Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	filter
GNB1	2782	broad.mit.edu	37	1	1756837	1756837	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:1756837C>A	uc001aif.2	-	3	388	c.56G>T	c.(55-57)CGA>CTA	p.R19L	GNB1_uc009vky.2_5'UTR	NM_002074	NP_002065	P62873	GBB1_HUMAN	guanine nucleotide-binding protein, beta-1	19					cellular response to glucagon stimulus|energy reserve metabolic process|muscarinic acetylcholine receptor signaling pathway|platelet activation|Ras protein signal transduction|synaptic transmission	heterotrimeric G-protein complex	GTPase activity|GTPase binding|signal transducer activity				0	all_cancers(77;0.000708)|all_epithelial(69;0.000943)|all_lung(157;0.00963)|Lung NSC(156;0.0232)|Ovarian(185;0.0634)	all_epithelial(116;5.62e-19)|all_lung(118;2.3e-08)|Lung NSC(185;2.38e-06)|Renal(390;0.00183)|Breast(487;0.00354)|Hepatocellular(190;0.00826)|Myeloproliferative disorder(586;0.0122)|Ovarian(437;0.0308)|Medulloblastoma(700;0.123)|Lung SC(97;0.128)		Epithelial(90;1.14e-35)|OV - Ovarian serous cystadenocarcinoma(86;7.31e-23)|GBM - Glioblastoma multiforme(42;3.1e-07)|COAD - Colon adenocarcinoma(227;0.000323)|Colorectal(212;0.000374)|Kidney(185;0.00392)|BRCA - Breast invasive adenocarcinoma(365;0.00573)|STAD - Stomach adenocarcinoma(132;0.0072)|KIRC - Kidney renal clear cell carcinoma(229;0.0482)|Lung(427;0.236)		ACTACATACTCGAATCTGGTT	0.403													12	250	---	---	---	---	PASS
PER3	8863	broad.mit.edu	37	1	7887545	7887545	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:7887545G>T	uc001aoo.2	+	17	2707	c.2532G>T	c.(2530-2532)TTG>TTT	p.L844F	PER3_uc009vmg.1_Missense_Mutation_p.L852F|PER3_uc009vmh.1_Missense_Mutation_p.L845F|PER3_uc001aop.2_Missense_Mutation_p.L852F|PER3_uc010nzw.1_Missense_Mutation_p.L533F	NM_016831	NP_058515	P56645	PER3_HUMAN	period 3	844	Pro-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	signal transducer activity			ovary(1)|pancreas(1)|skin(1)	3	Ovarian(185;0.0634)|all_lung(157;0.178)	all_epithelial(116;9.35e-21)|all_lung(118;7.57e-07)|Lung NSC(185;4.52e-06)|Renal(390;0.000147)|Breast(487;0.00086)|Colorectal(325;0.000959)|Hepatocellular(190;0.00825)|Ovarian(437;0.0253)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0234)|all cancers(8;8.58e-70)|GBM - Glioblastoma multiforme(8;1.81e-35)|Colorectal(212;2.06e-07)|COAD - Colon adenocarcinoma(227;1.92e-05)|Kidney(185;7.18e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000472)|STAD - Stomach adenocarcinoma(132;0.00118)|KIRC - Kidney renal clear cell carcinoma(229;0.00122)|READ - Rectum adenocarcinoma(331;0.0649)		TTCCTTACTTGGATACTTTTA	0.567													7	115	---	---	---	---	PASS
MTOR	2475	broad.mit.edu	37	1	11217271	11217271	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:11217271G>T	uc001asd.2	-	30	4528	c.4407C>A	c.(4405-4407)ACC>ACA	p.T1469T		NM_004958	NP_004949	P42345	MTOR_HUMAN	FK506 binding protein 12-rapamycin associated	1469	FAT.				cell growth|cellular response to hypoxia|insulin receptor signaling pathway|nerve growth factor receptor signaling pathway|peptidyl-serine phosphorylation|phosphatidylinositol-mediated signaling|protein autophosphorylation|protein catabolic process|response to amino acid stimulus|response to nutrient|T cell costimulation|TOR signaling cascade	endoplasmic reticulum membrane|Golgi membrane|lysosome|mitochondrial outer membrane|phosphatidylinositol 3-kinase complex|PML body|TORC1 complex|TORC2 complex	ATP binding|phosphoprotein binding|protein serine/threonine kinase activity			central_nervous_system(7)|lung(6)|ovary(6)|skin(3)|kidney(3)|large_intestine(2)|breast(2)	29						CGTCCTTGTTGGTGTCCATTT	0.542													6	61	---	---	---	---	PASS
PRAMEF1	65121	broad.mit.edu	37	1	12854104	12854104	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:12854104G>T	uc001auj.1	+	3	431	c.328G>T	c.(328-330)GAG>TAG	p.E110*		NM_023013	NP_075389	O95521	PRAM1_HUMAN	PRAME family member 1	110											0	Ovarian(185;0.249)	Renal(390;0.000469)|Lung NSC(185;0.00143)|all_lung(284;0.00181)|Colorectal(325;0.00215)|Breast(348;0.0042)|Myeloproliferative disorder(586;0.0393)|Hepatocellular(190;0.0623)|Ovarian(437;0.0731)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00812)|Colorectal(212;4.88e-06)|Kidney(185;4.89e-05)|KIRC - Kidney renal clear cell carcinoma(229;0.000194)|COAD - Colon adenocarcinoma(227;0.000241)|BRCA - Breast invasive adenocarcinoma(304;0.000293)|STAD - Stomach adenocarcinoma(313;0.0072)|READ - Rectum adenocarcinoma(331;0.0649)		GGATGTTGACGAGAATTTCTG	0.532													7	171	---	---	---	---	PASS
NBPF1	55672	broad.mit.edu	37	1	16893674	16893674	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16893674C>A	uc009vos.1	-	26	3952	c.3064G>T	c.(3064-3066)GGA>TGA	p.G1022*	NBPF1_uc009vot.1_Nonsense_Mutation_p.E405*|NBPF1_uc001ayz.1_Nonsense_Mutation_p.E405*|NBPF1_uc010oce.1_3'UTR	NM_017940	NP_060410	Q3BBV0	NBPF1_HUMAN	hypothetical protein LOC55672	1022	NBPF 6.					cytoplasm					0				UCEC - Uterine corpus endometrioid carcinoma (279;0.00459)|BRCA - Breast invasive adenocarcinoma(304;7.52e-06)|COAD - Colon adenocarcinoma(227;1.05e-05)|Kidney(64;0.00016)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.179)		AGGTACTCACCATCCATGTCA	0.463													16	743	---	---	---	---	PASS
UBR4	23352	broad.mit.edu	37	1	19408050	19408050	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:19408050C>A	uc001bbi.2	-	103	15030	c.15026G>T	c.(15025-15027)CGA>CTA	p.R5009L	UBR4_uc001bbf.2_5'UTR|UBR4_uc010ocv.1_Missense_Mutation_p.R532L|UBR4_uc009vph.2_Missense_Mutation_p.R643L|UBR4_uc010ocw.1_Missense_Mutation_p.R673L|UBR4_uc001bbg.2_Missense_Mutation_p.R720L|UBR4_uc001bbh.2_Missense_Mutation_p.R718L	NM_020765	NP_065816	Q5T4S7	UBR4_HUMAN	retinoblastoma-associated factor 600	5009					interspecies interaction between organisms	cytoplasm|cytoskeleton|integral to membrane|nucleus	calmodulin binding|ubiquitin-protein ligase activity|zinc ion binding			kidney(10)|ovary(7)|breast(4)|pancreas(2)|skin(2)	25		Colorectal(325;3.46e-05)|Renal(390;0.000147)|all_lung(284;0.000328)|Lung NSC(340;0.000406)|Breast(348;0.000814)|Ovarian(437;0.00774)|Myeloproliferative disorder(586;0.0256)		UCEC - Uterine corpus endometrioid carcinoma (279;0.00674)|BRCA - Breast invasive adenocarcinoma(304;5.43e-05)|Kidney(64;0.000337)|KIRC - Kidney renal clear cell carcinoma(64;0.00426)|STAD - Stomach adenocarcinoma(196;0.00715)|READ - Rectum adenocarcinoma(331;0.0816)		CTTCTCTTCTCGGGAAGTTGC	0.507													5	77	---	---	---	---	PASS
PLA2G2E	30814	broad.mit.edu	37	1	20249204	20249204	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:20249204C>A	uc001bct.1	-	2	143	c.85G>T	c.(85-87)GAG>TAG	p.E29*		NM_014589	NP_055404	Q9NZK7	PA2GE_HUMAN	phospholipase A2, group IIE precursor	29					inflammatory response|lipid catabolic process|phospholipid metabolic process	extracellular region	calcium ion binding|phospholipase A2 activity				0		Colorectal(325;0.000147)|Renal(390;0.000469)|all_lung(284;0.00459)|Lung NSC(340;0.00475)|Breast(348;0.00526)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0427)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0178)|COAD - Colon adenocarcinoma(152;1.07e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000133)|GBM - Glioblastoma multiforme(114;0.000146)|Kidney(64;0.000163)|KIRC - Kidney renal clear cell carcinoma(64;0.00258)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)		GTCATCTTCTCGATCATCACC	0.522													4	30	---	---	---	---	PASS
EIF4G3	8672	broad.mit.edu	37	1	21177916	21177916	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:21177916G>T	uc001bec.2	-	23	3695	c.3439C>A	c.(3439-3441)CGG>AGG	p.R1147R	EIF4G3_uc010odi.1_Silent_p.R751R|EIF4G3_uc010odj.1_Silent_p.R1146R|EIF4G3_uc009vpz.2_Silent_p.R867R|EIF4G3_uc001bed.2_Silent_p.R1147R|EIF4G3_uc001bef.2_Silent_p.R1183R|EIF4G3_uc001bee.2_Silent_p.R1153R	NM_003760	NP_003751	O43432	IF4G3_HUMAN	eukaryotic translation initiation factor 4	1147					interspecies interaction between organisms|regulation of translational initiation|RNA metabolic process	eukaryotic translation initiation factor 4F complex	protein binding|RNA cap binding|translation initiation factor activity			skin(1)	1		all_lung(284;2.61e-06)|Lung NSC(340;2.81e-06)|Colorectal(325;3.46e-05)|Renal(390;9.67e-05)|Breast(348;0.00149)|Ovarian(437;0.00338)|Myeloproliferative disorder(586;0.0256)		UCEC - Uterine corpus endometrioid carcinoma (279;0.023)|COAD - Colon adenocarcinoma(152;5.42e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000327)|GBM - Glioblastoma multiforme(114;0.000696)|Kidney(64;0.0018)|STAD - Stomach adenocarcinoma(196;0.00644)|KIRC - Kidney renal clear cell carcinoma(64;0.0185)|READ - Rectum adenocarcinoma(331;0.124)|Lung(427;0.191)		GTATTTGGCCGAGCTGTTGCA	0.488													5	56	---	---	---	---	PASS
SEPN1	57190	broad.mit.edu	37	1	26142090	26142090	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:26142090G>T	uc010oer.1	+	16	1709	c.1654G>T	c.(1654-1656)GAG>TAG	p.E552*	SEPN1_uc010oes.1_Nonsense_Mutation_p.E518*	NM_020451	NP_065184	Q9NZV5	SELN_HUMAN	selenoprotein N, 1 isoform 1 precursor	552						endoplasmic reticulum membrane|extracellular region	protein binding			ovary(2)	2		Colorectal(325;3.46e-05)|Lung NSC(340;0.00038)|all_lung(284;0.00051)|Renal(390;0.0007)|Ovarian(437;0.00473)|Breast(348;0.0155)|Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0505)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0421)|OV - Ovarian serous cystadenocarcinoma(117;1.26e-25)|Colorectal(126;3.01e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.000751)|BRCA - Breast invasive adenocarcinoma(304;0.00099)|STAD - Stomach adenocarcinoma(196;0.00151)|GBM - Glioblastoma multiforme(114;0.0143)|READ - Rectum adenocarcinoma(331;0.0649)		CGTGAAGCCCGAGGAAATCGA	0.602													5	72	---	---	---	---	PASS
PTAFR	5724	broad.mit.edu	37	1	28476668	28476668	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:28476668C>G	uc001bpl.2	-	2	992	c.865G>C	c.(865-867)GAC>CAC	p.D289H	PTAFR_uc001bpm.3_Missense_Mutation_p.D289H|PTAFR_uc009vte.2_Missense_Mutation_p.D289H	NM_000952	NP_000943	P25105	PTAFR_HUMAN	platelet-activating factor receptor	289	Helical; Name=7; (Potential).				chemotaxis|inflammatory response|interferon-gamma-mediated signaling pathway|phosphatidylinositol-mediated signaling	integral to plasma membrane|nucleus	phospholipid binding|platelet activating factor receptor activity				0		Colorectal(325;0.000147)|Renal(390;0.00357)|Lung NSC(340;0.00715)|all_lung(284;0.00732)|Breast(348;0.0174)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0545)|all_neural(195;0.0557)		UCEC - Uterine corpus endometrioid carcinoma (279;0.215)|OV - Ovarian serous cystadenocarcinoma(117;6e-22)|Colorectal(126;3.04e-08)|COAD - Colon adenocarcinoma(152;1.7e-06)|KIRC - Kidney renal clear cell carcinoma(1967;0.00279)|BRCA - Breast invasive adenocarcinoma(304;0.00595)|STAD - Stomach adenocarcinoma(196;0.00678)|READ - Rectum adenocarcinoma(331;0.0649)		ATAACAGGGTCTAAGACACAG	0.537													5	18	---	---	---	---	PASS
LAPTM5	7805	broad.mit.edu	37	1	31208107	31208107	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:31208107G>T	uc001bsc.2	-	7	703	c.612C>A	c.(610-612)TAC>TAA	p.Y204*		NM_006762	NP_006753	Q13571	LAPM5_HUMAN	lysosomal protein transmembrane 5	204	Helical; (Potential).				transport	integral to plasma membrane|lysosomal membrane					0		Colorectal(325;0.0199)|Myeloproliferative disorder(586;0.0393)|all_neural(195;0.0966)|Medulloblastoma(700;0.151)|Ovarian(437;0.192)		STAD - Stomach adenocarcinoma(196;0.0196)|READ - Rectum adenocarcinoma(331;0.0649)		ACTTGAACATGTAGACCTGGA	0.552													5	67	---	---	---	---	PASS
AK2	204	broad.mit.edu	37	1	33480161	33480161	+	Nonsense_Mutation	SNP	C	A	A	rs148421308	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:33480161C>A	uc001bwp.1	-	5	502	c.460G>T	c.(460-462)GAG>TAG	p.E154*	uc001bwn.2_Intron|AK2_uc001bwo.1_Nonsense_Mutation_p.E154*|AK2_uc010ohq.1_Nonsense_Mutation_p.E146*|AK2_uc009vud.1_Nonsense_Mutation_p.E112*|AK2_uc010ohr.1_Nonsense_Mutation_p.E106*|AK2_uc001bwq.1_Nonsense_Mutation_p.E106*	NM_001625	NP_001616	P54819	KAD2_HUMAN	adenylate kinase 2 isoform a	154					nucleobase, nucleoside and nucleotide interconversion	mitochondrial intermembrane space	adenylate kinase activity|ATP binding				0		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0837)				TTGAACTCCTCGTGGTAGGAA	0.383													7	197	---	---	---	---	PASS
ZMYM4	9202	broad.mit.edu	37	1	35879662	35879662	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:35879662G>T	uc001byt.2	+	27	4118	c.4038G>T	c.(4036-4038)TGG>TGT	p.W1346C	ZMYM4_uc009vuu.2_Missense_Mutation_p.W1314C|ZMYM4_uc001byu.2_Missense_Mutation_p.W1022C|ZMYM4_uc009vuv.2_Missense_Mutation_p.W1085C	NM_005095	NP_005086	Q5VZL5	ZMYM4_HUMAN	zinc finger protein 262	1346					multicellular organismal development		DNA binding|zinc ion binding			large_intestine(2)|ovary(1)|kidney(1)|skin(1)	5		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)				TGAAAATATGGGAACCTACAA	0.279													7	74	---	---	---	---	PASS
EIF2C4	192670	broad.mit.edu	37	1	36319095	36319095	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36319095C>A	uc001bzj.1	+							NM_017629	NP_060099	Q9HCK5	AGO4_HUMAN	eukaryotic translation initiation factor 2C, 4						mRNA catabolic process|negative regulation of translation involved in gene silencing by miRNA	cytoplasmic mRNA processing body|cytosol	protein binding|RNA binding			ovary(1)	1		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)				attCTCTTTACAGTGCGGAAG	0.348													4	21	---	---	---	---	PASS
EIF2C1	26523	broad.mit.edu	37	1	36383327	36383327	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:36383327G>T	uc001bzl.2	+	16	2375	c.2162G>T	c.(2161-2163)CGA>CTA	p.R721L	EIF2C1_uc001bzk.2_Missense_Mutation_p.R646L|EIF2C1_uc009vuy.2_RNA	NM_012199	NP_036331	Q9UL18	AGO1_HUMAN	eukaryotic translation initiation factor 2C, 1	721	Piwi.				negative regulation of translation involved in gene silencing by miRNA|nuclear-transcribed mRNA catabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body|cytosol|micro-ribonucleoprotein complex|polysome	protein binding|RNA binding			ovary(2)|skin(1)	3		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.0887)				AAGAATGAGCGAGTGAGTGAG	0.502													6	96	---	---	---	---	PASS
SF3A3	10946	broad.mit.edu	37	1	38453319	38453319	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:38453319C>A	uc001cci.2	-	4	353	c.229G>T	c.(229-231)GGA>TGA	p.G77*	SF3A3_uc010oik.1_Intron	NM_006802	NP_006793	Q12874	SF3A3_HUMAN	splicing factor 3a, subunit 3	77					nuclear mRNA 3'-splice site recognition	catalytic step 2 spliceosome|nuclear speck	nucleic acid binding|protein binding|zinc ion binding				0	Acute lymphoblastic leukemia(166;0.074)|all_hematologic(146;0.197)	Myeloproliferative disorder(586;0.0255)				TCATTGGGTCCTGAAATGGCA	0.403													7	116	---	---	---	---	PASS
MACF1	23499	broad.mit.edu	37	1	39801335	39801335	+	Silent	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:39801335A>G	uc010oiu.1	+	1	4526	c.4395A>G	c.(4393-4395)AAA>AAG	p.K1465K	MACF1_uc010ois.1_Intron|MACF1_uc001cda.1_Intron|MACF1_uc001cdc.1_Intron|MACF1_uc001cdb.1_Intron	NM_033044	NP_149033	Q9UPN3	MACF1_HUMAN	microfilament and actin filament cross-linker	3030					cell cycle arrest|Golgi to plasma membrane protein transport|positive regulation of Wnt receptor signaling pathway|regulation of epithelial cell migration|regulation of focal adhesion assembly|regulation of microtubule-based process|Wnt receptor signaling pathway|wound healing	Golgi apparatus|microtubule|ruffle membrane	actin filament binding|ATPase activity|calcium ion binding|microtubule binding			ovary(8)|breast(3)|central_nervous_system(3)|skin(2)	16	Lung NSC(20;5.57e-06)|Ovarian(52;0.00769)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;7.78e-19)|Epithelial(16;1.73e-17)|all cancers(16;2.49e-16)|LUSC - Lung squamous cell carcinoma(16;0.00146)|Lung(16;0.00204)			CAAGTGAAAAAGGGAAAGAAG	0.368													3	66	---	---	---	---	PASS
PABPC4	8761	broad.mit.edu	37	1	40035605	40035605	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40035605G>T	uc010oiv.1	-	4	1471	c.573C>A	c.(571-573)ACC>ACA	p.T191T	PABPC4_uc001cdl.2_Silent_p.T191T|PABPC4_uc001cdm.2_Silent_p.T191T|SNORA55_uc001cdo.1_5'Flank	NM_003819	NP_003810	Q13310	PABP4_HUMAN	poly A binding protein, cytoplasmic 4 isoform 2	191	RRM 3.				blood coagulation|RNA catabolic process|RNA processing|translation	cytoplasm|ribonucleoprotein complex	nucleotide binding|poly(A) RNA binding|poly(U) RNA binding|protein binding				0	Lung NSC(20;1.55e-06)|Ovarian(52;0.00769)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;2.89e-18)|Epithelial(16;6.17e-17)|all cancers(16;1.18e-15)|LUSC - Lung squamous cell carcinoma(16;0.000261)|Lung(16;0.000457)			TATAAACATTGGTGAATTCCT	0.423													6	57	---	---	---	---	PASS
ZNF642	339559	broad.mit.edu	37	1	40961342	40961342	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40961342C>A	uc001cfo.2	+	6	1486	c.1192C>A	c.(1192-1194)CTT>ATT	p.L398I	ZNF642_uc009vwb.2_Missense_Mutation_p.L398I|ZNF642_uc010ojk.1_Missense_Mutation_p.L399I	NM_198494	NP_940896	Q49AA0	ZN642_HUMAN	zinc finger protein 642	398	C2H2-type 5.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	Ovarian(52;0.00769)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0255)	OV - Ovarian serous cystadenocarcinoma(33;8.81e-19)			GATTAGACACCTTAGTGAACA	0.408													5	34	---	---	---	---	PASS
WDR65	149465	broad.mit.edu	37	1	43649507	43649507	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:43649507C>A	uc001cip.1	+	4	841	c.720C>A	c.(718-720)ACC>ACA	p.T240T	EBNA1BP2_uc001cio.2_Intron|WDR65_uc010ojz.1_Silent_p.T229T|WDR65_uc001ciq.1_Silent_p.T240T	NM_152498	NP_689711	Q96MR6	WDR65_HUMAN	WD repeat domain 65	240										skin(1)	1	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0505)				AGGAACCTACCAATGGCTCAA	0.483													5	74	---	---	---	---	PASS
DPH2	1802	broad.mit.edu	37	1	44437066	44437066	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:44437066G>T	uc001ckz.2	+	4	687	c.492G>T	c.(490-492)TTG>TTT	p.L164F	DPH2_uc001cla.2_Intron|DPH2_uc010okk.1_Missense_Mutation_p.L29F|DPH2_uc001clb.2_Missense_Mutation_p.L88F	NM_001384	NP_001375	Q9BQC3	DPH2_HUMAN	diphthamide biosynthesis protein 2 isoform a	164					peptidyl-diphthamide biosynthetic process from peptidyl-histidine	cytoplasm				ovary(1)	1	Acute lymphoblastic leukemia(166;0.155)	Myeloproliferative disorder(586;0.0511)				CAGAGGCTTTGGCTACTCTCC	0.587													5	18	---	---	---	---	PASS
FOXD2	2306	broad.mit.edu	37	1	47904255	47904255	+	Silent	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:47904255T>C	uc001crm.2	+	1	2567	c.448T>C	c.(448-450)TTG>CTG	p.L150L		NM_004474	NP_004465	O60548	FOXD2_HUMAN	forkhead box D2	150	Fork-head.				axon extension involved in axon guidance|cartilage development|dichotomous subdivision of terminal units involved in ureteric bud branching|embryo development|enteric nervous system development|iridophore differentiation|lateral line nerve glial cell development|melanocyte differentiation|neural crest cell migration|pattern specification process|peripheral nervous system development|positive regulation of BMP signaling pathway|positive regulation of kidney development|positive regulation of transcription from RNA polymerase II promoter|regulation of sequence-specific DNA binding transcription factor activity|sympathetic nervous system development	transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding				0				READ - Rectum adenocarcinoma(2;0.0908)		GCGGCTGACGTTGAGCGAGAT	0.582													6	21	---	---	---	---	PASS
PRKAA2	5563	broad.mit.edu	37	1	57170117	57170117	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:57170117G>T	uc001cyk.3	+	7	1333	c.1262G>T	c.(1261-1263)CGA>CTA	p.R421L		NM_006252	NP_006243	P54646	AAPK2_HUMAN	AMP-activated protein kinase alpha 2 catalytic	421					carnitine shuttle|cell cycle arrest|cholesterol biosynthetic process|energy reserve metabolic process|fatty acid biosynthetic process|insulin receptor signaling pathway|regulation of fatty acid biosynthetic process|regulation of fatty acid oxidation	cytosol|nucleoplasm	ATP binding|metal ion binding			breast(4)|ovary(1)|stomach(1)	6						GAAGTTTACCGAGCTATGAAG	0.378													5	82	---	---	---	---	PASS
MSH4	4438	broad.mit.edu	37	1	76363685	76363685	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:76363685G>A	uc001dhd.1	+	18	2490	c.2449G>A	c.(2449-2451)GTA>ATA	p.V817I		NM_002440	NP_002431	O15457	MSH4_HUMAN	mutS homolog 4	817					chiasma assembly|homologous chromosome segregation|mismatch repair|reciprocal meiotic recombination	synaptonemal complex	ATP binding|DNA-dependent ATPase activity|mismatched DNA binding			lung(3)|ovary(2)	5						AGTTCAACATGTAAAGAATAC	0.333								MMR					21	82	---	---	---	---	PASS
FUBP1	8880	broad.mit.edu	37	1	78414917	78414917	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:78414917C>A	uc001dii.2	-	19	1938	c.1849G>T	c.(1849-1851)GAG>TAG	p.E617*	FUBP1_uc001dih.3_RNA|FUBP1_uc010orm.1_Nonsense_Mutation_p.E638*	NM_003902	NP_003893	Q96AE4	FUBP1_HUMAN	far upstream element-binding protein	617					transcription from RNA polymerase II promoter	nucleus	protein binding|RNA binding|sequence-specific DNA binding transcription factor activity|single-stranded DNA binding			central_nervous_system(2)|lung(1)	3						CTATAATACTCAGCCCAGGCT	0.483													6	51	---	---	---	---	PASS
ELTD1	64123	broad.mit.edu	37	1	79383618	79383618	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:79383618C>A	uc001diq.3	-	11	1735	c.1579G>T	c.(1579-1581)GGA>TGA	p.G527*		NM_022159	NP_071442	Q9HBW9	ELTD1_HUMAN	EGF, latrophilin and seven transmembrane domain	527	Cytoplasmic (Potential).				neuropeptide signaling pathway	integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(1)|skin(1)	2				COAD - Colon adenocarcinoma(225;0.0905)|Colorectal(170;0.103)|all cancers(265;0.105)|Epithelial(280;0.148)		TGCAAAAATCCCTTGTTGTAG	0.418													7	123	---	---	---	---	PASS
