung(126;0.00243)	all_cancers(40;0.0236)|Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)			CCGATAGTCCGGAGAGCTGGT	0.537													7	118	---	---	---	---	PASS
KIF13A	63971	broad.mit.edu	37	6	17987315	17987315	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:17987315G>C	uc003ncg.3	-	2	221	c.116C>G	c.(115-117)CCT>CGT	p.P39R	KIF13A_uc003ncf.2_Missense_Mutation_p.P39R|KIF13A_uc003nch.3_Missense_Mutation_p.P39R|KIF13A_uc003nci.3_Missense_Mutation_p.P39R|KIF13A_uc003nck.2_RNA	NM_022113	NP_071396	Q9H1H9	KI13A_HUMAN	kinesin family member 13A isoform a	39	Kinesin-motor.				cargo loading into vesicle|cell cycle|cytokinesis|endosome to lysosome transport|Golgi to plasma membrane protein transport|melanosome organization|plus-end-directed vesicle transport along microtubule	centrosome|endosome membrane|microtubule|midbody|trans-Golgi network membrane	ATP binding|microtubule motor activity|protein binding			large_intestine(2)|ovary(2)	4	Breast(50;0.0107)|Ovarian(93;0.016)	all_hematologic(90;0.125)	all cancers(50;0.0865)|Epithelial(50;0.0974)			AGAAGGAGGAGGGTGCAGGAC	0.562													9	123	---	---	---	---	PASS
ZSCAN16	80345	broad.mit.edu	37	6	28093491	28093491	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28093491G>C	uc003nkm.2	+	2	370	c.270G>C	c.(268-270)CTG>CTC	p.L90L	uc010jqw.1_Intron|uc003nkk.1_RNA|uc003nkl.1_Intron|ZSCAN16_uc011dky.1_Silent_p.L90L	NM_025231	NP_079507	Q9H4T2	ZSC16_HUMAN	zinc finger and SCAN domain containing 16	90	SCAN box.				viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			large_intestine(1)	1						AACAGTTCCTGAGCATTCTTC	0.522													8	91	---	---	---	---	PASS
HCP5	10866	broad.mit.edu	37	6	31431770	31431770	+	3'UTR	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31431770A>G	uc003ntl.2	+	2						NM_006674	NP_006665	Q6MZN7	HCP5_HUMAN	HLA complex P5						defense response						0						catactgtccaattcccctgt	0.000													53	76	---	---	---	---	PASS
TNXB	7148	broad.mit.edu	37	6	32014187	32014187	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32014187C>T	uc003nzl.2	-	31	10567	c.10365G>A	c.(10363-10365)GTG>GTA	p.V3455V	TNXB_uc003nzg.1_5'Flank|TNXB_uc003nzh.1_5'UTR	NM_019105	NP_061978	P22105	TENX_HUMAN	tenascin XB isoform 1 precursor	3502	Fibronectin type-III 27.				actin cytoskeleton organization|cell adhesion|collagen metabolic process|elastic fiber assembly|signal transduction	extracellular space|intracellular|proteinaceous extracellular matrix	heparin binding|integrin binding				0						TCTCCTCAGCCACGGTCAGTT	0.632													7	20	---	---	---	---	PASS
PPT2	9374	broad.mit.edu	37	6	32130348	32130348	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32130348C>G	uc003nzx.2	+	8	1282	c.714C>G	c.(712-714)TTC>TTG	p.F238L	PPT2_uc003nzw.2_Missense_Mutation_p.F244L|PPT2_uc011dpi.1_RNA|PPT2_uc003nzy.1_RNA|PPT2_uc003nzz.2_Missense_Mutation_p.F238L|PPT2_uc003oaa.2_Missense_Mutation_p.F238L|PPT2_uc010jtu.1_Missense_Mutation_p.F238L|EGFL8_uc003oac.1_5'Flank|EGFL8_uc003oab.1_5'Flank	NM_005155	NP_005146	Q9UMR5	PPT2_HUMAN	palmitoyl-protein thioesterase 2 isoform a	238					protein modification process	lysosome	palmitoyl-(protein) hydrolase activity				0						TTTGTAGCTTCTTTGGTTTCT	0.373													71	234	---	---	---	---	PASS
TAP2	6891	broad.mit.edu	37	6	32800587	32800587	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32800587C>A	uc003occ.2	-	5	991	c.960G>T	c.(958-960)GAG>GAT	p.E320D	TAP2_uc011dqf.1_Missense_Mutation_p.E320D|TAP2_uc003ocb.1_Missense_Mutation_p.E320D|TAP2_uc003ocd.2_Missense_Mutation_p.E320D	NM_018833	NP_061313	Q03519	TAP2_HUMAN	transporter 2, ATP-binding cassette, sub-family	320	Involved in peptide-binding site.|ABC transmembrane type-1.|Cytoplasmic (Potential).				antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent|antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent|antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent|cytosol to ER transport|intracellular transport of viral proteins in host cell|peptide antigen transport|positive regulation of antigen processing and presentation of peptide antigen via MHC class I|positive regulation of T cell mediated cytotoxicity	nucleus|plasma membrane|TAP complex	ATP binding|MHC class I protein binding|oligopeptide-transporting ATPase activity|peptide antigen binding|peptide antigen-transporting ATPase activity|TAP1 binding|TAP2 binding|tapasin binding				0						CATCCTGGATCTCCCGAAGCA	0.612													7	33	---	---	---	---	PASS
RGL2	5863	broad.mit.edu	37	6	33261395	33261395	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33261395G>C	uc003odv.2	-	14	1723	c.1590C>G	c.(1588-1590)ATC>ATG	p.I530M	RGL2_uc003odu.2_Missense_Mutation_p.I90M|RGL2_uc010jur.2_Missense_Mutation_p.I90M|RGL2_uc003odw.2_Missense_Mutation_p.I448M|RGL2_uc011drb.1_3'UTR	NM_004761	NP_004752	O15211	RGL2_HUMAN	ral guanine nucleotide dissociation	530					Ras protein signal transduction|regulation of small GTPase mediated signal transduction	intracellular	Ras guanyl-nucleotide exchange factor activity			skin(3)|lung(1)|breast(1)|pancreas(1)	6						TCCACTGCGAGATGACCAATG	0.572													10	40	---	---	---	---	PASS
FKBP5	2289	broad.mit.edu	37	6	35565137	35565137	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35565137C>G	uc011dte.1	-	6	756	c.553G>C	c.(553-555)GAT>CAT	p.D185H	FKBP5_uc003okx.2_Missense_Mutation_p.D185H|FKBP5_uc011dtf.1_Missense_Mutation_p.D6H|FKBP5_uc003oky.2_Missense_Mutation_p.D185H|FKBP5_uc003okz.2_Missense_Mutation_p.D185H	NM_001145776	NP_001139248	Q13451	FKBP5_HUMAN	FK506 binding protein 5 isoform 1	185	PPIase FKBP-type 2.				protein folding	cytoplasm|membrane|nucleus	FK506 binding|heat shock protein binding|peptidyl-prolyl cis-trans isomerase activity			ovary(1)	1						AATGCCACATCTCTGCAGTCA	0.488													9	98	---	---	---	---	PASS
LHFPL5	222662	broad.mit.edu	37	6	35773576	35773576	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35773576C>G	uc003olg.1	+	1	506	c.129C>G	c.(127-129)CTC>CTG	p.L43L		NM_182548	NP_872354	Q8TAF8	TMHS_HUMAN	lipoma HMGIC fusion partner-like 5	43	Helical; (Potential).					integral to membrane				skin(1)	1						TCATGGCCCTCTTCATCCAGC	0.592													35	115	---	---	---	---	PASS
CDKN1A	1026	broad.mit.edu	37	6	36652284	36652284	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:36652284G>C	uc003omm.3	+	2	528	c.406G>C	c.(406-408)GAC>CAC	p.D136H	CDKN1A_uc011dtq.1_Missense_Mutation_p.D170H|CDKN1A_uc003oml.2_Missense_Mutation_p.D136H|CDKN1A_uc003omn.2_Missense_Mutation_p.D136H	NM_000389	NP_000380	P38936	CDN1A_HUMAN	cyclin-dependent kinase inhibitor 1A	136					cell cycle arrest|cellular response to extracellular stimulus|cellular response to ionizing radiation|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1 phase of mitotic cell cycle|G1/S transition of mitotic cell cycle|G2/M transition of mitotic cell cycle|induction of apoptosis by intracellular signals|negative regulation of cell growth|negative regulation of cell proliferation|positive regulation of fibroblast proliferation|positive regulation of reactive oxygen species metabolic process|Ras protein signal transduction|S phase of mitotic cell cycle|stress-induced premature senescence	cyclin-dependent protein kinase holoenzyme complex|cytosol|nucleoplasm|PCNA-p21 complex	cyclin-dependent protein kinase activating kinase activity|cyclin-dependent protein kinase inhibitor activity|metal ion binding			ovary(1)|breast(1)	2						TGGACCTGGAGACTCTCAGGG	0.587									Multiple_Endocrine_Neoplasia_type_1				4	33	---	---	---	---	PASS
RSPH9	221421	broad.mit.edu	37	6	43624433	43624433	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43624433G>A	uc003ovw.1	+	4	669	c.643G>A	c.(643-645)GAC>AAC	p.D215N	RSPH9_uc003ovx.1_Missense_Mutation_p.D200N	NM_152732	NP_689945	Q9H1X1	RSPH9_HUMAN	radial spoke head 9 homolog	215					cilium axoneme assembly|cilium movement	cytoplasm|cytoskeleton				upper_aerodigestive_tract(1)|skin(1)	2						GGATTTCATGGACTCCTTGGA	0.517									Kartagener_syndrome				10	434	---	---	---	---	PASS
HSP90AB1	3326	broad.mit.edu	37	6	44216498	44216498	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44216498C>G	uc003oxa.1	+	2	216	c.132C>G	c.(130-132)ATC>ATG	p.I44M	HSP90AB1_uc011dvr.1_Missense_Mutation_p.I44M|HSP90AB1_uc003oxb.1_Missense_Mutation_p.I44M|HSP90AB1_uc011dvs.1_Translation_Start_Site|HSP90AB1_uc003oxc.1_5'Flank	NM_007355	NP_031381	P08238	HS90B_HUMAN	heat shock 90kDa protein 1, beta	44					axon guidance|negative regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of nitric oxide biosynthetic process|protein folding|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|response to unfolded protein	cytosol|melanosome	ATP binding|nitric-oxide synthase regulator activity|TPR domain binding|unfolded protein binding			lung(3)|breast(1)	4	all_cancers(18;1.7e-05)|all_lung(25;0.00747)|Hepatocellular(11;0.00908)|Ovarian(13;0.0273)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)			GGGAGTTGATCTCTAATGCTT	0.433													12	363	---	---	---	---	PASS
HCRTR2	3062	broad.mit.edu	37	6	55120033	55120033	+	Missense_Mutation	SNP	C	T	T	rs141639071	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:55120033C>T	uc003pcl.2	+	3	817	c.502C>T	c.(502-504)CGG>TGG	p.R168W	HCRTR2_uc010jzv.2_RNA|HCRTR2_uc010jzw.1_Missense_Mutation_p.R103W	NM_001526	NP_001517	O43614	OX2R_HUMAN	orexin receptor 2	168	Cytoplasmic (Potential).				feeding behavior	integral to plasma membrane	neuropeptide receptor activity	p.R168W(1)		ovary(2)|lung(2)|upper_aerodigestive_tract(1)|breast(1)	6	Lung NSC(77;0.107)|Renal(3;0.122)		LUSC - Lung squamous cell carcinoma(124;0.23)			CACAGCAAAGCGGGCCCGTAA	0.517													5	72	---	---	---	---	PASS
MYO6	4646	broad.mit.edu	37	6	76623906	76623906	+	Missense_Mutation	SNP	A	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76623906A>C	uc003pih.1	+	34	3845	c.3566A>C	c.(3565-3567)AAA>ACA	p.K1189T	MYO6_uc003pii.1_Missense_Mutation_p.K1166T|MYO6_uc003pij.1_Missense_Mutation_p.K137T	NM_004999	NP_004990	Q9UM54	MYO6_HUMAN	myosin VI	1198					actin filament-based movement|DNA damage response, signal transduction by p53 class mediator|endocytosis|intracellular protein transport|positive regulation of transcription from RNA polymerase II promoter|regulation of secretion|sensory perception of sound|synaptic transmission	cell cortex|clathrin coated vesicle membrane|coated pit|cytosol|DNA-directed RNA polymerase II, holoenzyme|filamentous actin|Golgi apparatus|nuclear membrane|perinuclear region of cytoplasm|ruffle membrane|unconventional myosin complex	actin filament binding|ADP binding|ATP binding|calmodulin binding|minus-end directed microfilament motor activity|protein binding			kidney(1)|pancreas(1)	2		all_hematologic(105;0.189)		BRCA - Breast invasive adenocarcinoma(397;0.223)		CAGAGTAAGAAAAAAGGCTGG	0.532													15	176	---	---	---	---	PASS
SYNCRIP	10492	broad.mit.edu	37	6	86324411	86324411	+	3'UTR	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:86324411C>G	uc003pla.2	-	11					SYNCRIP_uc003pku.2_Intron|SYNCRIP_uc003pkw.2_Intron|SYNCRIP_uc003pky.2_Intron|SYNCRIP_uc003pkv.2_Intron|SYNCRIP_uc003pkx.2_Intron|SYNCRIP_uc003pkz.2_3'UTR	NM_006372	NP_006363	O60506	HNRPQ_HUMAN	synaptotagmin binding, cytoplasmic RNA						CRD-mediated mRNA stabilization|interspecies interaction between organisms	catalytic step 2 spliceosome|CRD-mediated mRNA stability complex|endoplasmic reticulum|histone pre-mRNA 3'end processing complex|microsome|nucleoplasm	nucleotide binding|protein binding			ovary(2)	2		all_cancers(76;0.000137)|Acute lymphoblastic leukemia(125;3.66e-08)|Prostate(29;8.2e-07)|all_hematologic(105;8.61e-05)|all_epithelial(107;0.0297)		BRCA - Breast invasive adenocarcinoma(108;0.0389)		GGCACCCGTTCAGATTTAGGG	0.408													8	17	---	---	---	---	PASS
SYNCRIP	10492	broad.mit.edu	37	6	86324442	86324442	+	3'UTR	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:86324442C>T	uc003pla.2	-	11					SYNCRIP_uc003pku.2_Intron|SYNCRIP_uc003pkw.2_Intron|SYNCRIP_uc003pky.2_Intron|SYNCRIP_uc003pkv.2_Intron|SYNCRIP_uc003pkx.2_Intron|SYNCRIP_uc003pkz.2_3'UTR	NM_006372	NP_006363	O60506	HNRPQ_HUMAN	synaptotagmin binding, cytoplasmic RNA						CRD-mediated mRNA stabilization|interspecies interaction between organisms	catalytic step 2 spliceosome|CRD-mediated mRNA stability complex|endoplasmic reticulum|histone pre-mRNA 3'end processing complex|microsome|nucleoplasm	nucleotide binding|protein binding			ovary(2)	2		all_cancers(76;0.000137)|Acute lymphoblastic leukemia(125;3.66e-08)|Prostate(29;8.2e-07)|all_hematologic(105;8.61e-05)|all_epithelial(107;0.0297)		BRCA - Breast invasive adenocarcinoma(108;0.0389)		ATCAACCTATCAGTCTCCAAT	0.393													12	36	---	---	---	---	PASS
L3MBTL3	84456	broad.mit.edu	37	6	130413972	130413972	+	Nonsense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:130413972C>G	uc003qbt.2	+	17	1771	c.1601C>G	c.(1600-1602)TCA>TGA	p.S534*	L3MBTL3_uc003qbu.2_Nonsense_Mutation_p.S509*	NM_032438	NP_115814	Q96JM7	LMBL3_HUMAN	l(3)mbt-like 3 isoform a	534	MBT 3.				chromatin modification|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(5)|skin(1)	6				GBM - Glioblastoma multiforme(226;0.0266)|OV - Ovarian serous cystadenocarcinoma(155;0.154)		GGCTGGTGTTCAAAAACAGGA	0.408													23	110	---	---	---	---	PASS
TMEM200A	114801	broad.mit.edu	37	6	130762701	130762701	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:130762701C>G	uc003qca.2	+	3	2005	c.1134C>G	c.(1132-1134)GCC>GCG	p.A378A	TMEM200A_uc010kfh.2_Silent_p.A378A|TMEM200A_uc010kfi.2_Silent_p.A378A|TMEM200A_uc003qcb.2_Silent_p.A378A	NM_052913	NP_443145	Q86VY9	T200A_HUMAN	transmembrane protein 200A	378	Cytoplasmic (Potential).					integral to membrane				ovary(1)	1				GBM - Glioblastoma multiforme(226;0.0139)|OV - Ovarian serous cystadenocarcinoma(155;0.12)		CTGGGGCTGCCAGAAGACAGT	0.522													13	74	---	---	---	---	PASS
NUP43	348995	broad.mit.edu	37	6	150067104	150067104	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:150067104C>G	uc003qmz.2	-	2	272	c.215G>C	c.(214-216)AGA>ACA	p.R72T	NUP43_uc011eee.1_RNA|NUP43_uc011eef.1_Missense_Mutation_p.R72T	NM_198887	NP_942590	Q8NFH3	NUP43_HUMAN	nucleoporin 43kDa	72	WD 2.				carbohydrate metabolic process|cell division|chromosome segregation|glucose transport|mitotic prometaphase|mRNA transport|protein transport|regulation of glucose transport|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytosol|Nup107-160 complex	protein binding			upper_aerodigestive_tract(1)	1		Ovarian(120;0.0164)		OV - Ovarian serous cystadenocarcinoma(155;4.71e-13)|GBM - Glioblastoma multiforme(68;0.101)		ACCATGGTGTCTGATATCACA	0.368													31	160	---	---	---	---	PASS
SYNE1	23345	broad.mit.edu	37	6	152563519	152563519	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152563519C>G	uc010kiw.2	-	107	20351	c.19749G>C	c.(19747-19749)CAG>CAC	p.Q6583H	SYNE1_uc010kiv.2_Missense_Mutation_p.Q1107H|SYNE1_uc003qos.3_Missense_Mutation_p.Q1107H|SYNE1_uc003qot.3_Missense_Mutation_p.Q6512H|SYNE1_uc003qou.3_Missense_Mutation_p.Q6583H	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	6583	Potential.|Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)		GTGTAAGGTTCTGATTCAGAC	0.473										HNSCC(10;0.0054)			29	120	---	---	---	---	PASS
SYNE1	23345	broad.mit.edu	37	6	152771879	152771879	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:152771879G>A	uc010kiw.2	-	27	3878	c.3276C>T	c.(3274-3276)GAC>GAT	p.D1092D	SYNE1_uc003qot.3_Silent_p.D1099D|SYNE1_uc003qou.3_Silent_p.D1092D|SYNE1_uc010kjb.1_Silent_p.D1075D|SYNE1_uc003qow.2_Silent_p.D387D|SYNE1_uc003qox.1_Silent_p.D608D	NM_182961	NP_892006	Q8NF91	SYNE1_HUMAN	spectrin repeat containing, nuclear envelope 1	1092	Cytoplasmic (Potential).				cell death|cytoskeletal anchoring at nuclear membrane|Golgi organization|muscle cell differentiation|nuclear matrix anchoring at nuclear membrane	cytoskeleton|Golgi apparatus|integral to membrane|nuclear outer membrane|postsynaptic membrane|sarcomere|SUN-KASH complex	actin binding|lamin binding			central_nervous_system(15)|upper_aerodigestive_tract(9)|ovary(8)|skin(6)|large_intestine(5)|pancreas(2)	45		Ovarian(120;0.0955)	BRCA - Breast invasive adenocarcinoma(37;0.243)	OV - Ovarian serous cystadenocarcinoma(155;2.24e-10)		CCCTTACTGGGTCCCGCACTG	0.493										HNSCC(10;0.0054)			8	263	---	---	---	---	PASS
CYP2W1	54905	broad.mit.edu	37	7	1024674	1024674	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:1024674G>A	uc003sjq.1	+	3	439	c.426G>A	c.(424-426)CCG>CCA	p.P142P	CYP2W1_uc003sjr.1_Silent_p.P142P	NM_017781	NP_060251	Q8TAV3	CP2W1_HUMAN	cytochrome P450, family 2, subfamily W,	142					xenobiotic metabolic process	endoplasmic reticulum membrane	electron carrier activity|heme binding|monooxygenase activity|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen				0		Ovarian(82;0.0112)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0178)|OV - Ovarian serous cystadenocarcinoma(56;1.74e-15)		GCCGGGAGCCGGTGGCTGACA	0.677													14	16	---	---	---	---	PASS
CHST12	55501	broad.mit.edu	37	7	2472655	2472655	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:2472655G>C	uc003smc.2	+	2	516	c.381G>C	c.(379-381)GTG>GTC	p.V127V	CHST12_uc003smd.2_Silent_p.V127V	NM_018641	NP_061111	Q9NRB3	CHSTC_HUMAN	carbohydrate sulfotransferase 12	127	Lumenal (Potential).				dermatan sulfate biosynthetic process	integral to Golgi membrane	3'-phosphoadenosine 5'-phosphosulfate binding|chondroitin 4-sulfotransferase activity|protein binding			kidney(1)	1		Ovarian(82;0.0253)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0847)|OV - Ovarian serous cystadenocarcinoma(56;2.25e-13)		GGAGGAGCGTGCTGCGGGGCT	0.706													16	45	---	---	---	---	PASS
DAGLB	221955	broad.mit.edu	37	7	6461401	6461401	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6461401A>T	uc003sqa.2	-	9	1345	c.1175T>A	c.(1174-1176)GTG>GAG	p.V392E	DAGLB_uc003spz.2_Missense_Mutation_p.V89E|DAGLB_uc011jwt.1_Missense_Mutation_p.V206E|DAGLB_uc011jwu.1_Missense_Mutation_p.V263E|DAGLB_uc003sqb.2_Missense_Mutation_p.V111E|DAGLB_uc003sqc.2_Missense_Mutation_p.V111E|DAGLB_uc011jwv.1_RNA|DAGLB_uc003sqd.3_Missense_Mutation_p.V351E|DAGLB_uc011jww.1_RNA	NM_139179	NP_631918	Q8NCG7	DGLB_HUMAN	diacylglycerol lipase, beta isoform 1	392	Cytoplasmic (Potential).				lipid catabolic process|platelet activation	integral to membrane|plasma membrane	acylglycerol lipase activity|metal ion binding|triglyceride lipase activity			ovary(2)|central_nervous_system(1)	3		Ovarian(82;0.232)		UCEC - Uterine corpus endometrioid carcinoma (126;0.102)		CACGTCCAGCACCTCACTCTC	0.587													6	20	---	---	---	---	PASS
HDAC9	9734	broad.mit.edu	37	7	18975441	18975441	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:18975441A>T	uc003suh.2	+	22	2845	c.2804A>T	c.(2803-2805)CAT>CTT	p.H935L	HDAC9_uc003sue.2_Missense_Mutation_p.H935L|HDAC9_uc003sui.2_Missense_Mutation_p.H938L|HDAC9_uc003suj.2_Missense_Mutation_p.H894L|HDAC9_uc003suk.2_Missense_Mutation_p.H183L	NM_058176	NP_478056	Q9UKV0	HDAC9_HUMAN	histone deacetylase 9 isoform 1	935	Histone deacetylase.				B cell differentiation|cellular response to insulin stimulus|heart development|histone H3 deacetylation|histone H4 deacetylation|inflammatory response|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|peptidyl-lysine deacetylation|positive regulation of cell migration involved in sprouting angiogenesis|regulation of skeletal muscle fiber development|transcription, DNA-dependent	cytoplasm|histone deacetylase complex|histone methyltransferase complex|transcription factor complex	histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|histone deacetylase binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|protein binding|protein kinase C binding|repressing transcription factor binding|transcription corepressor activity			lung(2)|central_nervous_system(2)|kidney(1)	5	all_lung(11;0.187)				Valproic Acid(DB00313)	GGTTTTGGTCATTTGACGAAG	0.353													60	112	---	---	---	---	PASS
GARS	2617	broad.mit.edu	37	7	30673444	30673444	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30673444G>C	uc003tbm.2	+	17	2545	c.2188G>C	c.(2188-2190)GAG>CAG	p.E730Q		NM_002047	NP_002038	P41250	SYG_HUMAN	glycyl-tRNA synthetase	730					cell death|diadenosine tetraphosphate biosynthetic process|glycyl-tRNA aminoacylation	cytosol|mitochondrial matrix|soluble fraction	ATP binding|glycine-tRNA ligase activity|protein dimerization activity			ovary(1)	1					Glycine(DB00145)	TGAAGGGCAAGAGACTGGTAA	0.428													12	55	---	---	---	---	PASS
PDE1C	5137	broad.mit.edu	37	7	31793151	31793151	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:31793151C>T	uc003tcm.1	-	18	2446	c.1977G>A	c.(1975-1977)TTG>TTA	p.L659L	PDE1C_uc003tcn.1_Silent_p.L659L|PDE1C_uc003tco.1_Silent_p.L719L	NM_005020	NP_005011	Q14123	PDE1C_HUMAN	phosphodiesterase 1C	659					activation of phospholipase C activity|nerve growth factor receptor signaling pathway	cytosol	calmodulin binding|calmodulin-dependent cyclic-nucleotide phosphodiesterase activity|metal ion binding			skin(3)|central_nervous_system(1)	4			GBM - Glioblastoma multiforme(11;0.216)			TAAAATGACGCAAAGGAGGCT	0.483													42	37	---	---	---	---	PASS
BBS9	27241	broad.mit.edu	37	7	33384191	33384191	+	Splice_Site	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:33384191A>T	uc003tdn.1	+	12	1789	c.1276_splice	c.e12-2	p.Q426_splice	BBS9_uc003tdo.1_Splice_Site_p.Q426_splice|BBS9_uc003tdp.1_Splice_Site_p.Q426_splice|BBS9_uc003tdq.1_Splice_Site_p.Q426_splice|BBS9_uc010kwn.1_Splice_Site|BBS9_uc003tdr.1_5'Flank|BBS9_uc011kao.1_Splice_Site_p.Q304_splice	NM_198428	NP_940820	Q3SYG4	PTHB1_HUMAN	parathyroid hormone-responsive B1 isoform 2						fat cell differentiation|response to stimulus|visual perception	BBSome|cilium membrane|microtubule organizing center|nucleus	protein binding			ovary(3)|upper_aerodigestive_tract(1)|skin(1)	5			GBM - Glioblastoma multiforme(11;0.0894)			CTGTGTTTACAGCAAGCGACC	0.388									Bardet-Biedl_syndrome				26	94	---	---	---	---	PASS
INHBA	3624	broad.mit.edu	37	7	41739709	41739709	+	Silent	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:41739709T>C	uc003thq.2	-	1	499	c.264A>G	c.(262-264)AGA>AGG	p.R88R	LOC285954_uc003tht.3_Intron|INHBA_uc003thr.2_Silent_p.R88R|LOC285954_uc003ths.2_Intron	NM_002192	NP_002183	P08476	INHBA_HUMAN	inhibin beta A precursor	88					cell cycle arrest|cell surface receptor linked signaling pathway|defense response|erythrocyte differentiation|eyelid development in camera-type eye|G1/S transition of mitotic cell cycle|growth|hair follicle development|hemoglobin biosynthetic process|hemopoietic progenitor cell differentiation|induction of apoptosis|male gonad development|negative regulation of B cell differentiation|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of follicle-stimulating hormone secretion|negative regulation of interferon-gamma biosynthetic process|negative regulation of macrophage differentiation|negative regulation of phosphorylation|nervous system development|odontogenesis|ovarian follicle development|palate development|positive regulation of erythrocyte differentiation|positive regulation of follicle-stimulating hormone secretion|positive regulation of ovulation|positive regulation of transcription from RNA polymerase II promoter|progesterone secretion|regulation of activin receptor signaling pathway	activin A complex|inhibin A complex	cytokine activity|follistatin binding|growth factor activity|hormone activity|identical protein binding|signal transducer activity			lung(5)|ovary(1)	6						CATGAAGCTTTCTGATCGCGT	0.522										TSP Lung(11;0.080)			18	482	---	---	---	---	PASS
URGCP	55665	broad.mit.edu	37	7	43917868	43917868	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:43917868C>G	uc003tiw.2	-	6	1251	c.1194G>C	c.(1192-1194)CTG>CTC	p.L398L	URGCP_uc003tiu.2_Silent_p.L355L|URGCP_uc003tiv.2_Silent_p.L323L|URGCP_uc003tix.2_Silent_p.L389L|URGCP_uc003tiy.2_Silent_p.L355L|URGCP_uc003tiz.2_Silent_p.L355L|URGCP_uc011kbj.1_Silent_p.L355L	NM_001077663	NP_001071131	Q8TCY9	URGCP_HUMAN	up-regulated gene 4 isoform 3	398					cell cycle	centrosome|nucleus	GTP binding			ovary(2)|liver(1)|skin(1)	4						TCAGAAATCTCAGGTTTGTGT	0.448													8	210	---	---	---	---	PASS
LOC168474	168474	broad.mit.edu	37	7	64313111	64313111	+	Silent	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:64313111C>A	uc003ttj.1	-	1	1068	c.516G>T	c.(514-516)GTG>GTT	p.V172V		NR_002789				SubName: Full=Selenophosphate synthetase 1; SubName: Full=Selenophosphate synthetase 1, isoform CRA_a;												0						GATGCACAGCCACTGCCCCCT	0.493													11	36	---	---	---	---	PASS
SPDYE7P	441251	broad.mit.edu	37	7	72334665	72334665	+	RNA	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72334665G>A	uc010lal.1	-	1		c.4991C>T				NR_003666				Homo sapiens speedy homolog E7 (Xenopus laevis), pseudogene (SPDYE7P), non-coding RNA.												0						CAACTCCTCCGGGGAAACCCA	0.602													18	93	---	---	---	---	PASS
PMS2L3	5387	broad.mit.edu	37	7	75141699	75141699	+	Intron	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:75141699G>A	uc003udp.2	-						PMS2L3_uc003udn.2_RNA|PMS2L3_uc003udq.2_Intron	NM_005395	NP_005386			SubName: Full=Postmeiotic segregation increased 2-like 3; SubName: Full=Postmeiotic segregation increased 2-like 3, isoform CRA_b;												0						AGTTAGGTCGGCAAACTCTTG	0.418								Direct_reversal_of_damage|MMR					4	54	---	---	---	---	PASS
ABCB4	5244	broad.mit.edu	37	7	87032471	87032471	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87032471G>C	uc003uiv.1	-	27	3710	c.3634C>G	c.(3634-3636)CTG>GTG	p.L1212V	ABCB4_uc003uiw.1_Missense_Mutation_p.L1205V|ABCB4_uc003uix.1_Missense_Mutation_p.L1158V	NM_018849	NP_061337	P21439	MDR3_HUMAN	ATP-binding cassette, subfamily B, member 4	1212	ABC transporter 2.|Cytoplasmic (By similarity).				cellular lipid metabolic process	apical plasma membrane|Golgi membrane|integral to plasma membrane|intercellular canaliculus|membrane fraction	ATP binding|xenobiotic-transporting ATPase activity			ovary(4)|skin(1)|pancreas(1)	6	Esophageal squamous(14;0.0058)|all_lung(186;0.201)|Lung NSC(181;0.203)					TCAGTATCCAGAGCTGATGTA	0.433													39	233	---	---	---	---	PASS
SAMD9	54809	broad.mit.edu	37	7	92732369	92732369	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92732369C>T	uc003umf.2	-	3	3298	c.3042G>A	c.(3040-3042)GAG>GAA	p.E1014E	SAMD9_uc003umg.2_Silent_p.E1014E	NM_017654	NP_060124	Q5K651	SAMD9_HUMAN	sterile alpha motif domain containing 9	1014						cytoplasm				ovary(3)|skin(2)|breast(1)|central_nervous_system(1)	7	all_cancers(62;5.71e-11)|all_epithelial(64;3.25e-10)|Breast(17;0.000675)|Lung NSC(181;0.0969)|all_lung(186;0.125)		STAD - Stomach adenocarcinoma(171;0.000302)			AGAACAAATTCTCAGTTAGCA	0.373													72	86	---	---	---	---	PASS
TRRAP	8295	broad.mit.edu	37	7	98547739	98547739	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98547739G>C	uc003upp.2	+	37	5376	c.5167G>C	c.(5167-5169)GGT>CGT	p.G1723R	TRRAP_uc011kis.1_Missense_Mutation_p.G1705R|TRRAP_uc003upr.2_Missense_Mutation_p.G1422R	NM_003496	NP_003487	Q9Y4A5	TRRAP_HUMAN	transformation/transcription domain-associated	1723					histone deubiquitination|histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	NuA4 histone acetyltransferase complex|PCAF complex|STAGA complex|transcription factor TFTC complex	phosphotransferase activity, alcohol group as acceptor|protein binding|transcription cofactor activity			ovary(9)|large_intestine(8)|central_nervous_system(6)|skin(6)|stomach(5)|upper_aerodigestive_tract(1)|lung(1)|liver(1)	37	all_cancers(62;6.96e-09)|all_epithelial(64;4.86e-09)|Lung NSC(181;0.01)|all_lung(186;0.016)|Esophageal squamous(72;0.0274)		STAD - Stomach adenocarcinoma(171;0.215)			AGCCTTTACTGGTCGTTTTCT	0.413													10	201	---	---	---	---	PASS
TRRAP	8295	broad.mit.edu	37	7	98588176	98588176	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98588176G>T	uc003upp.2	+	63	9911	c.9702G>T	c.(9700-9702)TGG>TGT	p.W3234C	TRRAP_uc011kis.1_Missense_Mutation_p.W3205C|TRRAP_uc003upr.2_Missense_Mutation_p.W2922C	NM_003496	NP_003487	Q9Y4A5	TRRAP_HUMAN	transformation/transcription domain-associated	3234	FAT.				histone deubiquitination|histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	NuA4 histone acetyltransferase complex|PCAF complex|STAGA complex|transcription factor TFTC complex	phosphotransferase activity, alcohol group as acceptor|protein binding|transcription cofactor activity			ovary(9)|large_intestine(8)|central_nervous_system(6)|skin(6)|stomach(5)|upper_aerodigestive_tract(1)|lung(1)|liver(1)	37	all_cancers(62;6.96e-09)|all_epithelial(64;4.86e-09)|Lung NSC(181;0.01)|all_lung(186;0.016)|Esophageal squamous(72;0.0274)		STAD - Stomach adenocarcinoma(171;0.215)			GGCTGGCCTGGATCCCACAGC	0.552													12	68	---	---	---	---	PASS
GNB2	2783	broad.mit.edu	37	7	100274933	100274933	+	Intron	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100274933T>C	uc003uwb.2	+						GNB2_uc003uwc.2_Intron|GNB2_uc010lhd.2_Intron|GNB2_uc010lhe.2_Intron|GNB2_uc003uwd.2_Intron|GNB2_uc010lhf.2_Intron|GNB2_uc003uwe.2_Intron|GNB2_uc003uwf.2_5'UTR	NM_005273	NP_005264	P62879	GBB2_HUMAN	guanine nucleotide-binding protein, beta-2						cellular response to glucagon stimulus|energy reserve metabolic process|G-protein coupled receptor protein signaling pathway|synaptic transmission	perinuclear region of cytoplasm|plasma membrane	GTPase activity|GTPase binding|signal transducer activity			ovary(2)	2	Lung NSC(181;0.035)|all_lung(186;0.0509)|Esophageal squamous(72;0.0817)	Ovarian(593;0.238)				GTGTCTTGTTTTCACGCCACC	0.403													5	24	---	---	---	---	PASS
DNAJB9	4189	broad.mit.edu	37	7	108212184	108212184	+	Missense_Mutation	SNP	A	C	C	rs78948360		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:108212184A>C	uc003vfn.2	+	2	216	c.14A>C	c.(13-15)CAG>CCG	p.Q5P	THAP5_uc003vfl.2_5'Flank|THAP5_uc003vfm.2_5'Flank	NM_012328	NP_036460	Q9UBS3	DNJB9_HUMAN	DnaJ (Hsp40) homolog, subfamily B, member 9	5					ER-associated protein catabolic process|protein folding	endoplasmic reticulum|nucleolus	heat shock protein binding|misfolded protein binding|unfolded protein binding				0						GCTACTCCCCAGTCAATTTTC	0.318													13	85	---	---	---	---	PASS
FOXP2	93986	broad.mit.edu	37	7	114299626	114299626	+	Splice_Site	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:114299626G>C	uc003vhb.2	+	13	1920	c.1546_splice	c.e13-1	p.A516_splice	FOXP2_uc003vgu.2_Splice_Site|FOXP2_uc003vgz.2_Splice_Site_p.A541_splice|FOXP2_uc003vha.2_Splice_Site_p.A424_splice|FOXP2_uc011kmu.1_Splice_Site_p.A533_splice|FOXP2_uc011kmv.1_Splice_Site_p.A515_splice|FOXP2_uc010ljz.1_Splice_Site_p.A331_splice|FOXP2_uc003vhe.1_Splice_Site_p.A86_splice	NM_014491	NP_055306	O15409	FOXP2_HUMAN	forkhead box P2 isoform I						camera-type eye development|caudate nucleus development|cerebellum development|cerebral cortex development|embryo development|growth|lung alveolus development|negative regulation of transcription, DNA-dependent|pattern specification process|positive regulation of epithelial cell proliferation involved in lung morphogenesis|positive regulation of mesenchymal cell proliferation|post-embryonic development|putamen development|regulation of sequence-specific DNA binding transcription factor activity|righting reflex|skeletal muscle tissue development|smooth muscle tissue development|vocal learning	cytoplasm|transcription factor complex	chromatin binding|DNA bending activity|double-stranded DNA binding|promoter binding|protein heterodimerization activity|protein homodimerization activity|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding|zinc ion binding			ovary(4)|pancreas(1)|lung(1)|breast(1)|skin(1)	8						TCTCATTTCAGGCTATCATGG	0.363													14	130	---	---	---	---	PASS
TES	26136	broad.mit.edu	37	7	115897562	115897562	+	3'UTR	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:115897562C>T	uc003vho.2	+	7					TES_uc011kmy.1_3'UTR|TES_uc003vhp.2_3'UTR	NM_015641	NP_056456	Q9UGI8	TES_HUMAN	testin isoform 1						negative regulation of cell proliferation	cytoplasm|focal adhesion|nucleus|protein complex	zinc ion binding				0	Lung NSC(10;0.0137)|all_lung(10;0.0148)	Breast(660;0.0602)	STAD - Stomach adenocarcinoma(10;0.00878)			AAGTATCGAGCCATAGCTATC	0.393													4	13	---	---	---	---	PASS
LMOD2	442721	broad.mit.edu	37	7	123302335	123302335	+	Missense_Mutation	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:123302335T>C	uc003vky.2	+	2	852	c.695T>C	c.(694-696)TTT>TCT	p.F232S		NM_207163	NP_997046	Q6P5Q4	LMOD2_HUMAN	leiomodin 2 (cardiac)	232						cytoskeleton	actin binding|tropomyosin binding				0						CTTACCCGCTTTGCTGAAGCC	0.488													5	21	---	---	---	---	PASS
FAM40B	57464	broad.mit.edu	37	7	129110495	129110495	+	Nonsense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:129110495C>G	uc011koy.1	+	18	1923	c.1883C>G	c.(1882-1884)TCA>TGA	p.S628*	FAM40B_uc003vow.2_Nonsense_Mutation_p.S628*|FAM40B_uc011koz.1_Nonsense_Mutation_p.S120*	NM_020704	NP_065755	Q9ULQ0	FA40B_HUMAN	hypothetical protein LOC57464 isoform a	628											0						TACAGCATCTCAGTCCTGGAT	0.463													4	42	---	---	---	---	PASS
AKR1B15	441282	broad.mit.edu	37	7	134261766	134261766	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:134261766A>G	uc011kpr.1	+	10	1176	c.877A>G	c.(877-879)ATG>GTG	p.M293V	AKR1B15_uc011kps.1_Missense_Mutation_p.M265V	NM_001080538	NP_001074007	C9JRZ8	AK1BF_HUMAN	aldo-keto reductase family 1, member B15	293	NADP (By similarity).						oxidoreductase activity			ovary(1)	1						CCCCAAGTCTATGACACCAGC	0.517													5	120	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	7	142143823	142143823	+	Intron	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142143823G>T	uc011kro.1	+						uc011krp.1_Intron|uc011krr.1_Intron|uc003vys.1_RNA					SubName: Full=V_segment translation product; Flags: Fragment;																		CCCCTTGCCTGGGTCTTGTCG	0.488													29	78	---	---	---	---	PASS
TAS2R60	338398	broad.mit.edu	37	7	143141091	143141091	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143141091C>T	uc011ktg.1	+	1	546	c.546C>T	c.(544-546)GGC>GGT	p.G182G	uc003wda.2_Intron	NM_177437	NP_803186	P59551	T2R60_HUMAN	taste receptor, type 2, member 60	182	Extracellular (Potential).				sensory perception of bitter taste	integral to membrane	G-protein coupled receptor activity			skin(6)	6	Melanoma(164;0.172)					ATGTCACTGGCGATAGCATAC	0.408													11	226	---	---	---	---	PASS
ABCB8	11194	broad.mit.edu	37	7	150733073	150733073	+	Intron	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150733073G>C	uc003wil.3	+						ABCB8_uc003wii.2_Intron|ABCB8_uc003wij.3_Intron|ABCB8_uc010lpw.1_Missense_Mutation_p.E210Q|ABCB8_uc010lpx.2_Intron|ABCB8_uc011kvd.1_Intron|ABCB8_uc003wim.3_Intron|ABCB8_uc003wik.3_Intron	NM_007188	NP_009119	Q9NUT2	ABCB8_HUMAN	ATP-binding cassette, sub-family B, member 8							ATP-binding cassette (ABC) transporter complex|integral to membrane|membrane fraction|mitochondrial inner membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			breast(2)|upper_aerodigestive_tract(1)	3			OV - Ovarian serous cystadenocarcinoma(82;0.0121)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)		TGGGAGGGCGGAGCACAAAGC	0.647													5	23	---	---	---	---	PASS
CLN8	2055	broad.mit.edu	37	8	1728460	1728460	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:1728460G>A	uc003wpo.3	+	3	893	c.588G>A	c.(586-588)CTG>CTA	p.L196L		NM_018941	NP_061764	Q9UBY8	CLN8_HUMAN	ceroid-lipofuscinosis, neuronal 8	196	TLC.				cell death|ceramide biosynthetic process|cholesterol metabolic process|lipid transport|negative regulation of proteolysis|phospholipid metabolic process	endoplasmic reticulum membrane|ER-Golgi intermediate compartment membrane|integral to membrane				ovary(1)|central_nervous_system(1)|skin(1)	3		Ovarian(12;0.0563)|Colorectal(14;0.0815)|Hepatocellular(245;0.0831)		BRCA - Breast invasive adenocarcinoma(11;7.67e-05)|READ - Rectum adenocarcinoma(644;0.0913)		ACCAGTGGCTGATGATTCACA	0.517													19	54	---	---	---	---	PASS
MCPH1	79648	broad.mit.edu	37	8	6312749	6312749	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:6312749G>C	uc003wqi.2	+	9	1979	c.1911G>C	c.(1909-1911)TTG>TTC	p.L637F		NM_024596	NP_078872	Q8NEM0	MCPH1_HUMAN	microcephalin	637						microtubule organizing center				central_nervous_system(1)|skin(1)	2		Hepatocellular(245;0.0663)		Colorectal(4;0.0505)		ATGAGGAATTGAAGAAAAGTG	0.368													24	106	---	---	---	---	PASS
C8orf74	203076	broad.mit.edu	37	8	10555323	10555323	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:10555323G>A	uc003wtd.1	+	3	485	c.456G>A	c.(454-456)CCG>CCA	p.P152P	C8orf74_uc003wte.1_RNA	NM_001040032	NP_001035121	Q6P047	CH074_HUMAN	hypothetical protein LOC203076	152											0				COAD - Colon adenocarcinoma(149;0.0811)		ATCCCCTCCCGCTGGCCGAGG	0.652													17	36	---	---	---	---	PASS
UNC5D	137970	broad.mit.edu	37	8	35541109	35541109	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:35541109C>T	uc003xjr.1	+	5	943	c.615C>T	c.(613-615)GAC>GAT	p.D205D	UNC5D_uc003xjs.1_Silent_p.D200D|UNC5D_uc003xjt.1_Translation_Start_Site	NM_080872	NP_543148	Q6UXZ4	UNC5D_HUMAN	unc-5 homolog D precursor	205	Extracellular (Potential).|Ig-like C2-type.				apoptosis|axon guidance	integral to membrane	receptor activity			upper_aerodigestive_tract(2)|ovary(2)|pancreas(1)|skin(1)	6				READ - Rectum adenocarcinoma(1;1.31e-05)|Colorectal(1;0.000723)		CTGAACAAGACGAGAACATTG	0.463													3	27	---	---	---	---	PASS
ADAM2	2515	broad.mit.edu	37	8	39604118	39604118	+	Nonsense_Mutation	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:39604118T>A	uc003xnj.2	-	19	2122	c.2047A>T	c.(2047-2049)AAA>TAA	p.K683*	ADAM2_uc003xnk.2_Nonsense_Mutation_p.K664*|ADAM2_uc011lck.1_Nonsense_Mutation_p.K620*|ADAM2_uc003xnl.2_Nonsense_Mutation_p.K527*	NM_001464	NP_001455	Q99965	ADAM2_HUMAN	ADAM metallopeptidase domain 2 proprotein	683	Extracellular (Potential).				cell adhesion|fusion of sperm to egg plasma membrane|proteolysis	integral to plasma membrane	integrin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2		all_cancers(7;2.38e-28)|all_epithelial(6;8.85e-21)|all_lung(54;1.24e-07)|Lung NSC(58;1.94e-07)|Hepatocellular(245;0.00745)|Breast(189;0.00908)|Renal(179;0.0183)|Colorectal(162;0.246)	LUSC - Lung squamous cell carcinoma(45;0.000149)	READ - Rectum adenocarcinoma(644;0.0689)|Kidney(114;0.162)		CTCATTGGTTTGGAATGGTAA	0.294													17	106	---	---	---	---	PASS
CHRNB3	1142	broad.mit.edu	37	8	42585836	42585836	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:42585836C>A	uc003xpi.1	+	4	477	c.349C>A	c.(349-351)CTC>ATC	p.L117I		NM_000749	NP_000740	Q05901	ACHB3_HUMAN	cholinergic receptor, nicotinic, beta	117	Extracellular (Potential).				synaptic transmission, cholinergic	cell junction|nicotinic acetylcholine-gated receptor-channel complex|postsynaptic membrane	nicotinic acetylcholine-activated cation-selective channel activity|receptor activity			ovary(1)	1	all_lung(13;5.7e-12)|Lung NSC(13;1.6e-10)|Ovarian(28;0.00579)|Prostate(17;0.0119)|Lung SC(25;0.184)	all_lung(54;0.00026)|Lung NSC(58;0.000992)|Hepatocellular(245;0.0524)|Renal(179;0.0822)|Esophageal squamous(32;0.0954)	Lung(22;0.0199)|LUSC - Lung squamous cell carcinoma(45;0.0869)			TGACATAGTTCTCTTTGAAAA	0.299													14	34	---	---	---	---	PASS
EFCAB1	79645	broad.mit.edu	37	8	49642408	49642408	+	Missense_Mutation	SNP	C	G	G	rs145734570	byFrequency	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:49642408C>G	uc003xqo.2	-	4	502	c.342G>C	c.(340-342)TTG>TTC	p.L114F	EFCAB1_uc003xqn.3_Intron|EFCAB1_uc011ldj.1_Missense_Mutation_p.L62F|EFCAB1_uc010lxx.2_Intron|EFCAB1_uc011ldk.1_Intron	NM_024593	NP_078869	Q9HAE3	EFCB1_HUMAN	EF-hand calcium binding domain 1 isoform a	114	2 (Potential).|EF-hand 2.						calcium ion binding				0		all_epithelial(80;0.0134)|Lung NSC(129;0.0207)|all_lung(136;0.0464)				CGTCACCATTCAAATCAAACA	0.348													5	56	---	---	---	---	PASS
SOX17	64321	broad.mit.edu	37	8	55372575	55372575	+	3'UTR	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:55372575A>G	uc003xsb.3	+	2						NM_022454	NP_071899	Q9H6I2	SOX17_HUMAN	SRY-box 17						angiogenesis|cardiac cell fate determination|endocardial cell differentiation|endocardium formation|endoderm formation|heart formation|heart looping|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cell growth|outflow tract morphogenesis|positive regulation of transcription, DNA-dependent|protein destabilization|protein stabilization|regulation of embryonic development|renal system development|vasculogenesis|Wnt receptor signaling pathway	transcription factor complex	beta-catenin binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|transcription factor binding|transcription regulatory region DNA binding			lung(1)	1		Lung NSC(129;0.109)|all_epithelial(80;0.176)|all_lung(136;0.181)	OV - Ovarian serous cystadenocarcinoma(7;1.9e-07)|Epithelial(17;1.7e-05)|all cancers(17;0.000159)			GATCCGCCCCAGCCTGCAGGC	0.542													4	35	---	---	---	---	PASS
RP1	6101	broad.mit.edu	37	8	55534676	55534676	+	Splice_Site	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:55534676G>T	uc003xsd.1	+	3	764	c.616_splice	c.e3-1	p.V206_splice	RP1_uc011ldy.1_Splice_Site_p.V206_splice	NM_006269	NP_006260	P56715	RP1_HUMAN	retinitis pigmentosa RP1 protein						axoneme assembly|intracellular signal transduction|photoreceptor cell maintenance|photoreceptor cell outer segment organization|phototransduction, visible light|retinal cone cell development|retinal rod cell development	cilium axoneme|cytoplasm|microtubule|microtubule associated complex|photoreceptor connecting cilium|photoreceptor inner segment|photoreceptor outer segment	microtubule binding			skin(7)|ovary(4)|pancreas(1)	12		all_lung(136;0.0831)|Lung NSC(129;0.109)|all_epithelial(80;0.123)	OV - Ovarian serous cystadenocarcinoma(7;4.4e-07)|Epithelial(17;3.37e-05)|all cancers(17;0.000285)			GTCTCTTTTAGGTTCCCAGCC	0.433													4	46	---	---	---	---	PASS
TGS1	96764	broad.mit.edu	37	8	56698335	56698335	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:56698335A>T	uc003xsj.3	+	3	611	c.224A>T	c.(223-225)CAT>CTT	p.H75L	TGS1_uc010lyh.2_5'UTR	NM_024831	NP_079107	Q96RS0	TGS1_HUMAN	trimethylguanosine synthase homolog	75					cellular lipid metabolic process|ncRNA metabolic process|regulation of transcription, DNA-dependent|RNA capping|spliceosomal snRNP assembly|transcription, DNA-dependent	Cajal body|cytosol	RNA trimethylguanosine synthase activity			ovary(1)|lung(1)|breast(1)	3		all_lung(136;0.119)|all_epithelial(80;0.125)|Lung NSC(129;0.147)	Epithelial(17;0.00027)|all cancers(17;0.00251)			GCAGAATCACATGACAGCAAA	0.413													31	55	---	---	---	---	PASS
TGS1	96764	broad.mit.edu	37	8	56715061	56715061	+	Missense_Mutation	SNP	A	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:56715061A>C	uc003xsj.3	+	9	2282	c.1895A>C	c.(1894-1896)AAT>ACT	p.N632T	TGS1_uc010lyh.2_Missense_Mutation_p.N536T	NM_024831	NP_079107	Q96RS0	TGS1_HUMAN	trimethylguanosine synthase homolog	632	Sufficient for catalytic activity.				cellular lipid metabolic process|ncRNA metabolic process|regulation of transcription, DNA-dependent|RNA capping|spliceosomal snRNP assembly|transcription, DNA-dependent	Cajal body|cytosol	RNA trimethylguanosine synthase activity			ovary(1)|lung(1)|breast(1)	3		all_lung(136;0.119)|all_epithelial(80;0.125)|Lung NSC(129;0.147)	Epithelial(17;0.00027)|all cancers(17;0.00251)			aaaaagGTGAATGGTCTGCCT	0.338													11	49	---	---	---	---	PASS
OSR2	116039	broad.mit.edu	37	8	99961627	99961627	+	Silent	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:99961627C>A	uc003yir.2	+	2	982	c.447C>A	c.(445-447)GGC>GGA	p.G149G	OSR2_uc010mbn.2_Silent_p.G149G|OSR2_uc003yiq.2_Silent_p.G149G|OSR2_uc011lgx.1_Silent_p.G270G	NM_001142462	NP_001135934	Q8N2R0	OSR2_HUMAN	odd-skipped related 2 isoform a	149					bone morphogenesis|chondrocyte differentiation|embryonic digit morphogenesis|embryonic forelimb morphogenesis|embryonic hindlimb morphogenesis|embryonic leg joint morphogenesis|embryonic skeletal joint morphogenesis|eyelid development in camera-type eye|head development|mesonephros development|metanephros development|middle ear morphogenesis|negative regulation of transcription from RNA polymerase II promoter|odontogenesis|osteoblast proliferation|palate development|positive regulation of bone mineralization|positive regulation of epithelial cell proliferation|positive regulation of transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|zinc ion binding			central_nervous_system(1)	1	Breast(36;4.14e-07)		OV - Ovarian serous cystadenocarcinoma(57;0.0136)			CCATCTCGGGCCTCAGTAAAT	0.532													14	218	---	---	---	---	PASS
ATP6V1C1	528	broad.mit.edu	37	8	104054610	104054610	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:104054610G>C	uc003ykz.3	+	3	420	c.175G>C	c.(175-177)GCT>CCT	p.A59P	ATP6V1C1_uc010mbz.2_5'UTR|ATP6V1C1_uc003yla.2_Missense_Mutation_p.A59P|ATP6V1C1_uc011lhl.1_Intron	NM_001695	NP_001686	P21283	VATC1_HUMAN	ATPase, H+ transporting, lysosomal V1 subunit	59					ATP hydrolysis coupled proton transport|cellular iron ion homeostasis|insulin receptor signaling pathway|transferrin transport	cytosol|plasma membrane|proton-transporting V-type ATPase, V1 domain	protein binding|proton-transporting ATPase activity, rotational mechanism				0	Lung NSC(17;0.000427)|all_lung(17;0.000533)		OV - Ovarian serous cystadenocarcinoma(57;3.57e-05)|STAD - Stomach adenocarcinoma(118;0.133)			AGATGAACTGGCTAAACTGGA	0.368													8	192	---	---	---	---	PASS
PKHD1L1	93035	broad.mit.edu	37	8	110412320	110412320	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110412320A>G	uc003yne.2	+	13	1132	c.1028A>G	c.(1027-1029)AAG>AGG	p.K343R		NM_177531	NP_803875	Q86WI1	PKHL1_HUMAN	fibrocystin L precursor	343	Extracellular (Potential).|IPT/TIG 3.				immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)			AGAGGCCTGAAGCTTGAGGTG	0.408										HNSCC(38;0.096)			6	172	---	---	---	---	PASS
CSMD3	114788	broad.mit.edu	37	8	113358347	113358347	+	Missense_Mutation	SNP	T	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113358347T>G	uc003ynu.2	-	41	6580	c.6421A>C	c.(6421-6423)ATA>CTA	p.I2141L	CSMD3_uc003yns.2_Missense_Mutation_p.I1343L|CSMD3_uc003ynt.2_Missense_Mutation_p.I2101L|CSMD3_uc011lhx.1_Missense_Mutation_p.I2037L	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	2141	Extracellular (Potential).|CUB 12.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63						GGTAGATTTATTGTCCATGTG	0.383										HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			45	167	---	---	---	---	PASS
TRPS1	7227	broad.mit.edu	37	8	116599614	116599614	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:116599614G>C	uc003ynz.2	-	4	2734	c.2275C>G	c.(2275-2277)CCA>GCA	p.P759A	TRPS1_uc011lhy.1_Missense_Mutation_p.P763A|TRPS1_uc003yny.2_Missense_Mutation_p.P772A|TRPS1_uc010mcy.2_Missense_Mutation_p.P759A	NM_014112	NP_054831	Q9UHF7	TRPS1_HUMAN	zinc finger transcription factor TRPS1	759	Mediates interaction with GLI3.				negative regulation of transcription from RNA polymerase II promoter|NLS-bearing substrate import into nucleus|regulation of chondrocyte differentiation|skeletal system development|transcription from RNA polymerase II promoter	nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(2)|skin(2)|pancreas(1)|lung(1)|kidney(1)	7	all_cancers(13;5.44e-23)|all_epithelial(1;2.14e-27)|Lung NSC(37;2.55e-05)|Ovarian(258;0.0219)		Epithelial(1;9.78e-37)|all cancers(1;3.14e-31)|BRCA - Breast invasive adenocarcinoma(1;2.56e-12)			TCAGAAACTGGCTCTCCCATT	0.493									Langer-Giedion_syndrome				35	439	---	---	---	---	PASS
HSF1	3297	broad.mit.edu	37	8	145535686	145535686	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145535686G>C	uc003zbt.3	+	9	1068	c.898G>C	c.(898-900)GAG>CAG	p.E300Q	HSF1_uc003zbu.3_RNA	NM_005526	NP_005517	Q00613	HSF1_HUMAN	heat shock transcription factor 1	300	Regulatory domain.			E->A: Derepression of transcriptional activity at control temperature by 11%.		cytoplasm	protein binding|sequence-specific DNA binding transcription factor activity				0	all_cancers(97;6.64e-12)|all_epithelial(106;2.89e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;3.94e-40)|Epithelial(56;1.12e-39)|all cancers(56;9.11e-35)|BRCA - Breast invasive adenocarcinoma(115;0.0547)|Colorectal(110;0.055)			TGTCAAGGAGGAGCCCCCCAG	0.701													5	13	---	---	---	---	PASS
FBXL6	26233	broad.mit.edu	37	8	145580795	145580795	+	Intron	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145580795G>A	uc003zcb.2	-						C8ORFK29_uc011llb.1_5'Flank|C8ORFK29_uc010mfw.2_5'Flank|C8ORFK29_uc003zby.3_5'Flank|FBXL6_uc003zbz.2_5'UTR|FBXL6_uc003zca.2_Intron|FBXL6_uc010mfx.2_5'UTR|GPR172A_uc003zcc.1_5'Flank|GPR172A_uc003zcd.1_5'Flank|GPR172A_uc003zce.1_5'Flank|GPR172A_uc010mfy.1_5'Flank|GPR172A_uc003zcf.1_5'Flank|GPR172A_uc011llc.1_5'Flank	NM_012162	NP_036294	Q8N531	FBXL6_HUMAN	F-box and leucine-rich repeat protein 6 isoform						proteolysis		ubiquitin-protein ligase activity			ovary(1)|lung(1)	2	all_cancers(97;6.64e-12)|all_epithelial(106;2.89e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;4.43e-40)|Epithelial(56;1.48e-39)|all cancers(56;1.49e-34)|BRCA - Breast invasive adenocarcinoma(115;0.0441)|Colorectal(110;0.055)			CGGGGAGACAGAGGGGCAGCT	0.607													6	34	---	---	---	---	PASS
KIFC2	90990	broad.mit.edu	37	8	145693255	145693255	+	Nonsense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145693255C>G	uc003zcz.2	+	7	760	c.695C>G	c.(694-696)TCA>TGA	p.S232*	CYHR1_uc003zcv.2_5'Flank|CYHR1_uc003zcw.2_5'Flank|CYHR1_uc003zcx.2_5'Flank|CYHR1_uc003zcy.2_5'Flank	NM_145754	NP_665697	Q96AC6	KIFC2_HUMAN	kinesin family member C2	232	Potential.|Gln-rich.				microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity|protein binding			ovary(2)|central_nervous_system(1)	3	all_cancers(97;4.61e-11)|all_epithelial(106;2.89e-10)|Lung NSC(106;5.7e-05)|all_lung(105;0.000174)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;1.08e-41)|Epithelial(56;8.67e-41)|all cancers(56;1.1e-35)|BRCA - Breast invasive adenocarcinoma(115;0.035)|Colorectal(110;0.055)			GCGACGGACTCAGAGAAAAGG	0.667											OREG0019057	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	4	59	---	---	---	---	PASS
ZNF16	7564	broad.mit.edu	37	8	146157055	146157055	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:146157055C>A	uc003zet.2	-	4	1305	c.1118G>T	c.(1117-1119)GGA>GTA	p.G373V	ZNF16_uc003zeu.2_Missense_Mutation_p.G373V	NM_001029976	NP_001025147	P17020	ZNF16_HUMAN	zinc finger protein 16	373					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(5)	5	all_cancers(97;8.72e-12)|all_epithelial(106;1.07e-10)|Lung NSC(106;7.18e-05)|all_lung(105;0.00021)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)	Acute lymphoblastic leukemia(644;0.136)	Epithelial(56;3.45e-38)|all cancers(56;3.04e-33)|BRCA - Breast invasive adenocarcinoma(115;0.0424)|Colorectal(110;0.055)	GBM - Glioblastoma multiforme(99;0.02)|KIRC - Kidney renal clear cell carcinoma(644;0.0486)		AGGCTTCTCTCCTGTGTGAGT	0.532													4	115	---	---	---	---	PASS
MLLT3	4300	broad.mit.edu	37	9	20620762	20620762	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:20620762G>A	uc003zoe.2	-	2	343	c.84C>T	c.(82-84)TTC>TTT	p.F28F	MLLT3_uc011lne.1_5'UTR|MLLT3_uc011lnf.1_Silent_p.F25F|MLLT3_uc003zof.2_5'UTR|MLLT3_uc011lng.1_5'UTR	NM_004529	NP_004520	P42568	AF9_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	28	YEATS.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding			lung(2)|ovary(1)	3				GBM - Glioblastoma multiforme(3;4.35e-105)|Lung(42;3.48e-06)|LUSC - Lung squamous cell carcinoma(42;7.92e-05)		AGTCGTGGGTGAAGCCCTCCA	0.602			T	MLL	ALL								21	119	---	---	---	---	PASS
ZCCHC7	84186	broad.mit.edu	37	9	37126516	37126516	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:37126516G>C	uc003zzq.2	+	2	360	c.187G>C	c.(187-189)GAA>CAA	p.E63Q	ZCCHC7_uc011lqh.1_Intron|ZCCHC7_uc011lqi.1_Missense_Mutation_p.E62Q|ZCCHC7_uc010mlt.2_Missense_Mutation_p.E62Q|ZCCHC7_uc003zzs.1_Missense_Mutation_p.E62Q	NM_032226	NP_115602	Q8N3Z6	ZCHC7_HUMAN	zinc finger, CCHC domain containing 7	63							nucleic acid binding|zinc ion binding			ovary(1)|central_nervous_system(1)|skin(1)	3				GBM - Glioblastoma multiforme(29;0.0137)		TGGGAATTCGGAATCTTCGAG	0.423													10	226	---	---	---	---	PASS
ANKRD20A3	441425	broad.mit.edu	37	9	42368547	42368547	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:42368547G>A	uc004acd.2	+	1	245	c.133G>A	c.(133-135)GAC>AAC	p.D45N	ANKRD20A3_uc010mmv.2_Missense_Mutation_p.D45N	NM_001012419	NP_001012419	Q5VUR7	A20A3_HUMAN	ankyrin repeat domain 20 family, member A3	45											0						TGTCAAAGGCGACGCCGCGGA	0.677													5	68	---	---	---	---	PASS
VPS13A	23230	broad.mit.edu	37	9	79890500	79890500	+	Silent	SNP	A	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:79890500A>C	uc004akr.2	+	25	2859	c.2599A>C	c.(2599-2601)AGA>CGA	p.R867R	VPS13A_uc004akp.3_Silent_p.R867R|VPS13A_uc004akq.3_Silent_p.R867R|VPS13A_uc004aks.2_Silent_p.R867R	NM_033305	NP_150648	Q96RL7	VP13A_HUMAN	vacuolar protein sorting 13A isoform A	867					Golgi to endosome transport|protein transport	intracellular	protein binding			pancreas(3)|skin(3)|ovary(2)|large_intestine(1)|central_nervous_system(1)	10						TATTCGAACCAGAAAGTTACA	0.348													30	170	---	---	---	---	PASS
CEP78	84131	broad.mit.edu	37	9	80881397	80881397	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:80881397C>G	uc004akx.2	+	15	2113	c.1837C>G	c.(1837-1839)CTC>GTC	p.L613V	CEP78_uc004aky.3_Missense_Mutation_p.L630V|CEP78_uc010mpp.2_Missense_Mutation_p.L614V|CEP78_uc004akz.1_Missense_Mutation_p.L101V	NM_032171	NP_115547	Q5JTW2	CEP78_HUMAN	centrosomal protein 78kDa isoform b	613					G2/M transition of mitotic cell cycle	centrosome|cytosol		p.L613L(1)		ovary(1)	1						TCCTTTGCCTCTCGACTCCTT	0.428													8	62	---	---	---	---	PASS
FLJ46321	389763	broad.mit.edu	37	9	84608089	84608089	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:84608089A>G	uc004amn.2	+	4	2751	c.2704A>G	c.(2704-2706)ATG>GTG	p.M902V		NM_001001670	NP_001001670	Q6ZQQ2	F75D1_HUMAN	hypothetical protein LOC389763	902						integral to membrane					0						CAAACAAAAGATGTTGGAAGC	0.433													4	63	---	---	---	---	PASS
PTCH1	5727	broad.mit.edu	37	9	98239043	98239043	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:98239043C>G	uc004avk.3	-	11	1788	c.1600G>C	c.(1600-1602)GAG>CAG	p.E534Q	PTCH1_uc010mro.2_Missense_Mutation_p.E383Q|PTCH1_uc010mrp.2_Missense_Mutation_p.E383Q|PTCH1_uc010mrq.2_Missense_Mutation_p.E383Q|PTCH1_uc004avl.3_Missense_Mutation_p.E383Q|PTCH1_uc010mrr.2_Missense_Mutation_p.E468Q|PTCH1_uc004avm.3_Missense_Mutation_p.E533Q|PTCH1_uc010mrs.1_Missense_Mutation_p.E202Q	NM_000264	NP_000255	Q13635	PTC1_HUMAN	patched isoform L	534	SSD.|Cytoplasmic (Potential).				embryonic limb morphogenesis|negative regulation of multicellular organism growth|protein processing|regulation of smoothened signaling pathway|smoothened signaling pathway	integral to plasma membrane	hedgehog receptor activity			skin(242)|central_nervous_system(72)|bone(33)|upper_aerodigestive_tract(11)|lung(6)|large_intestine(4)|breast(4)|oesophagus(3)|ovary(3)|vulva(1)	379		Medulloblastoma(1;7.87e-06)|all_neural(1;0.000555)|Acute lymphoblastic leukemia(62;0.136)				TGCATTACCTCAAAAGGGATT	0.423									Basal_Cell_Nevus_syndrome				4	23	---	---	---	---	PASS
TMEM38B	55151	broad.mit.edu	37	9	108472984	108472984	+	Intron	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:108472984T>C	uc004bcu.1	+						TMEM38B_uc010mtn.1_Intron|uc004bcv.2_RNA	NM_018112	NP_060582	Q9NVV0	TM38B_HUMAN	transmembrane protein 38B							integral to membrane|nuclear membrane|sarcoplasmic reticulum membrane	potassium channel activity			ovary(1)|skin(1)	2						ATTCACACCGTAAATCTTCAG	0.468													3	54	---	---	---	---	PASS
EPB41L4B	54566	broad.mit.edu	37	9	112018480	112018480	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:112018480G>C	uc004bdz.1	-	9	1160	c.865C>G	c.(865-867)CTT>GTT	p.L289V	EPB41L4B_uc004bea.2_Missense_Mutation_p.L289V	NM_019114	NP_061987	Q9H329	E41LB_HUMAN	erythrocyte membrane protein band 4.1 like 4B	289	FERM.					cytoplasm|cytoskeleton|extrinsic to membrane	cytoskeletal protein binding|structural constituent of cytoskeleton			ovary(1)|central_nervous_system(1)|skin(1)	3						GTCAGTCCAAGAGAATATTCA	0.368													30	159	---	---	---	---	PASS
PTPN3	5774	broad.mit.edu	37	9	112185044	112185044	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:112185044C>G	uc004bed.2	-	13	1202	c.1090G>C	c.(1090-1092)GAA>CAA	p.E364Q	PTPN3_uc004beb.2_Missense_Mutation_p.E233Q|PTPN3_uc004bec.2_Intron|PTPN3_uc010mtu.2_RNA|PTPN3_uc011lwg.1_Intron|PTPN3_uc011lwh.1_Intron|PTPN3_uc011lwe.1_Missense_Mutation_p.E77Q|PTPN3_uc011lwf.1_Intron	NM_002829	NP_002820	P26045	PTN3_HUMAN	protein tyrosine phosphatase, non-receptor type	364					negative regulation of membrane protein ectodomain proteolysis|negative regulation of mitotic cell cycle	cytoplasm|cytoskeleton|internal side of plasma membrane	ATPase binding|cytoskeletal protein binding|phosphotyrosine binding|protein tyrosine phosphatase activity			ovary(3)	3						CTCTTGGTTTCTAAGTGCTCC	0.448													5	212	---	---	---	---	PASS
SVEP1	79987	broad.mit.edu	37	9	113198707	113198707	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:113198707A>T	uc010mtz.2	-	28	5054	c.4717T>A	c.(4717-4719)TCC>ACC	p.S1573T		NM_153366	NP_699197	Q4LDE5	SVEP1_HUMAN	polydom	1573	Pentaxin.				cell adhesion	cytoplasm|extracellular region|membrane	calcium ion binding			ovary(7)	7						TGGCTTATGGAGCCCACAAAA	0.473													4	104	---	---	---	---	PASS
DFNB31	25861	broad.mit.edu	37	9	117240927	117240927	+	Missense_Mutation	SNP	G	A	A	rs141863996		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:117240927G>A	uc004biz.3	-	2	1392	c.743C>T	c.(742-744)TCG>TTG	p.S248L	DFNB31_uc004biy.3_5'UTR|DFNB31_uc004bja.3_Missense_Mutation_p.S248L|DFNB31_uc004bjb.2_Missense_Mutation_p.S248L	NM_015404	NP_056219	Q9P202	WHRN_HUMAN	CASK-interacting protein CIP98 isoform 1	248					inner ear receptor stereocilium organization|retina homeostasis|sensory perception of light stimulus|sensory perception of sound	cytoplasm|growth cone|stereocilium				ovary(4)|central_nervous_system(1)|pancreas(1)	6						GGGCAGGCCCGAGGGTGGGGA	0.662													7	11	---	---	---	---	PASS
PAPPA	5069	broad.mit.edu	37	9	118949701	118949701	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:118949701C>G	uc004bjn.2	+	2	1065	c.684C>G	c.(682-684)TTC>TTG	p.F228L	PAPPA_uc011lxp.1_Missense_Mutation_p.F21L|PAPPA_uc011lxq.1_Missense_Mutation_p.F21L	NM_002581	NP_002572	Q13219	PAPP1_HUMAN	pregnancy-associated plasma protein A	228					cell differentiation|female pregnancy	cytoplasm|extracellular region|membrane	metalloendopeptidase activity|zinc ion binding			ovary(4)|skin(4)|pancreas(1)	9						GTGGCATATTCAGCCCACTGA	0.547													16	60	---	---	---	---	PASS
C5	727	broad.mit.edu	37	9	123716141	123716141	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:123716141C>T	uc004bkv.2	-	40	4798	c.4768G>A	c.(4768-4770)GCT>ACT	p.A1590T		NM_001735	NP_001726	P01031	CO5_HUMAN	complement component 5 preproprotein	1590	NTR.				activation of MAPK activity|chemotaxis|complement activation, alternative pathway|complement activation, classical pathway|cytolysis|G-protein coupled receptor protein signaling pathway|inflammatory response|negative regulation of macrophage chemotaxis|positive regulation of chemokine secretion|positive regulation vascular endothelial growth factor production	extracellular space|membrane attack complex	chemokine activity|endopeptidase inhibitor activity			ovary(2)	2				OV - Ovarian serous cystadenocarcinoma(323;4.98e-53)|GBM - Glioblastoma multiforme(294;0.0242)	Eculizumab(DB01257)	TCAGCAACAGCTTCCCCTGAG	0.383													21	100	---	---	---	---	PASS
CIZ1	25792	broad.mit.edu	37	9	130940682	130940682	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:130940682C>G	uc004btt.2	-	9	1749	c.1586G>C	c.(1585-1587)GGA>GCA	p.G529A	CIZ1_uc004btr.2_Missense_Mutation_p.G501A|CIZ1_uc004bts.2_Missense_Mutation_p.G500A|CIZ1_uc011maq.1_Missense_Mutation_p.G468A|CIZ1_uc004btu.2_Missense_Mutation_p.G449A|CIZ1_uc011mar.1_Missense_Mutation_p.G428A|CIZ1_uc011mas.1_Missense_Mutation_p.G559A|CIZ1_uc004btw.2_Missense_Mutation_p.G473A|CIZ1_uc004btv.2_Missense_Mutation_p.G529A	NM_001131016	NP_001124488	Q9ULV3	CIZ1_HUMAN	CDKN1A interacting zinc finger protein 1 isoform	529						nucleus	nucleic acid binding|protein binding|zinc ion binding			ovary(2)|central_nervous_system(2)	4						TTCACATTCTCCCACATCTAG	0.562													13	168	---	---	---	---	PASS
LAMC3	10319	broad.mit.edu	37	9	133927972	133927972	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:133927972G>C	uc004caa.1	+	10	1823	c.1725G>C	c.(1723-1725)CTG>CTC	p.L575L		NM_006059	NP_006050	Q9Y6N6	LAMC3_HUMAN	laminin, gamma 3 precursor	575	Laminin IV type A.				cell adhesion	basement membrane|membrane	structural molecule activity			ovary(2)|pancreas(1)	3	all_hematologic(7;0.0028)	Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;5.06e-05)|Epithelial(140;0.000551)		CTGTACAGCTGAGGCTGGAAG	0.642											OREG0019556	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	12	53	---	---	---	---	PASS
SETX	23064	broad.mit.edu	37	9	135204838	135204838	+	Missense_Mutation	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135204838T>C	uc004cbk.2	-	10	2330	c.2147A>G	c.(2146-2148)AAA>AGA	p.K716R	SETX_uc004cbj.2_Missense_Mutation_p.K335R|SETX_uc010mzt.2_Missense_Mutation_p.K335R	NM_015046	NP_055861	Q7Z333	SETX_HUMAN	senataxin	716					cell death|double-strand break repair|RNA processing	cytoplasm|nucleolus|nucleoplasm	ATP binding|DNA helicase activity			ovary(2)|skin(1)	3		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;6.82e-06)|Epithelial(140;0.000171)		AGAGATCTCTTTTACAGACTT	0.363													66	173	---	---	---	---	PASS
C9orf98	158067	broad.mit.edu	37	9	135601228	135601228	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135601228G>C	uc004cbu.1	-	13	1843	c.1287C>G	c.(1285-1287)GTC>GTG	p.V429V	C9orf98_uc010mzx.1_RNA|C9orf98_uc004cbv.1_Silent_p.V225V	NM_152572	NP_689785	Q96MA6	KAD8_HUMAN	putative adenylate kinase-like protein C9orf98	429	Adenylate kinase.					cytosol	adenylate kinase activity|ATP binding|cytidylate kinase activity				0				OV - Ovarian serous cystadenocarcinoma(145;4.89e-06)|Epithelial(140;0.00016)		TTTTCAGCTTGACCTGCTCTT	0.552													3	10	---	---	---	---	PASS