LPHN2	23266	broad.mit.edu	37	1	82409087	82409087	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:82409087G>A	uc001dit.3	+	6	1013	c.832G>A	c.(832-834)GCC>ACC	p.A278T	LPHN2_uc001dis.2_Intron|LPHN2_uc001diu.2_Missense_Mutation_p.A278T|LPHN2_uc001div.2_Missense_Mutation_p.A278T|LPHN2_uc009wcd.2_Missense_Mutation_p.A278T	NM_012302	NP_036434	O95490	LPHN2_HUMAN	latrophilin 2 precursor	278	Extracellular (Potential).|Olfactomedin-like.				neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity|latrotoxin receptor activity|sugar binding	p.A278P(2)		ovary(3)|lung(3)|breast(2)|central_nervous_system(1)	9				all cancers(265;0.00142)|Epithelial(280;0.00829)|OV - Ovarian serous cystadenocarcinoma(397;0.077)|STAD - Stomach adenocarcinoma(256;0.248)		GGTCATTTACGCCACTGAACA	0.428													11	38	---	---	---	---	PASS
SSX2IP	117178	broad.mit.edu	37	1	85127909	85127909	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:85127909C>A	uc001dkh.2	-	9	1174	c.899G>T	c.(898-900)AGA>ATA	p.R300I	SSX2IP_uc001dkf.2_Missense_Mutation_p.R273I|SSX2IP_uc001dkg.2_RNA|SSX2IP_uc010orz.1_Missense_Mutation_p.R273I|SSX2IP_uc001dki.2_Missense_Mutation_p.R300I|SSX2IP_uc010osa.1_Missense_Mutation_p.R273I|SSX2IP_uc001dkj.2_Missense_Mutation_p.R300I|SSX2IP_uc009wci.2_Intron|SSX2IP_uc001dkk.1_Missense_Mutation_p.R296I	NM_014021	NP_054740	Q9Y2D8	ADIP_HUMAN	synovial sarcoma, X breakpoint 2 interacting	300					cell adhesion	nucleus|protein complex				ovary(2)	2				all cancers(265;0.0053)|Epithelial(280;0.0214)|OV - Ovarian serous cystadenocarcinoma(397;0.173)		TACTCTTTCTCTAGGTTTCTT	0.338													9	172	---	---	---	---	PASS
CLCA2	9635	broad.mit.edu	37	1	86900260	86900260	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:86900260G>C	uc001dlr.3	+	6	966	c.804G>C	c.(802-804)CAG>CAC	p.Q268H		NM_006536	NP_006527	Q9UQC9	CLCA2_HUMAN	chloride channel accessory 2 precursor	268	Extracellular (Potential).				cell adhesion	basal plasma membrane|cell junction|extracellular region|integral to plasma membrane	chloride channel activity			ovary(1)|breast(1)|skin(1)	3		Lung NSC(277;0.238)		all cancers(265;0.0233)|Epithelial(280;0.0452)		TACAGAACCAGATGTGCAGCC	0.453													10	49	---	---	---	---	PASS
CLCA4	22802	broad.mit.edu	37	1	87031604	87031604	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:87031604C>A	uc009wcs.2	+	6	899	c.855C>A	c.(853-855)ACC>ACA	p.T285T	CLCA4_uc009wct.2_Silent_p.T48T|CLCA4_uc009wcu.2_Silent_p.T105T	NM_012128	NP_036260	Q14CN2	CLCA4_HUMAN	chloride channel accessory 4	285						apical plasma membrane|extracellular region|integral to plasma membrane	chloride channel activity			ovary(2)	2		Lung NSC(277;0.238)		all cancers(265;0.0202)|Epithelial(280;0.0404)		TTAAAAACACCATACCCATGG	0.408													8	97	---	---	---	---	PASS
LRRC8B	23507	broad.mit.edu	37	1	90048540	90048540	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:90048540G>T	uc001dni.2	+	7	838	c.331G>T	c.(331-333)GAG>TAG	p.E111*	LRRC8B_uc001dnh.2_Nonsense_Mutation_p.E111*|LRRC8B_uc001dnj.2_Nonsense_Mutation_p.E111*	NM_001134476	NP_001127948	Q6P9F7	LRC8B_HUMAN	leucine rich repeat containing 8 family, member	111						integral to membrane				ovary(2)	2		all_lung(203;0.17)		all cancers(265;0.00515)|Epithelial(280;0.0241)		CGTCTGTTACGAGAAACAGCT	0.512													7	90	---	---	---	---	PASS
ZNF644	84146	broad.mit.edu	37	1	91406192	91406192	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:91406192G>T	uc001dnw.2	-	3	861	c.719C>A	c.(718-720)ACA>AAA	p.T240K	ZNF644_uc001dnv.2_Intron|ZNF644_uc001dnx.2_Intron|ZNF644_uc001dny.1_Missense_Mutation_p.T240K	NM_201269	NP_958357	Q9H582	ZN644_HUMAN	zinc finger protein 644 isoform 1	240					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|breast(1)|skin(1)	3		all_lung(203;0.00206)|Lung NSC(277;0.0519)|Lung SC(238;0.101)		all cancers(265;0.00102)|Epithelial(280;0.00766)|KIRC - Kidney renal clear cell carcinoma(1967;0.147)|OV - Ovarian serous cystadenocarcinoma(397;0.173)		TCCCGTTACTGTATTGACACA	0.368													6	79	---	---	---	---	PASS
BTBD8	284697	broad.mit.edu	37	1	92546225	92546225	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:92546225C>A	uc001doo.2	+	1	364	c.97C>A	c.(97-99)CGG>AGG	p.R33R	BTBD8_uc010otc.1_RNA	NM_183242	NP_899065	Q5XKL5	BTBD8_HUMAN	BTB (POZ) domain containing 8	33						nucleus				ovary(1)	1		all_lung(203;0.0484)|Lung NSC(277;0.126)|Glioma(108;0.222)		all cancers(265;0.0153)|Epithelial(280;0.0982)		GCCGTGTGAGCGGCGCCGGCT	0.627													4	16	---	---	---	---	PASS
RPL5	6125	broad.mit.edu	37	1	93303026	93303026	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:93303026C>A	uc001doz.2	+	6	619	c.541C>A	c.(541-543)CCT>ACT	p.P181T	FAM69A_uc001dpc.2_Intron|RPL5_uc001dpa.2_RNA|RPL5_uc001dpb.2_Missense_Mutation_p.P131T|RPL5_uc001dpd.2_5'UTR	NM_000969	NP_000960	P46777	RL5_HUMAN	ribosomal protein L5	181					endocrine pancreas development|ribosomal large subunit biogenesis|rRNA processing|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit|nucleolus	5S rRNA binding|protein binding|structural constituent of ribosome				0		all_lung(203;0.00265)|Lung NSC(277;0.0056)|all_neural(321;0.185)|Melanoma(281;0.192)|Glioma(108;0.203)		GBM - Glioblastoma multiforme(16;0.000305)|all cancers(265;0.000343)|Epithelial(280;0.0927)		CAAACGATTCCCTGGTTATGA	0.358													5	37	---	---	---	---	PASS
CCDC18	343099	broad.mit.edu	37	1	93705398	93705398	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:93705398C>A	uc001dpq.2	+	21	3448	c.3280C>A	c.(3280-3282)CAA>AAA	p.Q1094K	CCDC18_uc009wdl.1_Missense_Mutation_p.Q611K	NM_206886	NP_996769	Q5T9S5	CCD18_HUMAN	sarcoma antigen NY-SAR-41	975	Potential.									ovary(2)|breast(2)|pancreas(1)	5		all_lung(203;0.00196)|Lung NSC(277;0.00903)|Melanoma(281;0.099)|all_neural(321;0.185)|Glioma(108;0.203)		all cancers(265;0.00166)|GBM - Glioblastoma multiforme(16;0.00551)|Epithelial(280;0.0967)		ACAGAAGGCTCAATTATCATT	0.333													6	53	---	---	---	---	PASS
GCLM	2730	broad.mit.edu	37	1	94367168	94367168	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:94367168C>A	uc001dqg.1	-	3	543	c.250G>T	c.(250-252)GAT>TAT	p.D84Y		NM_002061	NP_002052	P48507	GSH0_HUMAN	glutamate-cysteine ligase regulatory protein	84					glutamate metabolic process|glutathione biosynthetic process|regulation of blood vessel size|response to drug|response to oxidative stress|xenobiotic metabolic process	cytosol|soluble fraction	glutamate-cysteine ligase catalytic subunit binding			ovary(1)	1		all_lung(203;0.000815)|Lung NSC(277;0.00363)		all cancers(265;0.00566)|GBM - Glioblastoma multiforme(16;0.0203)|Epithelial(280;0.131)	L-Cysteine(DB00151)|L-Glutamic Acid(DB00142)	TCTCTTTCATCAGGATTTATC	0.303													27	95	---	---	---	---	PASS
SLC30A7	148867	broad.mit.edu	37	1	101377733	101377733	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:101377733G>T	uc001dtn.2	+	5	637	c.450G>T	c.(448-450)GTG>GTT	p.V150V	SLC30A7_uc001dto.2_Silent_p.V150V	NM_001144884	NP_001138356	Q8NEW0	ZNT7_HUMAN	zinc transporter like 2	150	Helical; (Potential).				zinc ion transport	Golgi apparatus|integral to membrane	cation transmembrane transporter activity|protein binding				0		all_epithelial(167;0.000445)|all_lung(203;0.00645)|Lung NSC(277;0.0119)		Epithelial(280;0.0437)|all cancers(265;0.0498)|COAD - Colon adenocarcinoma(174;0.162)|Colorectal(144;0.19)|Lung(183;0.201)		TTGGGTTTGTGGTAAACCTAA	0.383													8	190	---	---	---	---	PASS
COL11A1	1301	broad.mit.edu	37	1	103483389	103483389	+	Missense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:103483389T>A	uc001dul.2	-	11	1718	c.1400A>T	c.(1399-1401)GAC>GTC	p.D467V	COL11A1_uc001duk.2_5'UTR|COL11A1_uc001dum.2_Missense_Mutation_p.D479V|COL11A1_uc001dun.2_Missense_Mutation_p.D428V|COL11A1_uc009weh.2_Missense_Mutation_p.D351V	NM_001854	NP_001845	P12107	COBA1_HUMAN	alpha 1 type XI collagen isoform A	467	Triple-helical region (interrupted).				collagen fibril organization|detection of mechanical stimulus involved in sensory perception of sound|visual perception	collagen type XI	extracellular matrix binding|extracellular matrix structural constituent|protein binding, bridging			ovary(6)|breast(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|pancreas(1)	12		all_epithelial(167;2.52e-07)|all_lung(203;3.11e-05)|Lung NSC(277;6.61e-05)|Breast(1374;0.181)		Lung(183;0.186)|all cancers(265;0.242)|Epithelial(280;0.248)		ATCGCCAGGGTCACCAGGGGG	0.378													18	53	---	---	---	---	PASS
AMY2B	280	broad.mit.edu	37	1	104118116	104118116	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:104118116G>T	uc001duq.2	+	9	1671	c.1055G>T	c.(1054-1056)CGA>CTA	p.R352L	AMY2B_uc010ouo.1_RNA|LOC648740_uc001dur.2_Missense_Mutation_p.R352L|AMY2B_uc001dus.1_RNA	NM_020978	NP_066188	P19961	AMY2B_HUMAN	amylase, pancreatic, alpha-2B precursor	352		Chloride (By similarity).			carbohydrate metabolic process|digestion	extracellular region	alpha-amylase activity|metal ion binding				0		all_epithelial(167;3.05e-05)|all_lung(203;0.000199)|Lung NSC(277;0.000451)		Colorectal(144;0.0669)|all cancers(265;0.083)|Epithelial(280;0.094)|Lung(183;0.112)		GGTTTTACACGAGTAATGTCA	0.333													7	268	---	---	---	---	PASS
MOV10	4343	broad.mit.edu	37	1	113231656	113231656	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:113231656C>A	uc001eck.2	+	3	507	c.237C>A	c.(235-237)CTC>CTA	p.L79L	MOV10_uc001ecl.2_Silent_p.L79L|MOV10_uc001ecn.2_Silent_p.L79L|MOV10_uc001ecm.2_Silent_p.L19L|MOV10_uc009wgj.1_Silent_p.L19L	NM_001130079	NP_001123551	Q9HCE1	MOV10_HUMAN	Mov10, Moloney leukemia virus 10, homolog	79					mRNA cleavage involved in gene silencing by miRNA|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasmic mRNA processing body	ATP binding|helicase activity|protein binding|RNA binding			ovary(4)|skin(1)	5	Lung SC(450;0.246)	all_cancers(81;3.31e-11)|all_epithelial(167;5.69e-10)|all_lung(203;3.73e-05)|Breast(1374;0.000525)|Lung NSC(69;0.000954)|Ovarian(761;0.0367)|Lung SC(238;0.114)		OV - Ovarian serous cystadenocarcinoma(397;3.99e-67)|all cancers(265;1e-62)|Epithelial(280;4.78e-61)|Lung(183;0.0234)|Colorectal(144;0.0686)|READ - Rectum adenocarcinoma(129;0.0929)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)|BRCA - Breast invasive adenocarcinoma(282;0.24)		TCTTCAGACTCGACCGCTGGG	0.537													5	58	---	---	---	---	PASS
NRAS	4893	broad.mit.edu	37	1	115256591	115256591	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:115256591G>T	uc009wgu.2	-	3	374	c.120C>A	c.(118-120)TAC>TAA	p.Y40*		NM_002524	NP_002515	P01111	RASN_HUMAN	neuroblastoma RAS viral (v-ras) oncogene homolog	40	Effector region.				activation of MAPKK activity|axon guidance|blood coagulation|epidermal growth factor receptor signaling pathway|insulin receptor signaling pathway|leukocyte migration|nerve growth factor receptor signaling pathway|Ras protein signal transduction	Golgi membrane|plasma membrane	GTP binding|GTPase activity			haematopoietic_and_lymphoid_tissue(1008)|skin(956)|thyroid(334)|large_intestine(62)|NS(60)|soft_tissue(32)|lung(31)|upper_aerodigestive_tract(25)|urinary_tract(12)|liver(10)|adrenal_gland(9)|autonomic_ganglia(8)|testis(8)|central_nervous_system(8)|prostate(8)|breast(7)|biliary_tract(6)|ovary(6)|stomach(5)|pancreas(5)|endometrium(2)|kidney(2)|cervix(2)|eye(1)	2607	all_epithelial(7;5.11e-05)|all_lung(7;0.000179)|Lung NSC(6;0.00195)|Lung SC(450;0.211)	all_cancers(81;4.64e-07)|all_epithelial(167;4.2e-07)|all_lung(203;9.97e-06)|Lung NSC(69;1.74e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|COAD - Colon adenocarcinoma(174;0.111)|all cancers(265;0.112)|Epithelial(280;0.124)|LUSC - Lung squamous cell carcinoma(189;0.133)		CTTGTTTTCTGTAAGAATCCT	0.443		50	Mis		melanoma|MM|AML|thyroid				Noonan_syndrome	TSP Lung(23;0.16)|Multiple Myeloma(1;<1E-6)			5	85	---	---	---	---	PASS
TRIM45	80263	broad.mit.edu	37	1	117660706	117660706	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:117660706G>T	uc001egz.2	-	2	1760	c.1172C>A	c.(1171-1173)ACG>AAG	p.T391K	TRIM45_uc009whe.2_Intron|TRIM45_uc001eha.2_Missense_Mutation_p.T287K	NM_025188	NP_079464	Q9H8W5	TRI45_HUMAN	tripartite motif-containing 45 isoform 1	391						cytoplasm|nucleus	zinc ion binding			central_nervous_system(1)	1	Lung SC(450;0.225)	all_cancers(81;0.000979)|all_lung(203;7.65e-05)|all_epithelial(167;0.000134)|Lung NSC(69;0.000389)		Lung(183;0.0537)|Colorectal(144;0.172)|LUSC - Lung squamous cell carcinoma(189;0.187)		GGTATTAATCGTACCATAAAT	0.463													6	110	---	---	---	---	PASS
HSD3B2	3284	broad.mit.edu	37	1	119964870	119964870	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:119964870G>T	uc001ehs.2	+	3	1519	c.746G>T	c.(745-747)CGA>CTA	p.R249L	HSD3B2_uc001eht.2_Missense_Mutation_p.R249L|HSD3B2_uc001ehu.2_Intron	NM_000198	NP_000189	P26439	3BHS2_HUMAN	3 beta-hydroxysteroid dehydrogenase 2	249					androgen biosynthetic process|glucocorticoid biosynthetic process|mineralocorticoid biosynthetic process	integral to membrane|microsome|mitochondrial inner membrane|mitochondrial intermembrane space|smooth endoplasmic reticulum membrane	3-beta-hydroxy-delta5-steroid dehydrogenase activity|binding|steroid delta-isomerase activity			ovary(2)	2	all_neural(166;0.187)	all_lung(203;1.06e-06)|Lung NSC(69;7.5e-06)|all_epithelial(167;0.000284)		Lung(183;0.015)|LUSC - Lung squamous cell carcinoma(189;0.0836)	NADH(DB00157)|Trilostane(DB01108)	CCAAGTGTCCGAGGTCAATTC	0.512													4	38	---	---	---	---	PASS
REG4	83998	broad.mit.edu	37	1	120342482	120342482	+	Nonsense_Mutation	SNP	C	A	A	rs149733140		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:120342482C>A	uc001eig.2	-	5	609	c.169G>T	c.(169-171)GAG>TAG	p.E57*	REG4_uc001eif.2_Nonsense_Mutation_p.E57*	NM_001159352	NP_001152824	Q9BYZ8	REG4_HUMAN	regenerating islet-derived family, member 4	57	C-type lectin.					extracellular region	sugar binding			ovary(1)	1	all_cancers(5;4.81e-10)|all_epithelial(5;7.98e-11)|Melanoma(3;1.93e-05)|Breast(55;0.218)|all_neural(166;0.219)	all_lung(203;8.1e-07)|Lung NSC(69;5.89e-06)|all_epithelial(167;0.000959)		Lung(183;0.011)|LUSC - Lung squamous cell carcinoma(189;0.0588)		GACTGACACTCGAGCTATGTA	0.507													8	89	---	---	---	---	PASS
PDE4DIP	9659	broad.mit.edu	37	1	144857696	144857696	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144857696C>A	uc001elw.3	-	39	6649	c.6358G>T	c.(6358-6360)GGT>TGT	p.G2120C	NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|PDE4DIP_uc001elx.3_Missense_Mutation_p.G2014C|PDE4DIP_uc001elv.3_Missense_Mutation_p.G1127C	NM_014644	NP_055459	Q5VU43	MYOME_HUMAN	phosphodiesterase 4D interacting protein isoform	2120					cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)		GAATTCATACCAACATCCCGG	0.512			T	PDGFRB	MPD								8	142	---	---	---	---	PASS
PDE4DIP	9659	broad.mit.edu	37	1	144931332	144931332	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144931332G>T	uc001elw.3	-						NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|PDE4DIP_uc001elx.3_Intron|PDE4DIP_uc001emc.1_Intron|PDE4DIP_uc001emd.1_Intron|PDE4DIP_uc001emb.1_Missense_Mutation_p.S126Y|PDE4DIP_uc001emf.1_Intron	NM_014644	NP_055459	Q5VU43	MYOME_HUMAN	phosphodiesterase 4D interacting protein isoform						cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)		GAGCAGTGCAGAGTATCTCGC	0.542			T	PDGFRB	MPD								7	104	---	---	---	---	PASS
PDE4DIP	9659	broad.mit.edu	37	1	145015873	145015873	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:145015873C>A	uc001elx.3	-	3	550	c.215G>T	c.(214-216)CGA>CTA	p.R72L	NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elm.3_5'UTR|PDE4DIP_uc001eln.3_Missense_Mutation_p.R72L|PDE4DIP_uc001elo.2_Missense_Mutation_p.R143L|PDE4DIP_uc001emh.2_Missense_Mutation_p.R143L|uc001emj.2_Intron	NM_014644	NP_055459	Q5VU43	MYOME_HUMAN	phosphodiesterase 4D interacting protein isoform	6					cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)		CTCAAAGTCTCGAAGAGCCTG	0.433			T	PDGFRB	MPD								10	595	---	---	---	---	PASS
RPRD2	23248	broad.mit.edu	37	1	150429786	150429786	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150429786G>T	uc009wlr.2	+	8	1094	c.893G>T	c.(892-894)CGA>CTA	p.R298L	RPRD2_uc010pcc.1_Missense_Mutation_p.R272L|RPRD2_uc001eup.3_Missense_Mutation_p.R272L	NM_015203	NP_056018	Q5VT52	RPRD2_HUMAN	Regulation of nuclear pre-mRNA domain containing	298							protein binding			ovary(1)	1						TTTGCTAACCGAGTAAACAAT	0.358													5	73	---	---	---	---	PASS
MCL1	4170	broad.mit.edu	37	1	150550762	150550762	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150550762G>T	uc001euz.2	-	2	1024	c.894C>A	c.(892-894)CTC>CTA	p.L298L	MCL1_uc010pch.1_Silent_p.L188L|MCL1_uc001eva.2_Intron	NM_021960	NP_068779	Q07820	MCL1_HUMAN	myeloid cell leukemia sequence 1 isoform 1	298					anti-apoptosis|apoptosis|cell fate determination|cellular homeostasis|multicellular organismal development|response to cytokine stimulus	integral to membrane|mitochondrial outer membrane|nucleoplasm	BH3 domain binding|protein binding|protein channel activity|protein heterodimerization activity				0	all_cancers(9;1.69e-53)|all_epithelial(9;1.95e-43)|all_lung(15;1.09e-34)|Lung NSC(24;4.04e-31)|Breast(34;0.000326)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Melanoma(130;0.128)|Colorectal(459;0.171)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0241)|Epithelial(6;3.18e-23)|all cancers(9;1.79e-22)|OV - Ovarian serous cystadenocarcinoma(6;1.13e-14)|BRCA - Breast invasive adenocarcinoma(12;0.000503)|LUSC - Lung squamous cell carcinoma(543;0.171)|STAD - Stomach adenocarcinoma(528;0.206)			TTGTCCTTACGAGAACGTCTG	0.428													9	159	---	---	---	---	PASS
CTSK	1513	broad.mit.edu	37	1	150779234	150779234	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:150779234C>A	uc001evp.1	-	2	172	c.48G>T	c.(46-48)CTG>CTT	p.L16L	CTSK_uc001evq.1_5'UTR|CTSK_uc009wma.1_RNA	NM_000396	NP_000387	P43235	CATK_HUMAN	cathepsin K preproprotein	16					proteolysis	lysosome	cysteine-type endopeptidase activity|protein binding			skin(1)	1	all_cancers(9;2.32e-51)|all_epithelial(9;3.89e-42)|all_lung(15;4.59e-35)|Lung NSC(24;1.7e-31)|Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0395)|Hepatocellular(266;0.108)|Colorectal(459;0.171)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0485)|BRCA - Breast invasive adenocarcinoma(12;0.00606)|LUSC - Lung squamous cell carcinoma(543;0.211)			CCTCAGGGTACAGAGCAAAGC	0.532													7	72	---	---	---	---	PASS
MLLT11	10962	broad.mit.edu	37	1	151039902	151039902	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151039902G>T	uc001ewq.2	+	2	1087	c.202G>T	c.(202-204)GAG>TAG	p.E68*		NM_006818	NP_006809	Q13015	AF1Q_HUMAN	MLLT11 protein	68					positive regulation of apoptosis|positive regulation of mitochondrial depolarization|positive regulation of release of cytochrome c from mitochondria|positive regulation of transcription, DNA-dependent						0	Lung SC(34;0.00471)|Ovarian(49;0.0167)|all_hematologic(923;0.0597)|Hepatocellular(266;0.0997)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.0486)|LUSC - Lung squamous cell carcinoma(543;0.211)			TGGCCTCCTTGAGTACAGCAC	0.522													7	97	---	---	---	---	PASS
PSMD4	5710	broad.mit.edu	37	1	151239682	151239682	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:151239682G>T	uc001exl.2	+	10	1059	c.997G>T	c.(997-999)GAG>TAG	p.E333*	PSMD4_uc001exn.2_Nonsense_Mutation_p.E336*	NM_002810	NP_002801	P55036	PSMD4_HUMAN	proteasome 26S non-ATPase subunit 4	333					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA repair|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|regulation of transcription, DNA-dependent|S phase of mitotic cell cycle|viral reproduction	proteasome complex	protein binding|zinc ion binding				0	Lung SC(34;0.00471)|Ovarian(49;0.0147)|Hepatocellular(266;0.0997)|all_hematologic(923;0.127)|Melanoma(130;0.185)		UCEC - Uterine corpus endometrioid carcinoma (35;0.112)|LUSC - Lung squamous cell carcinoma(543;0.181)			GCAGGACCCCGAGTTCCTTCA	0.557													6	94	---	---	---	---	PASS
RPTN	126638	broad.mit.edu	37	1	152127904	152127904	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152127904G>T	uc001ezs.1	-	3	1736	c.1671C>A	c.(1669-1671)TCC>TCA	p.S557S		NM_001122965	NP_001116437	Q6XPR3	RPTN_HUMAN	repetin	557	Gln-rich.					proteinaceous extracellular matrix	calcium ion binding				0						GACCGTAGTGGGAACTCTGGC	0.512													11	323	---	---	---	---	PASS
RPTN	126638	broad.mit.edu	37	1	152128930	152128930	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152128930G>T	uc001ezs.1	-	3	710	c.645C>A	c.(643-645)ACC>ACA	p.T215T		NM_001122965	NP_001116437	Q6XPR3	RPTN_HUMAN	repetin	215	Gln-rich.					proteinaceous extracellular matrix	calcium ion binding				0						CCTGGCCACTGGTAGATTTGT	0.418													8	167	---	---	---	---	PASS
HRNR	388697	broad.mit.edu	37	1	152187072	152187072	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152187072C>A	uc001ezt.1	-	3	7109	c.7033G>T	c.(7033-7035)GAG>TAG	p.E2345*		NM_001009931	NP_001009931	Q86YZ3	HORN_HUMAN	hornerin	2345	25.				keratinization		calcium ion binding|protein binding			skin(2)|ovary(1)	3	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			GAGCTAGACTCGTGGTGACCA	0.567													12	484	---	---	---	---	PASS
FLG	2312	broad.mit.edu	37	1	152276039	152276039	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152276039C>A	uc001ezu.1	-	3	11359	c.11323G>T	c.(11323-11325)GAG>TAG	p.E3775*		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	3775	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			ACCGATTGCTCGTGGTAGGAT	0.597									Ichthyosis				7	173	---	---	---	---	PASS
FLG	2312	broad.mit.edu	37	1	152281424	152281424	+	Missense_Mutation	SNP	G	T	T	rs146743261		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:152281424G>T	uc001ezu.1	-	3	5974	c.5938C>A	c.(5938-5940)CGT>AGT	p.R1980S		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	1980	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			TCTGTGTGACGAGTGCCTGAT	0.572									Ichthyosis				9	353	---	---	---	---	PASS
NUP210L	91181	broad.mit.edu	37	1	154110594	154110594	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:154110594C>T	uc001fdw.2	-	6	910	c.838G>A	c.(838-840)GGG>AGG	p.G280R	NUP210L_uc009woq.2_5'Flank|NUP210L_uc010peh.1_Missense_Mutation_p.G280R	NM_207308	NP_997191	Q5VU65	P210L_HUMAN	nucleoporin 210kDa-like isoform 1	280						integral to membrane				skin(5)|ovary(4)|large_intestine(1)|central_nervous_system(1)	11	all_lung(78;9.35e-31)|Lung NSC(65;1.33e-28)|Hepatocellular(266;0.0877)|Melanoma(130;0.128)		LUSC - Lung squamous cell carcinoma(543;0.151)|Colorectal(543;0.198)			GTCACTCTCCCTTGAACCATT	0.338													19	93	---	---	---	---	PASS