C9orf98	158067	broad.mit.edu	37	9	135702366	135702366	+	Nonsense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135702366G>C	uc004cbu.1	-	8	1188	c.632C>G	c.(631-633)TCA>TGA	p.S211*	C9orf98_uc010mzx.1_RNA|C9orf98_uc004cbv.1_Nonsense_Mutation_p.S7*	NM_152572	NP_689785	Q96MA6	KAD8_HUMAN	putative adenylate kinase-like protein C9orf98	211						cytosol	adenylate kinase activity|ATP binding|cytidylate kinase activity				0				OV - Ovarian serous cystadenocarcinoma(145;4.89e-06)|Epithelial(140;0.00016)		CTCCAGCTCTGAGATGTCCTC	0.502													5	287	---	---	---	---	PASS
FAM166A	401565	broad.mit.edu	37	9	140139656	140139656	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140139656C>G	uc004cmi.1	-	4	592	c.537G>C	c.(535-537)CAG>CAC	p.Q179H		NM_001001710	NP_001001710	Q6J272	F166A_HUMAN	hypothetical protein LOC401565	179										ovary(1)	1						ACTCATCCCTCTGGCAGTGGT	0.667													4	45	---	---	---	---	PASS
FAM166A	401565	broad.mit.edu	37	9	140139944	140139944	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140139944C>G	uc004cmi.1	-	3	392	c.337G>C	c.(337-339)GAG>CAG	p.E113Q		NM_001001710	NP_001001710	Q6J272	F166A_HUMAN	hypothetical protein LOC401565	113										ovary(1)	1						CCTGGCGGCTCCTGGGCGTCC	0.627													14	91	---	---	---	---	PASS
CACNA1B	774	broad.mit.edu	37	9	140907677	140907677	+	Missense_Mutation	SNP	T	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140907677T>G	uc004cog.2	+	18	2402	c.2257T>G	c.(2257-2259)TCC>GCC	p.S753A	CACNA1B_uc011mfd.1_Missense_Mutation_p.S284A	NM_000718	NP_000709	Q00975	CAC1B_HUMAN	calcium channel, voltage-dependent, N type,	753	Cytoplasmic (Potential).				membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	ATP binding|protein C-terminus binding|voltage-gated calcium channel activity			breast(3)|large_intestine(2)|ovary(1)	6	all_cancers(76;0.166)			OV - Ovarian serous cystadenocarcinoma(145;1.16e-05)|Epithelial(140;0.000476)	Amlodipine(DB00381)|Gabapentin(DB00996)	CGCGAACATCTCCATCGCCGC	0.602													7	26	---	---	---	---	PASS
PITRM1	10531	broad.mit.edu	37	10	3189301	3189301	+	Intron	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:3189301G>C	uc010qah.1	-						PITRM1_uc001igr.1_Intron|PITRM1_uc001igs.1_5'Flank|PITRM1_uc001igt.1_Intron|PITRM1_uc009xhv.1_Intron|PITRM1_uc001igu.1_Intron|PITRM1_uc010qai.1_Intron|uc001igv.1_RNA			E7ES23	E7ES23_HUMAN	SubName: Full=cDNA FLJ54065, moderately similar to Mus musculus pitrilysin metallepetidase 1 (Pitrm1), mRNA;						proteolysis		metalloendopeptidase activity|zinc ion binding			pancreas(1)	1						ATACTTAATAGAATGAATCAT	0.318													11	52	---	---	---	---	PASS
USP6NL	9712	broad.mit.edu	37	10	11505382	11505382	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:11505382G>A	uc001ikt.3	-	15	1866	c.1545C>T	c.(1543-1545)CTC>CTT	p.L515L	USP6NL_uc001iks.1_Silent_p.L532L	NM_014688	NP_055503	Q92738	US6NL_HUMAN	USP6 N-terminal like isoform 1	515						intracellular	Rab GTPase activator activity				0						CGGTAACTGCGAGCGCGGGGT	0.587													23	145	---	---	---	---	PASS
CUBN	8029	broad.mit.edu	37	10	16911847	16911847	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:16911847C>G	uc001ioo.2	-	59	9294	c.9242G>C	c.(9241-9243)AGT>ACT	p.S3081T	CUBN_uc009xjq.1_RNA|CUBN_uc009xjr.1_Missense_Mutation_p.S437T	NM_001081	NP_001072	O60494	CUBN_HUMAN	cubilin precursor	3081	CUB 23.				cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)	ATCAAAATCACTGAACCTGTG	0.413													12	64	---	---	---	---	PASS
CSTF2T	23283	broad.mit.edu	37	10	53458275	53458275	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:53458275G>C	uc001jjp.2	-	1	1081	c.1035C>G	c.(1033-1035)GTC>GTG	p.V345V	PRKG1_uc001jjm.2_Intron|PRKG1_uc001jjn.2_Intron|PRKG1_uc001jjo.2_Intron	NM_015235	NP_056050	Q9H0L4	CSTFT_HUMAN	cleavage stimulation factor, 3' pre-RNA, subunit	345	Gly-rich.				mRNA processing	nucleus	nucleotide binding|RNA binding			ovary(1)	1				COAD - Colon adenocarcinoma(2;0.00736)|Colorectal(2;0.00898)|all cancers(4;0.0188)|GBM - Glioblastoma multiforme(4;0.0778)|Epithelial(53;0.122)		CTTCTCCAGTGACTGAAAGCA	0.582													20	73	---	---	---	---	PASS
MYST4	23522	broad.mit.edu	37	10	76781861	76781861	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:76781861G>C	uc001jwn.1	+	16	3737	c.3244G>C	c.(3244-3246)GAA>CAA	p.E1082Q	MYST4_uc001jwm.1_Missense_Mutation_p.E790Q|MYST4_uc001jwo.1_Missense_Mutation_p.E790Q|MYST4_uc001jwp.1_Missense_Mutation_p.E899Q	NM_012330	NP_036462	Q8WYB5	MYST4_HUMAN	MYST histone acetyltransferase (monocytic	1082	Poly-Glu.				histone H3 acetylation|negative regulation of transcription, DNA-dependent|nucleosome assembly|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	MOZ/MORF histone acetyltransferase complex|nucleosome	DNA binding|histone acetyltransferase activity|transcription factor binding|zinc ion binding			central_nervous_system(5)|ovary(4)|lung(3)|breast(2)|skin(1)|prostate(1)	16	all_cancers(46;0.0347)|all_epithelial(25;0.00236)|Prostate(51;0.0112)|Ovarian(15;0.0964)					ggaggaggaagaagaggagga	0.274			T	CREBBP	AML						OREG0020273	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	3	67	---	---	---	---	PASS
CYP26A1	1592	broad.mit.edu	37	10	94836385	94836385	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:94836385G>C	uc001kil.2	+	6	1129	c.1084G>C	c.(1084-1086)GAG>CAG	p.E362Q	CYP26A1_uc001kik.1_Missense_Mutation_p.E293Q|CYP26A1_uc001kim.1_Missense_Mutation_p.E260Q	NM_000783	NP_000774	O43174	CP26A_HUMAN	cytochrome P450, family 26, subfamily A,	362					negative regulation of retinoic acid receptor signaling pathway|retinoic acid catabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|microsome	electron carrier activity|heme binding|oxygen binding|retinoic acid 4-hydroxylase activity|retinoic acid binding			upper_aerodigestive_tract(1)|ovary(1)|breast(1)	3		Colorectal(252;0.122)				TGTTATTAAGGAGACCCTTCG	0.388													22	77	---	---	---	---	PASS
TCTN3	26123	broad.mit.edu	37	10	97446269	97446269	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97446269C>G	uc001klb.3	-	7	1115	c.871G>C	c.(871-873)GAT>CAT	p.D291H	TCTN3_uc001kla.3_Missense_Mutation_p.D140H|TCTN3_uc010qoi.1_Missense_Mutation_p.D212H|TCTN3_uc001kld.2_Missense_Mutation_p.D309H|TCTN3_uc009xux.1_Missense_Mutation_p.D140H|TCTN3_uc009xuy.1_RNA	NM_015631	NP_056446	Q6NUS6	TECT3_HUMAN	tectonic 3 isoform a precursor	291	Extracellular (Potential).				apoptosis	integral to membrane					0		Colorectal(252;0.0815)		Epithelial(162;1.69e-07)|all cancers(201;5.63e-06)		TTCTGTGGATCAGTCATGCTT	0.398													14	155	---	---	---	---	PASS
CC2D2B	387707	broad.mit.edu	37	10	97775978	97775978	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97775978C>T	uc001kll.2	+	6	628	c.429C>T	c.(427-429)ATC>ATT	p.I143I	uc001klg.1_Intron|uc001klj.1_Intron|CC2D2B_uc001klk.2_Intron|CC2D2B_uc010qop.1_Silent_p.I143I	NM_001001732	NP_001001732	Q6DHV5	C2D2B_HUMAN	coiled-coil and C2 domain containing 2B isoform	143										ovary(1)	1		Colorectal(252;0.158)		Epithelial(162;7.08e-08)|all cancers(201;2.71e-06)		GTTTAGCTATCGGAAATAAGG	0.418													15	51	---	---	---	---	PASS
SEC31B	25956	broad.mit.edu	37	10	102265919	102265919	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102265919C>G	uc001krc.1	-	9	1024	c.922G>C	c.(922-924)GAT>CAT	p.D308H	SEC31B_uc010qpo.1_Missense_Mutation_p.D307H|SEC31B_uc001krd.1_5'UTR|SEC31B_uc001krf.1_5'UTR|SEC31B_uc001kre.1_5'UTR|SEC31B_uc001krg.1_5'UTR|SEC31B_uc010qpp.1_Missense_Mutation_p.D311H|SEC31B_uc009xwn.1_Missense_Mutation_p.D308H|SEC31B_uc009xwo.1_Missense_Mutation_p.D308H|SEC31B_uc010qpq.1_Missense_Mutation_p.D151H	NM_015490	NP_056305	Q9NQW1	SC31B_HUMAN	SEC31 homolog B	308	WD 6.				protein transport|vesicle-mediated transport	endoplasmic reticulum membrane|ER to Golgi transport vesicle membrane				ovary(1)	1		Colorectal(252;0.117)		Epithelial(162;2.36e-10)|all cancers(201;2.09e-08)		CACTGCACATCAAAGCACCAG	0.517													12	98	---	---	---	---	PASS
FAM178A	55719	broad.mit.edu	37	10	102676898	102676898	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102676898G>C	uc001krt.3	+	3	1298	c.756G>C	c.(754-756)TTG>TTC	p.L252F	FAM178A_uc001krr.1_Missense_Mutation_p.L252F|FAM178A_uc001krs.2_Missense_Mutation_p.L252F|FAM178A_uc001kru.1_Missense_Mutation_p.L188F	NM_018121	NP_060591	Q8IX21	F178A_HUMAN	hypothetical protein LOC55719 isoform 1	252											0						TAAAGAGGTTGAGAAAGGAGC	0.438													12	76	---	---	---	---	PASS
GBF1	8729	broad.mit.edu	37	10	104139673	104139673	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:104139673G>C	uc001kux.1	+	36	5077	c.4837G>C	c.(4837-4839)GAG>CAG	p.E1613Q	GBF1_uc001kuy.1_Missense_Mutation_p.E1609Q|GBF1_uc001kuz.1_Missense_Mutation_p.E1610Q	NM_004193	NP_004184	Q92538	GBF1_HUMAN	golgi-specific brefeldin A resistant guanine	1613					COPI coating of Golgi vesicle|post-Golgi vesicle-mediated transport|regulation of ARF protein signal transduction|retrograde vesicle-mediated transport, Golgi to ER	Golgi membrane	ARF guanyl-nucleotide exchange factor activity|protein binding			ovary(1)|central_nervous_system(1)	2		Colorectal(252;0.0236)		Epithelial(162;5.16e-08)|all cancers(201;1.19e-06)		GGGTGGGATGGAGGAGACCCG	0.547													6	32	---	---	---	---	PASS
SH3PXD2A	9644	broad.mit.edu	37	10	105495508	105495508	+	Silent	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105495508G>T	uc001kxj.1	-	4	428	c.288C>A	c.(286-288)CCC>CCA	p.P96P	SH3PXD2A_uc010qqu.1_Silent_p.P26P	NM_014631	NP_055446	Q5TCZ1	SPD2A_HUMAN	SH3 multiple domains 1	96	PX.				cell communication|superoxide metabolic process	cell junction|cell projection|cytoplasm|podosome	phosphatidylinositol binding|protein binding				0		Colorectal(252;0.0815)|Breast(234;0.131)		Epithelial(162;4.09e-10)|all cancers(201;2.73e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0119)		ATTCATCGATGGGCTTCAGTC	0.582													25	112	---	---	---	---	PASS
GRK5	2869	broad.mit.edu	37	10	121156215	121156215	+	Nonsense_Mutation	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:121156215T>A	uc001led.2	+	4	503	c.270T>A	c.(268-270)TAT>TAA	p.Y90*	GRK5_uc009xzh.2_5'UTR|GRK5_uc010qta.1_5'UTR	NM_005308	NP_005299	P34947	GRK5_HUMAN	G protein-coupled receptor kinase 5	90	N-terminal.|RGS.				G-protein signaling, coupled to cAMP nucleotide second messenger|regulation of G-protein coupled receptor protein signaling pathway|tachykinin receptor signaling pathway	cytoplasm|plasma membrane|soluble fraction	ATP binding|G-protein coupled receptor kinase activity|phospholipid binding|protein kinase C binding|signal transducer activity			lung(2)|stomach(1)	3		Lung NSC(174;0.0971)|all_lung(145;0.127)|Ovarian(717;0.249)		all cancers(201;0.0227)		AGGCAGAATATGAAGTTACTC	0.333													4	87	---	---	---	---	PASS
INPP5F	22876	broad.mit.edu	37	10	121541205	121541205	+	Silent	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:121541205A>G	uc001leo.2	+	3	403	c.237A>G	c.(235-237)GGA>GGG	p.G79G	INPP5F_uc001len.3_Silent_p.G79G	NM_014937	NP_055752	Q9Y2H2	SAC2_HUMAN	inositol polyphosphate-5-phosphatase F	79							phosphoric ester hydrolase activity			ovary(2)	2		Lung NSC(174;0.109)|all_lung(145;0.142)		all cancers(201;0.00205)|BRCA - Breast invasive adenocarcinoma(275;0.158)		AACTCCCAGGAGACCATGAGG	0.423													19	68	---	---	---	---	PASS
EPS8L2	64787	broad.mit.edu	37	11	721618	721618	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:721618G>A	uc001lqt.2	+	10	1069	c.822G>A	c.(820-822)CAG>CAA	p.Q274Q	EPS8L2_uc010qwj.1_Silent_p.Q290Q|EPS8L2_uc001lqu.2_Silent_p.Q274Q|EPS8L2_uc010qwk.1_Silent_p.Q290Q|EPS8L2_uc001lqv.2_Silent_p.Q229Q|EPS8L2_uc001lqw.2_5'UTR|EPS8L2_uc001lqx.2_5'Flank|EPS8L2_uc001lqy.2_5'Flank	NM_022772	NP_073609	Q9H6S3	ES8L2_HUMAN	epidermal growth factor receptor pathway	274						cytoplasm				pancreas(1)	1		all_cancers(49;1.24e-08)|all_epithelial(84;1.87e-05)|Breast(177;0.000286)|Ovarian(85;0.000953)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.106)|all_lung(207;0.136)		all cancers(45;4.37e-27)|Epithelial(43;2.81e-26)|OV - Ovarian serous cystadenocarcinoma(40;1.33e-20)|BRCA - Breast invasive adenocarcinoma(625;4.29e-05)|Lung(200;0.0582)|LUSC - Lung squamous cell carcinoma(625;0.0703)		CCCGGCTGCAGAAGGCAGCCG	0.557													6	5	---	---	---	---	PASS
TPP1	1200	broad.mit.edu	37	11	6638455	6638455	+	Intron	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6638455C>T	uc001mel.1	-						TPP1_uc001mek.1_Intron|TPP1_uc010rar.1_Silent_p.L195L	NM_000391	NP_000382	O14773	TPP1_HUMAN	tripeptidyl-peptidase I preproprotein						bone resorption|cell death|lipid metabolic process|lysosome organization|nervous system development|neuromuscular process controlling balance|peptide catabolic process|protein catabolic process|proteolysis	lysosome|melanosome|soluble fraction	metal ion binding|peptide binding|protein binding|serine-type endopeptidase activity|tripeptidyl-peptidase activity				0		Medulloblastoma(188;0.00263)|all_neural(188;0.026)		Epithelial(150;3.45e-09)|BRCA - Breast invasive adenocarcinoma(625;0.131)		ACCCCACCCCCAGTCCCCAAT	0.557													18	37	---	---	---	---	PASS
OR10A5	144124	broad.mit.edu	37	11	6867721	6867721	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6867721G>C	uc001met.1	+	1	808	c.808G>C	c.(808-810)GAG>CAG	p.E270Q		NM_178168	NP_835462	Q9H207	O10A5_HUMAN	olfactory receptor, family 10, subfamily A,	270	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)	3		Medulloblastoma(188;0.0523)|all_neural(188;0.236)		Epithelial(150;4.68e-08)|BRCA - Breast invasive adenocarcinoma(625;0.129)		TAATTCTCCTGAGAGCAAGAA	0.423													59	171	---	---	---	---	PASS
DKK3	27122	broad.mit.edu	37	11	12023765	12023765	+	Intron	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:12023765T>A	uc001mju.2	-						DKK3_uc010rcf.1_Intron|DKK3_uc001mjv.2_Intron|DKK3_uc001mjw.2_Intron|DKK3_uc010rcg.1_Intron|DKK3_uc001mjx.2_Missense_Mutation_p.I145L	NM_001018057	NP_001018067	Q9UBP4	DKK3_HUMAN	dickkopf homolog 3 precursor						adrenal gland development|anatomical structure morphogenesis|negative regulation of aldosterone biosynthetic process|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cortisol biosynthetic process|negative regulation of transcription, DNA-dependent|Wnt receptor signaling pathway	extracellular space				breast(1)	1				Epithelial(150;0.000502)		ATATCACATATGAAAAAACAA	0.378													13	10	---	---	---	---	PASS
LDHAL6A	160287	broad.mit.edu	37	11	18487256	18487256	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:18487256G>A	uc001mop.1	+	4	578	c.317G>A	c.(316-318)CGC>CAC	p.R106H	LDHAL6A_uc001moq.2_Missense_Mutation_p.R106H	NM_001144071	NP_001137543	Q6ZMR3	LDH6A_HUMAN	lactate dehydrogenase A-like 6A	106		Substrate (By similarity).			glycolysis	cytoplasm	binding|L-lactate dehydrogenase activity				0					NADH(DB00157)	GGAGAAACACGCCTTGATTTA	0.388													10	124	---	---	---	---	PASS
MYBPC3	4607	broad.mit.edu	37	11	47364473	47364473	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47364473G>A	uc001nfa.3	-	15	1420	c.1365C>T	c.(1363-1365)CTC>CTT	p.L455L	MYBPC3_uc010rhl.1_RNA	NM_000256	NP_000247	Q14896	MYPC3_HUMAN	myosin binding protein C, cardiac	454	Ig-like C2-type 3.				cardiac muscle contraction|cell adhesion|muscle filament sliding|regulation of muscle filament sliding|regulation of striated muscle contraction|ventricular cardiac muscle tissue morphogenesis	C zone|cytosol|striated muscle myosin thick filament	actin binding|ATPase activator activity|metal ion binding|myosin heavy chain binding|structural constituent of muscle|titin binding			ovary(2)|central_nervous_system(1)	3				Lung(87;0.176)		GGCGCGTGATGAGCACAGGGG	0.632													3	10	---	---	---	---	PASS
OR5AK2	390181	broad.mit.edu	37	11	56756546	56756546	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56756546C>G	uc010rjp.1	+	1	158	c.158C>G	c.(157-159)TCC>TGC	p.S53C		NM_001005323	NP_001005323	Q8NH90	O5AK2_HUMAN	olfactory receptor, family 5, subfamily AK,	53	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(3)	3						AACACAGATTCCAGATTTCAA	0.378													79	57	---	---	---	---	PASS
TNKS1BP1	85456	broad.mit.edu	37	11	57080263	57080263	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57080263G>A	uc001njr.2	-	4	2211	c.1899C>T	c.(1897-1899)CTC>CTT	p.L633L	TNKS1BP1_uc001njs.2_Silent_p.L633L|TNKS1BP1_uc009ymd.1_Silent_p.L84L	NM_033396	NP_203754	Q9C0C2	TB182_HUMAN	tankyrase 1-binding protein 1	633	Pro-rich.|Acidic.				nuclear-transcribed mRNA poly(A) tail shortening|telomere maintenance via telomerase	cytoskeleton|cytosol|nuclear telomeric heterochromatin	ankyrin binding|enzyme binding			skin(1)	1		all_epithelial(135;0.21)				CATCAGCAAAGAGAACACAGG	0.662													10	24	---	---	---	---	PASS
OR9Q1	219956	broad.mit.edu	37	11	57946980	57946980	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57946980G>A	uc001nmj.2	+	3	380	c.64G>A	c.(64-66)GAA>AAA	p.E22K		NM_001005212	NP_001005212	Q8NGQ5	OR9Q1_HUMAN	olfactory receptor, family 9, subfamily Q,	22	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1		Breast(21;0.222)				TGAATATCCTGAATGGGCACT	0.453													10	144	---	---	---	---	PASS
OR9Q2	219957	broad.mit.edu	37	11	57958572	57958572	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57958572C>G	uc010rka.1	+	1	610	c.610C>G	c.(610-612)CTT>GTT	p.L204V		NM_001005283	NP_001005283	Q8NGE9	OR9Q2_HUMAN	olfactory receptor, family 9, subfamily Q,	204	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|breast(1)|central_nervous_system(1)	4		Breast(21;0.0589)				TGTGTTTGCTCTTTTCGTCAT	0.473													35	25	---	---	---	---	PASS
NRXN2	9379	broad.mit.edu	37	11	64427940	64427940	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64427940C>T	uc001oar.2	-	12	2692	c.2253G>A	c.(2251-2253)ACG>ACA	p.T751T	NRXN2_uc001oas.2_Silent_p.T720T|NRXN2_uc001oaq.2_Silent_p.T418T	NM_015080	NP_055895	P58401	NRX2B_HUMAN	neurexin 2 isoform alpha-1 precursor	Error:Variant_position_missing_in_P58401_after_alignment					cell adhesion	integral to membrane				upper_aerodigestive_tract(2)|central_nervous_system(2)|skin(2)|ovary(2)|kidney(1)|pancreas(1)	10						CCTCTGCCTCCGTGTGCATGG	0.602													5	35	---	---	---	---	PASS
RASGRP2	10235	broad.mit.edu	37	11	64502637	64502637	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:64502637G>A	uc009ypu.2	-	12	1586	c.1359C>T	c.(1357-1359)ATC>ATT	p.I453I	RASGRP2_uc001oat.2_Silent_p.I355I|RASGRP2_uc001oau.2_Silent_p.I308I|RASGRP2_uc009ypv.2_Silent_p.I453I|RASGRP2_uc009ypw.2_Silent_p.I453I	NM_001098671	NP_001092141	Q7LDG7	GRP2_HUMAN	RAS guanyl releasing protein 2	453	EF-hand 1.				platelet activation|Ras protein signal transduction|regulation of cell growth|regulation of small GTPase mediated signal transduction	cell junction|cytosol|ruffle membrane|synapse|synaptosome	calcium ion binding|diacylglycerol binding|guanyl-nucleotide exchange factor activity				0						TCCCACGGATGATCTGGAATT	0.557													15	47	---	---	---	---	PASS
B3GNT1	11041	broad.mit.edu	37	11	66113499	66113499	+	3'UTR	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66113499C>T	uc001ohr.2	-	2					BRMS1_uc001ohp.1_5'Flank|BRMS1_uc001oho.1_5'Flank	NM_006876	NP_006867	O43505	B3GN1_HUMAN	UDP-GlcNAc:betaGal						poly-N-acetyllactosamine biosynthetic process	integral to Golgi membrane	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity				0						GCTGACTTCTCAGATTAGGGG	0.453													6	158	---	---	---	---	PASS
KDM2A	22992	broad.mit.edu	37	11	67017821	67017821	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67017821C>T	uc001ojw.2	+	17	3184	c.2320C>T	c.(2320-2322)CGG>TGG	p.R774W	KDM2A_uc001ojx.2_Intron|KDM2A_uc001ojy.2_Missense_Mutation_p.R468W|KDM2A_uc010rpn.1_Missense_Mutation_p.R335W|KDM2A_uc001ojz.1_Missense_Mutation_p.R232W|KDM2A_uc001oka.2_5'Flank	NM_012308	NP_036440	Q9Y2K7	KDM2A_HUMAN	F-box and leucine-rich repeat protein 11	774					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleoplasm	DNA binding|histone demethylase activity (H3-K36 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|zinc ion binding			ovary(4)|lung(3)|breast(1)|skin(1)	9						CACCATGGTACGGGAAAAGGA	0.617													7	24	---	---	---	---	PASS
PLEKHB1	58473	broad.mit.edu	37	11	73372728	73372728	+	3'UTR	SNP	A	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:73372728A>C	uc001oua.2	+	8					PLEKHB1_uc001oub.2_3'UTR|PLEKHB1_uc001ouc.2_3'UTR|PLEKHB1_uc001oud.2_3'UTR|PLEKHB1_uc009ytq.2_3'UTR	NM_021200	NP_067023	Q9UF11	PKHB1_HUMAN	pleckstrin homology domain containing, family B						multicellular organismal development|phototransduction	cytoplasm|integral to membrane	signal transducer activity			ovary(1)|lung(1)	2						CTACCATCCAAGCCCTGTCCC	0.587											OREG0021217	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	5	21	---	---	---	---	PASS
UBTFL1	642623	broad.mit.edu	37	11	89819393	89819393	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:89819393A>T	uc010rub.1	+	1	276	c.276A>T	c.(274-276)AAA>AAT	p.K92N		NM_001143975	NP_001137447	P0CB47	UBFL1_HUMAN	upstream binding transcription factor, RNA	92					multicellular organismal development	cytoplasm|nucleus	DNA binding				0						AAAGCCAAAAATACAGGAACG	0.418													23	18	---	---	---	---	PASS
BCL9L	283149	broad.mit.edu	37	11	118771774	118771774	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118771774G>A	uc001pug.2	-	6	3643	c.2678C>T	c.(2677-2679)CCC>CTC	p.P893L	BCL9L_uc009zal.2_Missense_Mutation_p.P888L	NM_182557	NP_872363	Q86UU0	BCL9L_HUMAN	B-cell CLL/lymphoma 9-like	893	Pro-rich.				negative regulation of transforming growth factor beta receptor signaling pathway|positive regulation of epithelial to mesenchymal transition|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		transcription coactivator activity			ovary(1)|pancreas(1)	2	all_hematologic(175;0.0839)	Medulloblastoma(222;0.0425)|all_hematologic(192;0.103)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;7.66e-05)		GGACGCAGGGGGCAGAGGCAT	0.602													19	16	---	---	---	---	PASS
KDM5A	5927	broad.mit.edu	37	12	420231	420231	+	Splice_Site	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:420231C>G	uc001qif.1	-	21	3400	c.3037_splice	c.e21-1	p.S1013_splice	KDM5A_uc001qie.1_Splice_Site_p.S1013_splice|KDM5A_uc010sdn.1_Splice_Site_p.S972_splice	NM_001042603	NP_001036068	P29375	KDM5A_HUMAN	retinoblastoma binding protein 2 isoform 1						chromatin modification|multicellular organismal development|positive regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	cytoplasm|nucleolus	DNA binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(2)|ovary(1)	3						TGCTGCCACTCTGAAAAACCA	0.418			T 	NUP98	AML								3	36	---	---	---	---	PASS
CD163	9332	broad.mit.edu	37	12	7639982	7639982	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7639982C>T	uc001qsz.3	-	8	2151	c.2023G>A	c.(2023-2025)GAG>AAG	p.E675K	CD163_uc001qta.3_Missense_Mutation_p.E675K|CD163_uc009zfw.2_Missense_Mutation_p.E708K	NM_004244	NP_004235	Q86VB7	C163A_HUMAN	CD163 antigen isoform a	675	SRCR 6.|Extracellular (Potential).				acute-phase response	extracellular region|integral to plasma membrane	protein binding|scavenger receptor activity			ovary(6)|pancreas(1)|skin(1)	8						GCCACTTGCTCTGAAGGACAT	0.468													5	46	---	---	---	---	PASS
A2M	2	broad.mit.edu	37	12	9268390	9268390	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9268390A>G	uc001qvk.1	-	1	169	c.56T>C	c.(55-57)CTG>CCG	p.L19P	A2M_uc009zgk.1_5'UTR	NM_000014	NP_000005	P01023	A2MG_HUMAN	alpha-2-macroglobulin precursor	19					blood coagulation, intrinsic pathway|negative regulation of complement activation, lectin pathway|platelet activation|platelet degranulation|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|extracellular space|platelet alpha granule lumen	enzyme binding|GTPase activator activity|interleukin-1 binding|interleukin-8 binding|serine-type endopeptidase inhibitor activity|tumor necrosis factor binding			central_nervous_system(4)|skin(1)	5					Bacitracin(DB00626)|Becaplermin(DB00102)	GTCTGTGGGCAGGAGGACCAA	0.468													13	91	---	---	---	---	PASS
GSG1	83445	broad.mit.edu	37	12	13256440	13256440	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:13256440C>G	uc001rbn.2	-	1	180	c.7G>C	c.(7-9)GAT>CAT	p.D3H	GSG1_uc001rbo.2_Missense_Mutation_p.D3H|GSG1_uc001rbp.2_Missense_Mutation_p.D3H|GSG1_uc001rbq.1_Missense_Mutation_p.D3H	NM_001080555	NP_001074024	Q2KHT4	GSG1_HUMAN	germ cell associated 1 isoform 4	Error:Variant_position_missing_in_Q2KHT4_after_alignment						endoplasmic reticulum membrane|integral to membrane					0		Prostate(47;0.183)		BRCA - Breast invasive adenocarcinoma(232;0.15)		TGAGAGGGATCGCTCATTCAC	0.428													26	232	---	---	---	---	PASS
ATF7IP	55729	broad.mit.edu	37	12	14613579	14613579	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14613579G>T	uc001rbw.2	+	9	2467	c.2309G>T	c.(2308-2310)GGA>GTA	p.G770V	ATF7IP_uc010shs.1_3'UTR|ATF7IP_uc001rbu.2_Missense_Mutation_p.G770V|ATF7IP_uc001rbv.1_Missense_Mutation_p.G769V|ATF7IP_uc001rbx.2_Missense_Mutation_p.G769V|ATF7IP_uc010sht.1_3'UTR|ATF7IP_uc001rby.3_Missense_Mutation_p.G770V|ATF7IP_uc001rca.2_Missense_Mutation_p.G770V	NM_018179	NP_060649	Q6VMQ6	MCAF1_HUMAN	activating transcription factor 7 interacting	770	Interaction with SETDB1.				DNA methylation|interspecies interaction between organisms|positive regulation of transcription, DNA-dependent|regulation of RNA polymerase II transcriptional preinitiation complex assembly|transcription, DNA-dependent		protein binding			lung(3)|ovary(1)|skin(1)	5						GTGCCTAGTGGAAATCCCCAG	0.502													5	127	---	---	---	---	PASS
GUCY2C	2984	broad.mit.edu	37	12	14827597	14827597	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14827597G>T	uc001rcd.2	-	8	1183	c.1046C>A	c.(1045-1047)CCC>CAC	p.P349H	GUCY2C_uc009zhz.2_Missense_Mutation_p.P349H	NM_004963	NP_004954	P25092	GUC2C_HUMAN	guanylate cyclase 2C precursor	349	Extracellular (Potential).				intracellular signal transduction|receptor guanylyl cyclase signaling pathway	integral to membrane	ATP binding|GTP binding|guanylate cyclase activity|protein binding|protein kinase activity|receptor activity			ovary(4)|skin(2)	6						AGCAAATTTGGGGGTGGTAAT	0.388													10	189	---	---	---	---	PASS
EPS8	2059	broad.mit.edu	37	12	15803941	15803941	+	Splice_Site	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:15803941C>T	uc009zif.2	-	14	1345	c.1251_splice	c.e14-1	p.R417_splice	EPS8_uc001rdb.2_Splice_Site_p.R417_splice|EPS8_uc009zig.2_Splice_Site_p.R157_splice|EPS8_uc010shv.1_Splice_Site_p.R157_splice	NM_004447	NP_004438	Q12929	EPS8_HUMAN	epidermal growth factor receptor pathway						cell proliferation|epidermal growth factor receptor signaling pathway		SH3/SH2 adaptor activity			ovary(2)|upper_aerodigestive_tract(1)|skin(1)	4		all_epithelial(100;1.87e-05)|Breast(259;0.000286)|Hepatocellular(102;0.244)		BRCA - Breast invasive adenocarcinoma(232;4.29e-05)|GBM - Glioblastoma multiforme(207;0.0264)		CCACTCTGCTCTGCAGGAGGG	0.448													12	72	---	---	---	---	PASS
SLCO1B3	28234	broad.mit.edu	37	12	21028199	21028199	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21028199G>C	uc001rek.2	+	8	884	c.758G>C	c.(757-759)CGT>CCT	p.R253P	SLCO1B3_uc001rel.2_Missense_Mutation_p.R253P|SLCO1B3_uc010sil.1_Missense_Mutation_p.R253P|LST-3TM12_uc010sim.1_Intron|SLCO1B3_uc001reo.2_Missense_Mutation_p.R78P	NM_019844	NP_062818	Q9NPD5	SO1B3_HUMAN	solute carrier organic anion transporter family,	253	Extracellular (Potential).				bile acid metabolic process|sodium-independent organic anion transport	basolateral plasma membrane|cytoplasm|integral to plasma membrane	bile acid transmembrane transporter activity|organic anion transmembrane transporter activity			large_intestine(2)|ovary(1)|skin(1)	4	Esophageal squamous(101;0.149)					AAGGACTCTCGTTGGGTTGGA	0.378													42	272	---	---	---	---	PASS
IFLTD1	160492	broad.mit.edu	37	12	25706115	25706115	+	5'UTR	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:25706115G>A	uc001rgs.2	-	1					IFLTD1_uc001rgt.1_5'UTR|IFLTD1_uc010sji.1_5'UTR|IFLTD1_uc010sjj.1_Intron|IFLTD1_uc009zjc.2_5'UTR	NM_152590	NP_689803	Q8N9Z9	ILFT1_HUMAN	intermediate filament tail domain containing 1							intermediate filament	structural molecule activity			ovary(2)|central_nervous_system(1)	3	all_lung(3;2.75e-22)|Lung NSC(3;1.77e-21)|all_hematologic(7;0.00656)|Colorectal(261;0.0847)					AGCCAATCCTGATCTTGGCTA	0.428													13	24	---	---	---	---	PASS
ITPR2	3709	broad.mit.edu	37	12	26839539	26839539	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:26839539C>G	uc001rhg.2	-	11	1440	c.1023G>C	c.(1021-1023)AAG>AAC	p.K341N		NM_002223	NP_002214	Q14571	ITPR2_HUMAN	inositol 1,4,5-triphosphate receptor, type 2	341	Cytoplasmic (Potential).|MIR 4.				activation of phospholipase C activity|energy reserve metabolic process|nerve growth factor receptor signaling pathway|platelet activation|regulation of insulin secretion|response to hypoxia	integral to membrane|plasma membrane enriched fraction|platelet dense tubular network membrane|sarcoplasmic reticulum membrane	calcium ion transmembrane transporter activity|inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity			kidney(6)|ovary(4)|skin(2)|upper_aerodigestive_tract(1)|lung(1)	14	Colorectal(261;0.0847)					GGCGTTTTTTCTTTGAAGTTG	0.413													13	260	---	---	---	---	PASS
BICD1	636	broad.mit.edu	37	12	32480490	32480490	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32480490G>A	uc001rku.2	+	5	1182	c.1101G>A	c.(1099-1101)CGG>CGA	p.R367R	BICD1_uc001rkv.2_Silent_p.R367R|BICD1_uc010skd.1_RNA	NM_001714	NP_001705	Q96G01	BICD1_HUMAN	bicaudal D homolog 1 isoform 1	367	Potential.				anatomical structure morphogenesis|intracellular mRNA localization|microtubule anchoring at microtubule organizing center|minus-end-directed organelle transport along microtubule|positive regulation of receptor-mediated endocytosis|protein localization to organelle|RNA processing|stress granule assembly|viral reproduction	cytoplasmic vesicle|cytoskeleton|cytosol|host cell viral assembly compartment|membrane|perinuclear region of cytoplasm|trans-Golgi network	cytoskeletal adaptor activity|dynactin binding|dynein binding|proteinase activated receptor binding|Rab GTPase binding|structural constituent of cytoskeleton			large_intestine(1)|central_nervous_system(1)	2	all_cancers(9;5.13e-11)|all_epithelial(9;2.71e-11)|all_lung(12;6.66e-10)|Acute lymphoblastic leukemia(23;0.0122)|Lung SC(12;0.0213)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.204)		OV - Ovarian serous cystadenocarcinoma(6;0.0201)			AGCATGAGCGGGTGCACCGGC	0.612													8	61	---	---	---	---	PASS
CNTN1	1272	broad.mit.edu	37	12	41337797	41337797	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:41337797A>G	uc001rmm.1	+	14	1621	c.1508A>G	c.(1507-1509)GAT>GGT	p.D503G	CNTN1_uc009zjy.1_Missense_Mutation_p.D503G|CNTN1_uc001rmn.1_Missense_Mutation_p.D492G|CNTN1_uc001rmo.2_Missense_Mutation_p.D503G	NM_001843	NP_001834	Q12860	CNTN1_HUMAN	contactin 1 isoform 1 precursor	503					axon guidance|cell adhesion|Notch signaling pathway	anchored to membrane|membrane fraction|plasma membrane		p.D503H(1)		lung(4)|ovary(3)|large_intestine(1)|skin(1)	9	all_cancers(12;2.07e-06)|all_epithelial(1;4.26e-06)|Breast(8;0.0716)	Lung NSC(34;0.0211)|all_lung(34;0.0294)				AAATATATAGATCCTACGCGA	0.338													11	60	---	---	---	---	PASS
PLEKHA9	51054	broad.mit.edu	37	12	45567619	45567619	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:45567619G>A	uc001rom.1	-	3	1067	c.530C>T	c.(529-531)TCA>TTA	p.S177L	PLEKHA9_uc009zke.2_Missense_Mutation_p.S177L	NM_015899	NP_056983			pleckstrin homology domain containing, family A												0	Lung SC(27;0.192)|Renal(347;0.236)			GBM - Glioblastoma multiforme(48;0.173)		AGAGCAACTTGAGTCTGATCC	0.388													7	182	---	---	---	---	PASS
RND1	27289	broad.mit.edu	37	12	49258602	49258602	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:49258602C>T	uc001rsn.2	-	2	275	c.172G>A	c.(172-174)GAA>AAA	p.E58K		NM_014470	NP_055285	Q92730	RND1_HUMAN	GTP-binding protein RHO6 precursor	58					actin filament organization|axon guidance|negative regulation of cell adhesion|neuron remodeling|small GTPase mediated signal transduction	adherens junction|cytoskeleton|cytosol	GTP binding|GTPase activity|receptor binding			ovary(1)	1						ACCCTCTGTTCCTCTGTCTCC	0.507													25	176	---	---	---	---	PASS
SLC4A8	9498	broad.mit.edu	37	12	51845973	51845973	+	Nonsense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:51845973G>T	uc001rys.1	+	4	521	c.343G>T	c.(343-345)GAG>TAG	p.E115*	SLC4A8_uc010sni.1_Nonsense_Mutation_p.E62*|SLC4A8_uc001rym.2_Nonsense_Mutation_p.E62*|SLC4A8_uc001ryn.2_Nonsense_Mutation_p.E62*|SLC4A8_uc001ryo.2_Nonsense_Mutation_p.E62*|SLC4A8_uc001ryp.1_Nonsense_Mutation_p.E62*|SLC4A8_uc010snj.1_Nonsense_Mutation_p.E142*|SLC4A8_uc001ryq.3_Nonsense_Mutation_p.E115*|SLC4A8_uc001ryr.2_Nonsense_Mutation_p.E115*|SLC4A8_uc010snk.1_Nonsense_Mutation_p.E62*	NM_001039960	NP_001035049	Q2Y0W8	S4A8_HUMAN	solute carrier family 4, sodium bicarbonate	115	Extracellular (Potential).				bicarbonate transport|sodium ion transport	integral to membrane|plasma membrane	inorganic anion exchanger activity			ovary(3)|pancreas(1)|skin(1)	5				BRCA - Breast invasive adenocarcinoma(357;0.15)		TGTGCCTCATGAGCTGTTTAC	0.478													6	222	---	---	---	---	PASS
KRT6A	3853	broad.mit.edu	37	12	52882204	52882204	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:52882204C>T	uc001sam.2	-	7	1541	c.1332G>A	c.(1330-1332)CTG>CTA	p.L444L		NM_005554	NP_005545	P02538	K2C6A_HUMAN	keratin 6A	444	Rod.|Coil 2.				cell differentiation|ectoderm development|positive regulation of cell proliferation	keratin filament	protein binding|structural constituent of cytoskeleton			ovary(4)|skin(1)	5				BRCA - Breast invasive adenocarcinoma(357;0.189)		ACTCCTTCAGCAGCCGGGCCA	0.612													30	40	---	---	---	---	PASS
TCTN1	79600	broad.mit.edu	37	12	111064234	111064234	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:111064234C>G	uc009zvs.2	+	3	517	c.409C>G	c.(409-411)CAA>GAA	p.Q137E	TCTN1_uc010syb.1_Missense_Mutation_p.Q137E|TCTN1_uc009zvr.1_RNA|TCTN1_uc001trl.2_RNA|TCTN1_uc001trm.2_Missense_Mutation_p.Q77E|TCTN1_uc010syc.1_RNA|TCTN1_uc001tro.2_RNA|TCTN1_uc001trp.3_Missense_Mutation_p.Q137E|TCTN1_uc001trn.3_Missense_Mutation_p.Q137E|TCTN1_uc001tri.2_Missense_Mutation_p.Q81E|TCTN1_uc001trj.1_Missense_Mutation_p.Q81E|TCTN1_uc001trk.3_RNA	NM_001082537	NP_001076006	Q2MV58	TECT1_HUMAN	tectonic family member 1 isoform 2	137					multicellular organismal development	extracellular region					0						AAACCCACCTCAAAGAGTATT	0.313													8	41	---	---	---	---	PASS
C12orf51	283450	broad.mit.edu	37	12	112666449	112666449	+	Splice_Site	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112666449A>G	uc009zwc.2	-	35	5436	c.5418_splice	c.e35+1	p.E1806_splice	C12orf51_uc001ttr.1_5'Flank	NM_001109662	NP_001103132			chromosome 12 open reading frame 51											ovary(1)|lung(1)	2						AAATCACCTTACCTCTGATCT	0.403													9	83	---	---	---	---	PASS
TBX3	6926	broad.mit.edu	37	12	115115443	115115443	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:115115443C>G	uc001tvt.1	-	5	1847	c.883G>C	c.(883-885)GAC>CAC	p.D295H	TBX3_uc001tvu.1_Missense_Mutation_p.D275H	NM_016569	NP_057653	O15119	TBX3_HUMAN	T-box 3 protein isoform 2	295	T-box; second part.				anterior/posterior axis specification, embryo|anti-apoptosis|cell aging|embryonic arm morphogenesis|embryonic digit morphogenesis|female genitalia development|follicle-stimulating hormone secretion|luteinizing hormone secretion|male genitalia development|mesoderm morphogenesis|negative regulation of myoblast differentiation|negative regulation of transcription, DNA-dependent|positive regulation of cell cycle|positive regulation of cell proliferation|regulation of transcription from RNA polymerase II promoter|skeletal system development	nucleus	sequence-specific DNA binding			ovary(2)|skin(1)	3	Medulloblastoma(191;0.163)|all_neural(191;0.178)			BRCA - Breast invasive adenocarcinoma(302;0.0574)		GGGTTGTTGTCTATTTTTAAC	0.358													16	125	---	---	---	---	PASS
NCOR2	9612	broad.mit.edu	37	12	124856669	124856669	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124856669C>A	uc010tba.1	-	20	2823	c.2706G>T	c.(2704-2706)AGG>AGT	p.R902S	NCOR2_uc010tay.1_Missense_Mutation_p.R902S|NCOR2_uc010taz.1_Missense_Mutation_p.R885S|NCOR2_uc010tbb.1_Missense_Mutation_p.R902S|NCOR2_uc010tbc.1_Missense_Mutation_p.R884S|NCOR2_uc001ugj.1_Missense_Mutation_p.R902S	NM_001077261	NP_001070729	Q9Y618	NCOR2_HUMAN	nuclear receptor co-repressor 2 isoform 2	902					cellular lipid metabolic process|negative regulation of transcription from RNA polymerase II promoter|regulation of cellular ketone metabolic process by negative regulation of transcription from an RNA polymerase II promoter|transcription, DNA-dependent	nuclear body|nucleus|transcriptional repressor complex	DNA binding|histone deacetylase binding|Notch binding|protein N-terminus binding|transcription corepressor activity			skin(3)|ovary(1)	4	all_neural(191;0.0804)|Medulloblastoma(191;0.163)			Epithelial(86;3.99e-05)|OV - Ovarian serous cystadenocarcinoma(86;9.14e-05)|all cancers(50;0.000402)|BRCA - Breast invasive adenocarcinoma(302;0.0764)		CTGTGGTGGCCCTGCCGCTCC	0.711													3	16	---	---	---	---	PASS
EP400	57634	broad.mit.edu	37	12	132475243	132475243	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:132475243G>T	uc001ujn.2	+	8	2648	c.2613G>T	c.(2611-2613)CAG>CAT	p.Q871H	EP400_uc001ujl.2_Missense_Mutation_p.Q870H|EP400_uc001ujm.2_Missense_Mutation_p.Q871H|EP400_uc001ujj.1_Missense_Mutation_p.Q834H|EP400_uc001ujk.2_Missense_Mutation_p.Q907H	NM_015409	NP_056224	Q96L91	EP400_HUMAN	E1A binding protein p400	907					histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent	NuA4 histone acetyltransferase complex|nuclear speck	ATP binding|DNA binding|helicase activity			central_nervous_system(4)|ovary(3)|breast(3)|skin(2)	12	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.198)		OV - Ovarian serous cystadenocarcinoma(86;3.01e-08)|Epithelial(86;3.43e-07)|all cancers(50;2.01e-06)		TAAATTTACAGAAAGTTTCCA	0.393													13	51	---	---	---	---	PASS
SACS	26278	broad.mit.edu	37	13	23915126	23915126	+	Silent	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:23915126A>G	uc001uon.2	-	10	3478	c.2889T>C	c.(2887-2889)TCT>TCC	p.S963S	SACS_uc001uoo.2_Silent_p.S816S|SACS_uc001uop.1_Intron|SACS_uc001uoq.1_Intron	NM_014363	NP_055178	Q9NZJ4	SACS_HUMAN	sacsin	963					cell death|negative regulation of inclusion body assembly|protein folding	axon|cell body fiber|dendrite|mitochondrion|nucleus	ATP binding|chaperone binding|Hsp70 protein binding|proteasome binding			ovary(7)|skin(2)|upper_aerodigestive_tract(1)|large_intestine(1)|pancreas(1)	12		all_cancers(29;1.51e-22)|all_epithelial(30;7.82e-19)|all_lung(29;4.71e-18)|Lung SC(185;0.0225)|Breast(139;0.128)		all cancers(112;0.00197)|Epithelial(112;0.00854)|OV - Ovarian serous cystadenocarcinoma(117;0.0298)|Lung(94;0.189)		TTACTGAAATAGAAAGTCGCA	0.363													25	91	---	---	---	---	PASS
N4BP2L1	90634	broad.mit.edu	37	13	32977856	32977856	+	Intron	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:32977856C>G	uc001uuc.2	-						N4BP2L1_uc001uud.2_Intron|N4BP2L1_uc010tdy.1_Intron	NM_052818	NP_438169	Q5TBK1	N42L1_HUMAN	NEDD4 binding protein 2-like 1 isoform 1						cell killing		ATP binding			ovary(1)	1		Lung SC(185;0.0262)		all cancers(112;6.3e-06)|Epithelial(112;3.51e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.00607)|BRCA - Breast invasive adenocarcinoma(63;0.0171)		tgaggcaattctgatggagta	0.139													3	49	---	---	---	---	PASS
KBTBD6	89890	broad.mit.edu	37	13	41705450	41705450	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:41705450G>A	uc001uxu.1	-	1	1487	c.1198C>T	c.(1198-1200)CAG>TAG	p.Q400*	KBTBD6_uc010ace.1_Intron|KBTBD6_uc010tfe.1_Nonsense_Mutation_p.Q334*|uc001uxv.1_5'Flank	NM_152903	NP_690867	Q86V97	KBTB6_HUMAN	kelch repeat and BTB (POZ) domain-containing 6	400	Kelch 1.						protein binding			ovary(1)|skin(1)	2		Lung NSC(96;4.52e-06)|Breast(139;0.00123)|Prostate(109;0.0181)|Lung SC(185;0.0262)|Hepatocellular(98;0.114)		all cancers(112;4.08e-09)|Epithelial(112;4.74e-06)|OV - Ovarian serous cystadenocarcinoma(117;0.000131)|GBM - Glioblastoma multiforme(144;0.000876)|BRCA - Breast invasive adenocarcinoma(63;0.0673)		GTCCTGGGCTGAGCAGCTAGA	0.502													34	156	---	---	---	---	PASS
TSC22D1	8848	broad.mit.edu	37	13	45010788	45010788	+	Intron	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:45010788C>T	uc001uzn.3	-						TSC22D1_uc001uzo.1_Intron|TSC22D1_uc001uzm.3_5'UTR	NM_183422	NP_904358	Q15714	T22D1_HUMAN	TSC22 domain family, member 1 isoform 1						transcription from RNA polymerase II promoter	cytoplasm|nucleus	protein binding|sequence-specific DNA binding transcription factor activity				0		all_hematologic(4;8.74e-08)|Acute lymphoblastic leukemia(4;1.78e-07)|Lung NSC(96;2.21e-05)|Breast(139;0.000625)|Prostate(109;0.000947)|Hepatocellular(98;0.0202)|Lung SC(185;0.0262)		GBM - Glioblastoma multiforme(144;0.000522)|BRCA - Breast invasive adenocarcinoma(63;0.118)		AAAACACCCTCGTGGAAAAAA	0.438													54	225	---	---	---	---	PASS
NEK5	341676	broad.mit.edu	37	13	52667254	52667254	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:52667254G>C	uc001vge.2	-	13	1284	c.1144C>G	c.(1144-1146)CAA>GAA	p.Q382E	NEK5_uc001vgf.2_Missense_Mutation_p.Q382E	NM_199289	NP_954983	Q6P3R8	NEK5_HUMAN	NIMA-related kinase 5	382							ATP binding|metal ion binding|protein serine/threonine kinase activity			upper_aerodigestive_tract(1)	1		Breast(56;0.00173)|Lung NSC(96;0.0168)|Prostate(109;0.0412)|Hepatocellular(98;0.152)|Glioma(44;0.236)		GBM - Glioblastoma multiforme(99;3.7e-08)		GTATTTTCTTGAGGAATAGGG	0.418													44	126	---	---	---	---	PASS
KLF5	688	broad.mit.edu	37	13	73636553	73636553	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:73636553G>A	uc001vje.2	+	2	1140	c.816G>A	c.(814-816)CAG>CAA	p.Q272Q	KLF5_uc001vjd.2_Silent_p.Q181Q	NM_001730	NP_001721	Q13887	KLF5_HUMAN	Kruppel-like factor 5	272					transcription from RNA polymerase II promoter	nucleus	DNA binding|zinc ion binding			large_intestine(1)|ovary(1)|pancreas(1)	3		Prostate(6;0.00187)|Breast(118;0.0735)		GBM - Glioblastoma multiforme(99;0.0011)		CTGTTCCGCAGACTGCAGTGA	0.502													21	93	---	---	---	---	PASS
MYCBP2	23077	broad.mit.edu	37	13	77825292	77825292	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:77825292G>C	uc001vkf.2	-	16	2352	c.2261C>G	c.(2260-2262)CCC>CGC	p.P754R	MYCBP2_uc010aev.2_Missense_Mutation_p.P158R	NM_015057	NP_055872	O75592	MYCB2_HUMAN	MYC binding protein 2	754	Cys-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ligase activity|protein binding|zinc ion binding			ovary(4)|breast(4)|skin(3)|lung(2)|pancreas(1)	14		Breast(118;0.212)|Acute lymphoblastic leukemia(28;0.22)		GBM - Glioblastoma multiforme(99;0.109)		TTACCCTCCGGGGACTCTGTC	0.443													8	65	---	---	---	---	PASS
SLITRK6	84189	broad.mit.edu	37	13	86369424	86369424	+	Missense_Mutation	SNP	A	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:86369424A>C	uc001vll.1	-	2	1679	c.1220T>G	c.(1219-1221)TTT>TGT	p.F407C	SLITRK6_uc010afe.1_Intron	NM_032229	NP_115605	Q9H5Y7	SLIK6_HUMAN	slit and trk like 6 precursor	407	Extracellular (Potential).|LRR 7.					integral to membrane				large_intestine(1)|ovary(1)|central_nervous_system(1)	3	all_neural(89;0.117)|Medulloblastoma(90;0.163)			GBM - Glioblastoma multiforme(99;0.0456)		TAGGTTCATAAACGATCCTTC	0.338													30	101	---	---	---	---	PASS
GPR180	160897	broad.mit.edu	37	13	95273419	95273419	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:95273419A>G	uc001vly.2	+	6	902	c.824A>G	c.(823-825)CAA>CGA	p.Q275R	GPR180_uc001vlz.2_Missense_Mutation_p.Q174R|GPR180_uc010afi.2_Missense_Mutation_p.Q36R	NM_180989	NP_851320	Q86V85	GP180_HUMAN	G protein-coupled receptor 180 precursor	275						integral to membrane				breast(1)	1	all_neural(89;0.0684)|Medulloblastoma(90;0.163)					AAGAAGTCTCAAAGCAGACCT	0.423													5	188	---	---	---	---	PASS
ZIC2	7546	broad.mit.edu	37	13	100635308	100635308	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:100635308G>C	uc001von.2	+	1	990	c.990G>C	c.(988-990)GAG>GAC	p.E330D		NM_007129	NP_009060	O95409	ZIC2_HUMAN	zinc finger protein of the cerebellum 2	330					brain development|negative regulation of transcription, DNA-dependent|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription, DNA-dependent|visual perception	cytoplasm|nucleus	chromatin DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)					ACACAGGCGAGAAACCCTTCC	0.607													5	114	---	---	---	---	PASS
OR6S1	341799	broad.mit.edu	37	14	21108987	21108987	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:21108987C>G	uc001vxv.1	-	1	864	c.864G>C	c.(862-864)TTG>TTC	p.L288F		NM_001001968	NP_001001968	Q8NH40	OR6S1_HUMAN	olfactory receptor, family 6, subfamily S,	288	Helical; Name=7; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2	all_cancers(95;0.00304)		Epithelial(56;1.23e-06)|all cancers(55;1.01e-05)	GBM - Glioblastoma multiforme(265;0.0135)		TGAATGGATTCAACAGTGGTG	0.443													6	238	---	---	---	---	PASS
GZMB	3002	broad.mit.edu	37	14	25101100	25101100	+	Silent	SNP	G	A	A	rs149659869	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:25101100G>A	uc001wps.2	-	4	630	c.564C>T	c.(562-564)TGC>TGT	p.C188C	GZMB_uc010ama.2_Silent_p.C176C|GZMB_uc010amb.2_RNA	NM_004131	NP_004122	P10144	GRAB_HUMAN	granzyme B precursor	188	Peptidase S1.				activation of pro-apoptotic gene products|cleavage of lamin|cytolysis|induction of apoptosis by intracellular signals	cytosol|immunological synapse|nucleus	protein binding|serine-type endopeptidase activity				0				GBM - Glioblastoma multiforme(265;0.028)		GGTCCCCCACGCACAACTCAA	0.458													6	244	---	---	---	---	PASS
INSM2	84684	broad.mit.edu	37	14	36003540	36003540	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:36003540C>G	uc001wth.1	+	1	293	c.82C>G	c.(82-84)CTG>GTG	p.L28V		NM_032594	NP_115983	Q96T92	INSM2_HUMAN	insulinoma-associated protein IA-6	28					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			lung(1)|skin(1)	2	Breast(36;0.122)|Hepatocellular(127;0.158)		LUAD - Lung adenocarcinoma(9;2.16e-07)|Lung(238;2.63e-07)|Epithelial(34;0.00145)|all cancers(34;0.00452)	GBM - Glioblastoma multiforme(112;0.0223)		TGTCTTCCCTCTGCTGGGGCC	0.687													14	32	---	---	---	---	PASS
GNG2	54331	broad.mit.edu	37	14	52433361	52433361	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52433361G>C	uc001wzi.2	+	4	701	c.172G>C	c.(172-174)GAA>CAA	p.E58Q	GNG2_uc001wzh.2_RNA|GNG2_uc010aoc.1_RNA|GNG2_uc001wzj.2_RNA|GNG2_uc001wzk.2_Missense_Mutation_p.E58Q	NM_053064	NP_444292	P59768	GBG2_HUMAN	guanine nucleotide binding protein (G protein),	58					cellular response to glucagon stimulus|energy reserve metabolic process|platelet activation|synaptic transmission	heterotrimeric G-protein complex	protein binding|signal transducer activity				0	all_epithelial(31;0.0659)|Breast(41;0.0684)				Halothane(DB01159)	TCCGGCTTCAGAAAACCCGTT	0.522													75	112	---	---	---	---	PASS
GPR135	64582	broad.mit.edu	37	14	59930507	59930507	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:59930507C>T	uc010apj.2	-	1	1553	c.1438G>A	c.(1438-1440)GCA>ACA	p.A480T	GPR135_uc001xed.2_RNA	NM_022571	NP_072093	Q8IZ08	GP135_HUMAN	G protein-coupled receptor 135	480	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity				0				OV - Ovarian serous cystadenocarcinoma(108;0.134)		TTGGTCACTGCCGTCACCGGC	0.547													7	20	---	---	---	---	PASS
VASH1	22846	broad.mit.edu	37	14	77242312	77242312	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77242312G>A	uc001xst.2	+	5	1538	c.608G>A	c.(607-609)CGC>CAC	p.R203H		NM_014909	NP_055724	Q7L8A9	VASH1_HUMAN	vasohibin 1	203					cell cycle arrest|negative regulation of angiogenesis|negative regulation of blood vessel endothelial cell migration|negative regulation of endothelial cell proliferation	endoplasmic reticulum|extracellular space					0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0283)		AACTACTTCCGCCACATCGTG	0.632													3	7	---	---	---	---	PASS
VASH1	22846	broad.mit.edu	37	14	77242313	77242313	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77242313C>T	uc001xst.2	+	5	1539	c.609C>T	c.(607-609)CGC>CGT	p.R203R		NM_014909	NP_055724	Q7L8A9	VASH1_HUMAN	vasohibin 1	203					cell cycle arrest|negative regulation of angiogenesis|negative regulation of blood vessel endothelial cell migration|negative regulation of endothelial cell proliferation	endoplasmic reticulum|extracellular space					0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0283)		ACTACTTCCGCCACATCGTGC	0.632													3	7	---	---	---	---	PASS
BRF1	2972	broad.mit.edu	37	14	105707692	105707692	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:105707692C>T	uc001yqp.2	-	6	967	c.604G>A	c.(604-606)GAG>AAG	p.E202K	BRF1_uc010tyo.1_Missense_Mutation_p.E87K|BRF1_uc010typ.1_Missense_Mutation_p.E87K|BRF1_uc001yql.2_5'UTR|BRF1_uc001yqo.2_Intron|BRF1_uc010axg.1_Missense_Mutation_p.E175K|BRF1_uc001yqn.2_RNA|BRF1_uc010axh.1_RNA|BRF1_uc010axj.1_Intron	NM_001519	NP_001510	Q92994	TF3B_HUMAN	transcription initiation factor IIIB isoform 1	202	2.				positive regulation of transcription, DNA-dependent|rRNA transcription|transcription initiation from RNA polymerase III promoter|tRNA transcription	transcription factor TFIIIB complex	translation initiation factor activity|zinc ion binding			large_intestine(1)|ovary(1)|central_nervous_system(1)|skin(1)	4		all_cancers(154;0.0231)|all_epithelial(191;0.0694)|Melanoma(154;0.155)	OV - Ovarian serous cystadenocarcinoma(23;0.00753)|all cancers(16;0.00925)|Epithelial(46;0.0221)	Epithelial(152;0.14)		ATGGACACCTCGTGGTTCTTC	0.637													16	41	---	---	---	---	PASS
ADAM6	8755	broad.mit.edu	37	14	106641716	106641716	+	RNA	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:106641716C>G	uc010tyt.1	-	1021		c.24285G>C								Parts of antibodies, mostly variable regions.												0						TCCATCCCATCCACTCAAGCC	0.547													8	234	---	---	---	---	PASS
CYFIP1	23191	broad.mit.edu	37	15	22980128	22980128	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22980128C>G	uc001yus.2	+	23	2730	c.2626C>G	c.(2626-2628)CAA>GAA	p.Q876E	CYFIP1_uc001yut.2_Missense_Mutation_p.Q876E|CYFIP1_uc010aya.1_Missense_Mutation_p.Q904E|CYFIP1_uc001yuu.2_Missense_Mutation_p.Q445E|CYFIP1_uc001yuv.2_Missense_Mutation_p.Q70E	NM_014608	NP_055423	Q7L576	CYFP1_HUMAN	cytoplasmic FMR1 interacting protein 1 isoform	876					axon extension|lamellipodium assembly|regulation of cell shape|ruffle organization	cell junction|lamellipodium|mRNA cap binding complex|perinuclear region of cytoplasm|ruffle|synapse|synaptosome	actin filament binding|Rac GTPase binding			ovary(4)|pancreas(3)|liver(1)|skin(1)	9		all_cancers(20;2.26e-25)|all_epithelial(15;2.1e-22)|Lung NSC(15;3.36e-17)|all_lung(15;1.04e-16)|Breast(32;0.000776)|Colorectal(260;0.0488)		all cancers(64;2.22e-06)|Epithelial(43;1.49e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00101)		TCAGGAATTTCAAAGAGATAA	0.358													14	151	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	15	25422031	25422031	+	Intron	SNP	A	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25422031A>C	uc001yys.1	+						SNORD115-4_uc001yyu.1_RNA|SNORD115-5_uc001yyv.1_5'Flank					Homo sapiens clone Rt-5 SNURF-SNRPN mRNA, downstream untranslated exons, alternatively spliced.																		TGACTTAAAAATCATGCTCAA	0.522													6	298	---	---	---	---	PASS
BAHD1	22893	broad.mit.edu	37	15	40758317	40758317	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40758317G>C	uc001zlu.2	+	7	2402	c.2331G>C	c.(2329-2331)AAG>AAC	p.K777N	BAHD1_uc001zlt.2_Missense_Mutation_p.K776N|BAHD1_uc010bbp.1_Missense_Mutation_p.K773N|BAHD1_uc001zlv.2_Missense_Mutation_p.K774N	NM_014952	NP_055767	Q8TBE0	BAHD1_HUMAN	bromo adjacent homology domain containing 1	777	BAH.				heterochromatin formation|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromatin silencing complex|chromosome	chromatin binding|DNA binding|protein binding				0		all_cancers(109;8.28e-19)|all_epithelial(112;2.64e-15)|Lung NSC(122;5.14e-11)|all_lung(180;1.27e-09)|Melanoma(134;0.0574)|Ovarian(310;0.0822)|Colorectal(260;0.117)		GBM - Glioblastoma multiforme(113;3.46e-06)|BRCA - Breast invasive adenocarcinoma(123;0.08)		GCATCCTTAAGAACCCCCAGT	0.627													15	43	---	---	---	---	PASS
RPAP1	26015	broad.mit.edu	37	15	41817271	41817271	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41817271C>T	uc001zod.2	-	15	2117	c.1993G>A	c.(1993-1995)GAG>AAG	p.E665K	RPAP1_uc001zoc.2_5'Flank	NM_015540	NP_056355	Q9BWH6	RPAP1_HUMAN	RNA polymerase II associated protein 1	665						nucleus	DNA binding|DNA-directed RNA polymerase activity			large_intestine(1)	1		all_cancers(109;6.59e-20)|all_epithelial(112;7.67e-17)|Lung NSC(122;5.34e-11)|all_lung(180;4.17e-10)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.173)		OV - Ovarian serous cystadenocarcinoma(18;2.84e-17)|GBM - Glioblastoma multiforme(113;1.68e-06)|Colorectal(105;0.0163)|BRCA - Breast invasive adenocarcinoma(123;0.117)		TCAGCTTCCTCTGGGGGCAAG	0.617													34	16	---	---	---	---	PASS
JMJD7-PLA2G4B	8681	broad.mit.edu	37	15	42136660	42136660	+	Intron	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42136660C>G	uc010bco.2	+						JMJD7-PLA2G4B_uc001zoo.3_Intron|JMJD7-PLA2G4B_uc010bcn.2_Intron|JMJD7-PLA2G4B_uc001zoq.3_Intron|JMJD7-PLA2G4B_uc001zor.1_5'UTR	NM_001114633	NP_001108105	P0C869	PA24B_HUMAN	phospholipase A2, group IVB						arachidonic acid metabolic process|calcium-mediated signaling|glycerophospholipid catabolic process|inflammatory response|parturition	cytosol|early endosome membrane|extracellular region|mitochondrial membrane	calcium ion binding|calcium-dependent phospholipase A2 activity|calcium-dependent phospholipid binding|lysophospholipase activity			large_intestine(1)	1						TGGCTCTCTTCTTTTCCAGAT	0.592													18	230	---	---	---	---	PASS
JMJD7-PLA2G4B	8681	broad.mit.edu	37	15	42138489	42138489	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42138489G>T	uc010bco.2	+	17	1790	c.1689G>T	c.(1687-1689)TGG>TGT	p.W563C	JMJD7-PLA2G4B_uc001zoo.3_Missense_Mutation_p.W794C|JMJD7-PLA2G4B_uc010bcn.2_Missense_Mutation_p.W794C|JMJD7-PLA2G4B_uc001zoq.3_Missense_Mutation_p.W264C|JMJD7-PLA2G4B_uc001zor.1_3'UTR	NM_001114633	NP_001108105	P0C869	PA24B_HUMAN	phospholipase A2, group IVB	563	PLA2c.				arachidonic acid metabolic process|calcium-mediated signaling|glycerophospholipid catabolic process|inflammatory response|parturition	cytosol|early endosome membrane|extracellular region|mitochondrial membrane	calcium ion binding|calcium-dependent phospholipase A2 activity|calcium-dependent phospholipid binding|lysophospholipase activity			large_intestine(1)	1						TTCTGACGTGGCGTCCACTGG	0.522													6	89	---	---	---	---	PASS
UBR1	197131	broad.mit.edu	37	15	43339472	43339472	+	Nonsense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43339472G>A	uc001zqq.2	-	14	1621	c.1555C>T	c.(1555-1557)CGA>TGA	p.R519*	UBR1_uc010udk.1_Nonsense_Mutation_p.R519*	NM_174916	NP_777576	Q8IWV7	UBR1_HUMAN	ubiquitin protein ligase E3 component n-recognin	519					cellular response to leucine|negative regulation of TOR signaling cascade	cytosol	leucine binding|zinc ion binding			lung(1)	1		all_cancers(109;4.32e-15)|all_epithelial(112;4.05e-13)|Lung NSC(122;1.75e-08)|all_lung(180;2e-07)|Melanoma(134;0.0179)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;4.08e-07)|COAD - Colon adenocarcinoma(120;0.185)|Colorectal(105;0.214)		ACCTGTCTTCGGATTTCTTCC	0.423													9	234	---	---	---	---	PASS
UNC13C	440279	broad.mit.edu	37	15	54435219	54435219	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:54435219C>T	uc002ack.2	+	2	2988	c.2988C>T	c.(2986-2988)AGC>AGT	p.S996S		NM_001080534	NP_001074003	Q8NB66	UN13C_HUMAN	unc-13 homolog C	996					exocytosis|intracellular signal transduction	cell junction|cytoplasm|presynaptic membrane	metal ion binding			ovary(5)|pancreas(2)	7				GBM - Glioblastoma multiforme(80;0.0789)|all cancers(107;0.124)		TTTCAGATAGCAGTTCTGTGG	0.313													10	83	---	---	---	---	PASS
MIR422A	494334	broad.mit.edu	37	15	64163136	64163136	+	RNA	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:64163136G>A	hsa-mir-422a|MI0001444	-			c.83G>A																				0						ggcccagggaggacaaagctt	0.234													18	53	---	---	---	---	PASS
DIS3L	115752	broad.mit.edu	37	15	66621672	66621672	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:66621672A>G	uc010ujm.1	+	14	2485	c.2470A>G	c.(2470-2472)AAG>GAG	p.K824E	DIS3L_uc002app.2_Missense_Mutation_p.K741E|DIS3L_uc010bho.2_Missense_Mutation_p.K690E	NM_001143688	NP_001137160	Q8TF46	DI3L1_HUMAN	DIS3 mitotic control homolog (S.	824					rRNA catabolic process	cytoplasm|exosome (RNase complex)	exonuclease activity|protein binding|ribonuclease activity|RNA binding			ovary(2)	2						AATGGAAATTAAGGGAAATCT	0.333													7	64	---	---	---	---	PASS
CCDC33	80125	broad.mit.edu	37	15	74573023	74573023	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:74573023C>G	uc002axo.2	+	9	1298	c.904C>G	c.(904-906)CCG>GCG	p.P302A	CCDC33_uc002axp.2_Missense_Mutation_p.P124A	NM_025055	NP_079331	Q8N5R6	CCD33_HUMAN	coiled-coil domain containing 33 isoform 1	505							protein binding			ovary(3)|skin(2)	5						AGGCAGCCAGCCGTGGACCCT	0.582													7	67	---	---	---	---	PASS
LMAN1L	79748	broad.mit.edu	37	15	75116785	75116785	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75116785C>G	uc002ayt.1	+	13	1419	c.1417C>G	c.(1417-1419)CAG>GAG	p.Q473E	LMAN1L_uc010bke.1_Missense_Mutation_p.Q461E|CPLX3_uc002ayu.1_5'Flank	NM_021819	NP_068591	Q9HAT1	LMA1L_HUMAN	lectin, mannose-binding, 1 like precursor	473	Helical; (Potential).					ER-Golgi intermediate compartment membrane|integral to membrane	sugar binding				0						CCTCCTCATTCAGACTGTAGG	0.597													7	122	---	---	---	---	PASS
TMC3	342125	broad.mit.edu	37	15	81628953	81628953	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:81628953C>G	uc002bgo.1	-	20	2200	c.2200G>C	c.(2200-2202)GAA>CAA	p.E734Q	TMC3_uc010blr.1_RNA	NM_001080532	NP_001074001	Q7Z5M5	TMC3_HUMAN	transmembrane channel-like 3	734	Cytoplasmic (Potential).			E -> EGK (in Ref. 1; AAP78778).		integral to membrane				ovary(1)|liver(1)	2						TACTTACCTTCTACCATCTGG	0.214													7	159	---	---	---	---	PASS
KIF7	374654	broad.mit.edu	37	15	90172769	90172769	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:90172769C>G	uc002bof.2	-	17	3431	c.3354G>C	c.(3352-3354)CAG>CAC	p.Q1118H	KIF7_uc010upw.1_Missense_Mutation_p.Q604H|C15orf42_uc010upv.1_RNA	NM_198525	NP_940927	Q2M1P5	KIF7_HUMAN	kinesin family member 7	1118	Potential.				microtubule-based movement|negative regulation of smoothened signaling pathway|positive regulation of smoothened signaling pathway	cilium	ATP binding|microtubule motor activity|protein binding			ovary(2)|lung(1)	3	Lung NSC(78;0.0237)|all_lung(78;0.0478)		BRCA - Breast invasive adenocarcinoma(143;0.128)			AGAAGGCAATCTGCTGCTGGT	0.622													13	61	---	---	---	---	PASS
WDR24	84219	broad.mit.edu	37	16	737292	737292	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:737292C>T	uc002ciz.1	-	3	1544	c.784G>A	c.(784-786)GAG>AAG	p.E262K	JMJD8_uc002ciw.1_5'Flank|JMJD8_uc002cix.1_5'Flank|JMJD8_uc002ciy.1_5'Flank	NM_032259	NP_115635	Q96S15	WDR24_HUMAN	WD repeat domain 24	348	WD 4.									ovary(1)|central_nervous_system(1)	2		Hepatocellular(780;0.0218)				TGGCGGCACTCTGGCCGCCAC	0.617													4	15	---	---	---	---	PASS
ZC3H7A	29066	broad.mit.edu	37	16	11855265	11855265	+	Silent	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11855265A>G	uc002dbk.2	-	18	2514	c.2316T>C	c.(2314-2316)TTT>TTC	p.F772F	ZC3H7A_uc002dbi.2_5'Flank|ZC3H7A_uc002dbj.2_Intron|ZC3H7A_uc002dbl.2_Silent_p.F772F|ZC3H7A_uc002dbm.1_Silent_p.F682F	NM_014153	NP_054872	Q8IWR0	Z3H7A_HUMAN	zinc finger CCCH-type containing 7A	772	C3H1-type 2.					nucleus	nucleic acid binding|zinc ion binding			ovary(2)|pancreas(1)|skin(1)	4						TATGTACATCAAACTGTAAAG	0.363													22	197	---	---	---	---	PASS
C16orf62	57020	broad.mit.edu	37	16	19693640	19693640	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19693640C>T	uc002dgn.1	+	28	2467	c.2455C>T	c.(2455-2457)CGC>TGC	p.R819C	C16orf62_uc002dgo.1_Missense_Mutation_p.R726C|C16orf62_uc002dgp.1_Missense_Mutation_p.R568C	NM_020314	NP_064710	Q7Z3J2	CP062_HUMAN	hypothetical protein LOC57020	819						integral to membrane				ovary(1)	1						TGAGAAAATCCGCATCTACAC	0.532													8	88	---	---	---	---	PASS
RUNDC2C	440352	broad.mit.edu	37	16	29376067	29376067	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29376067G>C	uc002dsj.1	+	5	806	c.409G>C	c.(409-411)GAT>CAT	p.D137H	uc010vct.1_Intron|RUNDC2C_uc010bys.1_RNA|RUNDC2C_uc010vdo.1_Missense_Mutation_p.D118H	NM_001012391	NP_001012391			RecName: Full=RUN domain-containing protein 2A;												0						CTCATTTGATGATGAGGAAGA	0.398													18	60	---	---	---	---	PASS
ZNF319	57567	broad.mit.edu	37	16	58030577	58030577	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:58030577C>G	uc002emx.1	-	2	2216	c.1593G>C	c.(1591-1593)AAG>AAC	p.K531N		NM_020807	NP_065858	Q9P2F9	ZN319_HUMAN	zinc finger protein 319	531	C2H2-type 15.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						CGCCCTGGTGCTTGTTGAGAT	0.637													4	13	---	---	---	---	PASS
CMTM2	146225	broad.mit.edu	37	16	66621981	66621981	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:66621981G>C	uc002ept.2	+	4	866	c.706G>C	c.(706-708)GAA>CAA	p.E236Q	CMTM2_uc010cdu.2_Missense_Mutation_p.E183Q	NM_144673	NP_653274	Q8TAZ6	CKLF2_HUMAN	chemokine-like factor superfamily 2	236					chemotaxis	extracellular space|integral to membrane	cytokine activity			ovary(1)	1		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.068)|Epithelial(162;0.212)		CAAGCCACCAGAACCTGGCAA	0.532													4	75	---	---	---	---	PASS
NAE1	8883	broad.mit.edu	37	16	66847711	66847711	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:66847711G>C	uc002eqf.2	-	12	956	c.879C>G	c.(877-879)CGC>CGG	p.R293R	NAE1_uc002eqe.2_Silent_p.R287R|NAE1_uc002eqg.2_Silent_p.R204R|NAE1_uc010cdv.2_Silent_p.R296R	NM_003905	NP_003896	Q13564	ULA1_HUMAN	NEDD8 activating enzyme E1 subunit 1 isoform a	293					apoptosis|cell cycle|DNA replication|mitotic cell cycle DNA replication checkpoint|protein neddylation|signal transduction	cytoplasm|insoluble fraction|plasma membrane	catalytic activity|protein heterodimerization activity			ovary(1)	1		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0914)|Epithelial(162;0.214)	Adenosine triphosphate(DB00171)	TATTTATGCAGCGATCATCAT	0.308													11	136	---	---	---	---	PASS