ASH1L	55870	broad.mit.edu	37	1	155449247	155449247	+	Silent	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:155449247T>C	uc009wqq.2	-	3	3894	c.3414A>G	c.(3412-3414)TTA>TTG	p.L1138L	ASH1L_uc001fkt.2_Silent_p.L1138L|ASH1L_uc009wqr.1_Silent_p.L1138L	NM_018489	NP_060959	Q9NR48	ASH1L_HUMAN	absent, small, or homeotic 1-like	1138					cell-cell signaling|DNA packaging|regulation of transcription, DNA-dependent|transcription from RNA polymerase II promoter	chromosome|Golgi apparatus|nucleus|tight junction	DNA binding|histone-lysine N-methyltransferase activity|zinc ion binding			skin(5)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	11	Hepatocellular(266;0.0997)|all_neural(408;0.129)|all_hematologic(923;0.145)		Epithelial(20;1.74e-08)|all cancers(21;3.29e-08)|BRCA - Breast invasive adenocarcinoma(34;0.021)			GTCTGGAGTGTAAATGCAAAT	0.473													18	39	---	---	---	---	PASS
TMEM79	84283	broad.mit.edu	37	1	156261304	156261304	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156261304G>A	uc010phi.1	+	4	1296	c.1100G>A	c.(1099-1101)CGC>CAC	p.R367H	TMEM79_uc001fod.2_Missense_Mutation_p.R208H|TMEM79_uc009wrw.2_Missense_Mutation_p.R367H|C1orf85_uc001fof.3_Intron|C1orf85_uc001fog.1_Intron	NM_032323	NP_115699	Q9BSE2	TMM79_HUMAN	transmembrane protein 79	367						integral to membrane				central_nervous_system(1)	1	Hepatocellular(266;0.158)					GAGCCGGAGCGCATGCTCACT	0.677													8	68	---	---	---	---	PASS
IQGAP3	128239	broad.mit.edu	37	1	156532415	156532415	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:156532415G>T	uc001fpf.2	-	9	916	c.841C>A	c.(841-843)CAG>AAG	p.Q281K	IQGAP3_uc009wsb.1_Missense_Mutation_p.Q238K	NM_178229	NP_839943	Q86VI3	IQGA3_HUMAN	IQ motif containing GTPase activating protein 3	281					small GTPase mediated signal transduction	intracellular	calmodulin binding|Ras GTPase activator activity			ovary(5)|skin(1)	6	all_hematologic(923;0.088)|Hepatocellular(266;0.158)					ATTTCAGCCTGAGTTAGGTAG	0.507													8	145	---	---	---	---	PASS
FCRL3	115352	broad.mit.edu	37	1	157666025	157666025	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:157666025G>C	uc001frb.2	-	7	1229	c.937C>G	c.(937-939)CAG>GAG	p.Q313E	FCRL3_uc001fqx.3_RNA|FCRL3_uc001fqy.3_RNA|FCRL3_uc001fqz.3_Missense_Mutation_p.Q313E|FCRL3_uc009wsn.2_RNA|FCRL3_uc009wso.2_RNA|FCRL3_uc001fra.2_Missense_Mutation_p.Q39E|FCRL3_uc001frc.1_Missense_Mutation_p.Q313E	NM_052939	NP_443171	Q96P31	FCRL3_HUMAN	Fc receptor-like 3 precursor	313	Ig-like C2-type 4.|Extracellular (Potential).					integral to membrane|plasma membrane	receptor activity			ovary(3)|breast(1)	4	all_hematologic(112;0.0378)					CCTGAACCCTGGGCTACTGAG	0.522													17	71	---	---	---	---	PASS
CD1B	910	broad.mit.edu	37	1	158300625	158300625	+	Silent	SNP	G	T	T	rs142860948		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158300625G>T	uc001frx.2	-	2	397	c.289C>A	c.(289-291)CGA>AGA	p.R97R	CD1B_uc001frw.2_5'UTR|CD1B_uc010pic.1_Silent_p.R97R	NM_001764	NP_001755	P29016	CD1B_HUMAN	CD1B antigen precursor	97	Extracellular (Potential).				antigen processing and presentation|immune response	endosome membrane|integral to membrane|lysosomal membrane|plasma membrane	protein binding			ovary(2)	2	all_hematologic(112;0.0378)					TGTACTTCTCGAGCGAATCCA	0.438													9	255	---	---	---	---	PASS
SPTA1	6708	broad.mit.edu	37	1	158585059	158585059	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158585059G>T	uc001fst.1	-	48	6934	c.6735C>A	c.(6733-6735)CTC>CTA	p.L2245L		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	2245	Spectrin 21.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)					CAAGCTGGTAGAGCTGGTCCC	0.532													8	125	---	---	---	---	PASS
SPTA1	6708	broad.mit.edu	37	1	158624456	158624456	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158624456C>A	uc001fst.1	-	21	3180	c.2981G>T	c.(2980-2982)CGA>CTA	p.R994L		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	994	SH3.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)					GGTGACTTCTCGGGGGCTGCG	0.468													5	62	---	---	---	---	PASS
PYHIN1	149628	broad.mit.edu	37	1	158908866	158908866	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:158908866G>T	uc001ftb.2	+						PYHIN1_uc001fta.3_Intron|PYHIN1_uc001ftc.2_Intron|PYHIN1_uc001ftd.2_Intron|PYHIN1_uc001fte.2_Intron	NM_152501	NP_689714	Q6K0P9	IFIX_HUMAN	pyrin and HIN domain family, member 1 alpha 1						cell cycle	nuclear speck				ovary(3)|pancreas(1)	4	all_hematologic(112;0.0378)					TAAACTACTTGTAGAAAAGAA	0.353													4	17	---	---	---	---	PASS
FCER1A	2205	broad.mit.edu	37	1	159275863	159275863	+	Silent	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:159275863T>C	uc001ftq.2	+	5	516	c.417T>C	c.(415-417)GAT>GAC	p.D139D		NM_002001	NP_001992	P12319	FCERA_HUMAN	Fc fragment of IgE, high affinity I, receptor	139	Ig-like 2.|Extracellular (Potential).					integral to plasma membrane				lung(2)|skin(2)|prostate(1)	5	all_hematologic(112;0.0429)				Benzylpenicilloyl Polylysine(DB00895)|Omalizumab(DB00043)	GGAACTGGGATGTGTACAAGG	0.493													5	39	---	---	---	---	PASS
ATP1A4	480	broad.mit.edu	37	1	160129229	160129229	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:160129229G>T	uc001fve.3	+	6	1170	c.691G>T	c.(691-693)GAA>TAA	p.E231*	ATP1A4_uc001fvf.3_RNA	NM_144699	NP_653300	Q13733	AT1A4_HUMAN	Na+/K+ -ATPase alpha 4 subunit isoform 1	231	Cytoplasmic (Potential).				ATP biosynthetic process|ATP hydrolysis coupled proton transport|regulation of cellular pH|sperm motility	sodium:potassium-exchanging ATPase complex	ATP binding|metal ion binding|sodium:potassium-exchanging ATPase activity			ovary(2)|skin(2)	4	all_cancers(52;2.56e-18)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.111)			TGGGGAGTCAGAACCCCAGAG	0.498													6	59	---	---	---	---	PASS
FCRLA	84824	broad.mit.edu	37	1	161681720	161681720	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:161681720C>A	uc001gbe.2	+						FCRLA_uc001gbd.2_Intron|FCRLA_uc001gbf.2_Intron|FCRLA_uc001gbg.2_Intron|FCRLA_uc009wuo.2_Intron|FCRLA_uc009wup.2_Intron|FCRLA_uc009wuq.2_Intron	NM_032738	NP_116127	Q7L513	FCRLA_HUMAN	Fc receptor-like and mucin-like 1						cell differentiation	cytoplasm|extracellular region					0	all_cancers(52;2.55e-15)|all_hematologic(112;0.0359)		BRCA - Breast invasive adenocarcinoma(70;0.00301)			TATCTTTTTCCCAGAACTGTT	0.502													8	198	---	---	---	---	PASS
POU2F1	5451	broad.mit.edu	37	1	167382310	167382310	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:167382310G>A	uc001gec.2	+	16	2042	c.1880G>A	c.(1879-1881)AGC>AAC	p.S627N	POU2F1_uc001ged.2_Missense_Mutation_p.S625N|POU2F1_uc001gee.2_Missense_Mutation_p.S627N|POU2F1_uc010plh.1_Missense_Mutation_p.S564N|POU2F1_uc001gef.2_Missense_Mutation_p.S639N|POU2F1_uc001geg.2_Missense_Mutation_p.S525N	NM_002697	NP_002688	P14859	PO2F1_HUMAN	POU class 2 homeobox 1	627					negative regulation of transcription, DNA-dependent|transcription from RNA polymerase III promoter	nucleoplasm	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(2)|skin(2)|breast(1)	5						GGTGCTCTCAGCCCAGCTCTA	0.433													24	104	---	---	---	---	PASS
F5	2153	broad.mit.edu	37	1	169510709	169510709	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169510709C>A	uc001ggg.1	-	13	3764	c.3619G>T	c.(3619-3621)GAC>TAC	p.D1207Y		NM_000130	NP_000121	P12259	FA5_HUMAN	coagulation factor V precursor	1207	B.|2-3.|35 X 9 AA approximate tandem repeats of [TNP]-L-S-P-D-L-S-Q-T.				cell adhesion|platelet activation|platelet degranulation	plasma membrane|platelet alpha granule lumen	copper ion binding|oxidoreductase activity			ovary(3)|large_intestine(1)|central_nervous_system(1)|skin(1)	6	all_hematologic(923;0.208)				Drotrecogin alfa(DB00055)	TGGCTGAGGTCTGGAGAGAGG	0.547													9	179	---	---	---	---	PASS
F5	2153	broad.mit.edu	37	1	169513755	169513755	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169513755G>T	uc001ggg.1	-							NM_000130	NP_000121	P12259	FA5_HUMAN	coagulation factor V precursor						cell adhesion|platelet activation|platelet degranulation	plasma membrane|platelet alpha granule lumen	copper ion binding|oxidoreductase activity			ovary(3)|large_intestine(1)|central_nervous_system(1)|skin(1)	6	all_hematologic(923;0.208)				Drotrecogin alfa(DB00055)	AGCTGAAAGTGTAAAATCTGT	0.408													5	17	---	---	---	---	PASS
F5	2153	broad.mit.edu	37	1	169529939	169529939	+	Missense_Mutation	SNP	C	T	T	rs118203912		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:169529939C>T	uc001ggg.1	-	4	584	c.439G>A	c.(439-441)GAA>AAA	p.E147K	F5_uc010plr.1_RNA	NM_000130	NP_000121	P12259	FA5_HUMAN	coagulation factor V precursor	147	F5/8 type A 1.|Plastocyanin-like 1.				cell adhesion|platelet activation|platelet degranulation	plasma membrane|platelet alpha granule lumen	copper ion binding|oxidoreductase activity			ovary(3)|large_intestine(1)|central_nervous_system(1)|skin(1)	6	all_hematologic(923;0.208)				Drotrecogin alfa(DB00055)	TAGGTGTATTCTCGGCCTGGA	0.517													17	80	---	---	---	---	PASS
DARS2	55157	broad.mit.edu	37	1	173800688	173800688	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173800688G>T	uc001gjh.1	+	5	822	c.412G>T	c.(412-414)GAG>TAG	p.E138*		NM_018122	NP_060592	Q6PI48	SYDM_HUMAN	aspartyl-tRNA synthetase 2, mitochondrial	138					tRNA aminoacylation for protein translation	mitochondrial matrix|nucleus	aspartate-tRNA ligase activity|ATP binding|nucleic acid binding			central_nervous_system(2)	2					L-Aspartic Acid(DB00128)	GCCAACAGGTGAGATTGAAAT	0.353													11	311	---	---	---	---	PASS
RC3H1	149041	broad.mit.edu	37	1	173930278	173930278	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:173930278C>A	uc001gju.3	-	12	2394	c.2307G>T	c.(2305-2307)AAG>AAT	p.K769N	RC3H1_uc010pms.1_Missense_Mutation_p.K769N|RC3H1_uc001gjv.2_Missense_Mutation_p.K769N|RC3H1_uc010pmt.1_Missense_Mutation_p.K769N	NM_172071	NP_742068	Q5TC82	RC3H1_HUMAN	roquin	769	Pro-rich.				cytoplasmic mRNA processing body assembly|negative regulation of activated T cell proliferation|negative regulation of B cell proliferation|negative regulation of germinal center formation|negative regulation of T-helper cell differentiation|nuclear-transcribed mRNA catabolic process|regulation of mRNA stability|regulation of T cell receptor signaling pathway	cytoplasmic mRNA processing body|stress granule	mRNA 3'-UTR binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(2)	2						GAGAGATAACCTTTCTTTCCT	0.458													7	115	---	---	---	---	PASS
GPR52	9293	broad.mit.edu	37	1	174417805	174417805	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:174417805C>A	uc001gka.1	+	1	594	c.556C>A	c.(556-558)CAT>AAT	p.H186N	RABGAP1L_uc001gjw.2_Intron|RABGAP1L_uc001gjx.2_Intron|RABGAP1L_uc001gjy.2_Intron|RABGAP1L_uc001gjz.2_Intron|uc010pmu.1_RNA	NM_005684	NP_005675	Q9Y2T5	GPR52_HUMAN	G protein-coupled receptor 52	186	Extracellular (Potential).					integral to plasma membrane	G-protein coupled receptor activity			skin(1)	1						ACCTGGTTACCATGGTGACAT	0.438													8	184	---	---	---	---	PASS
TNN	63923	broad.mit.edu	37	1	175087722	175087722	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:175087722C>A	uc001gkl.1	+	11	2525	c.2412C>A	c.(2410-2412)GTC>GTA	p.V804V		NM_022093	NP_071376	Q9UQP3	TENN_HUMAN	tenascin N precursor	804	Fibronectin type-III 7.				cell growth|cell migration|signal transduction	extracellular space|proteinaceous extracellular matrix				large_intestine(5)|ovary(3)|central_nervous_system(1)	9		Breast(1374;0.000962)		KIRC - Kidney renal clear cell carcinoma(1967;0.00198)		AAAACCTGGTCACTGACTGGG	0.512													11	52	---	---	---	---	PASS
LAMC1	3915	broad.mit.edu	37	1	183103915	183103915	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183103915C>A	uc001gpy.3	+	23	4227	c.3970C>A	c.(3970-3972)CTT>ATT	p.L1324I		NM_002293	NP_002284	P11047	LAMC1_HUMAN	laminin, gamma 1 precursor	1324	Potential.|Domain II and I.				axon guidance|cell migration|endoderm development|extracellular matrix disassembly|hemidesmosome assembly|positive regulation of epithelial cell proliferation|protein complex assembly|substrate adhesion-dependent cell spreading	extracellular space|laminin-1 complex|laminin-10 complex|laminin-11 complex	extracellular matrix structural constituent			ovary(3)|large_intestine(1)|kidney(1)	5					Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)	AGTCAAGAACCTTCTGGAGAA	0.423													12	251	---	---	---	---	PASS
LAMC2	3918	broad.mit.edu	37	1	183177132	183177132	+	Nonsense_Mutation	SNP	G	T	T	rs146325169	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:183177132G>T	uc001gqa.2	+	2	510	c.196G>T	c.(196-198)GAG>TAG	p.E66*	LAMC2_uc001gpz.3_Nonsense_Mutation_p.E66*|LAMC2_uc010poa.1_5'UTR	NM_005562	NP_005553	Q13753	LAMC2_HUMAN	laminin, gamma 2 isoform a precursor	66	Laminin EGF-like 1.				cell adhesion|epidermis development|hemidesmosome assembly		heparin binding			skin(2)|ovary(1)	3						CATTCACTGCGAGAAGTGCAA	0.488													7	207	---	---	---	---	PASS
TPR	7175	broad.mit.edu	37	1	186327695	186327695	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186327695C>A	uc001grv.2	-	13	1774	c.1477G>T	c.(1477-1479)GTA>TTA	p.V493L	TPR_uc010pop.1_Missense_Mutation_p.V569L	NM_003292	NP_003283	P12270	TPR_HUMAN	nuclear pore complex-associated protein TPR	493	Potential.				carbohydrate metabolic process|glucose transport|mitotic cell cycle spindle assembly checkpoint|mRNA transport|protein import into nucleus|regulation of glucose transport|seryl-tRNA aminoacylation|transmembrane transport|viral reproduction	condensed chromosome kinetochore|cytoplasm|nuclear membrane|nuclear pore|nucleoplasm	ATP binding|protein binding|serine-tRNA ligase activity			ovary(2)|lung(2)|urinary_tract(1)|central_nervous_system(1)|skin(1)	7		Breast(1374;0.000659)|Lung SC(1967;0.0262)|Prostate(1639;0.157)		Colorectal(1306;1.12e-05)|KIRC - Kidney renal clear cell carcinoma(1967;0.00553)		AGATCTTTTACTTGTATTTCC	0.343			T	NTRK1	papillary thyroid								6	107	---	---	---	---	PASS
PLA2G4A	5321	broad.mit.edu	37	1	186880486	186880486	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:186880486C>T	uc001gsc.2	+	7	728	c.523C>T	c.(523-525)CCA>TCA	p.P175S	PLA2G4A_uc010pos.1_Intron	NM_024420	NP_077734	P47712	PA24A_HUMAN	cytosolic phospholipase A2, group IVA	175	Phospholipid binding (Probable).|PLA2c.				phospholipid catabolic process|platelet activating factor biosynthetic process|platelet activation	cytosol|endoplasmic reticulum membrane	calcium ion binding|calcium-dependent phospholipid binding|lysophospholipase activity			lung(2)|breast(1)	3					Flunisolide(DB00180)|Fluocinolone Acetonide(DB00591)|Fluocinonide(DB01047)|Fluorometholone(DB00324)|Flurandrenolide(DB00846)|Fluticasone Propionate(DB00588)|Medrysone(DB00253)|Quinacrine(DB01103)	ACTCTTGGGTCCAAAGAATAG	0.388													17	75	---	---	---	---	PASS
RGS1	5996	broad.mit.edu	37	1	192547369	192547369	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:192547369G>T	uc001gsi.1	+	4	364	c.298G>T	c.(298-300)GGA>TGA	p.G100*	RGS1_uc010pou.1_Nonsense_Mutation_p.G100*	NM_002922	NP_002913	Q08116	RGS1_HUMAN	regulator of G-protein signalling 1	100	RGS.				immune response|inhibition of adenylate cyclase activity by G-protein signaling pathway|negative regulation of signal transduction	cytoplasm|plasma membrane	calmodulin binding|GTPase activator activity|signal transducer activity				0		Breast(1374;0.188)				AAATGTCTTTGGAAGTTTCCT	0.363													8	182	---	---	---	---	PASS
RGS13	6003	broad.mit.edu	37	1	192613497	192613497	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:192613497G>T	uc001gsj.2	+	4	314	c.33G>T	c.(31-33)ATG>ATT	p.M11I	RGS13_uc001gsk.2_Missense_Mutation_p.M11I	NM_002927	NP_002918	O14921	RGS13_HUMAN	regulator of G-protein signalling 13	11						plasma membrane	GTPase activator activity|signal transducer activity				0						TTTGTAAGATGTGCAGAGATG	0.284													9	301	---	---	---	---	PASS
UCHL5	51377	broad.mit.edu	37	1	192993077	192993077	+	Splice_Site	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:192993077C>A	uc001gsm.2	-	8	761	c.630_splice	c.e8-1	p.K210_splice	UCHL5_uc001gsn.2_Splice_Site|UCHL5_uc001gso.2_Splice_Site_p.K210_splice|UCHL5_uc010pov.1_Splice_Site|UCHL5_uc001gsp.2_Splice_Site_p.K210_splice|UCHL5_uc001gsq.2_Splice_Site_p.K210_splice|UCHL5_uc010pow.1_Splice_Site_p.K86_splice|UCHL5_uc010pox.1_Splice_Site_p.K86_splice	NM_015984	NP_057068	Q9Y5K5	UCHL5_HUMAN	ubiquitin carboxyl-terminal hydrolase L5						DNA recombination|DNA repair|protein deubiquitination|regulation of proteasomal protein catabolic process|regulation of transcription, DNA-dependent|transcription, DNA-dependent|ubiquitin-dependent protein catabolic process	cytosol|Ino80 complex|proteasome complex	endopeptidase inhibitor activity|omega peptidase activity|proteasome binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			lung(2)|ovary(1)	3						TTCACTGTACCTAGAAGAAAA	0.303													6	61	---	---	---	---	PASS
FAM58B	339521	broad.mit.edu	37	1	200182884	200182884	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200182884G>T	uc009wzi.1	+	1	229	c.193G>T	c.(193-195)GAG>TAG	p.E65*		NM_001105517	NP_001098987	P0C7Q3	FA58B_HUMAN	family with sequence similarity 58 member B	65					regulation of cyclin-dependent protein kinase activity|regulation of transcription, DNA-dependent		protein kinase binding				0	Prostate(682;0.19)					GTTCTTCTGCGAGACCATCCT	0.537													7	97	---	---	---	---	PASS
ZNF281	23528	broad.mit.edu	37	1	200377843	200377843	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200377843G>T	uc001gve.2	-	2	1098	c.991C>A	c.(991-993)CAT>AAT	p.H331N	ZNF281_uc001gvf.1_Missense_Mutation_p.H331N|ZNF281_uc001gvg.1_Missense_Mutation_p.H295N	NM_012482	NP_036614	Q9Y2X9	ZN281_HUMAN	zinc finger protein 281	331	C2H2-type 3.				negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(1)|breast(1)	2						CTCTCCATATGGTACTTCTGA	0.383													8	194	---	---	---	---	PASS
ZNF281	23528	broad.mit.edu	37	1	200378069	200378069	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200378069G>T	uc001gve.2	-	2	872	c.765C>A	c.(763-765)TCC>TCA	p.S255S	uc010ppi.1_5'Flank|ZNF281_uc001gvf.1_Silent_p.S255S|ZNF281_uc001gvg.1_Silent_p.S219S	NM_012482	NP_036614	Q9Y2X9	ZN281_HUMAN	zinc finger protein 281	255					negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding			ovary(1)|breast(1)	2						TCTGACTTGGGGAGAGGATGG	0.483													6	86	---	---	---	---	PASS
RABIF	5877	broad.mit.edu	37	1	202850122	202850122	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:202850122C>A	uc001gyl.2	-	2	393	c.356G>T	c.(355-357)CGA>CTA	p.R119L		NM_002871	NP_002862	P47224	MSS4_HUMAN	RAB-interacting factor	119					cellular membrane fusion|protein transport|small GTPase mediated signal transduction		guanyl-nucleotide exchange factor activity|zinc ion binding				0			BRCA - Breast invasive adenocarcinoma(75;0.166)			ATGGGAAACTCGTTCCAAGGC	0.478													6	59	---	---	---	---	PASS
NFASC	23114	broad.mit.edu	37	1	204948632	204948632	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:204948632G>T	uc001hbj.2	+	19	2449	c.2121G>T	c.(2119-2121)GAG>GAT	p.E707D	NFASC_uc010pra.1_Missense_Mutation_p.E703D|NFASC_uc001hbi.2_Missense_Mutation_p.E703D|NFASC_uc010prb.1_Missense_Mutation_p.E718D|NFASC_uc010prc.1_Missense_Mutation_p.E274D|NFASC_uc001hbk.1_Missense_Mutation_p.E513D|NFASC_uc001hbl.1_5'Flank	NM_001005388	NP_001005388	O94856	NFASC_HUMAN	neurofascin isoform 1 precursor	707	Extracellular (Potential).|Fibronectin type-III 1.				axon guidance|cell adhesion|myelination|peripheral nervous system development	integral to membrane|node of Ranvier|plasma membrane	protein binding			ovary(3)|breast(1)|central_nervous_system(1)|skin(1)	6	all_cancers(21;0.0375)|Breast(84;0.0437)|all_epithelial(62;0.171)|Prostate(682;0.19)		KIRC - Kidney renal clear cell carcinoma(13;0.0584)|Kidney(21;0.0934)|BRCA - Breast invasive adenocarcinoma(75;0.158)			CCATCAACGAGGTTGGGAGCA	0.622													7	64	---	---	---	---	PASS
DSTYK	25778	broad.mit.edu	37	1	205138464	205138464	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:205138464A>T	uc001hbw.2	-	3	1215	c.1151T>A	c.(1150-1152)CTG>CAG	p.L384Q	DSTYK_uc001hbx.2_Missense_Mutation_p.L384Q|DSTYK_uc001hby.1_Intron	NM_015375	NP_056190	Q6XUX3	DUSTY_HUMAN	receptor interacting protein kinase 5 isoform 1	384						cytoplasm	ATP binding|protein binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			lung(1)	1						AGTGATCTGCAGGTCCCGCTG	0.473													6	43	---	---	---	---	PASS
CR2	1380	broad.mit.edu	37	1	207639906	207639906	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207639906G>T	uc001hfw.2	+	2	188	c.94G>T	c.(94-96)GGC>TGC	p.G32C	CR2_uc001hfv.2_Missense_Mutation_p.G32C|CR2_uc009xch.2_Missense_Mutation_p.G32C	NM_001877	NP_001868	P20023	CR2_HUMAN	complement component (3d/Epstein Barr virus)	32	Sushi 1.|Extracellular (Potential).				complement activation, classical pathway|innate immune response	integral to membrane|plasma membrane	complement receptor activity|protein homodimerization activity			upper_aerodigestive_tract(3)|skin(3)|urinary_tract(1)|ovary(1)	8						TATCCTAAATGGCCGGATTAG	0.418													9	188	---	---	---	---	PASS
TMEM206	55248	broad.mit.edu	37	1	212560296	212560296	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:212560296C>A	uc001hjc.3	-	3	448	c.280G>T	c.(280-282)GAG>TAG	p.E94*	TMEM206_uc010pte.1_Nonsense_Mutation_p.E155*	NM_018252	NP_060722	Q9H813	TM206_HUMAN	transmembrane protein 206	94	Extracellular (Potential).					integral to membrane				breast(1)	1				all cancers(67;0.012)|OV - Ovarian serous cystadenocarcinoma(81;0.0121)|GBM - Glioblastoma multiforme(131;0.0377)|Epithelial(68;0.148)		TTGAGTTTCTCACGAAAGTCT	0.557													7	98	---	---	---	---	PASS
C1orf227	149643	broad.mit.edu	37	1	213009399	213009399	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:213009399G>T	uc001hjq.2	-	2	201	c.93C>A	c.(91-93)TCC>TCA	p.S31S		NM_001024601	NP_001019772	Q537H7	CA227_HUMAN	hypothetical protein LOC149643	31											0						CCAAGCAGTTGGATTCACGCT	0.408													7	110	---	---	---	---	PASS
USH2A	7399	broad.mit.edu	37	1	216052154	216052154	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216052154A>T	uc001hku.1	-	42	8897	c.8510T>A	c.(8509-8511)GTT>GAT	p.V2837D		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	2837	Extracellular (Potential).|Fibronectin type-III 15.				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)		AGAAATCACAACATATGATTC	0.438										HNSCC(13;0.011)			6	38	---	---	---	---	PASS