FHOD1	29109	broad.mit.edu	37	16	67264128	67264128	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67264128C>G	uc002esl.2	-	20	3167	c.3055G>C	c.(3055-3057)GAG>CAG	p.E1019Q	FHOD1_uc002esk.2_Missense_Mutation_p.E78Q|FHOD1_uc010ced.2_Missense_Mutation_p.E826Q	NM_013241	NP_037373	Q9Y613	FHOD1_HUMAN	formin homology 2 domain containing 1	1019					actin cytoskeleton organization	cytoplasm|cytoskeleton|nucleus	actin binding			breast(2)|ovary(1)	3		Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.000691)|Epithelial(162;0.00462)|all cancers(182;0.0434)		GAGAACTTCTCTGTCTGGAGA	0.592													6	74	---	---	---	---	PASS
FAM65A	79567	broad.mit.edu	37	16	67578917	67578917	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67578917G>T	uc010vjp.1	+	17	3084	c.2988G>T	c.(2986-2988)GAG>GAT	p.E996D	FAM65A_uc002eth.2_Missense_Mutation_p.E976D|FAM65A_uc010cej.2_Missense_Mutation_p.E979D|FAM65A_uc010vjq.1_Missense_Mutation_p.E990D|FAM65A_uc002etk.2_Missense_Mutation_p.E974D	NM_024519	NP_078795	Q6ZS17	FA65A_HUMAN	hypothetical protein LOC79567	980						cytoplasm	binding			ovary(2)|central_nervous_system(1)	3		Acute lymphoblastic leukemia(13;3.76e-06)|all_hematologic(13;0.000303)|Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0474)|Epithelial(162;0.117)		AGTGCACAGAGAGACTCAGCT	0.642													10	272	---	---	---	---	PASS
PARD6A	50855	broad.mit.edu	37	16	67695398	67695398	+	Nonsense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67695398C>A	uc002ett.2	+	2	195	c.104C>A	c.(103-105)TCG>TAG	p.S35*	ACD_uc002etp.3_5'Flank|ACD_uc002etq.3_5'Flank|ACD_uc002etr.3_5'Flank|ACD_uc010vjt.1_5'Flank|PARD6A_uc002ets.2_Nonsense_Mutation_p.S35*|PARD6A_uc002etu.2_5'UTR	NM_016948	NP_058644	Q9NPB6	PAR6A_HUMAN	par-6 partitioning defective 6 homolog alpha	35	Interaction with PRKCI and PRKCZ.|OPR.				cell cycle|cell division|cell-cell junction maintenance|tight junction assembly|viral reproduction	cytosol|nucleus|ruffle|tight junction	GTP-dependent protein binding|Rho GTPase binding|transcription factor binding			ovary(1)	1		Acute lymphoblastic leukemia(13;3.76e-06)|all_hematologic(13;0.000303)|Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0143)|Epithelial(162;0.047)|all cancers(182;0.228)		CCTCGCGCTTCGGTGAGCGGC	0.657													18	78	---	---	---	---	PASS
PARD6A	50855	broad.mit.edu	37	16	67696109	67696109	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:67696109G>C	uc002ett.2	+	3	691	c.600G>C	c.(598-600)GGG>GGC	p.G200G	ACD_uc002etp.3_5'Flank|ACD_uc002etq.3_5'Flank|ACD_uc002etr.3_5'Flank|ACD_uc010vjt.1_5'Flank|PARD6A_uc002ets.2_Silent_p.G199G|PARD6A_uc002etu.2_Silent_p.G24G	NM_016948	NP_058644	Q9NPB6	PAR6A_HUMAN	par-6 partitioning defective 6 homolog alpha	200	PDZ.|Interaction with PARD3 and CDC42 (By similarity).				cell cycle|cell division|cell-cell junction maintenance|tight junction assembly|viral reproduction	cytosol|nucleus|ruffle|tight junction	GTP-dependent protein binding|Rho GTPase binding|transcription factor binding			ovary(1)	1		Acute lymphoblastic leukemia(13;3.76e-06)|all_hematologic(13;0.000303)|Ovarian(137;0.0563)		OV - Ovarian serous cystadenocarcinoma(108;0.0143)|Epithelial(162;0.047)|all cancers(182;0.228)		TGGTACGTGGGGGTCTGGCTG	0.612													9	83	---	---	---	---	PASS
MARVELD3	91862	broad.mit.edu	37	16	71668136	71668136	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:71668136C>T	uc002fat.2	+	3	699	c.636C>T	c.(634-636)ATC>ATT	p.I212I	MARVELD3_uc002fau.2_Intron|MARVELD3_uc010cge.2_Intron	NM_052858	NP_443090	Q96A59	MALD3_HUMAN	MARVEL domain containing 3 isoform 2	212	MARVEL.|Cytoplasmic (Potential).					integral to membrane				skin(1)	1		Ovarian(137;0.125)				ACTTGCTGATCCTGGCCTGCA	0.527													178	99	---	---	---	---	PASS
CLEC18B	497190	broad.mit.edu	37	16	74445830	74445830	+	Intron	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:74445830G>C	uc002fct.2	-						CLEC18B_uc002fcu.2_Intron|CLEC18B_uc010vmu.1_3'UTR|CLEC18B_uc010vmv.1_Intron	NM_001011880	NP_001011880	Q6UXF7	CL18B_HUMAN	C-type lectin domain family 18, member B							extracellular region	sugar binding				0						ttggaatattgagcttgctct	0.234													5	31	---	---	---	---	PASS
MBTPS1	8720	broad.mit.edu	37	16	84135448	84135448	+	Translation_Start_Site	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84135448G>C	uc002fhi.2	-	2	443	c.-59C>G	c.(-61--57)ATCAA>ATGAA			NM_003791	NP_003782	Q14703	MBTP1_HUMAN	membrane-bound transcription factor site-1						cholesterol metabolic process|proteolysis	endoplasmic reticulum lumen|endoplasmic reticulum membrane|Golgi membrane|integral to membrane	serine-type endopeptidase activity			ovary(2)	2						TTTTCTTCTTGATTAAAAGTG	0.348													7	35	---	---	---	---	PASS
ACSF3	197322	broad.mit.edu	37	16	89211739	89211739	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89211739C>G	uc002fmp.2	+	9	1771	c.1431C>G	c.(1429-1431)ATC>ATG	p.I477M	ACSF3_uc010cig.1_Missense_Mutation_p.I477M|ACSF3_uc010cih.1_Missense_Mutation_p.I212M|ACSF3_uc002fmq.1_RNA|ACSF3_uc010cii.1_RNA|ACSF3_uc002fmr.1_Missense_Mutation_p.I212M	NM_174917	NP_777577	Q4G176	ACSF3_HUMAN	acyl-CoA synthetase family member 3 precursor	477					fatty acid metabolic process	mitochondrion	acid-thiol ligase activity|ATP binding				0				BRCA - Breast invasive adenocarcinoma(80;0.0281)		TGGACATCATCAAGACTGGAG	0.622													6	22	---	---	---	---	PASS
ANKFY1	51479	broad.mit.edu	37	17	4086740	4086740	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:4086740G>C	uc002fxq.1	-	14	1943	c.1905C>G	c.(1903-1905)AGC>AGG	p.S635R	ANKFY1_uc002fxn.2_Missense_Mutation_p.S677R|ANKFY1_uc002fxo.2_Missense_Mutation_p.S635R|ANKFY1_uc002fxp.2_Missense_Mutation_p.S634R|ANKFY1_uc010ckp.2_Missense_Mutation_p.S576R	NM_016376	NP_057460	Q9P2R3	ANFY1_HUMAN	ankyrin repeat and FYVE domain containing 1	635	ANK 9.					endosome membrane	metal ion binding|protein binding			ovary(2)|skin(1)	3						GTGCGCTCTTGCTGTCCTGCC	0.557													10	50	---	---	---	---	PASS
ZNF594	84622	broad.mit.edu	37	17	5086349	5086349	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:5086349C>T	uc010cla.1	-	2	1359	c.1203G>A	c.(1201-1203)GAG>GAA	p.E401E		NM_032530	NP_115919	Q96JF6	ZN594_HUMAN	zinc finger protein 594	401					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|skin(1)	3						CATATGGTTTCTCTCCTGTAT	0.408													17	303	---	---	---	---	PASS
TP53	7157	broad.mit.edu	37	17	7577121	7577121	+	Missense_Mutation	SNP	G	T	T	rs121913343		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7577121G>T	uc002gim.2	-	8	1011	c.817C>A	c.(817-819)CGT>AGT	p.R273S	TP53_uc002gig.1_Intron|TP53_uc002gih.2_Missense_Mutation_p.R273S|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Missense_Mutation_p.R141S|TP53_uc010cng.1_Missense_Mutation_p.R141S|TP53_uc002gii.1_Missense_Mutation_p.R141S|TP53_uc010cnh.1_Missense_Mutation_p.R273S|TP53_uc010cni.1_Missense_Mutation_p.R273S|TP53_uc002gij.2_Missense_Mutation_p.R273S	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	273	Interaction with DNA.||Interaction with E4F1.|Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).		R -> N (in a sporadic cancer; somatic mutation; requires 2 nucleotide substitutions).|R -> S (in a familial cancer not matching LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> L (in LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> C (in LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> G (in LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> Q (in sporadic cancers; somatic mutation).|R -> Y (in a sporadic cancer; somatic mutation; requires 2 nucleotide substitutions).|R -> P (in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.R273H(467)|p.R273C(396)|p.R273L(83)|p.R273P(24)|p.R273S(11)|p.R273G(9)|p.0?(7)|p.R273fs*72(3)|p.?(2)|p.R273fs*33(2)|p.F270fs*72(1)|p.R273_C275delRVC(1)|p.L265_K305del41(1)|p.S269fs*21(1)|p.R273R(1)|p.E258fs*71(1)|p.R273fs*71(1)|p.F270_D281del12(1)|p.E271_R273delEVR(1)|p.V272_K292del21(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)		GCACAAACACGCACCTCAAAG	0.542	R273C(SH10TC_STOMACH)|R273C(SUDHL4_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE)|R273C(8MGBA_CENTRAL_NERVOUS_SYSTEM)|R273C(SW1783_CENTRAL_NERVOUS_SYSTEM)|R273C(BL70_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE)|R273C(SW1710_URINARY_TRACT)|R273C(RH30_SOFT_TISSUE)|R273C(PANC0213_PANCREAS)|R273C(SJRH30_SOFT_TISSUE)|R273C(PF382_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE)|R273C(RDES_BONE)|R273C(TT2609C02_THYROID)|R273C(MFE319_ENDOMETRIUM)|R273C(RPMI8402_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE)|R273C(EFO27_OVARY)|R273C(NCIH1048_LUNG)|R273C(KARPAS299_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE)	111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			7	10	---	---	---	---	PASS
TP53	7157	broad.mit.edu	37	17	7577122	7577122	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7577122C>T	uc002gim.2	-	8	1010	c.816G>A	c.(814-816)GTG>GTA	p.V272V	TP53_uc002gig.1_Intron|TP53_uc002gih.2_Silent_p.V272V|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Silent_p.V140V|TP53_uc010cng.1_Silent_p.V140V|TP53_uc002gii.1_Silent_p.V140V|TP53_uc010cnh.1_Silent_p.V272V|TP53_uc010cni.1_Silent_p.V272V|TP53_uc002gij.2_Silent_p.V272V	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	272	|Interaction with E4F1.|Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).		V -> M (in sporadic cancers; somatic mutation).|V -> L (in LFS; germline mutation and in sporadic cancers; somatic mutation).|V -> A (in a familial cancer not matching LFS; germline mutation and in sporadic cancers; somatic mutation).|V -> G (in sporadic cancers; somatic mutation).|V -> E (in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.V272M(66)|p.V272L(24)|p.V272E(8)|p.V272A(7)|p.0?(7)|p.V272G(4)|p.V272fs*73(4)|p.V272V(3)|p.?(2)|p.F270fs*72(1)|p.V272fs*34(1)|p.L265_K305del41(1)|p.S269fs*21(1)|p.E258fs*71(1)|p.V272fs*74(1)|p.F270_D281del12(1)|p.R273fs*33(1)|p.E271_R273delEVR(1)|p.V272_K292del21(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)		CACAAACACGCACCTCAAAGC	0.537		111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			7	10	---	---	---	---	PASS
CHD3	1107	broad.mit.edu	37	17	7806657	7806657	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7806657C>T	uc002gje.2	+	23	3713	c.3563C>T	c.(3562-3564)GCG>GTG	p.A1188V	CHD3_uc002gjd.2_Missense_Mutation_p.A1247V|CHD3_uc002gjf.2_Missense_Mutation_p.A1188V|CHD3_uc002gjh.2_5'Flank|SCARNA21_uc002gji.1_5'Flank	NM_001005273	NP_001005273	Q12873	CHD3_HUMAN	chromodomain helicase DNA binding protein 3	1188	Helicase C-terminal.				chromatin modification|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	microtubule organizing center|NuRD complex	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding|zinc ion binding			breast(1)	1		Prostate(122;0.202)				GTGACTCGCGCGTCAGTGGAA	0.582													4	54	---	---	---	---	PASS
MYH4	4622	broad.mit.edu	37	17	10351974	10351974	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10351974G>C	uc002gmn.2	-	32	4603	c.4492C>G	c.(4492-4494)CAT>GAT	p.H1498D	uc002gml.1_Intron	NM_017533	NP_060003	Q9Y623	MYH4_HUMAN	myosin, heavy polypeptide 4, skeletal muscle	1498	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(10)|skin(2)|central_nervous_system(1)	13						GTTTCAAGATGATCCAGGGAT	0.428													6	150	---	---	---	---	PASS
AKAP10	11216	broad.mit.edu	37	17	19861601	19861601	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:19861601A>T	uc002gwo.2	-	4	740	c.603T>A	c.(601-603)GAT>GAA	p.D201E	AKAP10_uc002gwp.1_Missense_Mutation_p.D201E|AKAP10_uc010cqw.1_Missense_Mutation_p.D201E|AKAP10_uc010vze.1_Missense_Mutation_p.D122E	NM_007202	NP_009133	O43572	AKA10_HUMAN	A-kinase anchor protein 10 precursor	201	RGS 1.				blood coagulation|protein localization	cytosol|mitochondrion|plasma membrane	signal transducer activity			skin(1)	1	all_cancers(12;2.08e-05)|all_epithelial(12;0.00158)|Breast(13;0.165)					TATCAAGAGAATCAGTTAAAA	0.408													12	37	---	---	---	---	PASS
CCDC144NL	339184	broad.mit.edu	37	17	20768623	20768623	+	3'UTR	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:20768623A>G	uc002gyf.2	-	4						NM_001004306	NP_001004306	Q6NUI1	C144L_HUMAN	coiled-coil domain containing 144 family,												0						CAGTTTAATAAAAGAGTTCAT	0.308													3	17	---	---	---	---	PASS
ZNF207	7756	broad.mit.edu	37	17	30678830	30678830	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30678830G>A	uc002hhh.3	+	2	215	c.67G>A	c.(67-69)GAG>AAG	p.E23K	ZNF207_uc002hhj.3_Missense_Mutation_p.E23K|ZNF207_uc002hhi.3_Missense_Mutation_p.E23K|ZNF207_uc010csz.2_Missense_Mutation_p.E26K|ZNF207_uc002hhk.1_Missense_Mutation_p.E23K	NM_003457	NP_003448	O43670	ZN207_HUMAN	zinc finger protein 207 isoform a	23	C2H2-type 1.					nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Breast(31;0.116)|Ovarian(249;0.182)	BRCA - Breast invasive adenocarcinoma(9;0.239)			TTTTGATGATGAGAAGATCCT	0.338													18	616	---	---	---	---	PASS
MYO1D	4642	broad.mit.edu	37	17	31092057	31092057	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:31092057C>T	uc002hho.1	-	8	886	c.874G>A	c.(874-876)GAG>AAG	p.E292K	MYO1D_uc002hhp.1_Missense_Mutation_p.E292K|MYO1D_uc010wcb.1_Missense_Mutation_p.E292K	NM_015194	NP_056009	O94832	MYO1D_HUMAN	myosin ID	292	Myosin head-like.					myosin complex	actin binding|ATP binding|calmodulin binding			large_intestine(1)|ovary(1)|central_nervous_system(1)	3			BRCA - Breast invasive adenocarcinoma(9;0.0362)			TTGCCATTCTCAATAAGAGGC	0.368													7	350	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	17	40178971	40178971	+	Missense_Mutation	SNP	T	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40178971T>G	uc002hyu.2	-	4	612	c.469A>C	c.(469-471)ACC>CCC	p.T157P						RecName: Full=Zinc finger protein 385C;																		CCTGCTGGGGTGCGAAACAGA	0.642													5	8	---	---	---	---	PASS
EZH1	2145	broad.mit.edu	37	17	40874816	40874816	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40874816C>G	uc002iaz.2	-	6	629	c.484G>C	c.(484-486)GAA>CAA	p.E162Q	EZH1_uc002iba.2_Missense_Mutation_p.E153Q|EZH1_uc010wgt.1_Missense_Mutation_p.E92Q|EZH1_uc010wgu.1_Missense_Mutation_p.E168Q|EZH1_uc010wgv.1_Missense_Mutation_p.E122Q|EZH1_uc010wgw.1_Intron|EZH1_uc010cyp.2_Intron|EZH1_uc010cyq.2_Missense_Mutation_p.E79Q|EZH1_uc010cys.2_Missense_Mutation_p.E113Q|EZH1_uc010cyo.1_5'UTR|EZH1_uc010cyr.1_5'Flank	NM_001991	NP_001982	Q92800	EZH1_HUMAN	enhancer of zeste homolog 1	162					anatomical structure morphogenesis|regulation of transcription, DNA-dependent|transcription, DNA-dependent	ESC/E(Z) complex	chromatin binding|DNA binding			ovary(3)	3		Breast(137;0.00104)		BRCA - Breast invasive adenocarcinoma(366;0.0784)		CCACTACCTTCTTCACCATGG	0.403													3	95	---	---	---	---	PASS
EPN3	55040	broad.mit.edu	37	17	48618412	48618412	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:48618412C>T	uc002ira.3	+	7	1673	c.1238C>T	c.(1237-1239)TCC>TTC	p.S413F	SPATA20_uc002irc.2_5'Flank|EPN3_uc010wms.1_Missense_Mutation_p.S441F|EPN3_uc010wmt.1_RNA|EPN3_uc010wmu.1_Missense_Mutation_p.S386F	NM_017957	NP_060427	Q9H201	EPN3_HUMAN	epsin 3	413						clathrin-coated vesicle|nucleus|perinuclear region of cytoplasm	lipid binding			ovary(1)	1	Breast(11;1.23e-18)		BRCA - Breast invasive adenocarcinoma(22;2.88e-09)			CTGGAGACCTCCGACACACCT	0.637													15	16	---	---	---	---	PASS
APPBP2	10513	broad.mit.edu	37	17	58531675	58531675	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:58531675C>T	uc002iys.1	-	11	1614	c.1326G>A	c.(1324-1326)ATG>ATA	p.M442I	APPBP2_uc010ddl.1_Missense_Mutation_p.M371I	NM_006380	NP_006371	Q92624	APBP2_HUMAN	amyloid beta precursor protein-binding protein	442	TPR 6.				intracellular protein transport	cytoplasmic vesicle membrane|microtubule|microtubule associated complex|nucleus	microtubule motor activity|protein binding				0	all_neural(34;0.0878)|Medulloblastoma(34;0.0922)		Epithelial(12;3.67e-13)|all cancers(12;1.44e-11)|Colorectal(3;0.01)			TAAATTTTCTCATTGACTGAT	0.294													5	139	---	---	---	---	PASS
BRIP1	83990	broad.mit.edu	37	17	59763273	59763273	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59763273G>A	uc002izk.1	-	19	2970	c.2829C>T	c.(2827-2829)GTC>GTT	p.V943V	BRIP1_uc002izl.1_Silent_p.V324V	NM_032043	NP_114432	Q9BX63	FANCJ_HUMAN	BRCA1 interacting protein C-terminal helicase 1	943	Interaction with BRCA1.				DNA damage checkpoint|double-strand break repair|regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding			ovary(1)	1						GTAGTTCCTGGACACATATCT	0.363			F|N|Mis			AML|leukemia|breast		Direct_reversal_of_damage|Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia				44	323	---	---	---	---	PASS
BRIP1	83990	broad.mit.edu	37	17	59853848	59853848	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:59853848C>G	uc002izk.1	-	14	2152	c.2011G>C	c.(2011-2013)GAG>CAG	p.E671Q	BRIP1_uc002izl.1_Missense_Mutation_p.E52Q	NM_032043	NP_114432	Q9BX63	FANCJ_HUMAN	BRCA1 interacting protein C-terminal helicase 1	671					DNA damage checkpoint|double-strand break repair|regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|protein binding			ovary(1)	1						TCTTGGAACTCAAATGTTTCA	0.418			F|N|Mis			AML|leukemia|breast		Direct_reversal_of_damage|Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia				8	192	---	---	---	---	PASS
MED13	9969	broad.mit.edu	37	17	60023934	60023934	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:60023934G>C	uc002izo.2	-	30	6497	c.6420C>G	c.(6418-6420)CTC>CTG	p.L2140L		NM_005121	NP_005112	Q9UHV7	MED13_HUMAN	mediator complex subunit 13	2140					androgen receptor signaling pathway|positive regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			large_intestine(1)|ovary(1)	2						TTAGCCAGGAGAGTGCATTGT	0.373													7	85	---	---	---	---	PASS
CSH2	1443	broad.mit.edu	37	17	61951021	61951021	+	5'UTR	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61951021T>C	uc002jch.2	-	1					CSH2_uc002jcg.2_5'UTR|CSH2_uc002jci.2_5'UTR|GH2_uc002jcj.2_Intron|CSH2_uc002jck.2_Intron	NM_020991	NP_066271	P01243	CSH_HUMAN	chorionic somatomammotropin hormone 2 isoform 1						female pregnancy|signal transduction	extracellular region	hormone activity|metal ion binding				0						TTCGGGGAGTTGGGCCTTGGG	0.567													4	51	---	---	---	---	PASS
AXIN2	8313	broad.mit.edu	37	17	63532561	63532561	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:63532561G>T	uc002jfi.2	-	8	2307	c.2018C>A	c.(2017-2019)ACC>AAC	p.T673N	AXIN2_uc002jfh.2_Missense_Mutation_p.T608N	NM_004655	NP_004646	Q9Y2T1	AXIN2_HUMAN	axin 2	673					cellular protein localization|cellular response to organic cyclic compound|dorsal/ventral axis specification|intramembranous ossification|maintenance of DNA repeat elements|mRNA stabilization|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of catenin import into nucleus|negative regulation of cell proliferation|negative regulation of osteoblast differentiation|odontogenesis|positive regulation of cell death|positive regulation of epithelial to mesenchymal transition|positive regulation of protein phosphorylation|regulation of centromeric sister chromatid cohesion|regulation of mismatch repair|Wnt receptor signaling pathway involved in somitogenesis	Axin-APC-beta-catenin-GSK3B complex|cell cortex|centrosome|cytoplasmic membrane-bounded vesicle|cytoplasmic microtubule|nucleus|plasma membrane|postsynaptic density	armadillo repeat domain binding|beta-catenin binding|GTPase activator activity|protein kinase binding|signal transducer activity|ubiquitin protein ligase binding			central_nervous_system(1)|skin(1)	2						GGCACGGGGGGTGGTGCGGGG	0.682									Oligodontia_Ectodermal_Dysplasia_and_Colorectal_Polyp_syndrome				8	31	---	---	---	---	PASS
RNF157	114804	broad.mit.edu	37	17	74152378	74152378	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:74152378C>T	uc002jqz.2	-	14	1507	c.1438G>A	c.(1438-1440)GAG>AAG	p.E480K	RNF157_uc002jra.2_Missense_Mutation_p.E480K	NM_052916	NP_443148	Q96PX1	RN157_HUMAN	ring finger protein 157	480	Ser-rich.						zinc ion binding			ovary(1)	1			LUSC - Lung squamous cell carcinoma(166;0.187)			GTGAGATTCTCACTTTCTGGA	0.562													10	60	---	---	---	---	PASS
SLC25A10	1468	broad.mit.edu	37	17	79674028	79674028	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79674028C>G	uc010wut.1	+	4	563	c.438C>G	c.(436-438)ATC>ATG	p.I146M	MRPL12_uc002kbh.1_Missense_Mutation_p.I146M	NM_012140	NP_036272	Q9UBX3	DIC_HUMAN	solute carrier family 25 (mitochondrial carrier;	Error:Variant_position_missing_in_Q9UBX3_after_alignment					gluconeogenesis|mitochondrial transport	integral to membrane|mitochondrial inner membrane|nucleus	protein binding				0	all_neural(118;0.0878)|Ovarian(332;0.12)|all_lung(278;0.23)		BRCA - Breast invasive adenocarcinoma(99;0.0117)|OV - Ovarian serous cystadenocarcinoma(97;0.0955)		Succinic acid(DB00139)	TGAAGCTGATCAAGGAAATCA	0.582													5	54	---	---	---	---	PASS
C17orf62	79415	broad.mit.edu	37	17	80403819	80403819	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80403819C>G	uc002kez.2	-	4	267	c.219G>C	c.(217-219)AAG>AAC	p.K73N	C17orf62_uc002kex.2_5'Flank|C17orf62_uc002key.2_5'UTR|C17orf62_uc002kfa.2_Missense_Mutation_p.K73N|C17orf62_uc010dir.2_Missense_Mutation_p.K73N|C17orf62_uc002kfb.3_Missense_Mutation_p.K73N|C17orf62_uc002kfc.3_Missense_Mutation_p.K59N|C17orf62_uc002kfd.3_5'UTR|C17orf62_uc002kfe.3_5'UTR|C17orf62_uc010dis.1_Missense_Mutation_p.K73N	NM_001100407	NP_001093877	Q9BQA9	CQ062_HUMAN	hypothetical protein LOC79415 isoform a	73						integral to membrane	protein binding				0	Breast(20;0.00106)|all_neural(118;0.0804)		OV - Ovarian serous cystadenocarcinoma(97;0.0143)|BRCA - Breast invasive adenocarcinoma(99;0.0369)			TCCCTGTGCTCTTGTCGAAGA	0.607													3	34	---	---	---	---	PASS
NDC80	10403	broad.mit.edu	37	18	2599084	2599084	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2599084G>C	uc002kli.2	+	12	1470	c.1288G>C	c.(1288-1290)GAG>CAG	p.E430Q		NM_006101	NP_006092	O14777	NDC80_HUMAN	kinetochore associated 2	430	Interaction with the N-terminus of CDCA1.|Interaction with PSMC2 and SMC1A.|Interaction with NEK2 and ZWINT.|Interaction with SMC1A.				attachment of spindle microtubules to kinetochore|cell division|establishment of mitotic spindle orientation|mitotic prometaphase|mitotic sister chromatid segregation|mitotic spindle organization|phosphatidylinositol-mediated signaling	condensed nuclear chromosome outer kinetochore|cytosol|Ndc80 complex	protein binding			ovary(1)	1						TAAAGGTGCTGAGAATTCCAA	0.353													12	78	---	---	---	---	PASS
DLGAP1	9229	broad.mit.edu	37	18	3596897	3596897	+	Intron	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3596897C>G	uc002kmf.2	-						DLGAP1_uc010wyz.1_Intron|DLGAP1_uc002kme.1_Intron|DLGAP1_uc010dkn.2_Intron|DLGAP1_uc010wyw.1_Intron|DLGAP1_uc010wyx.1_Intron|DLGAP1_uc010wyy.1_Intron|DLGAP1_uc002kmg.2_Intron|FLJ35776_uc010wza.1_RNA|FLJ35776_uc010wzb.1_RNA	NM_004746	NP_004737	O14490	DLGP1_HUMAN	discs large homolog-associated protein 1 isoform						synaptic transmission	cell junction|postsynaptic density|postsynaptic membrane				ovary(2)|pancreas(1)|skin(1)	4		Colorectal(8;0.0257)				CCAGCATGATCTAGCAGGCCA	0.572													6	51	---	---	---	---	PASS
LAMA1	284217	broad.mit.edu	37	18	6942004	6942004	+	3'UTR	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:6942004G>C	uc002knm.2	-	63					LAMA1_uc002knk.2_3'UTR|LAMA1_uc002knl.2_3'UTR|LAMA1_uc010wzj.1_3'UTR	NM_005559	NP_005550	P25391	LAMA1_HUMAN	laminin, alpha 1 precursor						axon guidance|cell adhesion|cell surface receptor linked signaling pathway|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	extracellular space|laminin-1 complex|laminin-3 complex	extracellular matrix structural constituent|receptor binding			ovary(8)|large_intestine(4)|upper_aerodigestive_tract(2)|breast(2)|skin(2)|pancreas(2)|central_nervous_system(1)	21		Colorectal(10;0.172)			Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)	ATGAACTGAAGAGATTCTTAA	0.393													4	115	---	---	---	---	PASS
MALT1	10892	broad.mit.edu	37	18	56402448	56402448	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:56402448A>T	uc002lhm.1	+	13	1748	c.1490A>T	c.(1489-1491)GAA>GTA	p.E497V	MALT1_uc002lhn.1_Missense_Mutation_p.E486V	NM_006785	NP_006776	Q9UDY8	MALT1_HUMAN	mucosa associated lymphoid tissue lymphoma	497	Caspase-like.				activation of NF-kappaB-inducing kinase activity|anti-apoptosis|nuclear export|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-2 production|positive regulation of NF-kappaB transcription factor activity|positive regulation of phosphorylation|positive regulation of protein ubiquitination|positive regulation of T cell cytokine production|protein oligomerization|proteolysis|T cell receptor signaling pathway	CBM complex|cytosol|nucleus|perinuclear region of cytoplasm	cysteine-type endopeptidase activity|protein self-association|signal transducer activity|ubiquitin-protein ligase activity			ovary(2)|lung(1)|central_nervous_system(1)	4						CAAGGAGCAGAAGCTTTTGAA	0.184			T	BIRC3	MALT								23	33	---	---	---	---	PASS
ZNF236	7776	broad.mit.edu	37	18	74593443	74593443	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74593443A>G	uc002lmi.2	+	9	1584	c.1386A>G	c.(1384-1386)ATA>ATG	p.I462M	ZNF236_uc002lmj.2_RNA|ZNF236_uc002lmk.1_Missense_Mutation_p.I462M	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	462					cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)		AAAAAATGATAAAGAAGAAGT	0.383													20	16	---	---	---	---	PASS
ATP8B3	148229	broad.mit.edu	37	19	1800007	1800007	+	Silent	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1800007C>A	uc002ltw.2	-	14	1725	c.1491G>T	c.(1489-1491)ACG>ACT	p.T497T	ATP8B3_uc002ltv.2_Silent_p.T450T|ATP8B3_uc002ltx.2_RNA|ATP8B3_uc002lty.1_Silent_p.T245T|ATP8B3_uc002ltz.1_Silent_p.T444T	NM_138813	NP_620168	O60423	AT8B3_HUMAN	ATPase, class I, type 8B, member 3	497	Cytoplasmic (Potential).				ATP biosynthetic process		ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity				0		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		TGAGCGTGCCCGTCTTGTCCG	0.617													3	10	---	---	---	---	PASS
C19orf34	255193	broad.mit.edu	37	19	1953988	1953988	+	Missense_Mutation	SNP	G	C	C	rs150508720	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:1953988G>C	uc002lum.2	-	2	504	c.47C>G	c.(46-48)GCG>GGG	p.A16G	CSNK1G2_uc002lul.3_Intron	NM_152771	NP_689984			chromosome 19 open reading frame 34												0		Ovarian(11;0.000137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		GATGACAGTCGCCCTTGGTCT	0.667													58	56	---	---	---	---	PASS
CHAF1A	10036	broad.mit.edu	37	19	4409533	4409533	+	Missense_Mutation	SNP	T	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4409533T>G	uc002mal.2	+	3	837	c.737T>G	c.(736-738)TTG>TGG	p.L246W		NM_005483	NP_005474	Q13111	CAF1A_HUMAN	chromatin assembly factor 1, subunit A (p150)	246	PxVxL motif.|Binds to CBX1 chromo shadow domain.				cell cycle|DNA repair|DNA replication|DNA replication-dependent nucleosome assembly|protein complex assembly|regulation of transcription, DNA-dependent|transcription, DNA-dependent	CAF-1 complex|WINAC complex	chromatin binding|chromo shadow domain binding|unfolded protein binding			ovary(1)|skin(1)	2		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0148)|STAD - Stomach adenocarcinoma(1328;0.18)		CAGGACATCTTGGCTGTGAGA	0.562								Chromatin_Structure					7	32	---	---	---	---	PASS
FEM1A	55527	broad.mit.edu	37	19	4793524	4793524	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4793524A>G	uc002mbf.2	+	1	1797	c.1658A>G	c.(1657-1659)TAT>TGT	p.Y553C	uc002mbg.1_RNA	NM_018708	NP_061178	Q9BSK4	FEM1A_HUMAN	fem-1 homolog a	553	ANK 8.				regulation of ubiquitin-protein ligase activity	cytoplasm	binding|ubiquitin-protein ligase activity				0		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0139)		GTGGGCCGCTATCCCGTGGGC	0.632													16	28	---	---	---	---	PASS
ACTL9	284382	broad.mit.edu	37	19	8808755	8808755	+	Silent	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8808755G>C	uc002mkl.2	-	1	418	c.297C>G	c.(295-297)GGC>GGG	p.G99G		NM_178525	NP_848620	Q8TC94	ACTL9_HUMAN	actin-like 9	99						cytoplasm|cytoskeleton				large_intestine(2)|pancreas(1)	3						GGGCTGCCTCGCCGATGAACG	0.706													3	18	---	---	---	---	PASS
KRI1	65095	broad.mit.edu	37	19	10671688	10671688	+	Silent	SNP	C	T	T	rs140755508		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10671688C>T	uc002moy.1	-	8	681	c.672G>A	c.(670-672)CTG>CTA	p.L224L	KRI1_uc002mow.1_5'Flank|KRI1_uc002mox.1_Silent_p.L220L	NM_023008	NP_075384	Q8N9T8	KRI1_HUMAN	KRI1 homolog	224	Glu-rich.									ovary(1)	1			Epithelial(33;9.2e-06)|all cancers(31;3.9e-05)			CCAGTTCCTTCAGGGAATCTG	0.547													21	42	---	---	---	---	PASS
CYP4F3	4051	broad.mit.edu	37	19	15770248	15770248	+	3'UTR	SNP	A	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:15770248A>C	uc002nbj.2	+	13					CYP4F3_uc010xok.1_3'UTR|CYP4F3_uc010xol.1_3'UTR|CYP4F3_uc010xom.1_3'UTR|CYP4F3_uc002nbk.2_3'UTR|CYP4F3_uc010xon.1_3'UTR	NM_000896	NP_000887	Q08477	CP4F3_HUMAN	cytochrome P450, family 4, subfamily F,						leukotriene metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	electron carrier activity|heme binding|leukotriene-B4 20-monooxygenase activity|oxygen binding			ovary(3)	3						attcatcaaaagtgaggccta	0.279													5	28	---	---	---	---	PASS
C19orf44	84167	broad.mit.edu	37	19	16631462	16631462	+	3'UTR	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16631462C>T	uc002neh.1	+	9					MED26_uc002nee.2_Intron|CHERP_uc002nei.1_Intron|C19orf44_uc010eai.1_RNA|CHERP_uc010xpg.1_Intron	NM_032207	NP_115583	Q9H6X5	CS044_HUMAN	hypothetical protein LOC84167												0						GTACCAAGTTCCTAAATAGTG	0.592													3	15	---	---	---	---	PASS
C19orf44	84167	broad.mit.edu	37	19	16631600	16631600	+	3'UTR	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:16631600C>G	uc002neh.1	+	9					MED26_uc002nee.2_Intron|CHERP_uc002nei.1_Intron|C19orf44_uc010eai.1_RNA|CHERP_uc010xpg.1_Intron	NM_032207	NP_115583	Q9H6X5	CS044_HUMAN	hypothetical protein LOC84167												0						GCTGTGGACCCTGGCCCCCCG	0.592													17	27	---	---	---	---	PASS
PDE4C	5143	broad.mit.edu	37	19	18330071	18330071	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:18330071C>G	uc010xqc.1	-	8	1419	c.939G>C	c.(937-939)CAG>CAC	p.Q313H	PDE4C_uc002nik.3_Missense_Mutation_p.Q313H|PDE4C_uc002nil.3_Missense_Mutation_p.Q313H|PDE4C_uc002nif.3_Missense_Mutation_p.Q82H|PDE4C_uc002nig.3_Missense_Mutation_p.Q83H|PDE4C_uc002nih.3_Missense_Mutation_p.Q83H|PDE4C_uc010ebk.2_Missense_Mutation_p.Q207H|PDE4C_uc002nii.3_Missense_Mutation_p.Q281H|PDE4C_uc010ebl.2_Missense_Mutation_p.Q27H|PDE4C_uc010xqd.1_Missense_Mutation_p.Q82H	NM_001098819	NP_001092289	Q08493	PDE4C_HUMAN	phosphodiesterase 4C isoform PDE4C-2	313					signal transduction	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|metal ion binding			ovary(2)|skin(2)|central_nervous_system(1)	5					Dyphylline(DB00651)	CCTGGTCAGTCTGGACCCCAA	0.622													3	56	---	---	---	---	PASS
GMIP	51291	broad.mit.edu	37	19	19740716	19740716	+	3'UTR	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19740716T>C	uc002nnd.2	-	21					LPAR2_uc002nnb.3_5'Flank|LPAR2_uc002nna.3_5'Flank|LPAR2_uc002nnc.3_5'Flank|GMIP_uc010xrb.1_3'UTR|GMIP_uc010xrc.1_3'UTR	NM_016573	NP_057657	Q9P107	GMIP_HUMAN	GEM interacting protein						negative regulation of Rho GTPase activity|small GTPase mediated signal transduction	cytosol	metal ion binding|protein binding|Rho GTPase activator activity			ovary(1)	1						GAGGTAGGGATATATGGGTCC	0.532													3	4	---	---	---	---	PASS
RYR1	6261	broad.mit.edu	37	19	39063871	39063871	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39063871G>C	uc002oit.2	+	96	14183	c.14053G>C	c.(14053-14055)GAT>CAT	p.D4685H	RYR1_uc002oiu.2_Missense_Mutation_p.D4680H	NM_000540	NP_000531	P21817	RYR1_HUMAN	skeletal muscle ryanodine receptor isoform 1	4685					muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)	GCTGGAGTTTGATGGCCTGTA	0.617													5	92	---	---	---	---	PASS
EID2	163126	broad.mit.edu	37	19	40030087	40030087	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40030087C>T	uc002oma.2	-	1	752	c.633G>A	c.(631-633)ACG>ACA	p.T211T		NM_153232	NP_694964	Q8N6I1	EID2_HUMAN	CREBBP/EP300 inhibitor 2	211					cell differentiation|muscle organ development|negative regulation of transcription, DNA-dependent|negative regulation of transforming growth factor beta receptor signaling pathway|regulation of cell proliferation|SMAD protein complex assembly|transcription, DNA-dependent|transforming growth factor beta receptor complex assembly	nucleus	SMAD binding				0	all_cancers(60;4.04e-06)|all_lung(34;1.77e-07)|Lung NSC(34;2.09e-07)|all_epithelial(25;1.13e-05)|Ovarian(47;0.159)		Epithelial(26;3.2e-25)|all cancers(26;8.83e-23)|LUSC - Lung squamous cell carcinoma(53;0.00281)			TCAGAGCTATCGTAAAGGTTA	0.448													6	230	---	---	---	---	PASS
LGALS13	29124	broad.mit.edu	37	19	40095312	40095312	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40095312C>G	uc002omb.2	+	2	126	c.86C>G	c.(85-87)TCT>TGT	p.S29C		NM_013268	NP_037400	Q9UHV8	PP13_HUMAN	galectin-13	29	Galectin.				lipid catabolic process|phospholipid metabolic process		carboxylesterase activity|lysophospholipase activity|sugar binding			ovary(1)	1	all_cancers(60;1.77e-05)|all_lung(34;5.38e-08)|Lung NSC(34;6.37e-08)|Ovarian(47;0.116)		Epithelial(26;3.28e-26)|OV - Ovarian serous cystadenocarcinoma(5;7.31e-25)|all cancers(26;1.15e-23)|LUSC - Lung squamous cell carcinoma(53;0.00281)			CCAATCCACTCTTTTATGTGA	0.453													106	140	---	---	---	---	PASS
ZNF780A	284323	broad.mit.edu	37	19	40582009	40582009	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40582009C>G	uc002omy.2	-	6	565	c.340G>C	c.(340-342)GAG>CAG	p.E114Q	ZNF780A_uc002omw.3_Intron|ZNF780A_uc002omz.2_Missense_Mutation_p.E114Q|ZNF780A_uc010xvh.1_Missense_Mutation_p.E115Q	NM_001010880	NP_001010880	O75290	Z780A_HUMAN	zinc finger protein 780A isoform b	114					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(60;9.55e-06)|all_lung(34;1.17e-07)|Lung NSC(34;1.41e-07)|Ovarian(47;0.0925)					TAAAAGGCCTCAATGCCAAGA	0.328													11	245	---	---	---	---	PASS
C19orf47	126526	broad.mit.edu	37	19	40842021	40842021	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40842021C>G	uc002oni.3	-	4	330	c.329G>C	c.(328-330)CGT>CCT	p.R110P	C19orf47_uc002ong.2_5'UTR|C19orf47_uc002onh.2_Missense_Mutation_p.R43P	NM_178830	NP_849152	Q8N9M1	CS047_HUMAN	hypothetical protein LOC126526	110										ovary(1)|skin(1)	2			Lung(22;0.000636)			ACCCACCTGACGGTGCACCAC	0.547													3	89	---	---	---	---	PASS
HIPK4	147746	broad.mit.edu	37	19	40886914	40886914	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:40886914C>T	uc002onp.2	-	3	1269	c.984G>A	c.(982-984)CTG>CTA	p.L328L		NM_144685	NP_653286	Q8NE63	HIPK4_HUMAN	homeodomain interacting protein kinase 4	328	Protein kinase.					cytoplasm	ATP binding|protein serine/threonine kinase activity			ovary(1)|stomach(1)	2			Lung(22;4.95e-05)|LUSC - Lung squamous cell carcinoma(20;0.000292)			ACTCCCAGGTCAGCATGCGCT	0.647													4	109	---	---	---	---	PASS
SHKBP1	92799	broad.mit.edu	37	19	41094536	41094536	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41094536C>T	uc002oob.2	+	14	1392	c.1343C>T	c.(1342-1344)GCC>GTC	p.A448V	SHKBP1_uc002ooc.2_Missense_Mutation_p.A423V|SHKBP1_uc002ood.2_Missense_Mutation_p.A448V|SHKBP1_uc010xvl.1_Missense_Mutation_p.A371V|SHKBP1_uc002ooe.2_Missense_Mutation_p.A285V|SHKBP1_uc002oof.2_Missense_Mutation_p.A285V|SHKBP1_uc010xvm.1_Missense_Mutation_p.A228V|SHKBP1_uc010xvn.1_Missense_Mutation_p.A326V	NM_138392	NP_612401	Q8TBC3	SHKB1_HUMAN	SH3KBP1 binding protein 1	448	WD 4.					voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(1)|pancreas(1)	2			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)			TCAGTCTGTGCCGACAACAAC	0.617													6	431	---	---	---	---	PASS
ZNF233	353355	broad.mit.edu	37	19	44778142	44778142	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44778142G>A	uc002oyz.1	+	5	1456	c.1329G>A	c.(1327-1329)CAG>CAA	p.Q443Q	ZNF235_uc002oyx.1_Intron|ZNF235_uc010eji.2_Intron|ZNF233_uc002oyy.1_Silent_p.Q258Q	NM_181756	NP_861421	A6NK53	ZN233_HUMAN	zinc finger protein 233	443					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(2)	2		Prostate(69;0.0435)|all_neural(266;0.226)				GTCTTCACCAGAGAGTTCACA	0.428													36	89	---	---	---	---	PASS
EML2	24139	broad.mit.edu	37	19	46117878	46117878	+	Missense_Mutation	SNP	C	G	G	rs35344004		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46117878C>G	uc002pcn.2	-	17	1713	c.1678G>C	c.(1678-1680)GGG>CGG	p.G560R	EML2_uc002pco.2_RNA|EML2_uc002pcp.2_Missense_Mutation_p.G444R|EML2_uc010xxl.1_Missense_Mutation_p.G707R|EML2_uc010xxm.1_Missense_Mutation_p.G761R	NM_012155	NP_036287	O95834	EMAL2_HUMAN	echinoderm microtubule associated protein like	560					sensory perception of sound|visual perception	cytoplasm|intracellular membrane-bounded organelle|microtubule|microtubule associated complex	catalytic activity|protein binding			large_intestine(1)|ovary(1)	2		Ovarian(192;0.179)|all_neural(266;0.224)		OV - Ovarian serous cystadenocarcinoma(262;0.00553)|GBM - Glioblastoma multiforme(486;0.131)|Epithelial(262;0.197)		ACCCCAAACCCTAGGACACAA	0.448													42	155	---	---	---	---	PASS
HRC	3270	broad.mit.edu	37	19	49657670	49657670	+	Silent	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49657670G>T	uc002pmv.2	-	1	1012	c.825C>A	c.(823-825)GGC>GGA	p.G275G		NM_002152	NP_002143	P23327	SRCH_HUMAN	histidine rich calcium binding protein	275	2-5.|6 X approximate tandem repeats.|4 X tandem repeats, acidic.				muscle contraction	sarcoplasmic reticulum lumen	calcium ion binding			ovary(1)	1		all_lung(116;3.16e-06)|Lung NSC(112;6.25e-06)|all_neural(266;0.0189)|Ovarian(192;0.0392)		all cancers(93;2.01e-05)|OV - Ovarian serous cystadenocarcinoma(262;0.00019)|GBM - Glioblastoma multiforme(486;0.00279)|Epithelial(262;0.00622)		CAATCCCGTGGCCTTGGTGCC	0.373													27	44	---	---	---	---	PASS
TRPM4	54795	broad.mit.edu	37	19	49692258	49692258	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:49692258C>G	uc002pmw.2	+	14	2001	c.1929C>G	c.(1927-1929)CTC>CTG	p.L643L	TRPM4_uc010emu.2_Silent_p.L643L|TRPM4_uc010yak.1_Silent_p.L107L|TRPM4_uc002pmx.2_Silent_p.L469L|TRPM4_uc010emv.2_Silent_p.L528L|TRPM4_uc010yal.1_Silent_p.L289L|TRPM4_uc002pmy.2_5'UTR	NM_017636	NP_060106	Q8TD43	TRPM4_HUMAN	transient receptor potential cation channel,	643	Cytoplasmic (Potential).				dendritic cell chemotaxis|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of cell proliferation|protein sumoylation|regulation of T cell cytokine production	endoplasmic reticulum|Golgi apparatus|integral to membrane|plasma membrane	ATP binding|calcium activated cation channel activity|calmodulin binding			ovary(1)|central_nervous_system(1)	2		all_lung(116;8.54e-05)|Lung NSC(112;0.000139)|all_neural(266;0.0506)|Ovarian(192;0.15)		all cancers(93;2.88e-05)|OV - Ovarian serous cystadenocarcinoma(262;0.000222)|GBM - Glioblastoma multiforme(486;0.00339)|Epithelial(262;0.00751)		GCCTCCTCCTCCGTCGCTGCC	0.617													43	83	---	---	---	---	PASS
ZNF616	90317	broad.mit.edu	37	19	52620235	52620235	+	Missense_Mutation	SNP	T	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52620235T>C	uc002pym.2	-	4	465	c.182A>G	c.(181-183)GAG>GGG	p.E61G	ZNF616_uc002pyn.2_RNA	NM_178523	NP_848618	Q08AN1	ZN616_HUMAN	zinc finger protein 616	61	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.00392)|OV - Ovarian serous cystadenocarcinoma(262;0.0189)		ATTACTGTTCTCTGTTGGTGG	0.323													14	232	---	---	---	---	PASS
ZNF816A	125893	broad.mit.edu	37	19	53454831	53454831	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53454831G>C	uc002qal.1	-	5	498	c.197C>G	c.(196-198)TCT>TGT	p.S66C	ZNF321_uc010eqj.2_Intron|ZNF321_uc002qak.1_Intron|ZNF816A_uc002qam.1_Missense_Mutation_p.S50C	NM_001031665	NP_001026835	Q0VGE8	ZN816_HUMAN	zinc finger protein 816A	66	KRAB.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				GBM - Glioblastoma multiforme(134;0.0313)		GGATTTTAAAGAGCTATCTAA	0.333													41	86	---	---	---	---	PASS
LILRA5	353514	broad.mit.edu	37	19	54823808	54823808	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:54823808G>A	uc002qfe.2	-	2	207	c.87C>T	c.(85-87)CTC>CTT	p.L29L	LILRA5_uc002qff.2_Silent_p.L29L|LILRA5_uc010yev.1_Silent_p.L29L|LILRA5_uc010yew.1_Silent_p.L29L|LILRA5_uc002qfh.1_Silent_p.L29L|LILRA5_uc002qfg.1_Silent_p.L29L	NM_021250	NP_067073	A6NI73	LIRA5_HUMAN	leukocyte immunoglobulin-like receptor subfamily	29					innate immune response	extracellular region|integral to membrane	receptor activity			upper_aerodigestive_tract(1)	1	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(193;0.105)		CAATCTCACCGAGGCAGAGCA	0.602													24	19	---	---	---	---	PASS
NLRP7	199713	broad.mit.edu	37	19	55451137	55451137	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55451137C>T	uc002qih.3	-	4	1126	c.1050G>A	c.(1048-1050)ATG>ATA	p.M350I	NLRP7_uc002qig.3_Missense_Mutation_p.M350I|NLRP7_uc002qii.3_Missense_Mutation_p.M350I|NLRP7_uc010esk.2_Missense_Mutation_p.M350I|NLRP7_uc010esl.2_Missense_Mutation_p.M378I	NM_206828	NP_996611	Q8WX94	NALP7_HUMAN	NACHT, leucine rich repeat and PYD containing 7	350	NACHT.						ATP binding			large_intestine(1)|breast(1)|central_nervous_system(1)	3				GBM - Glioblastoma multiforme(193;0.0325)		CGTTGCTCCTCATTAGCTCAA	0.612													4	48	---	---	---	---	PASS
CPXM1	56265	broad.mit.edu	37	20	2777020	2777020	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:2777020A>T	uc002wgu.2	-	9	1179	c.1115T>A	c.(1114-1116)CTC>CAC	p.L372H	CPXM1_uc010gas.2_Missense_Mutation_p.L372H	NM_019609	NP_062555	Q96SM3	CPXM1_HUMAN	carboxypeptidase X, member 1 precursor	372	Poly-Leu.				cell adhesion|proteolysis		metallocarboxypeptidase activity|zinc ion binding			ovary(2)|skin(2)	4						CTGCATCAGGAGCAGAAGCAA	0.642													11	86	---	---	---	---	PASS
PLAGL2	5326	broad.mit.edu	37	20	30784748	30784748	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:30784748G>C	uc002wxn.2	-	3	1215	c.998C>G	c.(997-999)TCT>TGT	p.S333C		NM_002657	NP_002648	Q9UPG8	PLAL2_HUMAN	pleiomorphic adenoma gene-like 2	333						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|skin(1)	2			UCEC - Uterine corpus endometrioid carcinoma (5;0.0241)			AGCTGGGGAAGAGATAGGTGA	0.562													5	227	---	---	---	---	PASS
RBM12	10137	broad.mit.edu	37	20	34240440	34240440	+	3'UTR	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34240440G>C	uc002xdq.2	-	3					CPNE1_uc010zvj.1_Intron|CPNE1_uc002xde.2_Intron|CPNE1_uc002xdf.2_Intron|CPNE1_uc002xdg.2_Intron|CPNE1_uc010gfi.2_Intron|CPNE1_uc010gfj.2_Intron|CPNE1_uc002xdh.2_Intron|CPNE1_uc002xdi.2_Intron|CPNE1_uc002xdj.2_Intron|CPNE1_uc002xdk.2_Intron|CPNE1_uc002xdl.2_Intron|CPNE1_uc002xdm.2_Intron|CPNE1_uc010gfk.1_Intron|CPNE1_uc002xdn.1_Intron|CPNE1_uc002xdo.1_Intron|CPNE1_uc002xdp.1_Intron|RBM12_uc002xdr.2_3'UTR|RBM12_uc002xds.2_3'UTR	NM_152838	NP_690051	Q9NTZ6	RBM12_HUMAN	RNA binding motif protein 12							nucleus	nucleotide binding|protein binding|RNA binding			ovary(3)	3	Lung NSC(9;0.00608)|all_lung(11;0.00918)		BRCA - Breast invasive adenocarcinoma(18;0.00953)			AAAATGATGTGAATGGCTACC	0.383													27	171	---	---	---	---	PASS
PLCG1	5335	broad.mit.edu	37	20	39802821	39802821	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:39802821G>C	uc002xjp.1	+	31	3821	c.3700G>C	c.(3700-3702)GAT>CAT	p.D1234H	PLCG1_uc002xjo.1_Missense_Mutation_p.D1235H|PLCG1_uc010zwe.1_Missense_Mutation_p.D900H	NM_182811	NP_877963	P19174	PLCG1_HUMAN	phospholipase C, gamma 1 isoform b	1234					activation of phospholipase C activity|axon guidance|blood coagulation|cellular response to epidermal growth factor stimulus|epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|interspecies interaction between organisms|intracellular signal transduction|leukocyte migration|nerve growth factor receptor signaling pathway|phospholipid catabolic process|positive regulation of angiogenesis|positive regulation of blood vessel endothelial cell migration|positive regulation of epithelial cell migration|T cell receptor signaling pathway	cytosol|lamellipodium|plasma membrane|ruffle	calcium ion binding|phosphatidylinositol phospholipase C activity|protein binding|receptor signaling protein activity			lung(3)|breast(3)|skin(2)	8		Myeloproliferative disorder(115;0.00878)				GCGGGGCTCAGATGCCTCAGG	0.597													9	76	---	---	---	---	PASS
RBPJL	11317	broad.mit.edu	37	20	43943062	43943062	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:43943062A>G	uc002xns.2	+	9	949	c.877A>G	c.(877-879)AAA>GAA	p.K293E	RBPJL_uc002xnt.2_Missense_Mutation_p.K293E	NM_014276	NP_055091	Q9UBG7	RBPJL_HUMAN	recombining binding protein L	293	By similarity.				signal transduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)	1		Myeloproliferative disorder(115;0.0122)				GATCATCCGTAAAGTAGCAAA	0.577													4	163	---	---	---	---	PASS
ZBP1	81030	broad.mit.edu	37	20	56186846	56186846	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:56186846C>G	uc002xyo.2	-	6	1092	c.811G>C	c.(811-813)GAG>CAG	p.E271Q	ZBP1_uc010gjm.2_Missense_Mutation_p.E270Q|ZBP1_uc002xyp.2_Missense_Mutation_p.E196Q	NM_030776	NP_110403	Q9H171	ZBP1_HUMAN	Z-DNA binding protein 1 isoform a	271	RIP homotypic interaction motif (RHIM) 2.					cytoplasm|nucleus	double-stranded RNA adenosine deaminase activity|left-handed Z-DNA binding|RNA binding			ovary(2)	2	Lung NSC(12;0.000545)|all_lung(29;0.00195)|Melanoma(10;0.242)		BRCA - Breast invasive adenocarcinoma(13;7.87e-13)|Epithelial(14;3.26e-09)|all cancers(14;3.62e-08)			AGCCTCATCTCATTGCTGTGT	0.632													5	20	---	---	---	---	PASS
NRIP1	8204	broad.mit.edu	37	21	16336995	16336995	+	3'UTR	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:16336995C>G	uc002yjx.2	-	4						NM_003489	NP_003480	P48552	NRIP1_HUMAN	nuclear receptor interacting protein 1						androgen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		androgen receptor binding|estrogen receptor binding|glucocorticoid receptor binding|transcription coactivator activity|transcription corepressor activity				0				Epithelial(23;1.19e-05)|all cancers(11;4.64e-05)|COAD - Colon adenocarcinoma(22;0.000232)|Colorectal(24;0.0006)|OV - Ovarian serous cystadenocarcinoma(11;0.00418)|Lung(58;0.199)|LUSC - Lung squamous cell carcinoma(23;0.24)		AGTTCATACTCATTAGTTTTA	0.313													26	146	---	---	---	---	PASS
NRIP1	8204	broad.mit.edu	37	21	16337647	16337647	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:16337647G>C	uc002yjx.2	-	4	3465	c.2867C>G	c.(2866-2868)TCT>TGT	p.S956C		NM_003489	NP_003480	P48552	NRIP1_HUMAN	nuclear receptor interacting protein 1	956					androgen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		androgen receptor binding|estrogen receptor binding|glucocorticoid receptor binding|transcription coactivator activity|transcription corepressor activity				0				Epithelial(23;1.19e-05)|all cancers(11;4.64e-05)|COAD - Colon adenocarcinoma(22;0.000232)|Colorectal(24;0.0006)|OV - Ovarian serous cystadenocarcinoma(11;0.00418)|Lung(58;0.199)|LUSC - Lung squamous cell carcinoma(23;0.24)		GTCAGCCACAGAGTTACTTCT	0.418													39	193	---	---	---	---	PASS
NRIP1	8204	broad.mit.edu	37	21	16338392	16338392	+	Nonsense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:16338392C>A	uc002yjx.2	-	4	2720	c.2122G>T	c.(2122-2124)GAA>TAA	p.E708*		NM_003489	NP_003480	P48552	NRIP1_HUMAN	nuclear receptor interacting protein 1	708					androgen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		androgen receptor binding|estrogen receptor binding|glucocorticoid receptor binding|transcription coactivator activity|transcription corepressor activity				0				Epithelial(23;1.19e-05)|all cancers(11;4.64e-05)|COAD - Colon adenocarcinoma(22;0.000232)|Colorectal(24;0.0006)|OV - Ovarian serous cystadenocarcinoma(11;0.00418)|Lung(58;0.199)|LUSC - Lung squamous cell carcinoma(23;0.24)		GTACGTCTTTCAAGCAGATTT	0.403													20	108	---	---	---	---	PASS
NRIP1	8204	broad.mit.edu	37	21	16340196	16340196	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:16340196C>T	uc002yjx.2	-	4	916	c.318G>A	c.(316-318)ATG>ATA	p.M106I		NM_003489	NP_003480	P48552	NRIP1_HUMAN	nuclear receptor interacting protein 1	106	Repression domain 1.				androgen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		androgen receptor binding|estrogen receptor binding|glucocorticoid receptor binding|transcription coactivator activity|transcription corepressor activity				0				Epithelial(23;1.19e-05)|all cancers(11;4.64e-05)|COAD - Colon adenocarcinoma(22;0.000232)|Colorectal(24;0.0006)|OV - Ovarian serous cystadenocarcinoma(11;0.00418)|Lung(58;0.199)|LUSC - Lung squamous cell carcinoma(23;0.24)		CGTTTAAATTCATGATAGAAT	0.468													18	140	---	---	---	---	PASS
NRIP1	8204	broad.mit.edu	37	21	16340220	16340220	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:16340220C>T	uc002yjx.2	-	4	892	c.294G>A	c.(292-294)CGG>CGA	p.R98R		NM_003489	NP_003480	P48552	NRIP1_HUMAN	nuclear receptor interacting protein 1	98	Repression domain 1.				androgen receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent		androgen receptor binding|estrogen receptor binding|glucocorticoid receptor binding|transcription coactivator activity|transcription corepressor activity				0				Epithelial(23;1.19e-05)|all cancers(11;4.64e-05)|COAD - Colon adenocarcinoma(22;0.000232)|Colorectal(24;0.0006)|OV - Ovarian serous cystadenocarcinoma(11;0.00418)|Lung(58;0.199)|LUSC - Lung squamous cell carcinoma(23;0.24)		ACAGCCTCTTCCGCTTTGCTG	0.458													15	101	---	---	---	---	PASS
JAM2	58494	broad.mit.edu	37	21	27062211	27062211	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:27062211C>A	uc002ylp.1	+	3	712	c.167C>A	c.(166-168)ACT>AAT	p.T56N	JAM2_uc011ace.1_Missense_Mutation_p.T56N|JAM2_uc002ylq.1_RNA|JAM2_uc011acf.1_Intron|JAM2_uc010glh.1_RNA|JAM2_uc002ylr.1_Missense_Mutation_p.T56N|JAM2_uc010gli.1_Missense_Mutation_p.T56N	NM_021219	NP_067042	P57087	JAM2_HUMAN	junctional adhesion molecule 2 precursor	56	Ig-like V-type.|Extracellular (Potential).				blood coagulation|cell-cell adhesion|leukocyte migration	integral to plasma membrane|tight junction					0						CCAAAGAAGACTGTTTCCTCC	0.393													16	211	---	---	---	---	PASS
BACH1	571	broad.mit.edu	37	21	30701862	30701862	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:30701862C>G	uc002ynj.2	+	4	1739	c.1624C>G	c.(1624-1626)CAG>GAG	p.Q542E	BACH1_uc002ynk.2_Missense_Mutation_p.Q542E|BACH1_uc002ynl.2_RNA	NM_001186	NP_001177	O14867	BACH1_HUMAN	BTB and CNC homology 1 transcription factor	542						nucleus	protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|liver(1)	2						AAATGATTTTCAGTCCTTGTT	0.343													11	41	---	---	---	---	PASS
KRTAP19-8	728299	broad.mit.edu	37	21	32410498	32410498	+	3'UTR	SNP	T	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:32410498T>G	uc010glt.2	-	1						NM_001099219	NP_001092689	Q3LI54	KR198_HUMAN	keratin associated protein 19-8							intermediate filament				upper_aerodigestive_tract(1)	1						ACAGAGGGGGTAAAAAGACCT	0.423													13	35	---	---	---	---	PASS
DNAJC28	54943	broad.mit.edu	37	21	34860591	34860591	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:34860591C>G	uc002yrv.2	-	2	1559	c.1110G>C	c.(1108-1110)AAG>AAC	p.K370N	DNAJC28_uc002yrw.2_Missense_Mutation_p.K370N	NM_017833	NP_060303	Q9NX36	DJC28_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 28	370				LIVPILTRQKVHFDAQKEIVRAQKIYETLIKTKEVTDRNPN NLDQGEGEKTPEIKKGFLNWMNLWKFIKIRSF -> CSHPD QAKSPF (in Ref. 2; BAA91185).			heat shock protein binding				0						AAAAACCTTTCTTGATTTCAG	0.318													20	94	---	---	---	---	PASS
PDE9A	5152	broad.mit.edu	37	21	44179187	44179187	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:44179187A>T	uc002zbm.2	+	11	952	c.889A>T	c.(889-891)AGG>TGG	p.R297W	PDE9A_uc002zbn.2_Missense_Mutation_p.R170W|PDE9A_uc002zbo.2_Missense_Mutation_p.R244W|PDE9A_uc002zbp.2_Missense_Mutation_p.R90W|PDE9A_uc002zbq.2_Missense_Mutation_p.R195W|PDE9A_uc002zbs.2_Missense_Mutation_p.R90W|PDE9A_uc002zbr.2_Missense_Mutation_p.R90W|PDE9A_uc002zbt.2_Missense_Mutation_p.R169W|PDE9A_uc002zbu.2_Missense_Mutation_p.R163W|PDE9A_uc002zbv.2_Missense_Mutation_p.R137W|PDE9A_uc002zbw.2_Missense_Mutation_p.R80W|PDE9A_uc002zbx.2_Missense_Mutation_p.R237W|PDE9A_uc002zby.2_Missense_Mutation_p.R80W|PDE9A_uc002zbz.2_Missense_Mutation_p.R189W|PDE9A_uc002zca.2_Missense_Mutation_p.R256W|PDE9A_uc002zcb.2_Missense_Mutation_p.R271W|PDE9A_uc002zcc.2_Missense_Mutation_p.R196W|PDE9A_uc002zcd.2_Missense_Mutation_p.R211W|PDE9A_uc002zce.2_Missense_Mutation_p.R230W|PDE9A_uc002zcf.2_Missense_Mutation_p.R90W|PDE9A_uc002zcg.2_Missense_Mutation_p.R90W|PDE9A_uc002zch.2_Missense_Mutation_p.R80W|PDE9A_uc010gpf.1_Missense_Mutation_p.R90W	NM_002606	NP_002597	O76083	PDE9A_HUMAN	phosphodiesterase 9A isoform a	297	Catalytic (By similarity).				platelet activation|signal transduction	cytosol|endoplasmic reticulum|Golgi apparatus|perinuclear region of cytoplasm|ruffle membrane	3',5'-cyclic-GMP phosphodiesterase activity|metal ion binding|protein binding			ovary(1)|skin(1)	2						CACCCTCAGGAGGTGGCTGGT	0.587													3	30	---	---	---	---	PASS
UBE2G2	7327	broad.mit.edu	37	21	46191250	46191250	+	3'UTR	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:46191250G>T	uc002zfy.2	-	6					UBE2G2_uc002zfx.2_3'UTR	NM_003343	NP_003334	P60604	UB2G2_HUMAN	ubiquitin-conjugating enzyme E2G 2 isoform 1						protein K48-linked ubiquitination	cytosol	ATP binding|protein binding|ubiquitin-protein ligase activity			breast(3)|central_nervous_system(1)	4				Colorectal(79;0.0638)		GGAGAATGCTGAGCTGCTTGG	0.527													9	44	---	---	---	---	PASS
GAB4	128954	broad.mit.edu	37	22	17449260	17449260	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:17449260C>T	uc002zlw.2	-	5	1059	c.951G>A	c.(949-951)AAG>AAA	p.K317K	GAB4_uc010gqs.1_Missense_Mutation_p.V217I	NM_001037814	NP_001032903	Q2WGN9	GAB4_HUMAN	GRB2-associated binding protein family, member	317										large_intestine(1)|ovary(1)	2		all_epithelial(15;0.112)|Lung NSC(13;0.248)				GCTGGGTGTACTTGCCGGAGG	0.577													11	45	---	---	---	---	PASS
ATP6V1E1	529	broad.mit.edu	37	22	18075495	18075495	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:18075495G>C	uc002zmr.1	-	9	813	c.626C>G	c.(625-627)CCA>CGA	p.P209R	ATP6V1E1_uc002zms.1_Missense_Mutation_p.P179R|ATP6V1E1_uc002zmt.1_Missense_Mutation_p.P187R	NM_001696	NP_001687	P36543	VATE1_HUMAN	vacuolar H+ ATPase E1 isoform a	209					cellular iron ion homeostasis|insulin receptor signaling pathway|transferrin transport	apical plasma membrane|cytosol|endosome|proton-transporting two-sector ATPase complex, catalytic domain	protein binding|proton-transporting ATPase activity, rotational mechanism			large_intestine(1)|central_nervous_system(1)	2		all_epithelial(15;0.206)		Lung(27;0.19)		CCGGACTTCTGGCATCATCTG	0.423													25	84	---	---	---	---	PASS
SEC14L3	266629	broad.mit.edu	37	22	30866040	30866040	+	Missense_Mutation	SNP	T	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:30866040T>A	uc003ahy.2	-	4	289	c.200A>T	c.(199-201)GAT>GTT	p.D67V	SEC14L3_uc003ahz.2_5'UTR|SEC14L3_uc003aia.2_Missense_Mutation_p.D8V|SEC14L3_uc003aib.2_Missense_Mutation_p.D8V	NM_174975	NP_777635	Q9UDX4	S14L3_HUMAN	SEC14-like 3	67						integral to membrane|intracellular	lipid binding|transporter activity			ovary(3)|pancreas(1)|skin(1)	5					Vitamin E(DB00163)	ATGGTCAATATCCATGGTCTT	0.542													109	59	---	---	---	---	PASS
APOL1	8542	broad.mit.edu	37	22	36661303	36661303	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:36661303C>T	uc003apf.2	+	6	589	c.421C>T	c.(421-423)CTG>TTG	p.L141L	APOL1_uc011amn.1_Silent_p.L18L|APOL1_uc003apc.2_RNA|APOL1_uc003ape.2_Silent_p.L157L|APOL1_uc011amo.1_Silent_p.L18L|APOL1_uc011amp.1_Silent_p.L141L|APOL1_uc011amq.1_Silent_p.L123L|APOL1_uc010gwx.2_Silent_p.L18L	NM_003661	NP_003652	O14791	APOL1_HUMAN	apolipoprotein L1 isoform a precursor	141					cholesterol metabolic process|cytolysis|innate immune response|killing of cells of other organism|lipid transport|lipoprotein metabolic process	high-density lipoprotein particle|very-low-density lipoprotein particle	chloride channel activity|lipid binding|protein binding			breast(2)|ovary(1)	3						AAACTGGTTTCTGAAAGAGTT	0.473													16	82	---	---	---	---	PASS
CACNA1I	8911	broad.mit.edu	37	22	40066081	40066081	+	Silent	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:40066081C>T	uc003ayc.2	+	25	4233	c.4233C>T	c.(4231-4233)TTC>TTT	p.F1411F	CACNA1I_uc003ayd.2_Silent_p.F1376F|CACNA1I_uc003aye.2_Silent_p.F1326F|CACNA1I_uc003ayf.2_Silent_p.F1291F	NM_021096	NP_066919	Q9P0X4	CAC1I_HUMAN	calcium channel, voltage-dependent, T type,	1411	Helical; Name=S6 of repeat III; (Potential).|III.				axon guidance|signal transduction	voltage-gated calcium channel complex	low voltage-gated calcium channel activity|protein binding			breast(1)|central_nervous_system(1)	2	Melanoma(58;0.0749)				Flunarizine(DB04841)|Paramethadione(DB00617)|Verapamil(DB00661)	TGCTGTACTTCATCTCCTTCC	0.577													37	194	---	---	---	---	PASS
SAPS2	9701	broad.mit.edu	37	22	50869673	50869673	+	Silent	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50869673C>G	uc003blb.1	+	12	1619	c.1197C>G	c.(1195-1197)CTC>CTG	p.L399L	SAPS2_uc003bky.1_Silent_p.L399L|SAPS2_uc003bkz.1_Silent_p.L399L|SAPS2_uc003blc.2_Silent_p.L399L|SAPS2_uc003bla.1_Silent_p.L400L|SAPS2_uc003bld.1_5'UTR	NM_014678	NP_055493	O75170	PP6R2_HUMAN	SAPS domain family, member 2	399						cytoplasm|intracellular membrane-bounded organelle	protein binding				0		all_cancers(38;5.78e-13)|all_epithelial(38;1.71e-11)|all_lung(38;3.89e-05)|Breast(42;0.000523)|Lung NSC(38;0.000992)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		BRCA - Breast invasive adenocarcinoma(115;0.222)		CCGCTATTCTCTCCCACGCTG	0.547													31	100	---	---	---	---	PASS
TLR8	51311	broad.mit.edu	37	X	12939592	12939592	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:12939592G>A	uc004cve.2	+	2	2501	c.2433G>A	c.(2431-2433)GGG>GGA	p.G811G	TLR8_uc004cvd.2_Silent_p.G829G	NM_138636	NP_619542	Q9NR97	TLR8_HUMAN	toll-like receptor 8 precursor	811	Extracellular (Potential).|LRRCT.				cellular response to mechanical stimulus|defense response to virus|I-kappaB kinase/NF-kappaB cascade|immunoglobulin mediated immune response|inflammatory response|innate immune response|positive regulation of innate immune response|positive regulation of interferon-alpha biosynthetic process|positive regulation of interferon-beta biosynthetic process|positive regulation of interferon-gamma biosynthetic process|positive regulation of interleukin-8 biosynthetic process	endosome membrane	DNA binding|double-stranded RNA binding|single-stranded RNA binding|transmembrane receptor activity			ovary(4)|lung(2)|large_intestine(1)	7						ATCAAAGAGGGAAGAGTATTG	0.418													30	186	---	---	---	---	PASS
BMX	660	broad.mit.edu	37	X	15534291	15534291	+	Missense_Mutation	SNP	G	T	T	rs67912403		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:15534291G>T	uc004cww.2	+	5	570	c.382G>T	c.(382-384)GGG>TGG	p.G128W	BMX_uc004cwx.3_Missense_Mutation_p.G128W|BMX_uc004cwy.3_Missense_Mutation_p.G128W	NM_203281	NP_975010	P51813	BMX_HUMAN	BMX non-receptor tyrosine kinase	128	Btk-type.				cellular component disassembly involved in apoptosis|intracellular signal transduction|mesoderm development	cytosol	ATP binding|metal ion binding|non-membrane spanning protein tyrosine kinase activity|protein binding|signal transducer activity			lung(3)|ovary(2)	5	Hepatocellular(33;0.183)					CTTCGTGGACGGGAAGTTCCT	0.517													12	306	---	---	---	---	PASS
FAM48B1	100130302	broad.mit.edu	37	X	24383471	24383471	+	Missense_Mutation	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:24383471C>G	uc011mjx.1	+	1	2594	c.2594C>G	c.(2593-2595)CCA>CGA	p.P865R		NM_001136234	NP_001129706			hypothetical protein LOC100130302											kidney(1)	1						CAGCCACATCCAGGTGTGCAA	0.542													14	84	---	---	---	---	PASS
TSPAN7	7102	broad.mit.edu	37	X	38534989	38534989	+	Missense_Mutation	SNP	A	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:38534989A>T	uc004deg.3	+	5	541	c.472A>T	c.(472-474)AAC>TAC	p.N158Y	TSPAN7_uc011mkj.1_Missense_Mutation_p.N184Y|TSPAN7_uc011mkk.1_Missense_Mutation_p.N175Y|TSPAN7_uc004deh.2_Missense_Mutation_p.N66Y	NM_004615	NP_004606	P41732	TSN7_HUMAN	tetraspanin 7	158	Extracellular (Potential).				interspecies interaction between organisms	integral to plasma membrane				ovary(1)	1						GAACTACACCAACTGGAGCAC	0.483													23	50	---	---	---	---	PASS
CXorf38	159013	broad.mit.edu	37	X	40496396	40496396	+	Missense_Mutation	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:40496396G>A	uc004dew.2	-	4	489	c.484C>T	c.(484-486)CGT>TGT	p.R162C	CXorf38_uc011mko.1_Missense_Mutation_p.R77C|CXorf38_uc004dev.1_Missense_Mutation_p.R43C|CXorf38_uc010nhd.2_RNA	NM_144970	NP_659407	Q8TB03	CX038_HUMAN	hypothetical protein LOC159013	162										ovary(1)	1						ATCTCATTACGACATTTAATT	0.338													5	91	---	---	---	---	PASS
HDAC6	10013	broad.mit.edu	37	X	48666514	48666514	+	Missense_Mutation	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:48666514G>T	uc011mmi.1	+	9	802	c.707G>T	c.(706-708)CGC>CTC	p.R236L	HDAC6_uc004dks.1_Missense_Mutation_p.R236L|HDAC6_uc010nig.1_Missense_Mutation_p.R84L|HDAC6_uc004dkt.1_Missense_Mutation_p.R236L|HDAC6_uc011mmj.1_Missense_Mutation_p.R181L|HDAC6_uc011mmk.1_Missense_Mutation_p.R217L	NM_006044	NP_006035	Q9UBN7	HDAC6_HUMAN	histone deacetylase 6	236	Histone deacetylase 1.				aggresome assembly|cellular response to hydrogen peroxide|Hsp90 deacetylation|lysosome localization|macroautophagy|misfolded or incompletely synthesized protein catabolic process|negative regulation of proteolysis|negative regulation of transcription, DNA-dependent|peptidyl-lysine deacetylation|polyubiquitinated misfolded protein transport|positive regulation of apoptosis|positive regulation of cellular chaperone-mediated protein complex assembly|positive regulation of epithelial cell migration|positive regulation of receptor biosynthetic process|positive regulation of signal transduction|regulation of androgen receptor signaling pathway|regulation of receptor activity|response to growth factor stimulus|response to toxin|transcription, DNA-dependent|tubulin deacetylation	aggresome|caveola|cell leading edge|cytosol|histone deacetylase complex|microtubule associated complex|perinuclear region of cytoplasm	actin binding|alpha-tubulin binding|beta-catenin binding|dynein complex binding|histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|Hsp90 protein binding|microtubule binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|polyubiquitin binding|tau protein binding|tubulin deacetylase activity|zinc ion binding			ovary(3)|upper_aerodigestive_tract(1)	4					Vorinostat(DB02546)	GTGGCAGCCCGCTATGCTCAA	0.582													5	10	---	---	---	---	PASS