USH2A	7399	broad.mit.edu	37	1	216500991	216500991	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:216500991C>A	uc001hku.1	-	5	1177	c.790G>T	c.(790-792)GAG>TAG	p.E264*	USH2A_uc001hkv.2_Nonsense_Mutation_p.E264*	NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	264	Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)		ACAAACTGCTCTAAACCTGCA	0.368										HNSCC(13;0.011)			7	89	---	---	---	---	PASS
MIA3	375056	broad.mit.edu	37	1	222801477	222801477	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:222801477G>A	uc001hnl.2	+	4	924	c.915G>A	c.(913-915)GAG>GAA	p.E305E	MIA3_uc009xea.1_Silent_p.E141E	NM_198551	NP_940953	Q5JRA6	MIA3_HUMAN	melanoma inhibitory activity family, member 3	305	Extracellular (Potential).				exocytosis|negative regulation of cell adhesion|negative regulation of cell migration|positive regulation of leukocyte migration|protein transport|wound healing	endoplasmic reticulum membrane|integral to membrane	protein binding			ovary(4)|central_nervous_system(1)	5				GBM - Glioblastoma multiforme(131;0.0199)		ATTTTGATGAGGAATTGGATA	0.388													12	67	---	---	---	---	PASS
TLR5	7100	broad.mit.edu	37	1	223285199	223285199	+	Missense_Mutation	SNP	C	A	A	rs144418928		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:223285199C>A	uc001hnv.1	-	4	1621	c.1175G>T	c.(1174-1176)CGA>CTA	p.R392L	TLR5_uc001hnw.1_Missense_Mutation_p.R392L	NM_003268	NP_003259	O60602	TLR5_HUMAN	toll-like receptor 5 precursor	392	Extracellular (Potential).|LRR 9.		Missing (in 10% of the population; abolishes flagellin signaling; associated with resistance to SLEB1).		cellular response to mechanical stimulus|inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway|positive regulation of interleukin-8 production|positive regulation of toll-like receptor signaling pathway	integral to membrane|plasma membrane	interleukin-1 receptor binding|transmembrane receptor activity			ovary(2)|lung(1)|skin(1)	4				GBM - Glioblastoma multiforme(131;0.0851)		AGCATTGTCTCGGAGATCCAA	0.378													5	76	---	---	---	---	PASS
EPHX1	2052	broad.mit.edu	37	1	226016448	226016448	+	Silent	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:226016448C>G	uc001hpk.2	+	2	98	c.18C>G	c.(16-18)CTC>CTG	p.L6L	EPHX1_uc001hpl.2_Silent_p.L6L	NM_001136018	NP_001129490	P07099	HYEP_HUMAN	epoxide hydrolase 1	6	Helical; Signal-anchor; (Potential).				aromatic compound catabolic process|response to toxin	endoplasmic reticulum membrane|integral to membrane|microsome	cis-stilbene-oxide hydrolase activity|epoxide hydrolase activity			ovary(3)|lung(1)	4	Breast(184;0.197)					TAGAAATCCTCCTCACTTCAG	0.587													7	38	---	---	---	---	PASS
ITPKB	3707	broad.mit.edu	37	1	226923323	226923323	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:226923323C>A	uc010pvo.1	-	2	2177	c.1837G>T	c.(1837-1839)GAA>TAA	p.E613*	ITPKB_uc001hqh.2_Nonsense_Mutation_p.E613*	NM_002221	NP_002212	P27987	IP3KB_HUMAN	1D-myo-inositol-trisphosphate 3-kinase B	613							ATP binding|calmodulin binding|inositol trisphosphate 3-kinase activity			ovary(4)|central_nervous_system(1)	5		Prostate(94;0.0773)				TCTGAGTCTTCGTAGGATGAG	0.612													4	47	---	---	---	---	PASS
GUK1	2987	broad.mit.edu	37	1	228334602	228334602	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:228334602G>T	uc001hsh.2	+	5	517	c.214G>T	c.(214-216)GAG>TAG	p.E72*	GUK1_uc001hsi.2_Nonsense_Mutation_p.E93*|GUK1_uc001hsj.2_Nonsense_Mutation_p.E12*|GUK1_uc010pvv.1_Nonsense_Mutation_p.E72*|GJC2_uc001hsk.2_5'Flank	NM_000858	NP_000849	Q16774	KGUA_HUMAN	guanylate kinase 1 isoform b	72	Guanylate kinase-like.				nucleobase, nucleoside and nucleotide interconversion|purine nucleotide metabolic process	cytosol	ATP binding|guanylate kinase activity				0		Prostate(94;0.0405)				CGACTTCATCGAGCATGCCGA	0.602													5	56	---	---	---	---	PASS
C1orf96	126731	broad.mit.edu	37	1	229460970	229460970	+	3'UTR	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:229460970G>T	uc001htl.3	-	4					C1orf96_uc009xfc.2_RNA	NM_145257	NP_660300	Q6IQ19	CA096_HUMAN	hypothetical protein LOC126731							centrosome					0	Breast(184;0.0858)|Ovarian(103;0.103)	Prostate(94;0.178)				GGCTGTCCACGCAAGTGTTTC	0.398													6	124	---	---	---	---	PASS
B3GALNT2	148789	broad.mit.edu	37	1	235647796	235647796	+	Nonsense_Mutation	SNP	C	A	A	rs146090744	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:235647796C>A	uc001hxc.2	-	4	626	c.397G>T	c.(397-399)GAA>TAA	p.E133*	B3GALNT2_uc001hxd.1_Nonsense_Mutation_p.E174*	NM_152490	NP_689703	Q8NCR0	B3GL2_HUMAN	beta-1,3-N-acetylgalactosaminyltransferase 2	133	Lumenal (Potential).				protein glycosylation	Golgi membrane|integral to membrane	galactosyltransferase activity			breast(1)	1	Ovarian(103;0.0634)|Breast(184;0.23)	all_cancers(173;0.0539)|Prostate(94;0.0353)	OV - Ovarian serous cystadenocarcinoma(106;0.000117)			GAAGTGTCTTCGGACAGACTG	0.418													5	115	---	---	---	---	PASS
ERO1LB	56605	broad.mit.edu	37	1	236388417	236388417	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236388417C>A	uc001hxt.2	-	13	1331	c.1075G>T	c.(1075-1077)GAG>TAG	p.E359*		NM_019891	NP_063944	Q86YB8	ERO1B_HUMAN	endoplasmic reticulum oxidoreductin 1-Lbeta	359					electron transport chain|protein thiol-disulfide exchange|transport	endoplasmic reticulum membrane	flavin adenine dinucleotide binding|oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor|unfolded protein binding				0	Ovarian(103;0.0634)|Breast(184;0.247)	all_cancers(173;0.123)|Acute lymphoblastic leukemia(190;0.205)|Prostate(94;0.219)	OV - Ovarian serous cystadenocarcinoma(106;0.00162)			ATGGATTTCTCATCAAAGTGC	0.398													7	106	---	---	---	---	PASS
ACTN2	88	broad.mit.edu	37	1	236925848	236925848	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:236925848C>A	uc001hyf.2	+	21	2818	c.2614C>A	c.(2614-2616)CCA>ACA	p.P872T	ACTN2_uc001hyg.2_Missense_Mutation_p.P664T|ACTN2_uc009xgi.1_Missense_Mutation_p.P872T|ACTN2_uc010pxu.1_Missense_Mutation_p.P561T|ACTN2_uc001hyh.2_Missense_Mutation_p.P560T	NM_001103	NP_001094	P35609	ACTN2_HUMAN	actinin, alpha 2	872					focal adhesion assembly|microspike assembly|muscle filament sliding|platelet activation|platelet degranulation|protein homotetramerization|regulation of apoptosis|synaptic transmission	actin filament|cytosol|dendritic spine|extracellular region|filopodium|focal adhesion|nucleolus|platelet alpha granule lumen|pseudopodium|Z disc	actin binding|calcium ion binding|FATZ 1 binding|identical protein binding|integrin binding|protein dimerization activity|structural constituent of muscle|titin binding|titin Z domain binding|ZASP binding			ovary(4)|skin(1)	5	Ovarian(103;0.0634)|Breast(184;0.221)	all_cancers(173;0.00661)|Acute lymphoblastic leukemia(190;0.109)|Prostate(94;0.174)	OV - Ovarian serous cystadenocarcinoma(106;0.00168)			CTACTCGGGCCCAGGCAGTGT	0.587													5	17	---	---	---	---	PASS
FMN2	56776	broad.mit.edu	37	1	240497236	240497236	+	Missense_Mutation	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:240497236A>G	uc010pyd.1	+	12	4859	c.4634A>G	c.(4633-4635)AAT>AGT	p.N1545S	FMN2_uc010pye.1_Missense_Mutation_p.N1549S|FMN2_uc010pyf.1_Missense_Mutation_p.N191S|FMN2_uc010pyg.1_Missense_Mutation_p.N141S	NM_020066	NP_064450	Q9NZ56	FMN2_HUMAN	formin 2	1545	FH2.				actin cytoskeleton organization|establishment of meiotic spindle localization|intracellular signal transduction|meiotic chromosome movement towards spindle pole|meiotic metaphase I|multicellular organismal development|oogenesis|polar body extrusion after meiotic divisions		actin binding			ovary(4)|pancreas(3)|skin(3)|large_intestine(1)|central_nervous_system(1)	12	Ovarian(103;0.127)	all_cancers(173;0.013)	OV - Ovarian serous cystadenocarcinoma(106;0.0106)			TATCTCCGAAATTTTGATGAG	0.289													7	72	---	---	---	---	PASS
AKT3	10000	broad.mit.edu	37	1	243708878	243708878	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:243708878A>C	uc001iab.1	-	11	1266	c.1185T>G	c.(1183-1185)GAT>GAG	p.D395E	AKT3_uc001hzz.1_Missense_Mutation_p.D395E	NM_005465	NP_005456	Q9Y243	AKT3_HUMAN	AKT3 kinase isoform 1	395	Protein kinase.				signal transduction	Golgi apparatus|nucleus|plasma membrane	ATP binding|protein binding|protein serine/threonine kinase activity			stomach(1)|lung(1)|breast(1)|central_nervous_system(1)	4	all_cancers(71;0.000307)|all_epithelial(71;0.000374)|all_lung(81;0.0323)|Ovarian(71;0.0619)|all_neural(11;0.101)|Lung NSC(105;0.168)	all_cancers(173;0.0274)	all cancers(7;4.3e-08)|GBM - Glioblastoma multiforme(7;5.12e-06)|OV - Ovarian serous cystadenocarcinoma(106;0.00196)			TTTCTTTTGCATCATCTGGTC	0.299													23	96	---	---	---	---	PASS
OR6F1	343169	broad.mit.edu	37	1	247875492	247875492	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247875492C>A	uc001idj.1	-	1	566	c.566G>T	c.(565-567)TGC>TTC	p.C189F		NM_001005286	NP_001005286	Q8NGZ6	OR6F1_HUMAN	olfactory receptor, family 6, subfamily F,	189	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0	all_cancers(71;3.24e-05)|all_epithelial(71;1.3e-05)|Breast(184;0.0149)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)		OV - Ovarian serous cystadenocarcinoma(106;0.0168)			TGTGTTGGTGCAGGCCAGGGC	0.532													6	40	---	---	---	---	PASS
OR14A16	284532	broad.mit.edu	37	1	247978481	247978481	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:247978481G>A	uc001idm.1	-	1	551	c.551C>T	c.(550-552)GCT>GTT	p.A184V		NM_001001966	NP_001001966	Q8NHC5	O14AG_HUMAN	olfactory receptor, family 14, subfamily A,	184	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						GCAAGAAATAGCTAATAACTG	0.393													7	29	---	---	---	---	PASS
TRIM58	25893	broad.mit.edu	37	1	248039501	248039501	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:248039501G>T	uc001ido.2	+	6	1219	c.1171G>T	c.(1171-1173)GAG>TAG	p.E391*	OR2W3_uc001idp.1_Intron	NM_015431	NP_056246	Q8NG06	TRI58_HUMAN	tripartite motif-containing 58	391	B30.2/SPRY.					intracellular	zinc ion binding			skin(3)|ovary(1)|pancreas(1)|lung(1)|central_nervous_system(1)	7	all_cancers(71;0.000139)|all_epithelial(71;1.58e-05)|Breast(184;0.0117)|Ovarian(71;0.0377)|all_lung(81;0.127)|Lung NSC(105;0.136)	all_cancers(173;0.0286)	OV - Ovarian serous cystadenocarcinoma(106;0.0319)			GAAAGGGAATGAGTACATGGT	0.527													7	84	---	---	---	---	PASS
PXDN	7837	broad.mit.edu	37	2	1667512	1667512	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:1667512G>T	uc002qxa.2	-	12	1496	c.1432C>A	c.(1432-1434)CGG>AGG	p.R478R	PXDN_uc002qxb.1_Silent_p.R478R	NM_012293	NP_036425	Q92626	PXDN_HUMAN	peroxidasin precursor	478	Ig-like C2-type 3.				extracellular matrix organization|hydrogen peroxide catabolic process|immune response	endoplasmic reticulum|extracellular space|proteinaceous extracellular matrix	extracellular matrix structural constituent|heme binding|interleukin-1 receptor antagonist activity|peroxidase activity			pancreas(6)|ovary(2)	8	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.0797)	all_cancers(51;0.0845)|Lung NSC(108;0.00641)|all_epithelial(98;0.00716)		all cancers(51;0.0492)|OV - Ovarian serous cystadenocarcinoma(76;0.0973)|Epithelial(75;0.17)|GBM - Glioblastoma multiforme(21;0.228)		ACCAGGTGCCGCCGGTCCACG	0.602													12	46	---	---	---	---	PASS
RNASEH1	246243	broad.mit.edu	37	2	3599829	3599829	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:3599829C>G	uc002qxt.2	-	3	404	c.314G>C	c.(313-315)GGA>GCA	p.G105A	RNASEH1_uc002qxs.2_5'UTR	NM_002936	NP_002927	O60930	RNH1_HUMAN	ribonuclease H1	105					RNA catabolic process	cytoplasm	magnesium ion binding|ribonuclease H activity|RNA binding			ovary(1)	1	Acute lymphoblastic leukemia(172;0.0627)|all_hematologic(175;0.093)			OV - Ovarian serous cystadenocarcinoma(76;0.0713)|Epithelial(75;0.167)|all cancers(51;0.22)		ATGTCCATCTCCATCCAGTGG	0.542													13	62	---	---	---	---	PASS
ASAP2	8853	broad.mit.edu	37	2	9514948	9514948	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:9514948G>C	uc002qzh.2	+	17	1961	c.1621G>C	c.(1621-1623)GCG>CCG	p.A541P	ASAP2_uc002qzi.2_Missense_Mutation_p.A541P	NM_003887	NP_003878	O43150	ASAP2_HUMAN	ArfGAP with SH3 domain, ankyrin repeat and PH	541	Arf-GAP.				regulation of ARF GTPase activity	Golgi cisterna membrane|plasma membrane	ARF GTPase activator activity|protein binding|zinc ion binding				0						GAAGAAGCACGCGGATAACGC	0.468													11	46	---	---	---	---	PASS
CPSF3	51692	broad.mit.edu	37	2	9576404	9576404	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:9576404C>A	uc002qzo.1	+	7	709	c.674C>A	c.(673-675)ACT>AAT	p.T225N	CPSF3_uc010ewx.1_Missense_Mutation_p.T225N|CPSF3_uc002qzp.1_Missense_Mutation_p.T188N	NM_016207	NP_057291	Q9UKF6	CPSF3_HUMAN	cleavage and polyadenylation specific factor 3,	225					histone mRNA 3'-end processing|mRNA cleavage|mRNA export from nucleus|mRNA polyadenylation|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	mRNA cleavage and polyadenylation specificity factor complex|ribonucleoprotein complex	5'-3' exonuclease activity|endoribonuclease activity|metal ion binding|protein binding|RNA binding			breast(2)	2	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)	all_cancers(51;2.39e-25)|all_epithelial(98;8.75e-19)|Lung NSC(108;2.38e-06)|Ovarian(717;0.0308)		all cancers(51;2.2e-40)|Epithelial(75;6.71e-35)|OV - Ovarian serous cystadenocarcinoma(76;4.35e-21)|STAD - Stomach adenocarcinoma(1183;0.00644)		TTCTGTAACACTGTCCACGAT	0.438													5	89	---	---	---	---	PASS
RRM2	6241	broad.mit.edu	37	2	10264980	10264980	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:10264980G>T	uc002rah.2	+							NM_001034	NP_001025	P31350	RIR2_HUMAN	ribonucleotide reductase M2 polypeptide isoform						deoxyribonucleoside diphosphate metabolic process|deoxyribonucleotide biosynthetic process|DNA replication|nucleobase, nucleoside and nucleotide interconversion|regulation of transcription involved in G1/S phase of mitotic cell cycle	cytosol	ribonucleoside-diphosphate reductase activity|transition metal ion binding				0	all_hematologic(175;0.127)|Acute lymphoblastic leukemia(172;0.155)			Epithelial(75;0.188)|OV - Ovarian serous cystadenocarcinoma(76;0.221)		AAAGAAAGGTGAGTATTCAAG	0.348													7	69	---	---	---	---	PASS
NBAS	51594	broad.mit.edu	37	2	15378737	15378737	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:15378737C>A	uc002rcc.1	-	45	5824	c.5798G>T	c.(5797-5799)AGG>ATG	p.R1933M	NBAS_uc002rcb.1_Translation_Start_Site|NBAS_uc010exl.1_Missense_Mutation_p.R1005M|NBAS_uc002rcd.1_RNA	NM_015909	NP_056993	A2RRP1	NBAS_HUMAN	neuroblastoma-amplified protein	1933										ovary(2)|liver(1)|skin(1)	4						GTTTCTTTTCCTTGGCTTCTC	0.383													6	68	---	---	---	---	PASS
UBXN2A	165324	broad.mit.edu	37	2	24194180	24194180	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:24194180G>T	uc010exy.2	+	4	544	c.76G>T	c.(76-78)GGT>TGT	p.G26C	UBXN2A_uc002rem.2_RNA|UBXN2A_uc002ren.2_Missense_Mutation_p.G26C|UBXN2A_uc010ykj.1_Missense_Mutation_p.G26C	NM_181713	NP_859064	P68543	UBX2A_HUMAN	UBX domain containing 4	26											0						TCAACCTCTTGGTAATAATCA	0.328													9	173	---	---	---	---	PASS
DNMT3A	1788	broad.mit.edu	37	2	25497891	25497891	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:25497891C>A	uc002rgc.2	-	6	815	c.558G>T	c.(556-558)CCG>CCT	p.P186P	DNMT3A_uc002rgd.2_Silent_p.P186P|DNMT3A_uc010eyi.2_RNA	NM_022552	NP_072046	Q9Y6K1	DNM3A_HUMAN	DNA cytosine methyltransferase 3 alpha isoform	186					regulation of gene expression by genetic imprinting	cytoplasm|euchromatin|nuclear matrix	DNA (cytosine-5-)-methyltransferase activity|DNA binding|metal ion binding|protein binding			haematopoietic_and_lymphoid_tissue(133)|lung(4)|ovary(3)	140	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					AGGTGAGCCTCGGCATGGGCC	0.667			Mis|F|N|S		AML								4	7	---	---	---	---	PASS
DTNB	1838	broad.mit.edu	37	2	25875473	25875473	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:25875473G>T	uc002rgh.2	-	2	307	c.57C>A	c.(55-57)TTC>TTA	p.F19L	DTNB_uc010yko.1_5'Flank|DTNB_uc010ykp.1_5'UTR|DTNB_uc002rgo.2_5'UTR|DTNB_uc002rgi.2_Missense_Mutation_p.F19L|DTNB_uc002rgj.2_Missense_Mutation_p.F19L|DTNB_uc002rgk.2_Missense_Mutation_p.F19L|DTNB_uc002rgl.2_Missense_Mutation_p.F19L|DTNB_uc002rgq.2_Missense_Mutation_p.F19L|DTNB_uc002rgm.2_Missense_Mutation_p.F19L|DTNB_uc002rgn.2_5'UTR|DTNB_uc002rgr.1_Missense_Mutation_p.F8L|DTNB_uc010ykq.1_5'UTR	NM_021907	NP_068707	O60941	DTNB_HUMAN	dystrobrevin, beta isoform 1	19						cytoplasm	calcium ion binding|zinc ion binding			large_intestine(2)|ovary(2)	4	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					GCATTTCTATGAACAGCTGCC	0.383													8	191	---	---	---	---	PASS
C2orf70	339778	broad.mit.edu	37	2	26802211	26802211	+	Nonsense_Mutation	SNP	G	T	T	rs147381361	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:26802211G>T	uc010eyn.2	+	4	511	c.511G>T	c.(511-513)GAG>TAG	p.E171*		NM_001105519	NP_001098989	A6NJV1	CB070_HUMAN	hypothetical protein LOC339778	171										skin(1)	1						ACTAGCCCCCGAGAACCTGAA	0.532													5	41	---	---	---	---	PASS
MAPRE3	22924	broad.mit.edu	37	2	27245131	27245131	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27245131G>T	uc002rhw.2	+	2	198	c.45G>T	c.(43-45)CTG>CTT	p.L15L	MAPRE3_uc002rhx.2_Silent_p.L15L|MAPRE3_uc010yld.1_Silent_p.L15L	NM_012326	NP_036458	Q9UPY8	MARE3_HUMAN	microtubule-associated protein, RP/EB family,	15	CH.				cell division|mitosis|positive regulation of transcription, DNA-dependent	cytoplasm|cytoplasmic microtubule|microtubule|midbody|perinuclear region of cytoplasm	microtubule binding|protein binding|small GTPase regulator activity			ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					GTGAAAATCTGAGTCGCCATG	0.502													7	96	---	---	---	---	PASS
CCDC121	79635	broad.mit.edu	37	2	27849963	27849963	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27849963C>A	uc002rle.2	-	2	885	c.704G>T	c.(703-705)TGG>TTG	p.W235L	ZNF512_uc010yly.1_Intron|CCDC121_uc010eze.2_Missense_Mutation_p.W399L|CCDC121_uc002rld.2_Missense_Mutation_p.W397L|GPN1_uc010ezf.2_5'Flank|GPN1_uc010yma.1_5'Flank|GPN1_uc010ymb.1_5'Flank|GPN1_uc010ymc.1_5'Flank|GPN1_uc010ymd.1_5'Flank|GPN1_uc010yme.1_5'Flank|GPN1_uc010ezg.1_5'Flank	NM_024584	NP_078860	Q6ZUS5	CC121_HUMAN	coiled-coil domain containing 121 isoform 3	235	Potential.										0	Acute lymphoblastic leukemia(172;0.155)					CTCCAGATACCACTGTTCCTG	0.478													5	50	---	---	---	---	PASS
HEATR5B	54497	broad.mit.edu	37	2	37310555	37310555	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:37310555C>A	uc002rpp.1	-	2	99	c.3G>T	c.(1-3)ATG>ATT	p.M1I	CCDC75_uc010ezz.2_5'Flank|CCDC75_uc002rpr.3_5'Flank	NM_019024	NP_061897	Q9P2D3	HTR5B_HUMAN	HEAT repeat containing 5B	1							binding			ovary(5)|skin(2)|breast(1)	8		all_hematologic(82;0.21)				GGGCTAACTCCATTACGGAAG	0.318													6	74	---	---	---	---	PASS
FAM82A1	151393	broad.mit.edu	37	2	38178405	38178405	+	Intron	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:38178405G>C	uc002rql.2	+						FAM82A1_uc002rqn.1_Missense_Mutation_p.R16P|FAM82A1_uc002rqk.1_Intron|FAM82A1_uc002rqm.2_Intron	NM_144713	NP_653314	Q96LZ7	RMD2_HUMAN	family with sequence similarity 82, member A1							cytoplasm|integral to membrane|microtubule|spindle pole	binding			ovary(1)	1						AGCTTCCAACGATGTTCTCCA	0.453													5	56	---	---	---	---	PASS
ATL2	64225	broad.mit.edu	37	2	38546127	38546127	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:38546127G>T	uc002rqq.2	-	3	428	c.398C>A	c.(397-399)CCA>CAA	p.P133Q	ATL2_uc010ynm.1_Missense_Mutation_p.P115Q|ATL2_uc010ynn.1_Missense_Mutation_p.P115Q|ATL2_uc010yno.1_5'UTR|ATL2_uc002rqs.2_Missense_Mutation_p.P133Q|ATL2_uc002rqr.2_5'UTR	NM_001135673	NP_001129145	Q8NHH9	ATLA2_HUMAN	atlastin GTPase 2 isoform 2	133	Cytoplasmic.				endoplasmic reticulum organization|Golgi organization|protein homooligomerization	endoplasmic reticulum membrane|integral to membrane	GTP binding|GTPase activity|identical protein binding			ovary(1)|kidney(1)|skin(1)	3						GCCTGTCAATGGTTCATTGTT	0.348													10	299	---	---	---	---	PASS
USP34	9736	broad.mit.edu	37	2	61528293	61528293	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:61528293C>A	uc002sbe.2	-	29	3943	c.3921G>T	c.(3919-3921)ATG>ATT	p.M1307I		NM_014709	NP_055524	Q70CQ2	UBP34_HUMAN	ubiquitin specific protease 34	1307					positive regulation of canonical Wnt receptor signaling pathway|protein K48-linked deubiquitination|ubiquitin-dependent protein catabolic process|Wnt receptor signaling pathway		cysteine-type endopeptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(8)|breast(5)|skin(3)|lung(2)|prostate(1)	19			Epithelial(17;0.229)			ATACAAATACCATCTATAAAA	0.368													7	92	---	---	---	---	PASS
PCYOX1	51449	broad.mit.edu	37	2	70486552	70486552	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:70486552G>T	uc002sgn.3	+	2	239	c.173G>T	c.(172-174)GGG>GTG	p.G58V	PCYOX1_uc010fdo.2_5'UTR|PCYOX1_uc010yqu.1_Missense_Mutation_p.G58V	NM_016297	NP_057381	Q9UHG3	PCYOX_HUMAN	prenylcysteine oxidase 1 precursor	58					prenylated protein catabolic process	lysosome|very-low-density lipoprotein particle	prenylcysteine oxidase activity			central_nervous_system(1)	1						CAGAAATTTGGGAAAGATGTG	0.483													10	231	---	---	---	---	PASS
MPHOSPH10	10199	broad.mit.edu	37	2	71361836	71361836	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71361836C>A	uc002sht.1	+	4	1359	c.1007C>A	c.(1006-1008)CCA>CAA	p.P336Q	MPHOSPH10_uc010feb.1_Missense_Mutation_p.P336Q	NM_005791	NP_005782	O00566	MPP10_HUMAN	M-phase phosphoprotein 10	336					RNA splicing, via transesterification reactions|rRNA processing	chromosome|nucleolus|small nucleolar ribonucleoprotein complex	protein binding			skin(2)|ovary(1)	3						TTTGCTTTACCAGATGATGCG	0.323													8	204	---	---	---	---	PASS
DYSF	8291	broad.mit.edu	37	2	71795475	71795475	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:71795475C>A	uc002sie.2	+						DYSF_uc010feg.2_Intron|DYSF_uc010feh.2_Intron|DYSF_uc002sig.3_Intron|DYSF_uc010yqx.1_Intron|DYSF_uc010fee.2_Intron|DYSF_uc010fef.2_Intron|DYSF_uc010fei.2_Intron|DYSF_uc010fek.2_Intron|DYSF_uc010fej.2_Intron|DYSF_uc010fel.2_Intron|DYSF_uc010feo.2_Intron|DYSF_uc010fem.2_Intron|DYSF_uc010fen.2_Intron|DYSF_uc002sif.2_Intron	NM_003494	NP_003485	O75923	DYSF_HUMAN	dysferlin isoform 8							cytoplasmic vesicle membrane|integral to membrane|sarcolemma	calcium-dependent phospholipid binding			ovary(3)|breast(2)|pancreas(1)|skin(1)	7						AGACGTGAGTCGTGGGCAGGG	0.642													5	105	---	---	---	---	PASS