PAGE1	8712	broad.mit.edu	37	X	49454135	49454135	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:49454135C>T	uc004dom.2	-	5	437	c.304G>A	c.(304-306)GAA>AAA	p.E102K		NM_003785	NP_003776	O75459	GAGB1_HUMAN	P antigen family, member 1	102					cellular defense response					skin(1)	1	Ovarian(276;0.236)					CTATCCGCTTCAGGCTCTGGC	0.338													29	72	---	---	---	---	PASS
TRO	7216	broad.mit.edu	37	X	54948648	54948648	+	5'UTR	SNP	C	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54948648C>G	uc004dtq.2	+	2					TRO_uc011moj.1_Intron|TRO_uc004dts.2_5'UTR|TRO_uc004dtr.2_Intron|TRO_uc004dtt.2_Intron|TRO_uc004dtu.2_Intron|TRO_uc004dtv.2_Intron|TRO_uc011mok.1_Intron|TRO_uc004dtw.2_Intron|TRO_uc004dtx.2_5'Flank	NM_001039705	NP_001034794	Q12816	TROP_HUMAN	trophinin isoform 5						embryo implantation|homophilic cell adhesion	integral to plasma membrane				ovary(1)	1						CCATTCCCCTCAGGCTCACCT	0.512													5	10	---	---	---	---	PASS
TRO	7216	broad.mit.edu	37	X	54949137	54949137	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54949137A>G	uc004dtq.2	+	3	279	c.172A>G	c.(172-174)ATG>GTG	p.M58V	TRO_uc011moj.1_Missense_Mutation_p.M1V|TRO_uc004dts.2_Missense_Mutation_p.M58V|TRO_uc004dtr.2_Missense_Mutation_p.M58V|TRO_uc004dtt.2_RNA|TRO_uc004dtu.2_Intron|TRO_uc004dtv.2_Intron|TRO_uc011mok.1_Intron|TRO_uc004dtw.2_Intron|TRO_uc004dtx.2_5'Flank	NM_001039705	NP_001034794	Q12816	TROP_HUMAN	trophinin isoform 5	58					embryo implantation|homophilic cell adhesion	integral to plasma membrane				ovary(1)	1						CTCCCTGGCCATGGACCCACC	0.557													17	22	---	---	---	---	PASS
PFKFB1	5207	broad.mit.edu	37	X	54959833	54959833	+	3'UTR	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54959833G>A	uc004dty.1	-	14					PFKFB1_uc010nkd.1_3'UTR|PFKFB1_uc011mol.1_3'UTR	NM_002625	NP_002616	P16118	F261_HUMAN	6-phosphofructo-2-kinase/fructose-2,						energy reserve metabolic process|fructose 2,6-bisphosphate metabolic process|gluconeogenesis|glycolysis|intracellular protein kinase cascade	6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 complex	6-phosphofructo-2-kinase activity|ATP binding|fructose-2,6-bisphosphate 2-phosphatase activity|identical protein binding			ovary(1)	1						TCTTGGAAAGGGCTCAGTAGT	0.532													20	53	---	---	---	---	PASS
TAF1	6872	broad.mit.edu	37	X	70601652	70601652	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:70601652G>C	uc004dzu.3	+	9	1468	c.1417G>C	c.(1417-1419)GAG>CAG	p.E473Q	BCYRN1_uc011mpt.1_Intron|TAF1_uc004dzt.3_Missense_Mutation_p.E494Q	NM_138923	NP_620278	P21675	TAF1_HUMAN	TBP-associated factor 1 isoform 2	473					G1 phase of mitotic cell cycle|interspecies interaction between organisms|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription initiation from RNA polymerase II promoter|protein autophosphorylation|regulation of transcription involved in G2/M-phase of mitotic cell cycle|RNA polymerase II transcriptional preinitiation complex assembly|transcription elongation from RNA polymerase II promoter|viral reproduction	MLL1 complex|transcription factor TFIID complex	ATP binding|histone acetyl-lysine binding|histone acetyltransferase activity|p53 binding|protein binding|protein serine/threonine kinase activity|sequence-specific DNA binding|TBP-class protein binding|transcription coactivator activity			ovary(7)|breast(4)|large_intestine(2)|central_nervous_system(2)|lung(1)|skin(1)	17	Renal(35;0.156)	all_lung(315;0.000321)				CATTGACAATGAGGATCTGGT	0.453													5	216	---	---	---	---	PASS
ARMCX6	54470	broad.mit.edu	37	X	100871632	100871632	+	5'UTR	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:100871632G>C	uc004ehx.2	-	3					ARMCX6_uc004ehy.2_5'UTR	NM_019007	NP_061880	Q7L4S7	ARMX6_HUMAN	armadillo repeat containing, X-linked 6							integral to membrane					0						TGCCAGCCTTGGGGCAGGACA	0.592													13	31	---	---	---	---	PASS
PAK3	5063	broad.mit.edu	37	X	110435399	110435399	+	Missense_Mutation	SNP	A	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:110435399A>G	uc004epa.2	+	9	947	c.920A>G	c.(919-921)CAA>CGA	p.Q307R	PAK3_uc010npt.1_Missense_Mutation_p.Q292R|PAK3_uc010npu.1_Missense_Mutation_p.Q292R|PAK3_uc004eoy.1_Missense_Mutation_p.Q47R|PAK3_uc004eoz.2_Missense_Mutation_p.Q292R|PAK3_uc011mst.1_RNA|PAK3_uc010npv.1_Missense_Mutation_p.Q328R|PAK3_uc010npw.1_Missense_Mutation_p.Q313R	NM_001128173	NP_001121645	O75914	PAK3_HUMAN	p21-activated kinase 3 isoform d	307	Protein kinase.				multicellular organismal development		ATP binding|metal ion binding|protein serine/threonine kinase activity|SH3 domain binding			lung(6)|ovary(3)|large_intestine(1)	10						GCAACAGGACAAGAGGTAAGT	0.333										TSP Lung(19;0.15)			7	173	---	---	---	---	PASS
MCTS1	28985	broad.mit.edu	37	X	119742109	119742109	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:119742109G>C	uc004esx.2	+	4	640	c.292G>C	c.(292-294)GAT>CAT	p.D98H	MCTS1_uc011mub.1_Missense_Mutation_p.D99H	NM_014060	NP_054779	Q9ULC4	MCTS1_HUMAN	malignant T cell amplified sequence 1 isoform 1	98	PUA.				cell cycle|positive regulation of cell proliferation|regulation of growth|regulation of transcription, DNA-dependent|response to DNA damage stimulus|transcription, DNA-dependent	cytoplasm	RNA binding				0						CCAGCAGGTTGATAAAGGAGC	0.308													12	101	---	---	---	---	PASS
FAM127B	26071	broad.mit.edu	37	X	134185976	134185976	+	Missense_Mutation	SNP	C	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:134185976C>T	uc004eyf.2	-	1	246	c.163G>A	c.(163-165)GAG>AAG	p.E55K	FAM127B_uc004eyg.3_Missense_Mutation_p.E55K	NM_001078172	NP_001071640	Q9BWD3	F127B_HUMAN	family with sequence similarity 127, member B	55											0	Acute lymphoblastic leukemia(192;0.000127)					AACGTGTTCTCGTCCACGAAC	0.597													6	90	---	---	---	---	PASS
GPR112	139378	broad.mit.edu	37	X	135429691	135429691	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135429691G>C	uc004ezu.1	+	6	4117	c.3826G>C	c.(3826-3828)GAA>CAA	p.E1276Q	GPR112_uc010nsb.1_Missense_Mutation_p.E1071Q|GPR112_uc010nsc.1_Missense_Mutation_p.E1043Q	NM_153834	NP_722576	Q8IZF6	GP112_HUMAN	G-protein coupled receptor 112	1276	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(5)|large_intestine(2)|skin(2)|lung(1)|breast(1)|pancreas(1)	12	Acute lymphoblastic leukemia(192;0.000127)					GGAGGTGACAGAAATGTCCCC	0.438													59	117	---	---	---	---	PASS
GPR101	83550	broad.mit.edu	37	X	136112838	136112838	+	Missense_Mutation	SNP	C	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:136112838C>A	uc011mwh.1	-	1	996	c.996G>T	c.(994-996)ATG>ATT	p.M332I		NM_054021	NP_473362	Q96P66	GP101_HUMAN	G protein-coupled receptor 101	332	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)|lung(1)|skin(1)	5	Acute lymphoblastic leukemia(192;0.000127)					TGTCTGCCTTCATGCTGTTCT	0.557													46	304	---	---	---	---	PASS
F9	2158	broad.mit.edu	37	X	138612920	138612920	+	Translation_Start_Site	SNP	G	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:138612920G>T	uc004fas.1	+	1	26	c.-3G>T	c.(-5--1)AAGGT>AATGT		F9_uc004fat.1_Translation_Start_Site	NM_000133	NP_000124	P00740	FA9_HUMAN	coagulation factor IX preproprotein						blood coagulation, extrinsic pathway|blood coagulation, intrinsic pathway|peptidyl-glutamic acid carboxylation|post-translational protein modification|proteolysis	endoplasmic reticulum lumen|extracellular region|Golgi lumen|plasma membrane	calcium ion binding|serine-type endopeptidase activity			lung(2)|ovary(1)	3	Acute lymphoblastic leukemia(192;0.000127)				Antihemophilic Factor(DB00025)|Coagulation Factor IX(DB00100)|Heparin(DB01109)|Menadione(DB00170)	TGCTAGCAAAGGTTATGCAGC	0.433													6	128	---	---	---	---	PASS
MAGEA6	4105	broad.mit.edu	37	X	151870004	151870004	+	Missense_Mutation	SNP	G	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:151870004G>C	uc004ffq.1	+	3	888	c.694G>C	c.(694-696)GAG>CAG	p.E232Q	MAGEA6_uc004ffr.1_Missense_Mutation_p.E232Q|MAGEA2_uc010nto.2_Intron	NM_005363	NP_005354	P43360	MAGA6_HUMAN	melanoma antigen family A, 6	232	MAGE.						protein binding				0	Acute lymphoblastic leukemia(192;6.56e-05)					AGAGGTGTTTGAGGGGAGGGA	0.537													76	203	---	---	---	---	PASS
L1CAM	3897	broad.mit.edu	37	X	153128148	153128148	+	Silent	SNP	G	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:153128148G>A	uc004fjb.2	-	28	3852	c.3744C>T	c.(3742-3744)TCC>TCT	p.S1248S	L1CAM_uc004fjc.2_Silent_p.S1244S|L1CAM_uc010nuo.2_Silent_p.S1239S	NM_000425	NP_000416	P32004	L1CAM_HUMAN	L1 cell adhesion molecule isoform 1 precursor	1248	Cytoplasmic (Potential).				axon guidance|blood coagulation|cell death|leukocyte migration	integral to membrane				ovary(8)|central_nervous_system(1)	9	all_cancers(53;6.72e-15)|all_epithelial(53;3.19e-09)|all_lung(58;3.39e-06)|all_hematologic(71;4.25e-06)|Lung NSC(58;4.7e-06)|Acute lymphoblastic leukemia(192;6.56e-05)					GGTTGATGGGGGAAGTGGCCC	0.607													4	59	---	---	---	---	PASS
MTCP1NB	100272147	broad.mit.edu	37	X	154292253	154292253	+	Missense_Mutation	SNP	T	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:154292253T>G	uc004fmy.2	-	2	635	c.46A>C	c.(46-48)AAA>CAA	p.K16Q		NM_001018024	NP_001018024	P56277	MTCNB_HUMAN	mature T-cell proliferation 1 neighbor	16					cell proliferation	mitochondrion				lung(1)	1						TGTAAACATTTCTGTATCTCA	0.299													21	285	---	---	---	---	PASS
STIL	6491	broad.mit.edu	37	1	47716998	47717011	+	Frame_Shift_Del	DEL	CTTGGTTTAAGGTT	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:47716998_47717011delCTTGGTTTAAGGTT	uc001crc.1	-	17	3816_3829	c.3661_3674delAACCTTAAACCAAG	c.(3661-3675)AACCTTAAACCAAGTfs	p.N1221fs	TAL1_uc001crb.1_Intron|STIL_uc010omn.1_Frame_Shift_Del_p.N1175fs|STIL_uc010omo.1_Frame_Shift_Del_p.N1204fs|STIL_uc001crd.1_Frame_Shift_Del_p.N1222fs|STIL_uc001cre.1_Frame_Shift_Del_p.N1221fs	NM_003035	NP_003026	Q15468	STIL_HUMAN	SCL/TAL1 interrupting locus isoform 2	1221_1225					cell proliferation|multicellular organismal development	centrosome|cytosol				lung(2)|skin(1)	3		Acute lymphoblastic leukemia(5;0.00116)|all_hematologic(5;0.00444)				CACTGCAGGACTTGGTTTAAGGTTCTTTACTAAG	0.402													335	19	---	---	---	---	
PPAP2B	8613	broad.mit.edu	37	1	56989936	56989938	+	Intron	DEL	GGT	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:56989936_56989938delGGT	uc001cyj.1	-							NM_177414	NP_803133	O14495	LPP3_HUMAN	phosphatidic acid phosphatase type 2B						canonical Wnt receptor signaling pathway involved in positive regulation of cell-cell adhesion|canonical Wnt receptor signaling pathway involved in positive regulation of endothelial cell migration|canonical Wnt receptor signaling pathway involved in positive regulation of wound healing|germ cell migration|homotypic cell-cell adhesion|negative regulation of protein phosphorylation|positive regulation of sequence-specific DNA binding transcription factor activity|protein stabilization|sphingolipid metabolic process	adherens junction|Golgi apparatus|integral to membrane	phosphatidate phosphatase activity|phosphoprotein phosphatase activity|protein binding|sphingosine-1-phosphate phosphatase activity				0						GCCATGCGGAGGTGGTGTCTCAC	0.374													124	14	---	---	---	---	
CD1E	913	broad.mit.edu	37	1	158326857	158326857	+	3'UTR	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158326857delT	uc001fse.2	+	6					CD1E_uc001fsd.2_3'UTR|CD1E_uc001fsk.2_3'UTR|CD1E_uc001fsj.2_3'UTR|CD1E_uc001fsc.2_3'UTR|CD1E_uc010pig.1_RNA|CD1E_uc001fsa.2_3'UTR|CD1E_uc001fsf.2_3'UTR|CD1E_uc001fry.2_3'UTR|CD1E_uc001fsg.2_3'UTR|CD1E_uc001fsh.2_3'UTR|CD1E_uc001fsi.2_3'UTR|CD1E_uc009wsv.2_3'UTR|CD1E_uc001frz.2_3'UTR|CD1E_uc009wsw.2_3'UTR	NM_030893	NP_112155	P15812	CD1E_HUMAN	CD1E antigen isoform a precursor						antigen processing and presentation|immune response	early endosome|Golgi membrane|integral to plasma membrane|late endosome|lysosomal lumen				skin(3)	3	all_hematologic(112;0.0378)					CTGCTTTGGCTACATATCCAT	0.348													4	3	---	---	---	---	
SELE	6401	broad.mit.edu	37	1	169701554	169701555	+	Intron	DEL	TG	-	-	rs56090594		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169701554_169701555delTG	uc001ggm.3	-						C1orf112_uc001ggj.2_Intron	NM_000450	NP_000441	P16581	LYAM2_HUMAN	selectin E precursor						actin filament-based process|activation of phospholipase C activity|calcium-mediated signaling|heterophilic cell-cell adhesion|leukocyte migration involved in inflammatory response|leukocyte tethering or rolling|positive regulation of receptor internalization|regulation of inflammatory response|response to interleukin-1|response to lipopolysaccharide|response to tumor necrosis factor	caveola|coated pit|cortical cytoskeleton|extracellular space|integral to membrane|perinuclear region of cytoplasm	oligosaccharide binding|phospholipase binding|sialic acid binding|transmembrane receptor activity			ovary(3)|skin(2)	5	all_hematologic(923;0.208)					tgtgtatatatgtgtgtgtgtg	0.134													7	8	---	---	---	---	
FMO3	2328	broad.mit.edu	37	1	171077503	171077503	+	Intron	DEL	C	-	-	rs151221462		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:171077503delC	uc001ghi.2	+						FMO3_uc001ghh.2_Intron|FMO3_uc010pmb.1_Intron|FMO3_uc010pmc.1_Intron	NM_001002294	NP_001002294	P31513	FMO3_HUMAN	flavin containing monooxygenase 3						xenobiotic metabolic process	integral to membrane|intrinsic to endoplasmic reticulum membrane|microsome	flavin adenine dinucleotide binding|flavin-containing monooxygenase activity			skin(1)	1	all_hematologic(923;0.0922)|Acute lymphoblastic leukemia(37;0.181)					AGCTGAGCTTCCCCAAGTAAC	0.398													9	4	---	---	---	---	
C1orf21	81563	broad.mit.edu	37	1	184528611	184528614	+	Intron	DEL	TCCT	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:184528611_184528614delTCCT	uc001gqv.1	+							NM_030806	NP_110433	Q9H246	CA021_HUMAN	chromosome 1 open reading frame 21												0		Breast(1374;0.00262)		Colorectal(1306;4.8e-08)|KIRC - Kidney renal clear cell carcinoma(1967;0.00314)		CTCCTttccctccttccttccttc	0.020													5	3	---	---	---	---	
SLC26A9	115019	broad.mit.edu	37	1	205893754	205893754	+	Intron	DEL	T	-	-	rs67742034		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205893754delT	uc001hdq.2	-						SLC26A9_uc001hdo.2_Intron|SLC26A9_uc001hdp.2_Intron	NM_052934	NP_443166	Q7LBE3	S26A9_HUMAN	solute carrier family 26, member 9 isoform a							integral to membrane	chloride channel activity|secondary active sulfate transmembrane transporter activity			ovary(1)|skin(1)	2	Breast(84;0.201)		BRCA - Breast invasive adenocarcinoma(75;0.0458)			TTAAATAGCATTTTTTGCAAT	0.373													2	4	---	---	---	---	
C1orf57	84284	broad.mit.edu	37	1	233091296	233091296	+	Intron	DEL	A	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:233091296delA	uc001hvj.1	+						C1orf57_uc001hvi.2_Intron|C1orf57_uc009xft.1_Intron	NM_032324	NP_115700	Q9BSD7	NTPCR_HUMAN	nucleoside-triphosphatase C1orf57								ATP binding|nucleoside-triphosphatase activity|nucleotide phosphatase activity|transferase activity				0		all_cancers(173;0.0818)|Prostate(94;0.137)				ttttttttttattttAGGAGT	0.368													6	3	---	---	---	---	
RYR2	6262	broad.mit.edu	37	1	237875200	237875200	+	Intron	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:237875200delT	uc001hyl.1	+						RYR2_uc010pxz.1_Intron	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor						cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)			ATGAATTGACTTTTTTTTTTT	0.299													6	5	---	---	---	---	
OR2T35	403244	broad.mit.edu	37	1	248801602	248801603	+	Frame_Shift_Ins	INS	-	CA	CA			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248801602_248801603insCA	uc001ies.1	-	1	957_958	c.957_958insTG	c.(955-960)GTGATCfs	p.V319fs		NM_001001827	NP_001001827	Q8NGX2	O2T35_HUMAN	olfactory receptor, family 2, subfamily T,	319_320	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(71;2.04e-05)|all_epithelial(71;1.03e-05)|Breast(184;0.00909)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)	all_cancers(173;0.237)	OV - Ovarian serous cystadenocarcinoma(106;0.0265)			CCCTTCCTGATCACAGTCGCCA	0.545													4	2	---	---	---	---	
SRBD1	55133	broad.mit.edu	37	2	45832386	45832387	+	Intron	INS	-	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:45832386_45832387insA	uc002rus.2	-							NM_018079	NP_060549	Q8N5C6	SRBD1_HUMAN	S1 RNA binding domain 1						nucleobase, nucleoside, nucleotide and nucleic acid metabolic process		hydrolase activity, acting on ester bonds|RNA binding			central_nervous_system(1)	1		all_hematologic(82;0.166)|Acute lymphoblastic leukemia(82;0.17)	LUSC - Lung squamous cell carcinoma(58;0.0917)|Lung(47;0.154)			catgaatgaatAAAAAAAGTTT	0.173													50	7	---	---	---	---	
SNRNP27	11017	broad.mit.edu	37	2	70123808	70123809	+	Intron	INS	-	T	T	rs71397375		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:70123808_70123809insT	uc002sfw.2	+						SNRNP27_uc002sfv.2_Intron|SNRNP27_uc002sfx.2_Intron	NM_006857	NP_006848	Q8WVK2	SNR27_HUMAN	small nuclear ribonucleoprotein 27kDa						mRNA processing|RNA splicing	nucleus	nucleic acid binding				0						Gttttttttggttttttttttt	0.109													4	2	---	---	---	---	
SPC25	57405	broad.mit.edu	37	2	169745615	169745616	+	Intron	DEL	AC	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:169745615_169745616delAC	uc002uel.2	-							NM_020675	NP_065726	Q9HBM1	SPC25_HUMAN	spindle pole body component 25						cell division|chromosome segregation|mitotic prometaphase|mitotic spindle organization	condensed chromosome kinetochore|cytosol|Ndc80 complex|nucleus	protein binding			central_nervous_system(1)	1						atatatatataCACACACACAA	0.153													4	2	---	---	---	---	
TTN	7273	broad.mit.edu	37	2	179595762	179595775	+	Frame_Shift_Del	DEL	ACTGTATCAGTGAC	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179595762_179595775delACTGTATCAGTGAC	uc010zfg.1	-	57	14109_14122	c.13885_13898delGTCACTGATACAGT	c.(13885-13899)GTCACTGATACAGTCfs	p.V4629fs	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Frame_Shift_Del_p.V1290fs	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	5556_5560							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			CAGTATTGAGACTGTATCAGTGACACTGATTTTA	0.393													156	17	---	---	---	---	
ARAP2	116984	broad.mit.edu	37	4	36109441	36109445	+	Intron	DEL	TTATG	-	-	rs71888363		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:36109441_36109445delTTATG	uc003gsq.1	-							NM_015230	NP_056045	Q8WZ64	ARAP2_HUMAN	ArfGAP with RhoGAP domain, ankyrin repeat and PH						regulation of ARF GTPase activity|small GTPase mediated signal transduction	cytosol	ARF GTPase activator activity|phosphatidylinositol-3,4,5-trisphosphate binding|zinc ion binding			ovary(1)|pancreas(1)|skin(1)	3						CAATCATATCTTATGTTATATTATA	0.210													4	3	---	---	---	---	
FRAS1	80144	broad.mit.edu	37	4	79101922	79101922	+	Intron	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79101922delT	uc003hlb.2	+						FRAS1_uc003hkw.2_Intron	NM_025074	NP_079350	Q86XX4	FRAS1_HUMAN	Fraser syndrome 1						cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5						AATGACAGTCTTTTTTTTTTT	0.343													4	3	---	---	---	---	
GRID2	2895	broad.mit.edu	37	4	93806086	93806087	+	Intron	INS	-	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:93806086_93806087insA	uc011cdt.1	+						GRID2_uc010ikx.2_Intron|GRID2_uc011cdu.1_Intron|GRID2_uc011cdv.1_Intron	NM_001510	NP_001501	O43424	GRID2_HUMAN	glutamate receptor, ionotropic, delta 2						glutamate signaling pathway	cell junction|integral to plasma membrane|outer membrane-bounded periplasmic space|postsynaptic membrane	extracellular-glutamate-gated ion channel activity|ionotropic glutamate receptor activity			ovary(3)|skin(2)|large_intestine(1)	6		Hepatocellular(203;0.114)|all_hematologic(202;0.177)		OV - Ovarian serous cystadenocarcinoma(123;3.22e-06)|LUSC - Lung squamous cell carcinoma(81;0.185)|Lung(65;0.191)	L-Glutamic Acid(DB00142)	TTGGTCTCCCCAAAAAAAAAAA	0.342													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	5	10665156	10665170	+	IGR	DEL	ACCATCTTCTTGGTA	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:10665156_10665170delACCATCTTCTTGGTA								ROPN1L (200019 upstream) : DAP (14173 downstream)																							TCCACCGGTCACCATCTTCTTGGTAACCAAAATCA	0.474													178	12	---	---	---	---	
ZFR	51663	broad.mit.edu	37	5	32355671	32355672	+	3'UTR	INS	-	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:32355671_32355672insT	uc003jhr.1	-	20					ZFR_uc010ium.1_3'UTR|ZFR_uc011cny.1_RNA	NM_016107	NP_057191	Q96KR1	ZFR_HUMAN	zinc finger RNA binding protein						multicellular organismal development	chromosome|cytoplasm|nucleus	DNA binding|RNA binding|zinc ion binding				0				STAD - Stomach adenocarcinoma(35;0.19)		GTCGGAGCACATTTTTTTTTTT	0.327													4	2	---	---	---	---	
AGXT2	64902	broad.mit.edu	37	5	35036999	35036999	+	Intron	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35036999delT	uc003jjf.2	-						AGXT2_uc011com.1_Intron|AGXT2_uc011con.1_Intron	NM_031900	NP_114106	Q9BYV1	AGT2_HUMAN	alanine-glyoxylate aminotransferase 2 precursor						glyoxylate metabolic process|pyrimidine base metabolic process|pyrimidine nucleoside catabolic process	mitochondrial matrix	(R)-3-amino-2-methylpropionate-pyruvate transaminase activity|alanine-glyoxylate transaminase activity|pyridoxal phosphate binding			ovary(3)|skin(1)	4	all_lung(31;4.52e-05)		COAD - Colon adenocarcinoma(61;0.174)|Colorectal(62;0.229)	GBM - Glioblastoma multiforme(108;0.181)	Glycine(DB00145)|L-Alanine(DB00160)|Pyridoxal Phosphate(DB00114)|Pyruvic acid(DB00119)	GCATCATACCTTTTTTTTTCC	0.488													167	8	---	---	---	---	
GHR	2690	broad.mit.edu	37	5	42447779	42447782	+	Intron	DEL	CTCC	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:42447779_42447782delCTCC	uc003jmt.2	+						uc003jmu.2_Intron|uc003jmv.1_Intron	NM_000163	NP_000154	P10912	GHR_HUMAN	growth hormone receptor precursor						2-oxoglutarate metabolic process|activation of JAK2 kinase activity|activation of MAPK activity|allantoin metabolic process|citrate metabolic process|creatine metabolic process|creatinine metabolic process|endocytosis|fatty acid metabolic process|growth hormone receptor signaling pathway|insulin-like growth factor receptor signaling pathway|isoleucine metabolic process|JAK-STAT cascade|multicellular organismal metabolic process|oxaloacetate metabolic process|positive regulation of multicellular organism growth|positive regulation of tyrosine phosphorylation of Stat3 protein|positive regulation of tyrosine phosphorylation of Stat5 protein|receptor internalization|response to cycloheximide|response to estradiol stimulus|succinate metabolic process|taurine metabolic process|valine metabolic process	cell surface|extracellular space|growth hormone receptor complex|integral to plasma membrane	growth factor binding|peptide hormone binding|proline-rich region binding|protein homodimerization activity|protein kinase binding			lung(4)|kidney(1)|skin(1)	6		Myeloproliferative disorder(839;0.00878)			Pegvisomant(DB00082)|Somatropin recombinant(DB00052)	tccttgttttctccctccctccct	0.029													4	5	---	---	---	---	
AP3S1	1176	broad.mit.edu	37	5	115202418	115202421	+	Frame_Shift_Del	DEL	AAGA	-	-	rs80118146		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:115202418_115202421delAAGA	uc003krl.2	+	2	237_240	c.121_124delAAGA	c.(121-126)AAGAGAfs	p.K41fs	AP3S1_uc003krk.2_Frame_Shift_Del_p.K19fs|AP3S1_uc003krm.2_Frame_Shift_Del_p.K41fs	NM_001284	NP_001275	Q92572	AP3S1_HUMAN	adaptor-related protein complex 3, sigma 1	41_42					insulin receptor signaling pathway|intracellular protein transport|vesicle-mediated transport	AP-type membrane coat adaptor complex|cytoplasmic vesicle membrane|Golgi apparatus|transport vesicle	protein binding|protein transporter activity				0		all_cancers(142;0.00377)|all_epithelial(76;0.000129)|Prostate(80;0.0132)|Ovarian(225;0.0776)|Lung NSC(810;0.245)		OV - Ovarian serous cystadenocarcinoma(64;1.08e-07)|Epithelial(69;1.11e-06)|all cancers(49;5.2e-05)		TTTGGTATCTAAGAGAGATGAAAA	0.304													77	9	---	---	---	---	
Unknown	0	broad.mit.edu	37	6	16063918	16063919	+	IGR	INS	-	AAGA	AAGA			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:16063918_16063919insAAGA								DTNBP1 (400647 upstream) : MYLIP (65398 downstream)																							aggaaggaaggaagaaaggaag	0.079													5	3	---	---	---	---	
ATF6B	1388	broad.mit.edu	37	6	32085618	32085619	+	Intron	DEL	CT	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32085618_32085619delCT	uc003nzn.2	-						TNXB_uc010jts.1_5'Flank|ATF6B_uc003nzm.1_Intron|ATF6B_uc003nzo.2_Intron|ATF6B_uc003nzp.1_Intron	NM_004381	NP_004372	Q99941	ATF6B_HUMAN	activating transcription factor 6 beta isoform						response to unfolded protein|signal transduction	endoplasmic reticulum membrane|integral to membrane|nucleus	protein dimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0						AGAGGGGGCCCTCTCTCTCTCT	0.594													4	2	---	---	---	---	
LOC100132354	100132354	broad.mit.edu	37	6	43872656	43872659	+	Intron	DEL	TTCC	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:43872656_43872659delTTCC	uc011dvm.1	+							NR_024478				Homo sapiens cDNA FLJ38229 fis, clone FCBBF2004256.												0						Attccttcctttccttccttcctt	0.240													4	3	---	---	---	---	
REV3L	5980	broad.mit.edu	37	6	111650562	111650562	+	Intron	DEL	C	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:111650562delC	uc003puy.3	-						REV3L_uc003pux.3_Intron|REV3L_uc003puz.3_Intron|REV3L_uc003pva.1_Intron	NM_002912	NP_002903	O60673	DPOLZ_HUMAN	DNA polymerase zeta						DNA-dependent DNA replication|translesion synthesis	nucleus|zeta DNA polymerase complex	DNA binding|DNA-directed DNA polymerase activity|metal ion binding|nucleotide binding			large_intestine(2)|ovary(2)|skin(2)	6		all_cancers(87;7.57e-06)|Acute lymphoblastic leukemia(125;2.46e-08)|all_hematologic(75;1.08e-06)|all_epithelial(87;0.00138)|Colorectal(196;0.021)		OV - Ovarian serous cystadenocarcinoma(136;0.0314)|Epithelial(106;0.057)|all cancers(137;0.0663)		ttttttttttcttttaaaaaa	0.000								DNA_polymerases_(catalytic_subunits)|Direct_reversal_of_damage					3	3	---	---	---	---	
TXLNB	167838	broad.mit.edu	37	6	139581356	139581357	+	Intron	INS	-	AAAT	AAAT			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:139581356_139581357insAAAT	uc011eds.1	-							NM_153235	NP_694967	Q8N3L3	TXLNB_HUMAN	taxilin beta							cytoplasm				large_intestine(1)|ovary(1)	2				OV - Ovarian serous cystadenocarcinoma(155;0.000185)|GBM - Glioblastoma multiforme(68;0.000235)		gactctgtctcaaataaataaa	0.144													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	7	61970367	61970367	+	IGR	DEL	C	-	-	rs4718027		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:61970367delC								None (None upstream) : LOC643955 (781305 downstream)																							aacgggatttcttcattgaat	0.000													2397	16	---	---	---	---	
RABGEF1	27342	broad.mit.edu	37	7	66098579	66098580	+	Intron	INS	-	AT	AT			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:66098579_66098580insAT	uc003tvf.2	+						KCTD7_uc003tvd.3_Intron|KCTD7_uc003tve.2_Intron	NM_014504	NP_055319	Q9UJ41	RABX5_HUMAN	RAB guanine nucleotide exchange factor (GEF) 1						endocytosis|protein transport	early endosome|recycling endosome	DNA binding|protein binding|zinc ion binding			ovary(1)	1						GAAAGAGATCAATTTTTTTTTT	0.337													9	5	---	---	---	---	
STX1A	6804	broad.mit.edu	37	7	73123180	73123180	+	Intron	DEL	G	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:73123180delG	uc003tyx.2	-						STX1A_uc003tyy.2_Intron|STX1A_uc010lbj.1_Intron|hsa-mir-4284|MI0015893_5'Flank	NM_004603	NP_004594	Q16623	STX1A_HUMAN	syntaxin 1A isoform 1						energy reserve metabolic process|glutamate secretion|intracellular protein transport|regulation of insulin secretion	cell junction|extracellular region|integral to membrane|neuron projection|synaptic vesicle membrane|synaptosome	SNAP receptor activity				0		Lung NSC(55;0.0908)|all_lung(88;0.198)				AGACCCAGATGGGGAGGAGTG	0.627													6	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	7	98409055	98409057	+	IGR	DEL	TAG	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98409055_98409057delTAG								NPTX2 (149874 upstream) : TMEM130 (35055 downstream)																							gtagtggtgatagtggtgatggt	0.000													9	5	---	---	---	---	
PLEC	5339	broad.mit.edu	37	8	145007649	145007657	+	Intron	DEL	CCCTTCCCT	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:145007649_145007657delCCCTTCCCT	uc003zaf.1	-						PLEC_uc003zab.1_Intron|PLEC_uc003zac.1_Intron|PLEC_uc003zad.2_Intron|PLEC_uc003zae.1_Intron|PLEC_uc003zag.1_Intron|PLEC_uc003zah.2_Intron|PLEC_uc003zaj.2_Intron	NM_201380	NP_958782	Q15149	PLEC_HUMAN	plectin isoform 1						cellular component disassembly involved in apoptosis|hemidesmosome assembly	cytosol|focal adhesion|hemidesmosome|intermediate filament cytoskeleton|sarcolemma	actin binding|structural constituent of muscle|structural constituent of muscle			large_intestine(2)|ovary(2)|pancreas(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	9						CCTGTCCTTCCCCTTCCCTCCCTGCCCAC	0.632													5	9	---	---	---	---	
CBWD6	644019	broad.mit.edu	37	9	69207122	69207122	+	Intron	DEL	G	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:69207122delG	uc004afj.3	-						CBWD6_uc004afk.3_Intron|CBWD6_uc011lrf.1_Intron	NM_001085457	NP_001078926	Q4V339	CBWD6_HUMAN	COBW domain containing 6								ATP binding				0						CATATGTGCTGTTTTTTTGGA	0.294													4	3	---	---	---	---	
CEP110	11064	broad.mit.edu	37	9	123939408	123939412	+	Intron	DEL	ATTTG	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:123939408_123939412delATTTG	uc004bkx.1	+						CEP110_uc004blb.1_Intron|CEP110_uc010mvp.1_Intron	NM_007018	NP_008949	Q7Z7A1	CNTRL_HUMAN	centrosomal protein 110kDa						cell division|G2/M transition of mitotic cell cycle	centrosome|cytosol	protein binding				0						TGTTTCAAGAATTTGATTTATCCTT	0.341													69	30	---	---	---	---	
TRUB2	26995	broad.mit.edu	37	9	131075834	131075834	+	Intron	DEL	G	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131075834delG	uc004buq.1	-							NM_015679	NP_056494	O95900	TRUB2_HUMAN	TruB pseudouridine (psi) synthase homolog 2						pseudouridine synthesis|tRNA processing		pseudouridine synthase activity|RNA binding			ovary(1)	1						aaaaaaaaaagaaaagaaaaG	0.209													4	2	---	---	---	---	