ALMS1	7840	broad.mit.edu	37	2	73680088	73680088	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73680088G>T	uc002sje.1	+	10	6548	c.6437G>T	c.(6436-6438)CGA>CTA	p.R2146L	ALMS1_uc002sjf.1_Missense_Mutation_p.R2102L|ALMS1_uc002sjg.2_Missense_Mutation_p.R1532L|ALMS1_uc002sjh.1_Missense_Mutation_p.R1532L	NM_015120	NP_055935	Q8TCU4	ALMS1_HUMAN	Alstrom syndrome 1	2144	34 X 47 AA approximate tandem repeat.|33.				G2/M transition of mitotic cell cycle	centrosome|cilium|cytosol|microtubule basal body|spindle pole				skin(3)|ovary(2)|breast(2)|pancreas(1)|lung(1)	9						TTTTCACATCGAGAGAAACCA	0.403													5	48	---	---	---	---	PASS
TPRKB	51002	broad.mit.edu	37	2	73961573	73961573	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:73961573G>T	uc002sjn.2	-	2	235	c.124C>A	c.(124-126)CTG>ATG	p.L42M	TPRKB_uc002sjm.2_Missense_Mutation_p.L42M|TPRKB_uc002sjl.2_Intron|TPRKB_uc002sjo.2_Missense_Mutation_p.L42M|TPRKB_uc010yrm.1_Intron	NM_016058	NP_057142	Q9Y3C4	TPRKB_HUMAN	TP53RK binding protein	42					protein catabolic process	cytosol|nucleus	protein kinase binding			ovary(1)|skin(1)	2						GGATTTATCAGTGATCCATCG	0.289													6	89	---	---	---	---	PASS
SEMA4F	10505	broad.mit.edu	37	2	74906814	74906814	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74906814G>T	uc002sna.1	+	14	1902	c.1791G>T	c.(1789-1791)GTG>GTT	p.V597V	SEMA4F_uc010ffr.1_Silent_p.V209V|SEMA4F_uc002snb.1_Silent_p.V209V|SEMA4F_uc002snc.1_Silent_p.V442V	NM_004263	NP_004254	O95754	SEM4F_HUMAN	semaphorin W precursor	597	Ig-like C2-type.|Extracellular (Potential).				cell-cell signaling	endoplasmic reticulum|integral to plasma membrane	receptor activity			ovary(2)|pancreas(1)|skin(1)	4						CATCCTGTGTGTGGCACCAGC	0.592													6	74	---	---	---	---	PASS
LRRTM4	80059	broad.mit.edu	37	2	77746397	77746397	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:77746397C>A	uc002snr.2	-	3	1013	c.598G>T	c.(598-600)GCA>TCA	p.A200S	LRRTM4_uc002snq.2_Missense_Mutation_p.A200S|LRRTM4_uc002sns.2_Missense_Mutation_p.A200S|LRRTM4_uc002snt.2_Missense_Mutation_p.A201S	NM_001134745	NP_001128217	Q86VH4	LRRT4_HUMAN	leucine rich repeat transmembrane neuronal 4	200	Extracellular (Potential).|LRR 6.					integral to membrane				pancreas(3)|ovary(1)	4				Colorectal(11;0.059)		CCAGCAAATGCATTTCGGGAC	0.438													5	63	---	---	---	---	PASS
REG3G	130120	broad.mit.edu	37	2	79254970	79254970	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:79254970G>T	uc002snw.2	+	5	456	c.371G>T	c.(370-372)AGC>ATC	p.S124I	REG3G_uc002snx.2_Missense_Mutation_p.S124I|REG3G_uc010ffu.2_Missense_Mutation_p.S78I	NM_198448	NP_940850	Q6UW15	REG3G_HUMAN	regenerating islet-derived 3 gamma precursor	124	C-type lectin.				acute-phase response	extracellular region	sugar binding				0						GAGTGGAGTAGCACTGATGTG	0.507													15	88	---	---	---	---	PASS
CTNNA2	1496	broad.mit.edu	37	2	80085138	80085138	+	Splice_Site	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:80085138G>T	uc010ysh.1	+	3	304	c.299_splice	c.e3-1	p.G100_splice	CTNNA2_uc010yse.1_Splice_Site_p.G100_splice|CTNNA2_uc010ysf.1_Splice_Site_p.G100_splice|CTNNA2_uc010ysg.1_Splice_Site_p.G100_splice	NM_004389	NP_004380	P26232	CTNA2_HUMAN	catenin, alpha 2 isoform 1						axonogenesis|brain morphogenesis|cell-cell adhesion|dendrite morphogenesis|muscle cell differentiation|positive regulation of muscle cell differentiation|prepulse inhibition|radial glia guided migration of Purkinje cell|regulation of synapse structural plasticity	actin cytoskeleton|axon|cytosol	cadherin binding|structural constituent of cytoskeleton			pancreas(4)|lung(3)|breast(1)|skin(1)	9						CTGTCTTCCAGGTGAGACGAT	0.542													13	62	---	---	---	---	PASS
CTNNA2	1496	broad.mit.edu	37	2	80096961	80096961	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:80096961C>A	uc010ysh.1	+	4	490	c.485C>A	c.(484-486)GCT>GAT	p.A162D	CTNNA2_uc010yse.1_Missense_Mutation_p.A162D|CTNNA2_uc010ysf.1_Missense_Mutation_p.A162D|CTNNA2_uc010ysg.1_Missense_Mutation_p.A162D	NM_004389	NP_004380	P26232	CTNA2_HUMAN	catenin, alpha 2 isoform 1	162					axonogenesis|brain morphogenesis|cell-cell adhesion|dendrite morphogenesis|muscle cell differentiation|positive regulation of muscle cell differentiation|prepulse inhibition|radial glia guided migration of Purkinje cell|regulation of synapse structural plasticity	actin cytoskeleton|axon|cytosol	cadherin binding|structural constituent of cytoskeleton			pancreas(4)|lung(3)|breast(1)|skin(1)	9						GCCCTGGAAGCTGTCAAAAAT	0.373													17	75	---	---	---	---	PASS
DNAH6	1768	broad.mit.edu	37	2	84784929	84784929	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:84784929C>A	uc010fgb.2	+	11	1810	c.1673C>A	c.(1672-1674)TCG>TAG	p.S558*	DNAH6_uc002soo.2_Nonsense_Mutation_p.S137*|DNAH6_uc002sop.2_Nonsense_Mutation_p.S137*	NM_001370	NP_001361	Q9C0G6	DYH6_HUMAN	dynein, axonemal, heavy polypeptide 6	558	Stem (By similarity).				microtubule-based movement	cilium axoneme|cytoplasm|dynein complex|microtubule	ATP binding|ATPase activity|microtubule motor activity			central_nervous_system(1)	1						GTGCCTGATTCGTATTTTGAT	0.378													6	141	---	---	---	---	PASS
DNAH6	1768	broad.mit.edu	37	2	84784986	84784986	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:84784986G>T	uc010fgb.2	+	11	1867	c.1730G>T	c.(1729-1731)TGT>TTT	p.C577F	DNAH6_uc002soo.2_Missense_Mutation_p.C156F|DNAH6_uc002sop.2_Missense_Mutation_p.C156F	NM_001370	NP_001361	Q9C0G6	DYH6_HUMAN	dynein, axonemal, heavy polypeptide 6	577	Stem (By similarity).				microtubule-based movement	cilium axoneme|cytoplasm|dynein complex|microtubule	ATP binding|ATPase activity|microtubule motor activity			central_nervous_system(1)	1						GGAAAAACCTGTGGAACTGGG	0.353													6	91	---	---	---	---	PASS
CAPG	822	broad.mit.edu	37	2	85628769	85628769	+	Silent	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:85628769G>C	uc002spl.1	-	4	484	c.234C>G	c.(232-234)GCC>GCG	p.A78A	CAPG_uc002spm.1_Silent_p.A78A|CAPG_uc010ysq.1_Silent_p.A78A|CAPG_uc010fgi.1_Silent_p.A78A|CAPG_uc010fgj.1_5'UTR	NM_001747	NP_001738	P40121	CAPG_HUMAN	gelsolin-like capping protein	78					barbed-end actin filament capping|protein complex assembly	F-actin capping protein complex|melanosome|nuclear membrane|nucleolus	actin binding				0						CAGCCAGCACGGCACAGGCCC	0.652													4	20	---	---	---	---	PASS
VPS24	51652	broad.mit.edu	37	2	86756432	86756432	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:86756432C>A	uc002srj.2	-	3	324	c.195G>T	c.(193-195)AAG>AAT	p.K65N	VPS24_uc002srk.2_Translation_Start_Site|VPS24_uc002srl.2_Missense_Mutation_p.K65N|VPS24_uc010ytl.1_Missense_Mutation_p.K94N	NM_016079	NP_057163	Q9Y3E7	CHMP3_HUMAN	vacuolar protein sorting 24 isoform 1	65	Intramolecular interaction with C- terminus.				cell cycle|cell division|cellular membrane organization|endosome transport|protein transport	cytosol|late endosome membrane	protein binding			central_nervous_system(1)	1						TGATCATCTCCTTGGCCAGAA	0.458													7	118	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	2	90199179	90199179	+	RNA	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:90199179A>G	uc010fhm.2	+	24		c.3310A>G								Parts of antibodies, mostly variable regions.																		TCAACAGGCTAACAGTTTCCC	0.527													18	60	---	---	---	---	PASS
REV1	51455	broad.mit.edu	37	2	100029392	100029392	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:100029392G>A	uc002tad.2	-	13	2185	c.1973C>T	c.(1972-1974)TCT>TTT	p.S658F	REV1_uc002tac.2_Missense_Mutation_p.S657F	NM_016316	NP_057400	Q9UBZ9	REV1_HUMAN	REV1-like isoform 1	658					DNA replication|error-prone translesion synthesis|response to UV	nucleoplasm	damaged DNA binding|DNA-directed DNA polymerase activity|magnesium ion binding|protein binding			ovary(2)	2						TGCCAACTTAGATTCCATTGA	0.353								DNA_polymerases_(catalytic_subunits)|Direct_reversal_of_damage					14	61	---	---	---	---	PASS
AFF3	3899	broad.mit.edu	37	2	100623925	100623925	+	Intron	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:100623925G>A	uc002tag.2	-						AFF3_uc002taf.2_Intron|AFF3_uc010fiq.1_Intron|AFF3_uc010yvr.1_Intron|AFF3_uc002tah.1_Intron|AFF3_uc010fir.1_Intron|AFF3_uc002tai.2_5'UTR	NM_002285	NP_002276	P51826	AFF3_HUMAN	AF4/FMR2 family, member 3 isoform 1						multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(2)|pancreas(1)|lung(1)|kidney(1)|skin(1)	6						TTGTTAGTCTGGAGAAAGAAA	0.418													10	83	---	---	---	---	PASS
PTPN4	5775	broad.mit.edu	37	2	120703926	120703926	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:120703926G>T	uc002tmf.1	+	17	2296	c.1525G>T	c.(1525-1527)GGT>TGT	p.G509C	PTPN4_uc010flj.1_Missense_Mutation_p.G222C|PTPN4_uc010yyr.1_Missense_Mutation_p.G142C	NM_002830	NP_002821	P29074	PTN4_HUMAN	protein tyrosine phosphatase, non-receptor type	509						cytoplasm|cytoskeleton|internal side of plasma membrane	cytoskeletal protein binding|non-membrane spanning protein tyrosine phosphatase activity			ovary(2)	2					Alendronate(DB00630)	GCCTAATGGTGGTATTCCACA	0.279													8	150	---	---	---	---	PASS
EPB41L5	57669	broad.mit.edu	37	2	120918470	120918470	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:120918470G>T	uc002tmg.2	+	21	1933	c.1807G>T	c.(1807-1809)GAG>TAG	p.E603*	EPB41L5_uc010fll.2_Nonsense_Mutation_p.E603*|EPB41L5_uc010flm.2_Nonsense_Mutation_p.E407*	NM_020909	NP_065960	Q9HCM4	E41L5_HUMAN	erythrocyte membrane protein band 4.1 like 5	603						cytoplasm|cytoskeleton|extrinsic to membrane	cytoskeletal protein binding			ovary(1)	1						TGTGTTAAATGAGAATAATGT	0.413													9	148	---	---	---	---	PASS
UGGT1	56886	broad.mit.edu	37	2	128878864	128878864	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:128878864C>A	uc002tps.2	+	10	1243	c.1065C>A	c.(1063-1065)ACC>ACA	p.T355T	UGGT1_uc010fme.1_Silent_p.T230T|UGGT1_uc002tpr.2_Silent_p.T331T	NM_020120	NP_064505	Q9NYU2	UGGG1_HUMAN	UDP-glucose ceramide glucosyltransferase-like 1	355					'de novo' posttranslational protein folding|post-translational protein modification|protein N-linked glycosylation via asparagine	endoplasmic reticulum lumen|ER-Golgi intermediate compartment	UDP-glucose:glycoprotein glucosyltransferase activity|unfolded protein binding			ovary(1)	1						ATTTTCCTACCAAAGCCAGGT	0.403													7	52	---	---	---	---	PASS
HNMT	3176	broad.mit.edu	37	2	138722134	138722134	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:138722134C>A	uc002tvc.2	+	2	221	c.73C>A	c.(73-75)CAT>AAT	p.H25N	HNMT_uc002tvd.2_Missense_Mutation_p.H25N|HNMT_uc002tve.2_Missense_Mutation_p.H25N|HNMT_uc002tvf.2_Missense_Mutation_p.H25N	NM_006895	NP_008826	P50135	HNMT_HUMAN	histamine N-methyltransferase isoform 1	25					respiratory gaseous exchange	cytoplasm	histamine N-methyltransferase activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.125)	Amodiaquine(DB00613)|Histamine Phosphate(DB00667)|Quinacrine(DB01103)	GTTTCTCAACCATTCCACGGA	0.458													7	133	---	---	---	---	PASS
HNMT	3176	broad.mit.edu	37	2	138762707	138762707	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:138762707G>T	uc002tvc.2	+	6	583	c.435G>T	c.(433-435)CTG>CTT	p.L145L	HNMT_uc002tvf.2_Silent_p.L145L	NM_006895	NP_008826	P50135	HNMT_HUMAN	histamine N-methyltransferase isoform 1	145					respiratory gaseous exchange	cytoplasm	histamine N-methyltransferase activity			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.125)	Amodiaquine(DB00613)|Histamine Phosphate(DB00667)|Quinacrine(DB01103)	TCTAGATGCTGTATTATGTAA	0.363													7	109	---	---	---	---	PASS
LRP1B	53353	broad.mit.edu	37	2	141665446	141665446	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:141665446C>A	uc002tvj.1	-	22	4492	c.3520G>T	c.(3520-3522)GAT>TAT	p.D1174Y	LRP1B_uc010fnl.1_Missense_Mutation_p.D356Y	NM_018557	NP_061027	Q9NZR2	LRP1B_HUMAN	low density lipoprotein-related protein 1B	1174	Extracellular (Potential).|LDL-receptor class A 10.				protein transport|receptor-mediated endocytosis	integral to membrane	calcium ion binding			lung(17)|skin(12)|ovary(12)|pancreas(3)|upper_aerodigestive_tract(2)|central_nervous_system(2)|liver(1)|kidney(1)	50		all_cancers(3;1.1e-60)|all_epithelial(3;1.94e-59)|all_lung(3;1.09e-24)|Lung NSC(3;5.65e-24)|Esophageal squamous(3;5.41e-13)|Renal(3;0.000147)|Breast(3;0.000527)|Hepatocellular(3;0.011)|all_neural(3;0.014)|Colorectal(150;0.101)		UCEC - Uterine corpus endometrioid carcinoma (2;0.00139)|Epithelial(1;1.25e-24)|all cancers(1;8.86e-24)|OV - Ovarian serous cystadenocarcinoma(1;2.45e-12)|LUSC - Lung squamous cell carcinoma(1;2.97e-10)|Lung(1;6.05e-09)|BRCA - Breast invasive adenocarcinoma(221;0.0103)		CATGCAATACCACAGAGATAG	0.403										TSP Lung(27;0.18)			8	144	---	---	---	---	PASS
GTDC1	79712	broad.mit.edu	37	2	144903215	144903215	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:144903215C>A	uc002tvp.2	-	5	550	c.271G>T	c.(271-273)GAG>TAG	p.E91*	GTDC1_uc002tvo.2_Nonsense_Mutation_p.E91*|GTDC1_uc002tvq.2_Nonsense_Mutation_p.E91*|GTDC1_uc002tvr.2_Nonsense_Mutation_p.E91*|GTDC1_uc010fnn.2_Nonsense_Mutation_p.E91*|GTDC1_uc002tvs.2_Nonsense_Mutation_p.E59*|GTDC1_uc010fno.2_5'UTR|GTDC1_uc002tvt.1_Nonsense_Mutation_p.E91*	NM_001006636	NP_001006637	Q4AE62	GTDC1_HUMAN	glycosyltransferase-like domain containing 1	91					biosynthetic process		transferase activity, transferring glycosyl groups			ovary(1)	1				BRCA - Breast invasive adenocarcinoma(221;0.0914)		AACTGGTTCTCGTGAAAATAC	0.418													5	61	---	---	---	---	PASS
NEB	4703	broad.mit.edu	37	2	152543961	152543961	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:152543961G>A	uc010fnx.2	-	27	2800	c.2609C>T	c.(2608-2610)TCC>TTC	p.S870F		NM_004543	NP_004534	P20929	NEBU_HUMAN	nebulin isoform 3	870	Nebulin 20.				muscle filament sliding|muscle organ development|regulation of actin filament length|somatic muscle development	actin cytoskeleton|cytosol|Z disc	actin binding|structural constituent of muscle			ovary(8)|large_intestine(5)|breast(3)|central_nervous_system(2)|skin(1)|pancreas(1)	20				BRCA - Breast invasive adenocarcinoma(221;0.219)		TGTCTTCAAGGAGTGCAGCAT	0.438													11	132	---	---	---	---	PASS
PRPF40A	55660	broad.mit.edu	37	2	153532918	153532918	+	Splice_Site	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:153532918C>G	uc002tyi.2	-	10	1125	c.1112_splice	c.e10+1	p.D371_splice	PRPF40A_uc002tyh.3_Splice_Site_p.D344_splice|PRPF40A_uc010zcd.1_Splice_Site_p.D291_splice|PRPF40A_uc002tyj.2_Splice_Site_p.D240_splice	NM_017892	NP_060362	O75400	PR40A_HUMAN	formin binding protein 3						mRNA processing|RNA splicing	nuclear matrix|nuclear speck	protein binding				0						ACTAAACTTACTCAGCTACAG	0.333													3	9	---	---	---	---	PASS
GALNT13	114805	broad.mit.edu	37	2	154801051	154801051	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:154801051C>A	uc002tyr.3	+	3	608	c.41C>A	c.(40-42)TCG>TAG	p.S14*	GALNT13_uc002tyt.3_Nonsense_Mutation_p.S14*	NM_052917	NP_443149	Q8IUC8	GLT13_HUMAN	UDP-N-acetyl-alpha-D-galactosamine:polypeptide	14	Helical; Signal-anchor for type II membrane protein; (Potential).					Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding			ovary(2)|pancreas(2)|central_nervous_system(1)|skin(1)	6						CTAGCCACTTCGCTGATGTGG	0.418													6	112	---	---	---	---	PASS
FAP	2191	broad.mit.edu	37	2	163070542	163070542	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:163070542C>A	uc002ucd.2	-	11	1116	c.908G>T	c.(907-909)CGA>CTA	p.R303L	FAP_uc010zct.1_Missense_Mutation_p.R278L|FAP_uc010fpd.2_Intron|FAP_uc010fpe.1_Missense_Mutation_p.R270L	NM_004460	NP_004451	Q12884	SEPR_HUMAN	fibroblast activation protein, alpha subunit	303	Extracellular (Potential).				endothelial cell migration|negative regulation of extracellular matrix disassembly|proteolysis	cell junction|integral to membrane|invadopodium membrane|lamellipodium membrane	dipeptidyl-peptidase activity|metalloendopeptidase activity|protein homodimerization activity|serine-type endopeptidase activity			ovary(3)	3						CAAACATACTCGTTCATCAGT	0.408													5	74	---	---	---	---	PASS
FIGN	55137	broad.mit.edu	37	2	164591413	164591413	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:164591413C>A	uc002uck.1	-	2	336	c.25G>T	c.(25-27)GGC>TGC	p.G9C		NM_018086	NP_060556	Q5HY92	FIGN_HUMAN	fidgetin	9						nuclear matrix	ATP binding|nucleoside-triphosphatase activity			large_intestine(2)|ovary(1)|skin(1)	4						ACTGACATACCATAAACACTG	0.388													6	75	---	---	---	---	PASS
GRB14	2888	broad.mit.edu	37	2	165353980	165353980	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:165353980G>T	uc002ucl.2	-	10	1666	c.1125C>A	c.(1123-1125)TCC>TCA	p.S375S	GRB14_uc010zcv.1_Silent_p.S288S|GRB14_uc002ucm.2_RNA	NM_004490	NP_004481	Q14449	GRB14_HUMAN	growth factor receptor-bound protein 14	375					blood coagulation|leukocyte migration	cytosol|endosome membrane|Golgi membrane|microsome|plasma membrane	SH3/SH2 adaptor activity			ovary(5)|upper_aerodigestive_tract(1)|lung(1)	7						TTGCTACCAGGGAATTCTCTG	0.368													7	94	---	---	---	---	PASS
COBLL1	22837	broad.mit.edu	37	2	165551734	165551734	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:165551734C>A	uc010zcw.1	-	15	2607	c.2483G>T	c.(2482-2484)CGA>CTA	p.R828L	COBLL1_uc002ucp.2_Missense_Mutation_p.R761L|COBLL1_uc002ucq.2_Missense_Mutation_p.R723L|COBLL1_uc010zcx.1_Missense_Mutation_p.R769L|COBLL1_uc002ucn.2_Missense_Mutation_p.R189L|COBLL1_uc002uco.2_Missense_Mutation_p.R492L	NM_014900	NP_055715	Q53SF7	COBL1_HUMAN	COBL-like 1	799										ovary(2)|pancreas(1)	3						TATATACTCTCGTGTAATTTC	0.358													6	147	---	---	---	---	PASS
SCN1A	6323	broad.mit.edu	37	2	166866246	166866246	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:166866246G>T	uc010zcz.1	-	20	3970	c.3952C>A	c.(3952-3954)CGA>AGA	p.R1318R	SCN1A_uc002udo.3_Silent_p.R1198R|SCN1A_uc010fpk.2_Silent_p.R1170R	NM_006920	NP_008851	P35498	SCN1A_HUMAN	sodium channel, voltage-gated, type I, alpha	1329	Helical; Voltage-sensor; Name=S4 of repeat III; (By similarity).|III.					voltage-gated sodium channel complex	voltage-gated sodium channel activity			ovary(6)|skin(6)|large_intestine(1)	13					Lamotrigine(DB00555)|Levetiracetam(DB01202)|Phenacemide(DB01121)|Phenytoin(DB00252)|Topiramate(DB00273)|Zonisamide(DB00909)	CCTTCAAATCGAGATAAGGCT	0.358													5	68	---	---	---	---	PASS
G6PC2	57818	broad.mit.edu	37	2	169764369	169764369	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:169764369G>T	uc002uem.2	+	5	940	c.848G>T	c.(847-849)CGA>CTA	p.R283L	G6PC2_uc002uen.2_3'UTR|G6PC2_uc010fpv.2_Missense_Mutation_p.R167L	NM_021176	NP_066999	Q9NQR9	G6PC2_HUMAN	islet-specific glucose-6-phosphatase-related	283	Cytoplasmic (Potential).				gluconeogenesis|glucose homeostasis|glucose transport|regulation of insulin secretion|transmembrane transport	endoplasmic reticulum membrane|integral to membrane	glucose-6-phosphatase activity			pancreas(1)	1						CTGAGCTGCCGAGGGGGAAAT	0.517													5	50	---	---	---	---	PASS
LRP2	4036	broad.mit.edu	37	2	170007453	170007453	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170007453G>A	uc002ues.2	-	68	12758	c.12545C>T	c.(12544-12546)ACT>ATT	p.T4182I		NM_004525	NP_004516	P98164	LRP2_HUMAN	low density lipoprotein-related protein 2	4182	Extracellular (Potential).|LDL-receptor class B 35.				hormone biosynthetic process|protein glycosylation|receptor-mediated endocytosis|vitamin D metabolic process	coated pit|integral to membrane|lysosome	calcium ion binding|receptor activity|SH3 domain binding			ovary(13)|skin(6)|central_nervous_system(4)|large_intestine(3)|kidney(2)|pancreas(1)	29				STAD - Stomach adenocarcinoma(1183;0.000766)|COAD - Colon adenocarcinoma(177;0.0101)	Gentamicin(DB00798)|Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Urokinase(DB00013)	GTCCAGGTCAGTGGAAATCAG	0.433													15	75	---	---	---	---	PASS
LRP2	4036	broad.mit.edu	37	2	170070377	170070377	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:170070377C>A	uc002ues.2	-	36	6043	c.5830G>T	c.(5830-5832)GAA>TAA	p.E1944*		NM_004525	NP_004516	P98164	LRP2_HUMAN	low density lipoprotein-related protein 2	1944	LDL-receptor class B 18.|Extracellular (Potential).				hormone biosynthetic process|protein glycosylation|receptor-mediated endocytosis|vitamin D metabolic process	coated pit|integral to membrane|lysosome	calcium ion binding|receptor activity|SH3 domain binding			ovary(13)|skin(6)|central_nervous_system(4)|large_intestine(3)|kidney(2)|pancreas(1)	29				STAD - Stomach adenocarcinoma(1183;0.000766)|COAD - Colon adenocarcinoma(177;0.0101)	Gentamicin(DB00798)|Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)|Urokinase(DB00013)	TTTCCTCTTTCAATCTAAAGG	0.328													5	31	---	---	---	---	PASS
MYO3B	140469	broad.mit.edu	37	2	171509574	171509574	+	Silent	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:171509574A>T	uc002ufy.2	+	35	4112	c.3969A>T	c.(3967-3969)TCA>TCT	p.S1323S	MYO3B_uc002ufz.2_Silent_p.S1296S|MYO3B_uc002ufw.2_RNA|MYO3B_uc002ufx.2_RNA|MYO3B_uc002ugb.2_RNA|uc002ugc.1_Intron	NM_138995	NP_620482	Q8WXR4	MYO3B_HUMAN	myosin IIIB isoform 2	1323					response to stimulus|visual perception	cytoplasm|myosin complex	actin binding|ATP binding|motor activity|protein serine/threonine kinase activity			lung(8)|ovary(6)|skin(4)|central_nervous_system(1)	19						AGAACAACTCAGCCCACCCTT	0.408													12	69	---	---	---	---	PASS
ZAK	51776	broad.mit.edu	37	2	174097194	174097194	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:174097194G>T	uc002uhz.2	+						uc002uib.2_Intron	NM_016653	NP_057737	Q9NYL2	MLTK_HUMAN	MLK-related kinase isoform 1						activation of JUN kinase activity|activation of MAPKK activity|cell cycle arrest|cell death|cell differentiation|cell proliferation|DNA damage checkpoint|positive regulation of apoptosis|response to radiation	cytoplasm|nucleus	ATP binding|identical protein binding|magnesium ion binding|MAP kinase kinase kinase activity|protein binding			lung(3)|stomach(1)|ovary(1)|skin(1)	6			OV - Ovarian serous cystadenocarcinoma(117;0.176)			CAAGGTACCTGAGAAAGGGAC	0.318													11	258	---	---	---	---	PASS