CELF2	10659	broad.mit.edu	37	10	11363483	11363483	+	Intron	DEL	A	-	-	rs113196940		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:11363483delA	uc001iki.3	+						CELF2_uc010qbj.1_Intron|CELF2_uc001ikk.2_Intron|CELF2_uc001ikl.3_Intron|CELF2_uc010qbl.1_Intron|CELF2_uc010qbm.1_Intron|CELF2_uc001iko.3_Intron|CELF2_uc001ikp.3_Intron|CELF2_uc010qbn.1_Intron|CELF2_uc010qbo.1_Intron|CELF2_uc010qbp.1_Intron	NM_001025077	NP_001020248	O95319	CELF2_HUMAN	CUG triplet repeat, RNA binding protein 2						mRNA processing|regulation of heart contraction	cytoplasm|nucleus	nucleotide binding|protein binding|RNA binding				0						ATTCATGTTTaaaaaaaaaaa	0.214													5	5	---	---	---	---	
DHTKD1	55526	broad.mit.edu	37	10	12160750	12160750	+	Frame_Shift_Del	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:12160750delT	uc001ild.3	+	15	2504	c.2405delT	c.(2404-2406)GTTfs	p.V802fs		NM_018706	NP_061176	Q96HY7	DHTK1_HUMAN	dehydrogenase E1 and transketolase domain	802					glycolysis	mitochondrion	oxoglutarate dehydrogenase (succinyl-transferring) activity|thiamine pyrophosphate binding			ovary(1)|central_nervous_system(1)	2		Renal(717;0.228)	BRCA - Breast invasive adenocarcinoma(52;0.188)			TCCAACAGGGTTAAGACCCTC	0.378													543	22	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42384716	42384716	+	IGR	DEL	G	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42384716delG								None (None upstream) : LOC441666 (442599 downstream)																							ggaatcgaatggaatcatcat	0.000													1108	9	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42387774	42387774	+	IGR	DEL	C	-	-	rs141701904		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42387774delC								None (None upstream) : LOC441666 (439541 downstream)																							aatcattgaacggaattgaat	0.000													790	11	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42390479	42390479	+	IGR	DEL	G	-	-	rs72505278		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42390479delG								None (None upstream) : LOC441666 (436836 downstream)																							AAcatcgaatggaatcgaatg	0.040													88	13	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42396084	42396085	+	IGR	INS	-	G	G			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42396084_42396085insG								None (None upstream) : LOC441666 (431230 downstream)																							atggaatagtcaatgaactcga	0.000													1238	10	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42396450	42396450	+	IGR	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42396450delT								None (None upstream) : LOC441666 (430865 downstream)																							tggtctcgaatggaatcacct	0.000													278	9	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42529430	42529430	+	IGR	DEL	T	-	-	rs71266253		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42529430delT								None (None upstream) : LOC441666 (297885 downstream)																							gaagtccaaatatgcacttgc	0.000													945	14	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42530673	42530674	+	IGR	INS	-	A	A	rs58302682		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42530673_42530674insA								None (None upstream) : LOC441666 (296641 downstream)																							tctctctaaagaacgttcaact	0.000													21	28	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42596916	42596916	+	IGR	DEL	A	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42596916delA								None (None upstream) : LOC441666 (230399 downstream)																							cttcaaatggaaaggaatgga	0.000													2159	11	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42597165	42597165	+	IGR	DEL	G	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42597165delG								None (None upstream) : LOC441666 (230150 downstream)																							ggaatcgaatggaatcatcat	0.020													1927	7	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	42599640	42599640	+	IGR	DEL	A	-	-	rs145203825		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42599640delA								None (None upstream) : LOC441666 (227675 downstream)																							aatggaaatgaaaggagtcat	0.000													3905	9	---	---	---	---	
RTKN2	219790	broad.mit.edu	37	10	64005582	64005583	+	Intron	INS	-	A	A	rs145698745	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64005582_64005583insA	uc001jlw.2	-						RTKN2_uc001jlx.2_Intron	NM_145307	NP_660350	Q8IZC4	RTKN2_HUMAN	rhotekin 2						signal transduction	intracellular					0	Prostate(12;0.0297)|all_hematologic(501;0.215)					tcttaaactctaaagttctata	0.129													5	5	---	---	---	---	
HPSE2	60495	broad.mit.edu	37	10	100401359	100401359	+	Intron	DEL	A	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:100401359delA	uc001kpn.1	-						HPSE2_uc009xwc.1_Intron|HPSE2_uc001kpo.1_Intron|HPSE2_uc009xwd.1_Intron	NM_021828	NP_068600	Q8WWQ2	HPSE2_HUMAN	heparanase 2						carbohydrate metabolic process	intracellular|membrane	cation binding|heparanase activity			ovary(1)	1				Epithelial(162;1.8e-09)|all cancers(201;4.72e-07)		aaaattaattaaaaaaaaaaT	0.179													1	5	---	---	---	---	
ABLIM1	3983	broad.mit.edu	37	10	116272611	116272614	+	Intron	DEL	GAAA	-	-	rs72374792		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:116272611_116272614delGAAA	uc010qsg.1	-						ABLIM1_uc010qsh.1_Intron|ABLIM1_uc010qsi.1_Intron|ABLIM1_uc010qsk.1_Intron|ABLIM1_uc009xyp.2_Intron|ABLIM1_uc010qsf.1_Intron|ABLIM1_uc009xyn.2_Intron|ABLIM1_uc010qsj.1_Intron|ABLIM1_uc009xyo.2_Intron	NM_002313	NP_002304	O14639	ABLM1_HUMAN	actin-binding LIM protein 1 isoform a						axon guidance|cytoskeleton organization|organ morphogenesis|visual perception	actin cytoskeleton|cytoplasm	actin binding|zinc ion binding			breast(1)	1		Colorectal(252;0.0373)|Breast(234;0.231)		Epithelial(162;0.0132)|all cancers(201;0.0383)		aggaaggaaggaaagaaggaagga	0.049													4	2	---	---	---	---	
EIF3A	8661	broad.mit.edu	37	10	120825249	120825249	+	Intron	DEL	G	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:120825249delG	uc001ldu.2	-						EIF3A_uc010qsu.1_Intron	NM_003750	NP_003741	Q14152	EIF3A_HUMAN	eukaryotic translation initiation factor 3,						formation of translation initiation complex	cytosol|eukaryotic translation initiation factor 3 complex	protein binding|structural molecule activity|translation initiation factor activity				0		Lung NSC(174;0.094)|all_lung(145;0.123)		all cancers(201;0.0236)		GGGAGTAAGAGAAATGGGCTG	0.383													3	3	---	---	---	---	
GYLTL1B	120071	broad.mit.edu	37	11	45945557	45945578	+	Intron	DEL	AAAAAAAAAAAAAAAAAAGAAC	-	-	rs60577963		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:45945557_45945578delAAAAAAAAAAAAAAAAAAGAAC	uc001nbv.1	+						GYLTL1B_uc001nbw.1_Intron|GYLTL1B_uc001nbx.1_Intron|GYLTL1B_uc001nby.1_5'Flank	NM_152312	NP_689525	Q8N3Y3	LARG2_HUMAN	glycosyltransferase-like 1B						muscle cell homeostasis	Golgi membrane|integral to membrane	transferase activity, transferring glycosyl groups			ovary(2)|central_nervous_system(1)	3				GBM - Glioblastoma multiforme(35;0.226)		aaaaaaaaaaaaaaaaaaaaaaaaaaaaGAACATCCTGAGCC	0.302													4	2	---	---	---	---	
TIGD3	220359	broad.mit.edu	37	11	65124558	65124558	+	Frame_Shift_Del	DEL	C	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65124558delC	uc001odo.3	+	2	1442	c.1279delC	c.(1279-1281)CCCfs	p.P427fs		NM_145719	NP_663771	Q6B0B8	TIGD3_HUMAN	tigger transposable element derived 3	427					regulation of transcription, DNA-dependent	chromosome, centromeric region|nucleus	DNA binding				0						TGCCTTTGAGCCCCTGCCCAC	0.562													34	48	---	---	---	---	
LRP6	4040	broad.mit.edu	37	12	12291105	12291106	+	Intron	INS	-	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:12291105_12291106insA	uc001rah.3	-						BCL2L14_uc001raf.1_Intron|LRP6_uc010shl.1_Intron	NM_002336	NP_002327	O75581	LRP6_HUMAN	low density lipoprotein receptor-related protein						cellular response to cholesterol|negative regulation of protein phosphorylation|negative regulation of protein serine/threonine kinase activity|negative regulation of smooth muscle cell apoptosis|neural crest formation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of cell cycle|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of transcription from RNA polymerase II promoter|positive regulation of Wnt receptor signaling pathway involved in dorsal/ventral axis specification|Wnt receptor signaling pathway involved in dorsal/ventral axis specification	cell surface|cytoplasmic vesicle|endoplasmic reticulum|integral to membrane|plasma membrane	coreceptor activity|frizzled binding|kinase inhibitor activity|low-density lipoprotein receptor activity|protein homodimerization activity|toxin transporter activity|Wnt-protein binding			lung(4)|skin(4)|ovary(2)|kidney(1)|central_nervous_system(1)	12		Prostate(47;0.0865)				actccgtctccaaaaaaaaaaa	0.139													7	4	---	---	---	---	
C12orf35	55196	broad.mit.edu	37	12	32136793	32136794	+	Frame_Shift_Ins	INS	-	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:32136793_32136794insC	uc001rks.2	+	4	3318_3319	c.2904_2905insC	c.(2902-2907)AAAATAfs	p.K968fs		NM_018169	NP_060639	Q9HCM1	CL035_HUMAN	hypothetical protein LOC55196	968_969										ovary(1)|skin(1)	2	all_cancers(9;3.36e-11)|all_epithelial(9;2.56e-11)|all_lung(12;5.67e-10)|Acute lymphoblastic leukemia(23;0.0122)|Lung SC(12;0.0336)|all_hematologic(23;0.0429)|Esophageal squamous(101;0.204)		OV - Ovarian serous cystadenocarcinoma(6;0.0114)			TTTCACATAAAATATGTGATCA	0.351													115	10	---	---	---	---	
LRRK2	120892	broad.mit.edu	37	12	40702846	40702846	+	Intron	DEL	A	-	-	rs7305344	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:40702846delA	uc001rmg.3	+						LRRK2_uc009zjw.2_Intron|LRRK2_uc001rmi.2_Intron	NM_198578	NP_940980	Q5S007	LRRK2_HUMAN	leucine-rich repeat kinase 2						activation of MAPKK activity|determination of adult lifespan|exploration behavior|intracellular distribution of mitochondria|negative regulation of branching morphogenesis of a nerve|negative regulation of dendritic spine morphogenesis|negative regulation of neuroblast proliferation|negative regulation of neuron maturation|neuromuscular junction development|neuron death|peptidyl-serine phosphorylation|positive regulation of autophagy|positive regulation of dopamine receptor signaling pathway|positive regulation of programmed cell death|positive regulation of proteasomal ubiquitin-dependent protein catabolic process|positive regulation of protein phosphorylation|positive regulation of protein ubiquitination|protein autophosphorylation|regulation of kidney size|regulation of locomotion|regulation of membrane potential|response to oxidative stress|small GTPase mediated signal transduction|tangential migration from the subventricular zone to the olfactory bulb	external side of mitochondrial outer membrane	ATP binding|GTP binding|GTP-dependent protein kinase activity|GTPase activator activity|MAP kinase kinase activity|protein homodimerization activity|tubulin binding			ovary(12)|stomach(5)|upper_aerodigestive_tract(2)|lung(2)|large_intestine(1)|urinary_tract(1)|pancreas(1)	24	all_cancers(12;0.00108)|Breast(8;0.218)	Lung NSC(34;0.0942)|all_lung(34;0.11)				ATTTTTTTTTAAAAAAGGATT	0.289													54	8	---	---	---	---	
RB1	5925	broad.mit.edu	37	13	48954159	48954160	+	Intron	INS	-	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:48954159_48954160insT	uc001vcb.2	+							NM_000321	NP_000312	P06400	RB_HUMAN	retinoblastoma 1						androgen receptor signaling pathway|cell cycle arrest|chromatin remodeling|G1 phase of mitotic cell cycle|interspecies interaction between organisms|maintenance of mitotic sister chromatid cohesion|mitotic cell cycle G1/S transition checkpoint|myoblast differentiation|negative regulation of cell growth|negative regulation of protein kinase activity|negative regulation of S phase of mitotic cell cycle|negative regulation of sequence-specific DNA binding transcription factor activity|positive regulation of mitotic metaphase/anaphase transition|protein localization to chromosome, centromeric region|Ras protein signal transduction|regulation of centromere complex assembly|regulation of cohesin localization to chromatin|regulation of lipid kinase activity|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle|sister chromatid biorientation	chromatin|PML body|Rb-E2F complex|SWI/SNF complex	androgen receptor binding|DNA binding|kinase binding|phosphoprotein binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription factor binding|ubiquitin protein ligase binding	p.?(7)		lung(94)|eye(89)|central_nervous_system(47)|bone(22)|breast(21)|urinary_tract(17)|haematopoietic_and_lymphoid_tissue(14)|ovary(10)|prostate(9)|soft_tissue(8)|skin(7)|endometrium(5)|cervix(3)|liver(3)|salivary_gland(2)|stomach(2)|oesophagus(1)|adrenal_gland(1)|kidney(1)|gastrointestinal_tract_(site_indeterminate)(1)|pituitary(1)	358		all_cancers(8;6.9e-71)|all_epithelial(8;4.61e-22)|Acute lymphoblastic leukemia(8;1.1e-21)|all_hematologic(8;2.3e-21)|all_lung(13;1.51e-09)|Lung NSC(96;7.03e-07)|Breast(56;1.53e-05)|Prostate(109;0.000493)|Myeloproliferative disorder(33;0.0179)|Hepatocellular(98;0.0207)|all_neural(104;0.0227)|Glioma(44;0.0286)|Lung SC(185;0.0301)		GBM - Glioblastoma multiforme(2;9.98e-18)|LUSC - Lung squamous cell carcinoma(3;0.013)	Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)	TAAACAACTTCTTTTTTTTTTT	0.129		6	D|Mis|N|F|S		retinoblastoma|sarcoma|breast|small cell lung	retinoblastoma|sarcoma|breast|small cell lung			Hereditary_Retinoblastoma	TCGA GBM(7;6.82e-08)|TSP Lung(12;0.097)|TCGA Ovarian(6;0.080)			4	3	---	---	---	---	
MYO16	23026	broad.mit.edu	37	13	109644853	109644854	+	Intron	INS	-	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:109644853_109644854insT	uc001vqt.1	+						MYO16_uc010agk.1_Intron|MYO16_uc001vqu.1_Intron|MYO16_uc010tjh.1_Intron	NM_015011	NP_055826	Q9Y6X6	MYO16_HUMAN	myosin heavy chain Myr 8						cerebellum development|negative regulation of cell proliferation|negative regulation of S phase of mitotic cell cycle	myosin complex|nucleoplasm|perinuclear region of cytoplasm|plasma membrane	actin filament binding|ATP binding|motor activity			ovary(6)|large_intestine(1)|kidney(1)|breast(1)|central_nervous_system(1)	10	all_lung(23;0.000332)|all_neural(89;0.00294)|Medulloblastoma(90;0.00596)|Lung NSC(43;0.00751)|Lung SC(71;0.104)		BRCA - Breast invasive adenocarcinoma(86;0.19)|all cancers(43;0.201)			AAACTAAGTTCTTTTTTTAATT	0.238													65	15	---	---	---	---	
GABPB1	2553	broad.mit.edu	37	15	50570605	50570605	+	3'UTR	DEL	A	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:50570605delA	uc001zyb.2	-	9					GABPB1_uc001zya.2_3'UTR|GABPB1_uc010ufg.1_3'UTR	NM_005254	NP_005245	Q06547	GABP1_HUMAN	GA binding protein transcription factor, beta						positive regulation of transcription from RNA polymerase II promoter	nucleus	protein binding|protein heterodimerization activity|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			large_intestine(1)	1						TTGGAACTGTAAAAAAAAAAA	0.279													4	2	---	---	---	---	
GGA2	23062	broad.mit.edu	37	16	23498305	23498306	+	Intron	INS	-	TTT	TTT	rs116219854		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:23498305_23498306insTTT	uc002dlq.2	-						GGA2_uc010bxo.1_Intron	NM_015044	NP_055859	Q9UJY4	GGA2_HUMAN	ADP-ribosylation factor binding protein 2						intracellular protein transport|vesicle-mediated transport	clathrin adaptor complex|clathrin-coated vesicle|endosome membrane|trans-Golgi network	ADP-ribosylation factor binding			ovary(1)|central_nervous_system(1)	2				GBM - Glioblastoma multiforme(48;0.0386)		cttttctgttgttttttttttt	0.030													4	3	---	---	---	---	
SRCAP	10847	broad.mit.edu	37	16	30740925	30740929	+	Intron	DEL	CTTCT	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30740925_30740929delCTTCT	uc002dze.1	+						SRCAP_uc002dzf.2_Intron|SRCAP_uc002dzg.1_Intron	NM_006662	NP_006653	Q6ZRS2	SRCAP_HUMAN	Snf2-related CBP activator protein						interspecies interaction between organisms|regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	Golgi apparatus|nucleus|protein complex	ATP binding|DNA binding|helicase activity|histone acetyltransferase activity|transcription coactivator activity			ovary(3)|skin(1)	4			Colorectal(24;0.198)			GGACCCTtgacttctcttcttttct	0.234													58	17	---	---	---	---	
CLEC18C	283971	broad.mit.edu	37	16	70072983	70072984	+	Intron	INS	-	T	T			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70072983_70072984insT	uc002exy.2	+						PDXDC2_uc002eyb.2_RNA|PDXDC2_uc002eyc.2_Intron	NM_182619	NP_872425	Q8NCF0	CL18C_HUMAN	secretory protein LOC348174 precursor							extracellular region	sugar binding				0						GTTGCTTCAAGTTTTTTTTTTT	0.376													4	2	---	---	---	---	
SHPK	23729	broad.mit.edu	37	17	3524895	3524896	+	Intron	INS	-	TCCC	TCCC			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3524895_3524896insTCCC	uc002fvz.1	-							NM_013276	NP_037408	Q9UHJ6	SHPK_HUMAN	carbohydrate kinase-like						carbohydrate metabolic process	cytoplasm	ATP binding|sedoheptulokinase activity			ovary(1)	1				COAD - Colon adenocarcinoma(5;0.0828)		tctccattccttccctccctcc	0.000													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	17	22066949	22066949	+	IGR	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:22066949delT								FLJ36000 (153879 upstream) : None (None downstream)																							CCAGAAAAAATATGTGAGAGA	0.323													6	3	---	---	---	---	
ACCN1	40	broad.mit.edu	37	17	32126228	32126231	+	Intron	DEL	TTCC	-	-	rs71862880		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:32126228_32126231delTTCC	uc002hhu.2	-							NM_001094	NP_001085	Q16515	ACCN1_HUMAN	amiloride-sensitive cation channel 1, neuronal						central nervous system development|peripheral nervous system development|synaptic transmission	integral to plasma membrane	ligand-gated sodium channel activity|protein binding			ovary(2)|large_intestine(1)|central_nervous_system(1)	4		Breast(31;0.042)|Ovarian(249;0.202)		UCEC - Uterine corpus endometrioid carcinoma (308;0.13)|BRCA - Breast invasive adenocarcinoma(366;0.215)	Amiloride(DB00594)	GTGTAATCAGttccttccttcctt	0.201													4	3	---	---	---	---	
GHDC	84514	broad.mit.edu	37	17	40342704	40342704	+	Frame_Shift_Del	DEL	G	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40342704delG	uc002hzd.2	-	7	1710	c.1226delC	c.(1225-1227)GCAfs	p.A409fs	GHDC_uc002hzg.1_Frame_Shift_Del_p.A409fs|GHDC_uc010wgg.1_Frame_Shift_Del_p.A370fs|GHDC_uc002hze.3_Frame_Shift_Del_p.A409fs|GHDC_uc002hzf.3_Frame_Shift_Del_p.A409fs	NM_032484	NP_115873	Q8N2G8	GHDC_HUMAN	LGP1 homolog isoform 1	409						endoplasmic reticulum|nuclear envelope					0		all_cancers(22;0.000229)|Breast(137;0.00104)|all_epithelial(22;0.00304)		BRCA - Breast invasive adenocarcinoma(366;0.124)		CTGCCCCACTGCCCGGCCCAG	0.637													22	20	---	---	---	---	
LOC651250	651250	broad.mit.edu	37	17	66141032	66141032	+	Intron	DEL	C	-	-	rs76883902	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66141032delC	uc002jgo.1	+											full-length cDNA clone CS0DD005YM11 of Neuroblastoma Cot 50-normalized of Homo sapiens (human).												0						AAAAAAAAAACATAAGCCAAA	0.338													75	7	---	---	---	---	
FLJ45079	400624	broad.mit.edu	37	17	75881907	75881910	+	5'Flank	DEL	AAAG	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:75881907_75881910delAAAG	uc002jub.2	-							NM_001001685	NP_001001685			SubName: Full=FLJ45079 protein; SubName: Full=cDNA FLJ45079 fis, clone BRAWH3027675; SubName: Full=cDNA FLJ46474 fis, clone THYMU3024164;												0			BRCA - Breast invasive adenocarcinoma(99;0.00524)|Lung(188;0.154)			AGAGAAAGAAaaagaaagaaagaa	0.137													4	2	---	---	---	---	
FOXK2	3607	broad.mit.edu	37	17	80544132	80544133	+	Intron	DEL	GG	-	-	rs7216849		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:80544132_80544133delGG	uc002kfn.2	+						FOXK2_uc002kfm.1_Intron|FOXK2_uc010diu.2_Intron	NM_004514	NP_004505	Q01167	FOXK2_HUMAN	forkhead box K2						embryo development|pattern specification process|regulation of sequence-specific DNA binding transcription factor activity|regulation of transcription from RNA polymerase II promoter|tissue development	transcription factor complex	DNA bending activity|double-stranded DNA binding|magnesium ion binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding				0	Breast(20;0.00106)|all_neural(118;0.0952)		OV - Ovarian serous cystadenocarcinoma(97;0.0371)|BRCA - Breast invasive adenocarcinoma(99;0.0415)			aaggtgggccggggggggaaag	0.144													4	3	---	---	---	---	
AFG3L2	10939	broad.mit.edu	37	18	12351549	12351549	+	Intron	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:12351549delT	uc002kqz.1	-							NM_006796	NP_006787	Q9Y4W6	AFG32_HUMAN	AFG3 ATPase family gene 3-like 2						cell death|protein catabolic process|proteolysis	integral to membrane	ATP binding|metalloendopeptidase activity|nucleoside-triphosphatase activity|unfolded protein binding|zinc ion binding				0					Adenosine triphosphate(DB00171)	GTGttttttgttttttttttt	0.179													5	3	---	---	---	---	
SERPINB8	5271	broad.mit.edu	37	18	61645448	61645449	+	Intron	DEL	GC	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:61645448_61645449delGC	uc002ljv.2	+						SERPINB8_uc002ljs.1_Intron|SERPINB8_uc002ljt.2_Intron|SERPINB8_uc002lju.2_Intron|SERPINB8_uc010xex.1_Intron	NM_198833	NP_942130	P50452	SPB8_HUMAN	serine (or cysteine) proteinase inhibitor, clade						regulation of proteolysis	cytosol	protein binding|serine-type endopeptidase inhibitor activity			skin(1)	1		Esophageal squamous(42;0.129)				taccacCTCAGCGTCCACTGAC	0.282													17	7	---	---	---	---	
SEMA6B	10501	broad.mit.edu	37	19	4555839	4555839	+	Intron	DEL	G	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4555839delG	uc010duc.1	-						SEMA6B_uc010dud.2_Intron|SEMA6B_uc010xih.1_Intron	NM_032108	NP_115484	Q9H3T3	SEM6B_HUMAN	semaphorin 6B precursor						cell differentiation|nervous system development	integral to membrane	receptor activity			skin(1)	1		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|BRCA - Breast invasive adenocarcinoma(158;0.0149)|STAD - Stomach adenocarcinoma(1328;0.18)		TTTGGACAGCGCTGACTCCTC	0.443													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	19	27731986	27731989	+	IGR	DEL	TGTT	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:27731986_27731989delTGTT								None (None upstream) : LOC148189 (549413 downstream)																							ggaaacactctgtttgtaaagtct	0.000													1063	9	---	---	---	---	
Unknown	0	broad.mit.edu	37	19	27733247	27733247	+	IGR	DEL	A	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:27733247delA								None (None upstream) : LOC148189 (548155 downstream)																							aactagacagaatcattctca	0.000													989	19	---	---	---	---	
Unknown	0	broad.mit.edu	37	19	27736410	27736410	+	IGR	DEL	A	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:27736410delA								None (None upstream) : LOC148189 (544992 downstream)																							taaagtctgcaagtggatatt	0.000													549	11	---	---	---	---	
Unknown	0	broad.mit.edu	37	19	27738439	27738439	+	IGR	DEL	A	-	-	rs74193346		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:27738439delA								None (None upstream) : LOC148189 (542963 downstream)																							ctctgtttgtaaagtctgcaa	0.000													1146	9	---	---	---	---	
FXYD1	5348	broad.mit.edu	37	19	35632166	35632212	+	Intron	DEL	CTGGCCCCGCCTCTCCCTGGCCCCGCCTCTCCCTAGCCCCCCTCTCC	-	-	rs28699295		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35632166_35632212delCTGGCCCCGCCTCTCCCTGGCCCCGCCTCTCCCTAGCCCCCCTCTCC	uc002nyc.2	+						LGI4_uc002nxy.1_Intron|FXYD1_uc002nyb.1_3'UTR|FXYD1_uc002nyd.2_Intron|FXYD7_uc010xsp.1_5'Flank|FXYD7_uc002nye.1_5'Flank|FXYD7_uc002nyf.1_5'Flank	NM_021902	NP_068702	O00168	PLM_HUMAN	phospholemman precursor						muscle contraction	chloride channel complex|integral to plasma membrane	chloride channel activity				0	all_lung(56;7.56e-09)|Lung NSC(56;1.1e-08)|Esophageal squamous(110;0.162)		Epithelial(14;2.32e-21)|OV - Ovarian serous cystadenocarcinoma(14;3.17e-20)|all cancers(14;2.43e-18)|LUSC - Lung squamous cell carcinoma(66;0.0849)			ccacctctctctggccccgcctctccctggccccgcctctccctagcccccctctccctggccccgc	0.142													9	9	---	---	---	---	
HAMP	57817	broad.mit.edu	37	19	35775510	35775510	+	Intron	DEL	T	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:35775510delT	uc002nyw.2	+							NM_021175	NP_066998	P81172	HEPC_HUMAN	hepcidin antimicrobial peptide preproprotein						defense response to bacterium|defense response to fungus|immune response|killing of cells of other organism	extracellular region	hormone activity			central_nervous_system(1)	1	all_lung(56;2.37e-08)|Lung NSC(56;3.66e-08)|Esophageal squamous(110;0.162)		Epithelial(14;7.4e-20)|OV - Ovarian serous cystadenocarcinoma(14;6.47e-19)|all cancers(14;4.17e-17)|LUSC - Lung squamous cell carcinoma(66;0.0417)			atctgggaggttttttttttt	0.209													4	2	---	---	---	---	
RYR1	6261	broad.mit.edu	37	19	39018582	39018583	+	Intron	INS	-	A	A	rs142679376	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39018582_39018583insA	uc002oit.2	+						RYR1_uc002oiu.2_Intron|RYR1_uc002oiv.1_Intron|RYR1_uc010xuf.1_Intron	NM_000540	NP_000531	P21817	RYR1_HUMAN	skeletal muscle ryanodine receptor isoform 1						muscle contraction|release of sequestered calcium ion into cytosol|response to caffeine|response to hypoxia	cell cortex|cytosol|I band|integral to plasma membrane|junctional sarcoplasmic reticulum membrane|smooth endoplasmic reticulum|terminal cisterna	calcium ion binding|calmodulin binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(7)|pancreas(2)|breast(1)|central_nervous_system(1)|skin(1)	12	all_cancers(60;7.91e-06)		Lung(45;0.00172)|LUSC - Lung squamous cell carcinoma(53;0.00272)		Dantrolene(DB01219)	TAGAATGGATCGGGGGAGGGGT	0.569													1	6	---	---	---	---	
SPTBN4	57731	broad.mit.edu	37	19	41010047	41010047	+	Intron	DEL	C	-	-	rs843779	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41010047delC	uc002ony.2	+						SPTBN4_uc002onx.2_Intron|SPTBN4_uc002onz.2_Intron	NM_020971	NP_066022	Q9H254	SPTN4_HUMAN	spectrin, beta, non-erythrocytic 4 isoform						actin filament capping|axon guidance|cytoskeletal anchoring at plasma membrane|vesicle-mediated transport	cytosol|nuclear matrix|PML body|spectrin	actin binding|ankyrin binding|structural constituent of cytoskeleton			ovary(3)|central_nervous_system(1)|skin(1)	5			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)			CAGGTGCCGGCGGGGGGGCGG	0.617													74	7	---	---	---	---	
PHLDB3	653583	broad.mit.edu	37	19	43999307	43999308	+	Intron	INS	-	A	A	rs148094242	by1000genomes	TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43999307_43999308insA	uc002own.3	-						PHLDB3_uc010eit.2_Intron	NM_198850	NP_942147	Q6NSJ2	PHLB3_HUMAN	pleckstrin homology-like domain, family B,												0		Prostate(69;0.0153)				gagggaggaggggctagggcct	0.045													5	3	---	---	---	---	
TOX2	84969	broad.mit.edu	37	20	42556323	42556324	+	Intron	INS	-	C	C			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:42556323_42556324insC	uc010ggo.2	+						TOX2_uc002xle.3_Intron|TOX2_uc010ggp.2_Intron	NM_001098797	NP_001092267	Q96NM4	TOX2_HUMAN	TOX high mobility group box family member 2						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1		Myeloproliferative disorder(115;0.00452)	COAD - Colon adenocarcinoma(18;0.00189)			ctttcttccttccttcccttcc	0.005													4	4	---	---	---	---	
GRIK1	2897	broad.mit.edu	37	21	30963767	30963772	+	Intron	DEL	TCTTTT	-	-	rs72421506		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:30963767_30963772delTCTTTT	uc002yno.1	-						GRIK1_uc002ynn.2_Intron|GRIK1_uc011acs.1_Intron|GRIK1_uc011act.1_Intron|GRIK1_uc010glq.1_Intron	NM_000830	NP_000821	P39086	GRIK1_HUMAN	glutamate receptor, ionotropic, kainate 1						central nervous system development|synaptic transmission	cell junction|postsynaptic membrane	kainate selective glutamate receptor activity			large_intestine(1)|ovary(1)|skin(1)	3					L-Glutamic Acid(DB00142)|Topiramate(DB00273)	TAGGTGGAGGTCTTTTTCTTTTTCAT	0.296													3	3	---	---	---	---	
CECR2	27443	broad.mit.edu	37	22	17898558	17898560	+	Intron	DEL	GAA	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:17898558_17898560delGAA	uc010gqv.1	+							NM_031413	NP_113601	Q9BXF3	CECR2_HUMAN	cat eye syndrome chromosome region, candidate 2						chromatin modification|cytokinesis|cytoskeleton organization|DNA fragmentation involved in apoptotic nuclear change|vesicle-mediated transport		protein binding			ovary(1)|skin(1)	2		all_epithelial(15;0.139)		Lung(27;0.146)		ggaagaggaggaagaagaagaag	0.266													2	4	---	---	---	---	
C22orf42	150297	broad.mit.edu	37	22	32550001	32550002	+	Intron	INS	-	TG	TG	rs112706300		TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:32550001_32550002insTG	uc003amd.2	-							NM_001010859	NP_001010859	Q6IC83	CV042_HUMAN	chromosome 22 open reading frame 42											ovary(1)|skin(1)	2						atgagaccttTTcacacacaca	0.099													4	2	---	---	---	---	
KDM6A	7403	broad.mit.edu	37	X	44941860	44941861	+	Frame_Shift_Ins	INS	-	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:44941860_44941861insA	uc004dge.3	+	21	3559_3560	c.3184_3185insA	c.(3184-3186)GATfs	p.D1062fs	KDM6A_uc011mkz.1_Frame_Shift_Ins_p.D1114fs|KDM6A_uc011mla.1_Frame_Shift_Ins_p.D1017fs|KDM6A_uc011mlb.1_Frame_Shift_Ins_p.D1069fs|KDM6A_uc011mlc.1_Frame_Shift_Ins_p.D766fs|KDM6A_uc011mld.1_Frame_Shift_Ins_p.D701fs	NM_021140	NP_066963	O15550	KDM6A_HUMAN	ubiquitously transcribed tetratricopeptide	1062					histone H3-K4 methylation		metal ion binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen			kidney(24)|haematopoietic_and_lymphoid_tissue(23)|oesophagus(11)|large_intestine(7)|lung(5)|breast(4)|central_nervous_system(3)|urinary_tract(3)|endometrium(2)|pancreas(2)	84						AGACCACTCAGATAGTGAATCT	0.317			D|N|F|S		renal|oesophageal SCC|MM								95	44	---	---	---	---	
Unknown	0	broad.mit.edu	37	X	61731081	61731082	+	IGR	DEL	CT	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:61731081_61731082delCT								None (None upstream) : SPIN4 (836026 downstream)																							ttcaaaactgctctctcaaaag	0.000													100	9	---	---	---	---	
ZNF711	7552	broad.mit.edu	37	X	84502560	84502563	+	5'UTR	DEL	TGAA	-	-			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:84502560_84502563delTGAA	uc004eeo.2	+	3					ZNF711_uc004eep.2_5'UTR|ZNF711_uc004eeq.2_5'UTR	NM_021998	NP_068838	Q9Y462	ZN711_HUMAN	zinc finger protein 711						positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding|sequence-specific DNA binding|zinc ion binding			ovary(3)|skin(1)	4						CAGATATTGGTGAATGAACTTTGC	0.348													132	24	---	---	---	---	
Unknown	0	broad.mit.edu	37	M	12417	12418	+	RNA	INS	-	A	A			TCGA-CF-A1HS-01A-11D-A13W-08	TCGA-CF-A1HS-10A-01D-A13W-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrM:12417_12418insA	uc004cox.3	+	1		c.81_82insA			uc004coy.2_5'Flank					Homo sapiens NADH dehydrogenase subunit 5 (MTND5) mRNA, RNA 5, complete cds; mitochondrial gene for mitochondrial product.																		GTTAACCCTAACAAAAAAAACT	0.416													88	26	---	---	---	---	