HOXD10	3236	broad.mit.edu	37	2	176981715	176981715	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:176981715G>T	uc002ukj.2	+	1	224	c.154G>T	c.(154-156)GGA>TGA	p.G52*		NM_002148	NP_002139	P28358	HXD10_HUMAN	homeobox D10	52						nucleus	sequence-specific DNA binding			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.0207)|Epithelial(96;0.18)	Colorectal(32;0.0226)|READ - Rectum adenocarcinoma(9;0.0556)		GCAAACCTGTGGACTGCTCCC	0.493													6	70	---	---	---	---	PASS
OSBPL6	114880	broad.mit.edu	37	2	179259110	179259110	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179259110C>A	uc002ulx.2	+	24	3022	c.2644C>A	c.(2644-2646)CGG>AGG	p.R882R	OSBPL6_uc002uly.2_Silent_p.R907R|OSBPL6_uc010zfe.1_Silent_p.R851R|OSBPL6_uc002ulz.2_Silent_p.R846R|OSBPL6_uc002uma.2_Silent_p.R886R	NM_032523	NP_115912	Q9BZF3	OSBL6_HUMAN	oxysterol-binding protein-like protein 6 isoform	882					lipid transport		lipid binding			pancreas(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.00578)|Epithelial(96;0.00847)|all cancers(119;0.0335)			CCAGAGATCTCGGAGACGATA	0.353													6	139	---	---	---	---	PASS
PRKRA	8575	broad.mit.edu	37	2	179315083	179315083	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179315083C>A	uc002umf.2	-	2	322	c.121G>T	c.(121-123)GAA>TAA	p.E41*	PRKRA_uc002umd.2_Nonsense_Mutation_p.E16*|PRKRA_uc002ume.2_Nonsense_Mutation_p.E30*|PRKRA_uc002umg.2_5'UTR|DFNB59_uc002umi.3_5'Flank	NM_003690	NP_003681	O75569	PRKRA_HUMAN	protein kinase, interferon-inducible double	41	Sufficient for self-association and interaction with TARBP2.|DRBM 1.				immune response|negative regulation of cell proliferation|production of siRNA involved in RNA interference|response to virus	perinuclear region of cytoplasm	double-stranded RNA binding|enzyme activator activity|protein homodimerization activity			central_nervous_system(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(117;0.00406)|Epithelial(96;0.00634)|all cancers(119;0.0265)			ATGCCGTATTCGTGTAATACC	0.433													8	207	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179400362	179400362	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179400362C>A	uc010zfg.1	-	307	93500	c.93276G>T	c.(93274-93276)GAG>GAT	p.E31092D	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.E24787D|TTN_uc010zfi.1_Missense_Mutation_p.E24720D|TTN_uc010zfj.1_Missense_Mutation_p.E24595D	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	32019							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			CATCTTTTCTCTCTACCCCAT	0.433													10	141	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179432907	179432907	+	Silent	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179432907A>T	uc010zfg.1	-	275	70472	c.70248T>A	c.(70246-70248)GCT>GCA	p.A23416A	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Silent_p.A17111A|TTN_uc010zfi.1_Silent_p.A17044A|TTN_uc010zfj.1_Silent_p.A16919A	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	24343							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			AGGGATATTGAGCTACAATTG	0.423													33	129	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179458825	179458825	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179458825C>A	uc010zfg.1	-	246	50815	c.50591G>T	c.(50590-50592)CGC>CTC	p.R16864L	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.R10559L|TTN_uc010zfi.1_Missense_Mutation_p.R10492L|TTN_uc010zfj.1_Missense_Mutation_p.R10367L	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	17791							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			TATATGAGTGCGATCATCTTC	0.463													5	89	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179463947	179463947	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179463947C>A	uc010zfg.1	-	239	49093	c.48869G>T	c.(48868-48870)CGA>CTA	p.R16290L	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.R9985L|TTN_uc010zfi.1_Missense_Mutation_p.R9918L|TTN_uc010zfj.1_Missense_Mutation_p.R9793L	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	17217							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			GGCCATGATTCGGAATACATA	0.433													7	225	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179468687	179468687	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179468687G>T	uc010zfg.1	-	231	47247	c.47023C>A	c.(47023-47025)CAG>AAG	p.Q15675K	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.Q9370K|TTN_uc010zfi.1_Missense_Mutation_p.Q9303K|TTN_uc010zfj.1_Missense_Mutation_p.Q9178K	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	16602							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			GCTCTGAACTGGTATTTAACG	0.458													8	133	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179484438	179484438	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179484438G>T	uc010zfg.1	-	199	39126	c.38902C>A	c.(38902-38904)CTA>ATA	p.L12968I	TTN_uc010zfh.1_Missense_Mutation_p.L6663I|TTN_uc010zfi.1_Missense_Mutation_p.L6596I|TTN_uc010zfj.1_Missense_Mutation_p.L6471I	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	13895							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			CAAATCTGTAGTCGATGTATC	0.423													7	149	---	---	---	---	PASS
TTN	7273	broad.mit.edu	37	2	179545846	179545846	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:179545846G>T	uc010zfg.1	-	135	29792	c.29568C>A	c.(29566-29568)ACC>ACA	p.T9856T	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Silent_p.T6517T|TTN_uc010fre.1_Intron|TTN_uc002una.1_5'Flank|TTN_uc010frf.1_5'Flank	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	10783							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			TTTCACGTTTGGTAATTGAAA	0.328													6	69	---	---	---	---	PASS
ZNF804A	91752	broad.mit.edu	37	2	185801162	185801162	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:185801162C>G	uc002uph.2	+	4	1633	c.1039C>G	c.(1039-1041)CCT>GCT	p.P347A		NM_194250	NP_919226	Q7Z570	Z804A_HUMAN	zinc finger protein 804A	347						intracellular	zinc ion binding			ovary(6)|skin(3)|large_intestine(1)|pancreas(1)	11						TGAAGACATACCTGTTAGTGG	0.353													16	38	---	---	---	---	PASS
TFPI	7035	broad.mit.edu	37	2	188361711	188361711	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:188361711G>A	uc002upx.2	-	3	249	c.216C>T	c.(214-216)TTC>TTT	p.F72F	TFPI_uc002upy.2_Silent_p.F72F|TFPI_uc002upz.2_Silent_p.F68F|TFPI_uc002uqa.2_Silent_p.F72F|TFPI_uc002uqb.2_Silent_p.F72F	NM_006287	NP_006278	P10646	TFPI1_HUMAN	tissue factor pathway inhibitor isoform a	72	BPTI/Kunitz inhibitor 1.				blood coagulation, extrinsic pathway	extracellular space|plasma membrane	serine-type endopeptidase inhibitor activity			skin(1)	1			OV - Ovarian serous cystadenocarcinoma(117;0.0554)		Coagulation factor VIIa(DB00036)	TGAAAATATTGAAGAAAAATC	0.368													6	56	---	---	---	---	PASS
STAT1	6772	broad.mit.edu	37	2	191849039	191849039	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:191849039G>T	uc002usj.2	-	16	1732	c.1344C>A	c.(1342-1344)CTC>CTA	p.L448L	STAT1_uc010fse.1_Silent_p.L448L|STAT1_uc002usk.2_Silent_p.L448L|STAT1_uc002usl.2_Silent_p.L450L|STAT1_uc010fsf.1_Silent_p.L260L	NM_007315	NP_009330	P42224	STAT1_HUMAN	signal transducer and activator of transcription	448					activation of caspase activity|I-kappaB kinase/NF-kappaB cascade|interferon-gamma-mediated signaling pathway|interspecies interaction between organisms|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|response to virus|type I interferon-mediated signaling pathway|tyrosine phosphorylation of STAT protein	cytosol|nucleolus|nucleoplasm	calcium ion binding|protein binding|RNA polymerase II core promoter sequence-specific DNA binding|RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity|signal transducer activity			lung(3)|breast(3)|central_nervous_system(2)|upper_aerodigestive_tract(1)|ovary(1)	10			OV - Ovarian serous cystadenocarcinoma(117;0.00434)|Epithelial(96;0.0555)|all cancers(119;0.141)		Fludarabine(DB01073)	GTCTTACCTCGAGGTCAATTA	0.378													5	134	---	---	---	---	PASS
STAT4	6775	broad.mit.edu	37	2	191934480	191934480	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:191934480G>T	uc002usm.1	-	6	737	c.483C>A	c.(481-483)ACC>ACA	p.T161T	STAT4_uc002usn.1_Silent_p.T161T|STAT4_uc010zgk.1_Silent_p.T6T|STAT4_uc002uso.2_Silent_p.T161T	NM_003151	NP_003142	Q14765	STAT4_HUMAN	signal transducer and activator of transcription	161					JAK-STAT cascade	cytoplasm|nucleus	calcium ion binding|protein binding|sequence-specific DNA binding transcription factor activity|signal transducer activity			breast(3)|skin(2)|lung(1)|ovary(1)|prostate(1)|pancreas(1)	9			OV - Ovarian serous cystadenocarcinoma(117;0.00854)|Epithelial(96;0.0864)|all cancers(119;0.204)			CTAAGTATTTGGTATCTTGTT	0.299													7	102	---	---	---	---	PASS
MYO1B	4430	broad.mit.edu	37	2	192228559	192228559	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:192228559C>A	uc010fsg.2	+	10	1126	c.871C>A	c.(871-873)CGA>AGA	p.R291R	MYO1B_uc002usq.2_Silent_p.R291R|MYO1B_uc002usr.2_Silent_p.R291R|MYO1B_uc002uss.1_Silent_p.R291R	NM_001130158	NP_001123630	O43795	MYO1B_HUMAN	myosin IB isoform 1	291	Myosin head-like.					myosin complex	actin binding|ATP binding|calmodulin binding|motor activity			central_nervous_system(5)|large_intestine(2)|ovary(1)	8			OV - Ovarian serous cystadenocarcinoma(117;0.0112)|Epithelial(96;0.104)|all cancers(119;0.236)			GCCCGAATCTCGAGTGAATGG	0.438													5	91	---	---	---	---	PASS
DNAH7	56171	broad.mit.edu	37	2	196822072	196822072	+	Silent	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:196822072T>A	uc002utj.3	-	19	3092	c.2991A>T	c.(2989-2991)CCA>CCT	p.P997P		NM_018897	NP_061720	Q8WXX0	DYH7_HUMAN	dynein, axonemal, heavy chain 7	997	Stem (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			skin(10)|ovary(2)	12						ACATAATGTCTGGAGAGCTGA	0.468													13	47	---	---	---	---	PASS
HECW2	57520	broad.mit.edu	37	2	197085593	197085593	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:197085593C>A	uc002utm.1	-	25	4402	c.4219G>T	c.(4219-4221)GAG>TAG	p.E1407*	HECW2_uc002utl.1_Nonsense_Mutation_p.E1051*	NM_020760	NP_065811	Q9P2P5	HECW2_HUMAN	HECT, C2 and WW domain containing E3 ubiquitin	1407	HECT.				protein ubiquitination involved in ubiquitin-dependent protein catabolic process	cytoplasm	ubiquitin-protein ligase activity			skin(5)|ovary(5)|lung(4)|pancreas(2)|central_nervous_system(1)|kidney(1)	18						ACCATCCTCTCGATGTACTCC	0.438													5	125	---	---	---	---	PASS
PLCL1	5334	broad.mit.edu	37	2	198950016	198950016	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:198950016G>T	uc010fsp.2	+	2	2066	c.1775G>T	c.(1774-1776)TGT>TTT	p.C592F	PLCL1_uc002uuv.3_Missense_Mutation_p.C513F	NM_001114661	NP_001108133	Q15111	PLCL1_HUMAN	RecName: Full=Inactive phospholipase C-like protein 1;          Short=PLC-L1; AltName: Full=Phospholipase C-deleted in lung carcinoma; AltName: Full=Phospholipase C-related but catalytically inactive protein;          Short=PRIP;	592	PI-PLC Y-box.				intracellular signal transduction|lipid metabolic process	cytoplasm	calcium ion binding|phosphatidylinositol phospholipase C activity|signal transducer activity			ovary(1)|skin(1)	2					Quinacrine(DB01103)	GTGTCTATTTGTAAATCTGTT	0.403													13	48	---	---	---	---	PASS
ALS2CR11	151254	broad.mit.edu	37	2	202352462	202352462	+	Missense_Mutation	SNP	C	A	A	rs74717115	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202352462C>A	uc002uye.2	-	15	1793	c.1745G>T	c.(1744-1746)CGA>CTA	p.R582L	ALS2CR11_uc002uyf.2_Missense_Mutation_p.R1779L|ALS2CR11_uc010fti.2_3'UTR	NM_152525	NP_689738	Q53TS8	AL2SA_HUMAN	amyotrophic lateral sclerosis 2 (juvenile)	582										large_intestine(1)|ovary(1)|skin(1)	3						GTAGCTTTCTCGTTGCTTGTT	0.383													8	260	---	---	---	---	PASS
ALS2	57679	broad.mit.edu	37	2	202593846	202593846	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:202593846G>T	uc002uyo.2	-	14	2997	c.2641C>A	c.(2641-2643)CAT>AAT	p.H881N	ALS2_uc002uyp.3_Missense_Mutation_p.H881N|ALS2_uc010ftl.2_RNA	NM_020919	NP_065970	Q96Q42	ALS2_HUMAN	alsin isoform 1	881	DH.				cell death|endosome organization|positive regulation of Rac GTPase activity|regulation of endosome size	centrosome|cytosol|early endosome|growth cone|lamellipodium|protein complex|ruffle	protein homodimerization activity|protein serine/threonine kinase activator activity|Rab GTPase binding|Rab guanyl-nucleotide exchange factor activity|Rac guanyl-nucleotide exchange factor activity|Ran guanyl-nucleotide exchange factor activity			skin(5)|lung(1)|breast(1)	7						CTGCCGAGATGGAGAGCAAGA	0.433													6	84	---	---	---	---	PASS
NRP2	8828	broad.mit.edu	37	2	206630405	206630405	+	Intron	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:206630405G>A	uc002vaw.2	+						NRP2_uc002vau.2_Intron|NRP2_uc002vav.2_Intron|NRP2_uc002vax.2_Intron|NRP2_uc002vay.2_Intron	NM_201266	NP_957718	O60462	NRP2_HUMAN	neuropilin 2 isoform 1 precursor						angiogenesis|axon guidance|cell adhesion	integral to membrane|membrane fraction|plasma membrane	heparin binding|metal ion binding|semaphorin receptor activity|vascular endothelial growth factor receptor activity			skin(2)|ovary(1)|central_nervous_system(1)	4						CCAGTGGGTGGGGCAGCCACA	0.532													9	34	---	---	---	---	PASS
CREB1	1385	broad.mit.edu	37	2	208440037	208440037	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:208440037G>T	uc002vcc.2	+	7	840	c.589G>T	c.(589-591)GGT>TGT	p.G197C	CREB1_uc010ziz.1_Missense_Mutation_p.G181C|CREB1_uc002vcd.2_Missense_Mutation_p.G183C|CREB1_uc010zja.1_RNA	NM_134442	NP_604391	P16220	CREB1_HUMAN	cAMP responsive element binding protein 1	197					activation of phospholipase C activity|axon guidance|innate immune response|interspecies interaction between organisms|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of transcription from RNA polymerase II promoter|protein phosphorylation|stress-activated MAPK cascade|synaptic transmission|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway		protein dimerization activity|transcription cofactor activity		EWSR1/CREB1(42)	soft_tissue(42)|breast(1)|central_nervous_system(1)	44				LUSC - Lung squamous cell carcinoma(261;0.0768)|Epithelial(149;0.127)|Lung(261;0.145)	Adenosine monophosphate(DB00131)|Bromocriptine(DB01200)|Naloxone(DB01183)	GGCTAACAATGGTACCGATGG	0.438			T	EWSR1	clear cell sarcoma|angiomatoid fibrous histiocytoma								6	88	---	---	---	---	PASS
PLEKHM3	389072	broad.mit.edu	37	2	208725977	208725977	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:208725977C>A	uc002vcl.2	-	7	2450	c.1960G>T	c.(1960-1962)GGA>TGA	p.G654*		NM_001080475	NP_001073944	Q6ZWE6	PKHM3_HUMAN	pleckstrin homology domain containing, family M,	654					intracellular signal transduction		metal ion binding			ovary(1)	1						GCCAGCTTTCCCTCTATTACC	0.443													6	69	---	---	---	---	PASS
USP37	57695	broad.mit.edu	37	2	219394731	219394731	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219394731C>A	uc002vie.2	-	10	1264	c.811G>T	c.(811-813)GGT>TGT	p.G271C	USP37_uc010fvs.1_Missense_Mutation_p.G271C|USP37_uc010zkf.1_Missense_Mutation_p.G271C|USP37_uc002vif.2_Missense_Mutation_p.G271C|USP37_uc002vig.2_Missense_Mutation_p.G199C|USP37_uc010zkg.1_Missense_Mutation_p.G271C	NM_020935	NP_065986	Q86T82	UBP37_HUMAN	ubiquitin specific peptidase 37	271					ubiquitin-dependent protein catabolic process	nucleus	cysteine-type peptidase activity|ubiquitin thiolesterase activity			skin(3)|ovary(1)|prostate(1)	5		Renal(207;0.0915)		Epithelial(149;1.08e-06)|all cancers(144;0.000197)|LUSC - Lung squamous cell carcinoma(224;0.00375)|Lung(261;0.00487)		GCTCTGCTACCATAAAAGGAT	0.328													6	79	---	---	---	---	PASS
CCDC108	255101	broad.mit.edu	37	2	219870856	219870856	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:219870856G>C	uc002vjl.1	-	31	4893	c.4809C>G	c.(4807-4809)TGC>TGG	p.C1603W		NM_194302	NP_919278	Q6ZU64	CC108_HUMAN	coiled-coil domain containing 108 isoform 1	1603						integral to membrane	structural molecule activity			ovary(2)|upper_aerodigestive_tract(1)|pancreas(1)	4		Renal(207;0.0915)		Epithelial(149;1.12e-06)|all cancers(144;0.000196)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		GTGGCTGGGGGCAGGGCCAGG	0.617													5	32	---	---	---	---	PASS
STK11IP	114790	broad.mit.edu	37	2	220478475	220478475	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:220478475G>T	uc002vml.2	+	21	2615	c.2572G>T	c.(2572-2574)GAG>TAG	p.E858*		NM_052902	NP_443134	Q8N1F8	S11IP_HUMAN	LKB1 interacting protein	858					protein localization	cytoplasm	protein kinase binding			ovary(1)	1		Renal(207;0.0183)		Epithelial(149;2.69e-07)|all cancers(144;5.91e-05)|LUSC - Lung squamous cell carcinoma(224;0.008)|Lung(261;0.00942)		TCTCCACAGTGAGCCTCCAGC	0.622													6	49	---	---	---	---	PASS
CUL3	8452	broad.mit.edu	37	2	225422495	225422495	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:225422495T>C	uc002vny.2	-	2	529	c.145A>G	c.(145-147)AAC>GAC	p.N49D	CUL3_uc010zls.1_Intron|CUL3_uc010fwy.1_Missense_Mutation_p.N55D	NM_003590	NP_003581	Q13618	CUL3_HUMAN	cullin 3	49					cell cycle arrest|cell migration|cyclin catabolic process|cytokinesis|G1/S transition of mitotic cell cycle|induction of apoptosis by intracellular signals|mitotic anaphase|negative regulation of Rho protein signal transduction|positive regulation of cell proliferation|protein ubiquitination|stress fiber assembly	Cul3-RING ubiquitin ligase complex|Golgi apparatus|nucleus|polar microtubule	ubiquitin protein ligase binding			upper_aerodigestive_tract(1)|ovary(1)|liver(1)|kidney(1)	4		all_lung(227;0.00877)|Lung NSC(271;0.011)|Renal(207;0.0112)|all_hematologic(139;0.138)		Epithelial(121;1.58e-11)|all cancers(144;1.43e-08)|Lung(261;0.00863)|LUSC - Lung squamous cell carcinoma(224;0.00902)		AGACCACTGTTATTCTTACGC	0.358													6	52	---	---	---	---	PASS
KIAA1486	57624	broad.mit.edu	37	2	226273726	226273726	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:226273726C>A	uc002voe.2	+	2	305	c.130C>A	c.(130-132)CGA>AGA	p.R44R	KIAA1486_uc010fxa.1_Silent_p.R39R	NM_020864	NP_065915	Q9P242	K1486_HUMAN	hypothetical protein LOC57624	44										ovary(2)|central_nervous_system(1)	3		Renal(207;0.0112)|all_lung(227;0.0477)|Lung NSC(271;0.0644)|all_hematologic(139;0.101)|Esophageal squamous(248;0.129)		Epithelial(121;6.73e-10)|all cancers(144;4.32e-07)|Lung(261;0.0161)|LUSC - Lung squamous cell carcinoma(224;0.0223)		AGATATTGCTCGAGAGAATGA	0.408													5	50	---	---	---	---	PASS
COL4A4	1286	broad.mit.edu	37	2	228012080	228012080	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:228012080G>T	uc010zlt.1	-							NM_000092	NP_000083	P53420	CO4A4_HUMAN	alpha 4 type IV collagen precursor						axon guidance|glomerular basement membrane development	basal lamina|collagen type IV	extracellular matrix structural constituent|protein binding			ovary(5)|central_nervous_system(3)|pancreas(1)|breast(1)|skin(1)	11		Renal(207;0.00844)|all_lung(227;0.0187)|Lung NSC(271;0.0879)|all_hematologic(139;0.21)|Esophageal squamous(248;0.242)		Epithelial(121;6.7e-11)|all cancers(144;5.39e-08)|Lung(261;0.0132)|LUSC - Lung squamous cell carcinoma(224;0.0181)		AACAAACATTGAGTAGAAATT	0.403													10	175	---	---	---	---	PASS
COL4A3	1285	broad.mit.edu	37	2	228118298	228118298	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:228118298C>A	uc002vom.1	+	13	871	c.709C>A	c.(709-711)CCC>ACC	p.P237T	COL4A3_uc002von.1_Missense_Mutation_p.P237T|COL4A3_uc002voo.1_Missense_Mutation_p.P237T|COL4A3_uc002vop.1_Missense_Mutation_p.P237T|uc002voq.1_Intron|uc002vor.1_Intron	NM_000091	NP_000082	Q01955	CO4A3_HUMAN	alpha 3 type IV collagen isoform 1 precursor	237	Triple-helical region.				activation of caspase activity|axon guidance|blood circulation|cell adhesion|cell proliferation|cell surface receptor linked signaling pathway|glomerular basement membrane development|induction of apoptosis|negative regulation of angiogenesis|negative regulation of cell proliferation|sensory perception of sound	collagen type IV	extracellular matrix structural constituent|integrin binding|metalloendopeptidase inhibitor activity			skin(2)|ovary(1)	3		all_lung(227;0.00101)|Lung NSC(271;0.00278)|Renal(207;0.0112)|Ovarian(221;0.0129)|all_hematologic(139;0.211)|Esophageal squamous(248;0.247)		Epithelial(121;1.17e-46)|all cancers(144;6.87e-42)|Lung(261;0.0137)|LUSC - Lung squamous cell carcinoma(224;0.0187)		GTTAACAGGACCCCCGGGACC	0.438													33	111	---	---	---	---	PASS
PSMD1	5707	broad.mit.edu	37	2	231943383	231943383	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:231943383G>C	uc002vrn.1	+	10	1213	c.1082G>C	c.(1081-1083)CGG>CCG	p.R361P	PSMD1_uc002vrm.1_Missense_Mutation_p.R361P|PSMD1_uc010fxu.1_Missense_Mutation_p.R225P	NM_002807	NP_002798	Q99460	PSMD1_HUMAN	proteasome 26S non-ATPase subunit 1	361					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|regulation of protein catabolic process|S phase of mitotic cell cycle|viral reproduction	proteasome regulatory particle	enzyme regulator activity|protein binding			ovary(1)|skin(1)	2		Ovarian(221;0.000626)|Medulloblastoma(418;0.0109)|Renal(207;0.0112)|Lung NSC(271;0.0538)|all_lung(227;0.0713)|all_hematologic(139;0.0748)|Acute lymphoblastic leukemia(138;0.167)		Epithelial(121;4e-26)|LUSC - Lung squamous cell carcinoma(224;0.0138)|Lung(119;0.0168)	Bortezomib(DB00188)	GATGCAGTACGGAATTCTGTA	0.398													3	53	---	---	---	---	PASS
SH3BP4	23677	broad.mit.edu	37	2	235950626	235950626	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:235950626C>A	uc002vvp.2	+	4	1606	c.1213C>A	c.(1213-1215)CTT>ATT	p.L405I	SH3BP4_uc010fym.2_Missense_Mutation_p.L405I|SH3BP4_uc002vvq.2_Missense_Mutation_p.L405I	NM_014521	NP_055336	Q9P0V3	SH3B4_HUMAN	SH3-domain binding protein 4	405					endocytosis	clathrin-coated vesicle|coated pit|nucleus	protein binding			skin(3)|ovary(1)	4		Breast(86;0.000332)|Renal(207;0.00339)|all_lung(227;0.00458)|all_hematologic(139;0.0296)|Lung NSC(271;0.0419)		Epithelial(121;7.66e-20)|BRCA - Breast invasive adenocarcinoma(100;0.000402)|Lung(119;0.00299)|LUSC - Lung squamous cell carcinoma(224;0.00645)|GBM - Glioblastoma multiforme(43;0.237)		AAAAAATGACCTTTTTAGCAA	0.537													5	29	---	---	---	---	PASS
MLPH	79083	broad.mit.edu	37	2	238402140	238402140	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:238402140G>T	uc002vwt.2	+	2	298	c.71G>T	c.(70-72)CGA>CTA	p.R24L	MLPH_uc002vws.2_Missense_Mutation_p.R24L|MLPH_uc010fyt.1_Missense_Mutation_p.R24L|MLPH_uc002vwu.2_Missense_Mutation_p.R24L|MLPH_uc002vwv.2_Missense_Mutation_p.R24L	NM_024101	NP_077006	Q9BV36	MELPH_HUMAN	melanophilin isoform 1	24	RabBD.			R->A: Decreases RAB27A binding.			metal ion binding			ovary(1)	1		Breast(86;0.000381)|Renal(207;0.000966)|Ovarian(221;0.0695)|all_hematologic(139;0.095)|all_lung(227;0.17)|Melanoma(123;0.203)		Epithelial(121;1.17e-21)|OV - Ovarian serous cystadenocarcinoma(60;1.02e-10)|Kidney(56;4.23e-09)|KIRC - Kidney renal clear cell carcinoma(57;1.15e-07)|BRCA - Breast invasive adenocarcinoma(100;0.000439)|Lung(119;0.0132)|LUSC - Lung squamous cell carcinoma(224;0.0316)		GTTGTTCAACGAGATTTTGAC	0.547													6	95	---	---	---	---	PASS
CHL1	10752	broad.mit.edu	37	3	447294	447294	+	Missense_Mutation	SNP	G	A	A	rs141163165		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:447294G>A	uc003bou.2	+	27	3798	c.3527G>A	c.(3526-3528)AGT>AAT	p.S1176N	CHL1_uc003bot.2_Missense_Mutation_p.S1192N|CHL1_uc011asi.1_Missense_Mutation_p.S1139N	NM_006614	NP_006605	O00533	CHL1_HUMAN	cell adhesion molecule with homology to L1CAM	1176	Cytoplasmic (Potential).				axon guidance|cell adhesion|signal transduction	integral to membrane|plasma membrane|proteinaceous extracellular matrix				skin(5)|central_nervous_system(4)|large_intestine(2)|ovary(1)	12		all_cancers(2;1.14e-06)|all_epithelial(2;0.00367)|all_lung(1;0.061)|Lung NSC(2;0.201)		Epithelial(13;5.36e-06)|all cancers(10;1.4e-05)|OV - Ovarian serous cystadenocarcinoma(96;0.00323)|COAD - Colon adenocarcinoma(1;0.00925)|Colorectal(20;0.0198)		GGTCTCTTCAGTGAAGATGGA	0.473													16	34	---	---	---	---	PASS
GRM7	2917	broad.mit.edu	37	3	7188172	7188172	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:7188172G>T	uc003bqm.2	+	2	827	c.553G>T	c.(553-555)GAG>TAG	p.E185*	GRM7_uc011ata.1_RNA|GRM7_uc011atb.1_RNA|GRM7_uc010hcf.2_RNA|GRM7_uc011atc.1_RNA|GRM7_uc010hcg.2_Nonsense_Mutation_p.E185*|GRM7_uc003bql.2_Nonsense_Mutation_p.E185*	NM_000844	NP_000835	Q14831	GRM7_HUMAN	glutamate receptor, metabotropic 7 isoform a	185	Extracellular (Potential).				negative regulation of adenylate cyclase activity|negative regulation of cAMP biosynthetic process|negative regulation of glutamate secretion|sensory perception of smell|sensory perception of sound|synaptic transmission	asymmetric synapse|axon|cell cortex|dendritic shaft|integral to plasma membrane|postsynaptic membrane|presynaptic active zone	adenylate cyclase inhibitor activity|calcium ion binding|glutamate binding|group III metabotropic glutamate receptor activity|PDZ domain binding|serine binding			ovary(4)|lung(3)	7					L-Glutamic Acid(DB00142)	AACGGCACCCGAGCTAAGTGA	0.512													6	70	---	---	---	---	PASS
RPUSD3	285367	broad.mit.edu	37	3	9882216	9882216	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:9882216G>T	uc011atk.1	-	6	604	c.600C>A	c.(598-600)CTC>CTA	p.L200L	ARPC4_uc003btc.1_Intron|RPUSD3_uc011atl.1_Silent_p.L185L|RPUSD3_uc011atm.1_Silent_p.L192L|RPUSD3_uc003btn.2_3'UTR	NM_173659	NP_775930	Q6P087	RUSD3_HUMAN	RNA pseudouridylate synthase domain containing 3	200					pseudouridine synthesis		pseudouridine synthase activity|RNA binding			central_nervous_system(1)	1	Medulloblastoma(99;0.227)					CCGGACTCACGAGATTGACCC	0.562													5	107	---	---	---	---	PASS
ATG7	10533	broad.mit.edu	37	3	11389435	11389435	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:11389435G>T	uc003bwc.2	+	12	1327	c.1210G>T	c.(1210-1212)GAA>TAA	p.E404*	ATG7_uc003bwd.2_Nonsense_Mutation_p.E404*|ATG7_uc011aum.1_Nonsense_Mutation_p.E365*	NM_006395	NP_006386	O95352	ATG7_HUMAN	APG7 autophagy 7-like isoform a	404					autophagy|cellular membrane fusion|positive regulation of protein modification process|protein lipidation|protein transport	cytoplasm	APG12 activating enzyme activity|protein homodimerization activity|ubiquitin activating enzyme activity			central_nervous_system(1)	1						CTATGAGTTTGAAGATTGCCT	0.522													17	56	---	---	---	---	PASS
XPC	7508	broad.mit.edu	37	3	14211999	14211999	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:14211999G>T	uc011ave.1	-	3	455	c.351C>A	c.(349-351)ACC>ACA	p.T117T	XPC_uc011avf.1_5'UTR|XPC_uc011avg.1_Silent_p.T117T	NM_004628	NP_004619	Q01831	XPC_HUMAN	xeroderma pigmentosum, complementation group C	117	Glu-rich (acidic).				nucleotide-excision repair, DNA damage recognition|nucleotide-excision repair, DNA damage removal	cytoplasm|nucleoplasm|XPC complex	bubble DNA binding|damaged DNA binding|loop DNA binding|protein binding|single-stranded DNA binding			ovary(2)|breast(1)	3						CTTCATTCATGGTAGCCCCTC	0.428			Mis|N|F|S			skin basal cell|skin squamous cell|melanoma		NER	Xeroderma_Pigmentosum				9	183	---	---	---	---	PASS
FGD5	152273	broad.mit.edu	37	3	14974123	14974123	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:14974123A>T	uc003bzc.2	+	19	4347	c.4237A>T	c.(4237-4239)ACC>TCC	p.T1413S	FGD5_uc011avk.1_Missense_Mutation_p.T1370S|FGD5_uc003bzd.2_Missense_Mutation_p.T491S	NM_152536	NP_689749	Q6ZNL6	FGD5_HUMAN	FYVE, RhoGEF and PH domain containing 5	1413	PH 2.				actin cytoskeleton organization|filopodium assembly|regulation of Cdc42 GTPase activity|regulation of cell shape	cytoskeleton|Golgi apparatus|lamellipodium|ruffle	metal ion binding|Rho guanyl-nucleotide exchange factor activity|small GTPase binding			ovary(3)|kidney(1)|pancreas(1)	5						GCTAGGCTTCACCATTGCTCC	0.428													14	53	---	---	---	---	PASS
OXNAD1	92106	broad.mit.edu	37	3	16327883	16327883	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:16327883G>T	uc003caw.2	+	5	675	c.218G>T	c.(217-219)AGT>ATT	p.S73I	OXNAD1_uc010her.1_RNA|OXNAD1_uc003cax.2_Missense_Mutation_p.S73I|OXNAD1_uc011awb.1_Missense_Mutation_p.S91I	NM_138381	NP_612390	Q96HP4	OXND1_HUMAN	oxidoreductase NAD-binding domain containing 1	73	FAD-binding FR-type.						oxidoreductase activity			skin(1)	1						GGAGCTGCCAGTGAGTCACCG	0.478													6	74	---	---	---	---	PASS
TBC1D5	9779	broad.mit.edu	37	3	17418096	17418096	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:17418096C>A	uc003cbf.2	-	10	2287	c.622G>T	c.(622-624)GAA>TAA	p.E208*	TBC1D5_uc010hev.2_Nonsense_Mutation_p.E208*|TBC1D5_uc003cbe.2_Nonsense_Mutation_p.E208*|TBC1D5_uc010hew.1_Nonsense_Mutation_p.E160*	NM_014744	NP_055559	Q92609	TBCD5_HUMAN	TBC1 domain family, member 5 isoform b	208	Rab-GAP TBC.					intracellular	protein binding|Rab GTPase activator activity			ovary(1)	1						GCTAACAGTTCGTGCATGCCC	0.398													4	44	---	---	---	---	PASS
SATB1	6304	broad.mit.edu	37	3	18393544	18393544	+	Silent	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:18393544C>G	uc003cbh.2	-	10	3454	c.1719G>C	c.(1717-1719)GCG>GCC	p.A573A	SATB1_uc003cbi.2_Silent_p.A573A|SATB1_uc003cbj.2_Silent_p.A573A	NM_002971	NP_002962	Q01826	SATB1_HUMAN	special AT-rich sequence binding protein 1	573					cellular component disassembly involved in apoptosis|interspecies interaction between organisms|negative regulation of transcription from RNA polymerase II promoter	nuclear matrix|PML body	double-stranded DNA binding|sequence-specific DNA binding			skin(2)|ovary(1)|lung(1)	4						GGTGATGCACCGCGTTGCTCT	0.493													4	90	---	---	---	---	PASS
NGLY1	55768	broad.mit.edu	37	3	25805745	25805745	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:25805745G>T	uc003cdl.2	-	3	412	c.304C>A	c.(304-306)CGT>AGT	p.R102S	NGLY1_uc010hfg.2_Missense_Mutation_p.R102S|NGLY1_uc003cdm.2_Missense_Mutation_p.R102S|NGLY1_uc011awo.1_Missense_Mutation_p.R60S|NGLY1_uc003cdk.2_RNA	NM_018297	NP_060767	Q96IV0	NGLY1_HUMAN	N-glycanase 1 isoform 1	102					glycoprotein catabolic process	cytoplasm	metal ion binding|peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase activity|protein binding			breast(1)	1						ATCAGGTCACGAATTTTTTGC	0.403													6	183	---	---	---	---	PASS
GLB1	2720	broad.mit.edu	37	3	33109714	33109714	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:33109714C>A	uc003cfi.1	-						GLB1_uc003cfh.1_Intron|GLB1_uc003cfj.1_Intron|GLB1_uc011axk.1_Intron	NM_000404	NP_000395	P16278	BGAL_HUMAN	galactosidase, beta 1 isoform a preproprotein						carbohydrate metabolic process	lysosome|perinuclear region of cytoplasm	beta-galactosidase activity|cation binding|protein binding			large_intestine(1)	1		Melanoma(143;0.104)				ACATCTGTAACAACCTACCTG	0.308													5	60	---	---	---	---	PASS
TRANK1	9881	broad.mit.edu	37	3	36872688	36872688	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:36872688C>A	uc003cgj.2	-	12	6906	c.6604G>T	c.(6604-6606)GAG>TAG	p.E2202*		NM_014831	NP_055646	O15050	TRNK1_HUMAN	lupus brain antigen 1	2752					DNA repair		ATP binding|ATP-dependent DNA helicase activity|DNA binding			ovary(1)|central_nervous_system(1)	2						ACTGCCACCTCGGAAGCTGCC	0.557													4	36	---	---	---	---	PASS
SCN10A	6336	broad.mit.edu	37	3	38798188	38798188	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:38798188C>A	uc003ciq.2	-	9	1267	c.1267G>T	c.(1267-1269)GAG>TAG	p.E423*		NM_006514	NP_006505	Q9Y5Y9	SCNAA_HUMAN	sodium channel, voltage-gated, type X, alpha	423					sensory perception	voltage-gated sodium channel complex				ovary(5)|skin(3)|large_intestine(1)|kidney(1)	10				KIRC - Kidney renal clear cell carcinoma(284;0.0769)|Kidney(284;0.0945)	Benzocaine(DB01086)|Bupivacaine(DB00297)|Chloroprocaine(DB01161)|Cocaine(DB00907)|Dibucaine(DB00527)|Dyclonine(DB00645)|Hexylcaine(DB00473)|Levobupivacaine(DB01002)|Lidocaine(DB00281)|Mepivacaine(DB00961)|Oxybuprocaine(DB00892)|Procaine(DB00721)|Proparacaine(DB00807)|Ropivacaine(DB00296)	CGGAGCATCTCGAGGGCCTCC	0.502													5	86	---	---	---	---	PASS
GORASP1	64689	broad.mit.edu	37	3	39141908	39141908	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:39141908G>A	uc003ciw.1	-	6	751	c.653C>T	c.(652-654)CCA>CTA	p.P218L	GORASP1_uc003civ.1_RNA|GORASP1_uc003cix.1_RNA|GORASP1_uc003ciy.1_RNA|GORASP1_uc011ayw.1_Missense_Mutation_p.P123L|GORASP1_uc003ciz.1_Missense_Mutation_p.P63L	NM_031899	NP_114105	Q9BQQ3	GORS1_HUMAN	Golgi reassembly stacking protein 1	218	Pro-rich.				mitotic prophase|protein transport	cytosol|Golgi apparatus|membrane				ovary(2)|central_nervous_system(1)	3				KIRC - Kidney renal clear cell carcinoma(284;0.0519)|Kidney(284;0.0653)		AGCAGAAGGTGGTGGGGTGCC	0.612													3	5	---	---	---	---	PASS
SACM1L	22908	broad.mit.edu	37	3	45779277	45779277	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:45779277C>A	uc003cos.2	+	16	1527	c.1323C>A	c.(1321-1323)AAC>AAA	p.N441K	SACM1L_uc011bag.1_Missense_Mutation_p.N338K|SACM1L_uc011bah.1_Missense_Mutation_p.N375K|SACM1L_uc003cot.2_Missense_Mutation_p.N84K	NM_014016	NP_054735	Q9NTJ5	SAC1_HUMAN	suppressor of actin 1	441	SAC.					Golgi apparatus				ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.0102)|KIRC - Kidney renal clear cell carcinoma(197;0.0234)|Kidney(197;0.0277)		GGGCTGACAACGCAAATGCTT	0.348													5	70	---	---	---	---	PASS
COL7A1	1294	broad.mit.edu	37	3	48614120	48614120	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:48614120G>T	uc003ctz.2	-	67	5690	c.5689C>A	c.(5689-5691)CCT>ACT	p.P1897T		NM_000094	NP_000085	Q02388	CO7A1_HUMAN	alpha 1 type VII collagen precursor	1897	Triple-helical region.				cell adhesion|epidermis development	basement membrane|collagen type VII	protein binding|serine-type endopeptidase inhibitor activity			ovary(4)|breast(3)|skin(3)|central_nervous_system(1)	11				BRCA - Breast invasive adenocarcinoma(193;0.000293)|KIRC - Kidney renal clear cell carcinoma(197;0.00558)|Kidney(197;0.00632)		TGGCCAGGAGGGCCCACTGGC	0.617													4	10	---	---	---	---	PASS
RNF123	63891	broad.mit.edu	37	3	49758714	49758714	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:49758714G>T	uc003cxh.2	+	39	4007	c.3921G>T	c.(3919-3921)ACG>ACT	p.T1307T	RNF123_uc003cxi.2_RNA|AMIGO3_uc003cxj.2_5'Flank	NM_022064	NP_071347	Q5XPI4	RN123_HUMAN	ring finger protein 123	1307						cytoplasm	ligase activity|protein binding|zinc ion binding			kidney(3)|ovary(1)|lung(1)|breast(1)|skin(1)	7				BRCA - Breast invasive adenocarcinoma(193;4.71e-05)|Kidney(197;0.00227)|KIRC - Kidney renal clear cell carcinoma(197;0.00255)		GAGCCAATACGAGTACTACCT	0.542													6	131	---	---	---	---	PASS
PBRM1	55193	broad.mit.edu	37	3	52621494	52621494	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52621494G>C	uc003des.2	-	19	3010	c.2998C>G	c.(2998-3000)CGA>GGA	p.R1000G	PBRM1_uc003dex.2_RNA|PBRM1_uc003deq.2_Missense_Mutation_p.R1000G|PBRM1_uc003der.2_Missense_Mutation_p.R968G|PBRM1_uc003det.2_Missense_Mutation_p.R1015G|PBRM1_uc003deu.2_Missense_Mutation_p.R1015G|PBRM1_uc003dev.2_RNA|PBRM1_uc003dew.2_Missense_Mutation_p.R1000G|PBRM1_uc010hmk.1_Intron|PBRM1_uc003dey.2_Intron|PBRM1_uc003dez.1_Missense_Mutation_p.R999G|PBRM1_uc003dfb.1_Missense_Mutation_p.R912G|PBRM1_uc003dfa.1_Missense_Mutation_p.R346G	NM_181042	NP_060635	Q86U86	PB1_HUMAN	polybromo 1 isoform 4	1000	BAH 1.				chromatin remodeling|mitosis|negative regulation of cell proliferation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear chromosome	chromatin binding|DNA binding|protein binding			kidney(136)|breast(4)	140				BRCA - Breast invasive adenocarcinoma(193;1.8e-05)|Kidney(197;0.00105)|KIRC - Kidney renal clear cell carcinoma(197;0.00122)|OV - Ovarian serous cystadenocarcinoma(275;0.0613)		TCATTTGGTCGGTAAAACCAA	0.363			Mis|N|F|S|D|O		clear cell renal carcinoma|breast								3	42	---	---	---	---	PASS
NEK4	6787	broad.mit.edu	37	3	52802350	52802350	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52802350G>T	uc003dfq.3	-						NEK4_uc011bej.1_Intron|NEK4_uc003dfr.2_Intron	NM_003157	NP_003148	P51957	NEK4_HUMAN	NIMA-related kinase 4						cell division|mitosis	nucleus	ATP binding|metal ion binding|protein serine/threonine kinase activity			large_intestine(1)	1				BRCA - Breast invasive adenocarcinoma(193;7.44e-05)|Kidney(197;0.000711)|KIRC - Kidney renal clear cell carcinoma(197;0.00086)|OV - Ovarian serous cystadenocarcinoma(275;0.0513)		AGTCTACACAGTACCTGCAAA	0.428													7	178	---	---	---	---	PASS
CHDH	55349	broad.mit.edu	37	3	53854550	53854550	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:53854550C>A	uc003dgz.2	-	6	1511	c.1071G>T	c.(1069-1071)AAG>AAT	p.K357N		NM_018397	NP_060867	Q8NE62	CHDH_HUMAN	choline dehydrogenase precursor	357					alcohol metabolic process		choline dehydrogenase activity|flavin adenine dinucleotide binding			ovary(1)|central_nervous_system(1)	2		Hepatocellular(537;0.152)		BRCA - Breast invasive adenocarcinoma(193;0.000158)|KIRC - Kidney renal clear cell carcinoma(284;0.00588)|Kidney(284;0.00673)|OV - Ovarian serous cystadenocarcinoma(275;0.118)	Choline(DB00122)	TCCGCAGGGGCTTCTGTGCTG	0.552													6	104	---	---	---	---	PASS
OR5H6	79295	broad.mit.edu	37	3	97983199	97983199	+	Nonsense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:97983199T>A	uc003dsi.1	+	1	71	c.71T>A	c.(70-72)TTG>TAG	p.L24*		NM_001005479	NP_001005479	Q8NGV6	OR5H6_HUMAN	olfactory receptor, family 5, subfamily H,	24	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|large_intestine(1)	3						AATGCAACATTGCTGACAGAG	0.408													22	138	---	---	---	---	PASS
DCBLD2	131566	broad.mit.edu	37	3	98538223	98538223	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:98538223C>A	uc003dtd.2	-	8	1273	c.910G>T	c.(910-912)GCG>TCG	p.A304S	DCBLD2_uc003dte.2_Missense_Mutation_p.A304S	NM_080927	NP_563615	Q96PD2	DCBD2_HUMAN	discoidin, CUB and LCCL domain containing 2	304	Extracellular (Potential).|F5/8 type C.				cell adhesion|intracellular receptor mediated signaling pathway|negative regulation of cell growth|wound healing	cell surface|integral to plasma membrane				ovary(2)|central_nervous_system(1)	3						TGAGGATCCGCGATCACACCA	0.443													20	80	---	---	---	---	PASS
COL8A1	1295	broad.mit.edu	37	3	99514646	99514646	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:99514646A>C	uc003dtg.1	+	5	2146	c.1901A>C	c.(1900-1902)AAG>ACG	p.K634T	COL8A1_uc003dth.1_Missense_Mutation_p.K634T|COL8A1_uc003dti.1_Missense_Mutation_p.K635T	NM_001850	NP_001841	P27658	CO8A1_HUMAN	alpha 1 type VIII collagen precursor	634	C1q.|Nonhelical region (NC1).				angiogenesis|cell adhesion	basement membrane|collagen type VIII					0						GCCCCAGTGAAGTTTAACAAA	0.537													10	30	---	---	---	---	PASS
TOMM70A	9868	broad.mit.edu	37	3	100093869	100093869	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100093869C>A	uc003dtw.2	-	7	1652	c.1220G>T	c.(1219-1221)CGA>CTA	p.R407L		NM_014820	NP_055635	O94826	TOM70_HUMAN	translocase of outer mitochondrial membrane 70	407	Cytoplasmic (Potential).|TPR 6.				protein targeting to mitochondrion	integral to membrane|mitochondrial outer membrane translocase complex	protein binding|protein transmembrane transporter activity			ovary(1)	1						TACCTGTCCTCGGTGGTGATA	0.413													5	100	---	---	---	---	PASS
TOMM70A	9868	broad.mit.edu	37	3	100093992	100093992	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100093992C>A	uc003dtw.2	-	7	1529	c.1097G>T	c.(1096-1098)CGA>CTA	p.R366L		NM_014820	NP_055635	O94826	TOM70_HUMAN	translocase of outer mitochondrial membrane 70	366	Cytoplasmic (Potential).				protein targeting to mitochondrion	integral to membrane|mitochondrial outer membrane translocase complex	protein binding|protein transmembrane transporter activity			ovary(1)	1						AGCATTTGCTCGAAGCTATAT	0.353													6	230	---	---	---	---	PASS
TOMM70A	9868	broad.mit.edu	37	3	100105095	100105095	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100105095C>T	uc003dtw.2	-	3	1024	c.592G>A	c.(592-594)GAG>AAG	p.E198K		NM_014820	NP_055635	O94826	TOM70_HUMAN	translocase of outer mitochondrial membrane 70	198	Cytoplasmic (Potential).				protein targeting to mitochondrion	integral to membrane|mitochondrial outer membrane translocase complex	protein binding|protein transmembrane transporter activity			ovary(1)	1						TCTAGCTTCTCATGGGCTTTT	0.328													33	156	---	---	---	---	PASS
ABI3BP	25890	broad.mit.edu	37	3	100471739	100471739	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:100471739C>A	uc003dun.2	-	33	2966	c.2881G>T	c.(2881-2883)GAG>TAG	p.E961*	ABI3BP_uc003duj.2_Nonsense_Mutation_p.E541*|ABI3BP_uc003duk.2_Nonsense_Mutation_p.E670*|ABI3BP_uc003dul.2_Nonsense_Mutation_p.E791*|ABI3BP_uc011bhd.1_Nonsense_Mutation_p.E915*|ABI3BP_uc003dum.2_Nonsense_Mutation_p.E372*	NM_015429	NP_056244	Q7Z7G0	TARSH_HUMAN	ABI gene family, member 3 (NESH) binding protein	961						extracellular space				ovary(2)|large_intestine(1)|haematopoietic_and_lymphoid_tissue(1)	4						CCCTTACACTCTGAGTAAGAG	0.398													7	93	---	---	---	---	PASS
SENP7	57337	broad.mit.edu	37	3	101051624	101051624	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:101051624C>A	uc003dut.2	-	18	2674	c.2563G>T	c.(2563-2565)GTA>TTA	p.V855L	SENP7_uc003duu.2_Missense_Mutation_p.V790L|SENP7_uc003duv.2_Missense_Mutation_p.V822L|SENP7_uc003duw.2_Missense_Mutation_p.V789L|SENP7_uc003dux.2_Missense_Mutation_p.V691L|SENP7_uc003dus.2_Missense_Mutation_p.V43L	NM_020654	NP_065705	Q9BQF6	SENP7_HUMAN	sentrin/SUMO-specific protease 7 isoform 1	855	Protease.				proteolysis	nucleus	cysteine-type peptidase activity			ovary(3)|lung(2)	5						GACTCATTTACAGGTACAAAG	0.274													6	151	---	---	---	---	PASS
RG9MTD1	54931	broad.mit.edu	37	3	101283646	101283646	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:101283646G>T	uc003duz.2	+	2	169	c.21G>T	c.(19-21)ATG>ATT	p.M7I		NM_017819	NP_060289	Q7L0Y3	MRRP1_HUMAN	RNA (guanine-9-) methyltransferase domain	7					tRNA processing	mitochondrion	methyltransferase activity|protein binding			ovary(1)	1						TCCTCAAAATGAGTGTTAGTG	0.328													10	259	---	---	---	---	PASS
NFKBIZ	64332	broad.mit.edu	37	3	101576002	101576002	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:101576002G>T	uc003dvp.2	+	10	2025	c.1910G>T	c.(1909-1911)AGT>ATT	p.S637I	NFKBIZ_uc003dvo.2_Missense_Mutation_p.S537I|NFKBIZ_uc010hpo.2_Missense_Mutation_p.S537I|NFKBIZ_uc003dvq.2_Missense_Mutation_p.S515I	NM_031419	NP_113607	Q9BYH8	IKBZ_HUMAN	nuclear factor of kappa light polypeptide gene	637	Interaction with NFKB1/p50 (By similarity).|ANK 6.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus				ovary(2)	2						GAGCTGCCCAGTTGCCTGTCT	0.483													6	116	---	---	---	---	PASS
ALCAM	214	broad.mit.edu	37	3	105250889	105250889	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:105250889C>A	uc003dvx.2	+	4	978	c.438C>A	c.(436-438)CTC>CTA	p.L146L	ALCAM_uc003dvw.1_Silent_p.L146L|ALCAM_uc003dvy.2_Silent_p.L146L|ALCAM_uc011bhh.1_Silent_p.L95L|ALCAM_uc010hpp.2_5'Flank	NM_001627	NP_001618	Q13740	CD166_HUMAN	activated leukocyte cell adhesion molecule	146	Extracellular (Potential).|Ig-like V-type 2.				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(2)|breast(1)	3						CACTGTTTCTCGAAACAGAGC	0.348													6	251	---	---	---	---	PASS
CCDC54	84692	broad.mit.edu	37	3	107097232	107097232	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:107097232C>A	uc003dwi.1	+	1	1045	c.798C>A	c.(796-798)ACC>ACA	p.T266T		NM_032600	NP_115989	Q8NEL0	CCD54_HUMAN	coiled-coil domain containing 54	266											0						TCAGTGCTACCAAGTTAGAAG	0.423													7	118	---	---	---	---	PASS
DPPA4	55211	broad.mit.edu	37	3	109049533	109049533	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:109049533C>G	uc003dxq.3	-	5	572	c.517G>C	c.(517-519)GTG>CTG	p.V173L	DPPA4_uc011bho.1_Intron|DPPA4_uc011bhp.1_Missense_Mutation_p.V173L	NM_018189	NP_060659	Q7L190	DPPA4_HUMAN	developmental pluripotency associated 4	173						nucleus	protein binding			upper_aerodigestive_tract(1)	1						GGCTCCCCCACAGGAGGAAGA	0.507													12	93	---	---	---	---	PASS
TMPRSS7	344805	broad.mit.edu	37	3	111768698	111768698	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111768698G>T	uc010hqb.2	+	6	759	c.589G>T	c.(589-591)GAA>TAA	p.E197*	TMPRSS7_uc011bhr.1_Nonsense_Mutation_p.E52*	NM_001042575	NP_001036040	Q7RTY8	TMPS7_HUMAN	transmembrane protease, serine 7	323	Extracellular (Potential).|CUB 1.				proteolysis	integral to membrane|plasma membrane	serine-type endopeptidase activity			ovary(1)|kidney(1)	2						CAGAATTTGTGAACCCACAAG	0.368													7	124	---	---	---	---	PASS
SLC9A10	285335	broad.mit.edu	37	3	111927116	111927116	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:111927116C>A	uc003dyu.2	-	16	2117	c.1895G>T	c.(1894-1896)TGG>TTG	p.W632L	SLC9A10_uc011bhu.1_Intron|SLC9A10_uc010hqc.2_Missense_Mutation_p.W584L	NM_183061	NP_898884	Q4G0N8	S9A10_HUMAN	sperm-specific sodium proton exchanger	632	Helical; (Potential).|Ion transport-like.				cell differentiation|multicellular organismal development|sodium ion transport|spermatogenesis	cilium|flagellar membrane|integral to membrane	solute:hydrogen antiporter activity			ovary(3)|breast(2)	5						CTGGGATATCCAAGAGATTAT	0.299													11	252	---	---	---	---	PASS
GRAMD1C	54762	broad.mit.edu	37	3	113595041	113595041	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113595041C>T	uc003eaq.3	+	5	469	c.393C>T	c.(391-393)TTC>TTT	p.F131F	GRAMD1C_uc011bil.1_RNA|GRAMD1C_uc011bim.1_Intron	NM_017577	NP_060047	Q8IYS0	GRM1C_HUMAN	GRAM domain containing 1C	131	GRAM.					integral to membrane				ovary(2)|skin(1)	3						ATATAACCTTCATGACCAAGG	0.299													26	168	---	---	---	---	PASS
GRAMD1C	54762	broad.mit.edu	37	3	113623041	113623041	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113623041C>A	uc003eaq.3	+	8	787	c.711C>A	c.(709-711)TCC>TCA	p.S237S	GRAMD1C_uc011bil.1_RNA|GRAMD1C_uc011bim.1_Intron|GRAMD1C_uc003ear.2_Silent_p.S70S|GRAMD1C_uc003eas.2_Silent_p.S32S	NM_017577	NP_060047	Q8IYS0	GRM1C_HUMAN	GRAM domain containing 1C	237						integral to membrane				ovary(2)|skin(1)	3						AAAAATTATCCAAGTCAATCA	0.373													6	70	---	---	---	---	PASS
KIAA1407	57577	broad.mit.edu	37	3	113697729	113697729	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:113697729C>A	uc003eax.2	-	15	2583	c.2436G>T	c.(2434-2436)AAG>AAT	p.K812N	KIAA1407_uc011bin.1_RNA	NM_020817	NP_065868	Q8NCU4	K1407_HUMAN	hypothetical protein LOC57577	812										ovary(2)	2						GGATGACTCTCTTAAGCAGTA	0.418													10	221	---	---	---	---	PASS
POLQ	10721	broad.mit.edu	37	3	121207700	121207700	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121207700G>T	uc003eee.3	-	16	4207	c.4078C>A	c.(4078-4080)CAA>AAA	p.Q1360K	POLQ_uc003eed.2_Missense_Mutation_p.Q532K	NM_199420	NP_955452	O75417	DPOLQ_HUMAN	DNA polymerase theta	1360					DNA repair|DNA replication	nucleoplasm	ATP binding|ATP-dependent helicase activity|damaged DNA binding|DNA-directed DNA polymerase activity|single-stranded DNA-dependent ATPase activity			ovary(4)|breast(3)|lung(2)|upper_aerodigestive_tract(1)|skin(1)	11				GBM - Glioblastoma multiforme(114;0.0915)		GAGTTCTGTTGGACTAAGCTC	0.433								DNA_polymerases_(catalytic_subunits)					8	141	---	---	---	---	PASS
POLQ	10721	broad.mit.edu	37	3	121208219	121208219	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121208219G>T	uc003eee.3	-	16	3688	c.3559C>A	c.(3559-3561)CAT>AAT	p.H1187N	POLQ_uc003eed.2_Missense_Mutation_p.H359N	NM_199420	NP_955452	O75417	DPOLQ_HUMAN	DNA polymerase theta	1187					DNA repair|DNA replication	nucleoplasm	ATP binding|ATP-dependent helicase activity|damaged DNA binding|DNA-directed DNA polymerase activity|single-stranded DNA-dependent ATPase activity			ovary(4)|breast(3)|lung(2)|upper_aerodigestive_tract(1)|skin(1)	11				GBM - Glioblastoma multiforme(114;0.0915)		TGGATGTCATGGTGTTTCATA	0.373								DNA_polymerases_(catalytic_subunits)					9	263	---	---	---	---	PASS
GOLGB1	2804	broad.mit.edu	37	3	121410244	121410244	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:121410244G>T	uc003eei.3	-	14	8078	c.7952C>A	c.(7951-7953)TCT>TAT	p.S2651Y	GOLGB1_uc010hrc.2_Missense_Mutation_p.S2656Y|GOLGB1_uc003eej.3_Missense_Mutation_p.S2617Y	NM_004487	NP_004478	Q14789	GOGB1_HUMAN	golgi autoantigen, golgin subfamily b,	2651	Cytoplasmic (Potential).|Potential.				Golgi organization	ER-Golgi intermediate compartment|Golgi membrane|Golgi stack|integral to membrane	protein binding			ovary(6)|breast(2)|skin(2)	10				GBM - Glioblastoma multiforme(114;0.0989)		TCTCTTTTGAGAGGAGGAAAA	0.378													10	241	---	---	---	---	PASS
CCDC14	64770	broad.mit.edu	37	3	123665977	123665977	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:123665977C>A	uc011bjx.1	-	8	1109	c.1018G>T	c.(1018-1020)GGA>TGA	p.G340*	CCDC14_uc003egv.3_Intron|CCDC14_uc003egx.3_Nonsense_Mutation_p.G140*|CCDC14_uc010hrt.2_Nonsense_Mutation_p.G299*|CCDC14_uc003egy.3_Nonsense_Mutation_p.G140*|CCDC14_uc003egz.2_Nonsense_Mutation_p.G140*	NM_022757	NP_073594	Q49A88	CCD14_HUMAN	coiled-coil domain containing 14	340						centrosome					0		Lung NSC(201;0.0371)|Prostate(884;0.0405)|Myeloproliferative disorder(1037;0.205)		Lung(219;0.00942)|GBM - Glioblastoma multiforme(114;0.159)		TTATGAATTCCTTGTTGTGGC	0.418													7	115	---	---	---	---	PASS
ZNF148	7707	broad.mit.edu	37	3	124998070	124998070	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:124998070C>A	uc003ehx.3	-	6	967	c.481G>T	c.(481-483)GGA>TGA	p.G161*	SLC12A8_uc003ehw.3_5'UTR|ZNF148_uc003ehz.3_Nonsense_Mutation_p.G161*|ZNF148_uc010hsa.2_Nonsense_Mutation_p.G161*|ZNF148_uc003eia.3_Nonsense_Mutation_p.G161*|ZNF148_uc003ehy.2_Intron	NM_021964	NP_068799	Q9UQR1	ZN148_HUMAN	zinc finger protein 148	161					cellular defense response|negative regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	Golgi apparatus|nucleus	protein binding|sequence-specific DNA binding|zinc ion binding			skin(2)|ovary(1)|pancreas(1)	4						CCAAGTGATCCATCCTCATTT	0.289													7	125	---	---	---	---	PASS
OSBPL11	114885	broad.mit.edu	37	3	125286249	125286249	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:125286249G>T	uc003eic.2	-	6	1594	c.857C>A	c.(856-858)TCA>TAA	p.S286*		NM_022776	NP_073613	Q9BXB4	OSB11_HUMAN	oxysterol binding protein-like 11	286					lipid transport		lipid binding			ovary(3)|breast(1)|kidney(1)	5						TGAAGGCAATGAGCCCTTCTG	0.393													8	125	---	---	---	---	PASS
KBTBD12	166348	broad.mit.edu	37	3	127646667	127646667	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:127646667C>A	uc010hsr.2	+	2	1134	c.1131C>A	c.(1129-1131)CTC>CTA	p.L377L	KBTBD12_uc003ejy.3_5'UTR|KBTBD12_uc010hsq.2_Intron|KBTBD12_uc003eka.3_Missense_Mutation_p.S19Y|KBTBD12_uc003ejz.2_Silent_p.L377L	NM_207335	NP_997218	Q3ZCT8	KBTBC_HUMAN	kelch domain containing 6	377										ovary(1)	1						TTCGAGAACTCTATGCTCTGG	0.368													11	284	---	---	---	---	PASS
RAB7A	7879	broad.mit.edu	37	3	128514274	128514274	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128514274C>A	uc003eks.1	+						RAB7A_uc010hsv.1_Intron|RAB7A_uc003ekt.2_5'Flank	NM_004637	NP_004628	P51149	RAB7A_HUMAN	RAB7, member RAS oncogene family						endocytosis|endosome to lysosome transport|epidermal growth factor catabolic process|protein transport|small GTPase mediated signal transduction	Golgi apparatus|late endosome|lysosome|melanosome|phagocytic vesicle	GDP binding|GTP binding|GTPase activity|protein binding				0				GBM - Glioblastoma multiforme(114;0.231)		GTAAGTTACTCATGAATTTGA	0.468											OREG0015781	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	6	82	---	---	---	---	PASS
ACAD9	28976	broad.mit.edu	37	3	128629610	128629610	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128629610G>T	uc003ela.3	+	17	1921	c.1719G>T	c.(1717-1719)GTG>GTT	p.V573V	KIAA1257_uc003elg.1_Intron|ACAD9_uc011bks.1_Silent_p.V450V|ACAD9_uc003elb.2_Silent_p.V450V|ACAD9_uc003eld.1_RNA|ACAD9_uc003ele.2_Silent_p.V225V|uc003elf.1_Intron	NM_014049	NP_054768	Q9H845	ACAD9_HUMAN	acyl-Coenzyme A dehydrogenase family, member 9	573						mitochondrion	acyl-CoA dehydrogenase activity|flavin adenine dinucleotide binding			ovary(2)|central_nervous_system(1)	3						CCTTCTGCGTGGAAGCTTACT	0.522													9	249	---	---	---	---	PASS
RAB43	339122	broad.mit.edu	37	3	128852994	128852994	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:128852994G>T	uc003elo.1	-	9	797	c.586C>A	c.(586-588)CGG>AGG	p.R196R	ISY1_uc010hsz.1_Intron|ISY1_uc003elp.1_Silent_p.R196R|ISY1_uc010hta.1_Silent_p.R218R	NM_020701	NP_065752	Q86YS6	RAB43_HUMAN	ISY1 splicing factor homolog	Error:Variant_position_missing_in_Q86YS6_after_alignment					protein transport|small GTPase mediated signal transduction	plasma membrane	GTP binding			lung(1)	1						CTTGCCAGCCGAGCCTCTCTC	0.423													5	94	---	---	---	---	PASS
RHO	6010	broad.mit.edu	37	3	129251164	129251164	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:129251164G>T	uc003emt.2	+	3	696	c.601G>T	c.(601-603)GAG>TAG	p.E201*		NM_000539	NP_000530	P08100	OPSD_HUMAN	rhodopsin	201	Extracellular.	Zinc (By similarity).			protein-chromophore linkage|rhodopsin mediated signaling pathway	Golgi apparatus|integral to plasma membrane|photoreceptor inner segment membrane|photoreceptor outer segment membrane	G-protein coupled receptor activity|metal ion binding|photoreceptor activity|protein binding				0		all_neural(597;0.0227)|Myeloproliferative disorder(1037;0.0255)|Prostate(884;0.183)		GBM - Glioblastoma multiforme(114;2.58e-05)|Lung(219;0.0234)	Halothane(DB01159)	GGTCAACAACGAGTCTTTTGT	0.542													5	87	---	---	---	---	PASS
COL29A1	256076	broad.mit.edu	37	3	130174503	130174503	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:130174503C>A	uc010htj.1	+	37	7277	c.6783C>A	c.(6781-6783)CTC>CTA	p.L2261L	COL29A1_uc010hti.1_RNA|COL29A1_uc010htk.1_Silent_p.L300L	NM_153264	NP_694996	A8TX70	CO6A5_HUMAN	collagen, type XXIX, alpha 1	2261	Nonhelical region.				axon guidance|cell adhesion	collagen					0						TTGCAAGTCTCACTTCTGGTA	0.318													7	113	---	---	---	---	PASS
DNAJC13	23317	broad.mit.edu	37	3	132172954	132172954	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:132172954C>A	uc003eor.2	+	9	950	c.885C>A	c.(883-885)ACC>ACA	p.T295T	DNAJC13_uc010htq.1_Silent_p.T295T|DNAJC13_uc003eos.1_5'Flank	NM_015268	NP_056083	O75165	DJC13_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 13	295							heat shock protein binding			ovary(1)|breast(1)	2						AACTTTTTACCATTGAATTTA	0.289													11	344	---	---	---	---	PASS
TMEM108	66000	broad.mit.edu	37	3	133098645	133098645	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133098645G>T	uc003eph.2	+	4	364	c.90G>T	c.(88-90)CAG>CAT	p.Q30H	TMEM108_uc003epi.2_Missense_Mutation_p.Q30H|TMEM108_uc003epj.1_Missense_Mutation_p.Q30H|TMEM108_uc003epk.2_Intron|TMEM108_uc003epm.2_Translation_Start_Site	NM_023943	NP_076432	Q6UXF1	TM108_HUMAN	transmembrane protein 108 precursor	30	Extracellular (Potential).					integral to membrane				ovary(2)|skin(2)	4						TTGCCATCCAGGAACCATCTC	0.537													10	292	---	---	---	---	PASS
TF	7018	broad.mit.edu	37	3	133496080	133496080	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:133496080C>T	uc003epu.1	+	21	3788	c.2060C>T	c.(2059-2061)TCA>TTA	p.S687L	TF_uc011blt.1_Missense_Mutation_p.S560L|TF_uc003epw.1_Missense_Mutation_p.S126L|TF_uc003epv.1_Missense_Mutation_p.S687L	NM_001063	NP_001054	P02787	TRFE_HUMAN	transferrin precursor	687					cellular iron ion homeostasis|platelet activation|platelet degranulation|transferrin transport|transmembrane transport	apical plasma membrane|basal plasma membrane|coated pit|early endosome|endocytic vesicle|endosome membrane|extracellular region|late endosome|perinuclear region of cytoplasm|recycling endosome|stored secretory granule	ferric iron binding			ovary(1)|skin(1)	2					Aluminium(DB01370)|Bismuth(DB01402)|Iron Dextran(DB00893)	TGCTCCACCTCATGTGAGTAG	0.488													5	24	---	---	---	---	PASS
CEP63	80254	broad.mit.edu	37	3	134270794	134270794	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:134270794C>A	uc003eqo.1	+	13	1856	c.1407C>A	c.(1405-1407)CTC>CTA	p.L469L	CEP63_uc003eql.1_Silent_p.L423L|CEP63_uc003eqm.2_Silent_p.L423L|CEP63_uc003eqn.1_Silent_p.L469L|CEP63_uc003eqp.1_Silent_p.L98L	NM_025180	NP_079456	Q96MT8	CEP63_HUMAN	centrosomal protein 63 isoform a	469	Potential.				cell division|DNA damage checkpoint|G2/M transition of mitotic cell cycle|mitosis|signal transduction in response to DNA damage|spindle assembly	centrosome|cytosol|spindle pole	protein binding			ovary(1)	1						TGGAGTCACTCAAATTAGAAA	0.323													13	360	---	---	---	---	PASS
PCCB	5096	broad.mit.edu	37	3	136035888	136035888	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:136035888C>A	uc003eqy.1	+	10	1123	c.1072C>A	c.(1072-1074)CAA>AAA	p.Q358K	PCCB_uc003eqz.1_Missense_Mutation_p.Q358K|PCCB_uc011bmc.1_Missense_Mutation_p.Q378K|PCCB_uc011bmd.1_Missense_Mutation_p.Q275K	NM_000532	NP_000523	P05166	PCCB_HUMAN	propionyl Coenzyme A carboxylase, beta	358	Acyl-CoA binding (Potential).|Carboxyltransferase.				fatty acid beta-oxidation	mitochondrial matrix	ATP binding|propionyl-CoA carboxylase activity				0					Biotin(DB00121)|L-Valine(DB00161)	TGTTGGCAACCAACCTAAGGT	0.463													8	196	---	---	---	---	PASS
STAG1	10274	broad.mit.edu	37	3	136078014	136078014	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:136078014C>A	uc003era.1	-	27	3204	c.2912G>T	c.(2911-2913)CGA>CTA	p.R971L	STAG1_uc003erb.1_Missense_Mutation_p.R971L	NM_005862	NP_005853	Q8WVM7	STAG1_HUMAN	stromal antigen 1	971					cell division|chromosome segregation|mitotic metaphase/anaphase transition|mitotic prometaphase	cell junction|chromatin|chromosome, centromeric region|nucleoplasm	protein binding			ovary(2)	2						AACTGCTTCTCGTGTCTTAAT	0.408													6	106	---	---	---	---	PASS
ARMC8	25852	broad.mit.edu	37	3	137963964	137963964	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:137963964G>C	uc003esa.1	+	13	1398	c.1031G>C	c.(1030-1032)CGC>CCC	p.R344P	ARMC8_uc003erw.2_Missense_Mutation_p.R344P|ARMC8_uc003erx.2_Missense_Mutation_p.R344P|ARMC8_uc003ery.2_Missense_Mutation_p.R316P|ARMC8_uc003erz.2_Missense_Mutation_p.R316P|ARMC8_uc011bmf.1_Missense_Mutation_p.R327P|ARMC8_uc011bmg.1_Missense_Mutation_p.R291P|ARMC8_uc011bmh.1_Missense_Mutation_p.R285P|ARMC8_uc003esb.1_Missense_Mutation_p.R316P|ARMC8_uc003esc.1_Missense_Mutation_p.R116P	NM_015396	NP_056211	Q8IUR7	ARMC8_HUMAN	armadillo repeat containing 8 isoform 2	358							binding				0						CACGAACTCCGCCAGGCTGCA	0.458													13	78	---	---	---	---	PASS
ARMC8	25852	broad.mit.edu	37	3	137988927	137988927	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:137988927C>A	uc003esa.1	+	17	1757	c.1390C>A	c.(1390-1392)CAG>AAG	p.Q464K	TXNDC6_uc003esd.1_Intron|TXNDC6_uc010huf.1_Intron|TXNDC6_uc003ese.1_Intron|ARMC8_uc011bmf.1_Missense_Mutation_p.Q447K|ARMC8_uc011bmg.1_Missense_Mutation_p.Q411K|ARMC8_uc011bmh.1_Missense_Mutation_p.Q405K|ARMC8_uc003esb.1_Missense_Mutation_p.Q436K|ARMC8_uc003esc.1_Missense_Mutation_p.Q236K|ARMC8_uc003esf.1_Missense_Mutation_p.Q47K	NM_015396	NP_056211	Q8IUR7	ARMC8_HUMAN	armadillo repeat containing 8 isoform 2	478	ARM 10.						binding				0						TGGATTAACTCAGAGTGAAAA	0.363													7	99	---	---	---	---	PASS
CEP70	80321	broad.mit.edu	37	3	138291716	138291716	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:138291716G>T	uc003esl.2	-	3	252	c.54C>A	c.(52-54)CTC>CTA	p.L18L	CEP70_uc011bmk.1_Intron|CEP70_uc011bml.1_5'UTR|CEP70_uc011bmm.1_Intron|CEP70_uc003esm.2_Silent_p.L18L|CEP70_uc003esn.2_Silent_p.L18L	NM_024491	NP_077817	Q8NHQ1	CEP70_HUMAN	centrosomal protein 70 kDa	18					G2/M transition of mitotic cell cycle	centrosome|cytosol	protein binding			skin(1)	1						TTTCAGTCATGAGTCTGTCTG	0.338													9	244	---	---	---	---	PASS
MRPS22	56945	broad.mit.edu	37	3	139069035	139069035	+	Silent	SNP	C	A	A	rs139990376		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:139069035C>A	uc003etb.2	+	4	527	c.519C>A	c.(517-519)GTC>GTA	p.V173V	MRPS22_uc003etc.2_RNA|MRPS22_uc003etd.2_Silent_p.V172V|MRPS22_uc003ete.2_Silent_p.V132V	NM_020191	NP_064576	P82650	RT22_HUMAN	mitochondrial ribosomal protein S22	173						mitochondrial small ribosomal subunit	protein binding|structural constituent of ribosome			ovary(2)|skin(1)	3						GTTTTATTGTCGTCAGAGAAC	0.393													4	57	---	---	---	---	PASS
COPB2	9276	broad.mit.edu	37	3	139080022	139080022	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:139080022G>T	uc003etf.3	-	17	2241	c.2111C>A	c.(2110-2112)ACT>AAT	p.T704N	COPB2_uc011bmv.1_Missense_Mutation_p.T675N|COPB2_uc010hui.2_Missense_Mutation_p.T675N	NM_004766	NP_004757	P35606	COPB2_HUMAN	coatomer protein complex, subunit beta 2 (beta	704					COPI coating of Golgi vesicle|intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat|cytosol	protein binding|structural molecule activity			ovary(2)	2						TCCAGAGGCAGTGGCCAAAAG	0.478													7	170	---	---	---	---	PASS
GRK7	131890	broad.mit.edu	37	3	141499363	141499363	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:141499363C>A	uc011bnd.1	+	2	844	c.760C>A	c.(760-762)CTG>ATG	p.L254M		NM_139209	NP_631948	Q8WTQ7	GRK7_HUMAN	G-protein-coupled receptor kinase 7 precursor	254	Protein kinase.				visual perception	membrane	ATP binding|G-protein coupled receptor kinase activity|signal transducer activity			lung(2)|stomach(1)|ovary(1)|skin(1)	5						CATTGTCTCTCTGGCCTATGC	0.517													8	122	---	---	---	---	PASS
TFDP2	7029	broad.mit.edu	37	3	141671423	141671423	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:141671423C>A	uc003eun.3	-	13	1652	c.1273G>T	c.(1273-1275)GAG>TAG	p.E425*	TFDP2_uc003euk.3_Nonsense_Mutation_p.E338*|TFDP2_uc010hur.2_Nonsense_Mutation_p.E365*|TFDP2_uc003eul.3_Nonsense_Mutation_p.E365*|TFDP2_uc011bnf.1_Nonsense_Mutation_p.E328*|TFDP2_uc011bng.1_Nonsense_Mutation_p.E289*|TFDP2_uc003eum.3_Nonsense_Mutation_p.E365*	NM_006286	NP_006277	Q14188	TFDP2_HUMAN	transcription factor Dp-2 (E2F dimerization	425					cell cycle	transcription factor complex	DNA binding|protein domain specific binding|sequence-specific DNA binding transcription factor activity|transcription cofactor activity|transcription factor binding			kidney(1)	1						CAGGGGGTCTCGCCTCGGGAC	0.527													6	135	---	---	---	---	PASS
PLSCR2	57047	broad.mit.edu	37	3	146167049	146167049	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:146167049G>T	uc003evv.1	-	7	922	c.589C>A	c.(589-591)CCT>ACT	p.P197T	PLSCR2_uc003evw.1_Missense_Mutation_p.P266T	NM_020359	NP_065092	Q9NRY7	PLS2_HUMAN	phospholipid scramblase 2	197	Cytoplasmic (By similarity).				phospholipid scrambling	integral to membrane|plasma membrane	calcium ion binding|phospholipid scramblase activity				0						AGGTCTCTAGGGAATTGGATT	0.413													12	214	---	---	---	---	PASS
ZIC4	84107	broad.mit.edu	37	3	147113643	147113643	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:147113643G>A	uc003ewd.1	-	3	957	c.684C>T	c.(682-684)CAC>CAT	p.H228H	ZIC4_uc003ewc.1_Silent_p.H158H|ZIC4_uc011bno.1_Silent_p.H278H	NM_032153	NP_115529	Q8N9L1	ZIC4_HUMAN	zinc finger protein of the cerebellum 4	228	C2H2-type 3.			H -> Q (in Ref. 2; AAH29507).		nucleus	DNA binding|zinc ion binding			upper_aerodigestive_tract(1)|central_nervous_system(1)	2						ACTGACCTGTGTGAGTTCGTT	0.572													10	76	---	---	---	---	PASS
GYG1	2992	broad.mit.edu	37	3	148714590	148714590	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:148714590G>C	uc003ewn.2	+	4	433	c.380G>C	c.(379-381)GGG>GCG	p.G127A	GYG1_uc011bnp.1_Missense_Mutation_p.G127A|GYG1_uc003ewo.2_Missense_Mutation_p.G127A|GYG1_uc003ewp.2_Missense_Mutation_p.G127A	NM_004130	NP_004121	P46976	GLYG_HUMAN	glycogenin 1	127					glucose metabolic process|glycogen biosynthetic process|glycogen catabolic process	cytosol	glycogenin glucosyltransferase activity|metal ion binding|protein binding			ovary(1)	1			LUSC - Lung squamous cell carcinoma(72;0.0473)|Lung(72;0.0607)			CCAGACCCAGGGTGGCCTGAC	0.423													10	66	---	---	---	---	PASS
CP	1356	broad.mit.edu	37	3	148901366	148901366	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:148901366C>T	uc003ewy.3	-	13	2565	c.2312G>A	c.(2311-2313)GGA>GAA	p.G771E	CP_uc011bnr.1_RNA|CP_uc003ewx.3_Missense_Mutation_p.G552E|CP_uc003ewz.2_Missense_Mutation_p.G771E	NM_000096	NP_000087	P00450	CERU_HUMAN	ceruloplasmin precursor	771	Plastocyanin-like 5.|F5/8 type A 3.				cellular iron ion homeostasis|copper ion transport|transmembrane transport	extracellular space	chaperone binding|ferroxidase activity			ovary(1)	1		Prostate(884;0.00217)|Hepatocellular(537;0.00826)|Myeloproliferative disorder(1037;0.0122)|all_neural(597;0.0189)|Melanoma(1037;0.152)	LUSC - Lung squamous cell carcinoma(72;0.0473)|Lung(72;0.0607)		Drotrecogin alfa(DB00055)	GTAAAACTCTCCCTTATCTAA	0.303													8	43	---	---	---	---	PASS
COMMD2	51122	broad.mit.edu	37	3	149469237	149469237	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:149469237C>A	uc003exk.2	-	3	228	c.181G>T	c.(181-183)GGT>TGT	p.G61C		NM_016094	NP_057178	Q86X83	COMD2_HUMAN	COMM domain containing 2	61							protein binding				0			LUSC - Lung squamous cell carcinoma(72;0.0378)|Lung(72;0.048)			CCTTCCACACCATGCTGGACA	0.388													7	119	---	---	---	---	PASS
MME	4311	broad.mit.edu	37	3	154878217	154878217	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:154878217C>A	uc010hvr.1	+	17	1851	c.1640C>A	c.(1639-1641)TCT>TAT	p.S547Y	MME_uc003fab.1_Missense_Mutation_p.S547Y|MME_uc003fac.1_Missense_Mutation_p.S547Y|MME_uc003fad.1_Missense_Mutation_p.S547Y|MME_uc003fae.1_Missense_Mutation_p.S547Y	NM_007289	NP_009220	P08473	NEP_HUMAN	membrane metallo-endopeptidase	547	Extracellular (Potential).				cell-cell signaling|proteolysis	integral to plasma membrane	metal ion binding|metalloendopeptidase activity|protein binding			ovary(2)|central_nervous_system(1)	3		all_neural(597;0.00391)|Myeloproliferative disorder(1037;0.0122)	LUSC - Lung squamous cell carcinoma(72;0.114)|Lung(72;0.135)		Candoxatril(DB00616)	GCATTTTACTCTTCAGGAAGA	0.338													13	357	---	---	---	---	PASS
KCNAB1	7881	broad.mit.edu	37	3	156254473	156254473	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:156254473G>T	uc003far.2	+	14	1261	c.1197G>T	c.(1195-1197)GTG>GTT	p.V399V	KCNAB1_uc011bon.1_Silent_p.V370V|KCNAB1_uc003fas.2_Silent_p.V388V|KCNAB1_uc003fat.2_Silent_p.V381V|KCNAB1_uc010hvt.1_Silent_p.V352V|KCNAB1_uc011boo.1_Silent_p.V275V	NM_172160	NP_751892	Q14722	KCAB1_HUMAN	potassium voltage-gated channel, shaker-related	399						cytoplasm|integral to membrane	oxidoreductase activity|potassium channel regulator activity|voltage-gated potassium channel activity			ovary(3)|skin(1)	4			LUSC - Lung squamous cell carcinoma(72;0.0461)|Lung(72;0.0465)			CATCACATGTGGTAAATGAGA	0.398													8	151	---	---	---	---	PASS
VEPH1	79674	broad.mit.edu	37	3	157146189	157146189	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:157146189C>A	uc003fbj.1	-	5	935	c.618G>T	c.(616-618)TTG>TTT	p.L206F	VEPH1_uc003fbk.1_Missense_Mutation_p.L206F|VEPH1_uc010hvu.1_Missense_Mutation_p.L206F	NM_024621	NP_078897	Q14D04	MELT_HUMAN	ventricular zone expressed PH domain homolog 1	206						plasma membrane				breast(3)|ovary(1)|lung(1)	5			Lung(72;0.0272)|LUSC - Lung squamous cell carcinoma(72;0.0461)			GCTGAGACATCAAGGCCAGGA	0.433													13	77	---	---	---	---	PASS
RSRC1	51319	broad.mit.edu	37	3	158261981	158261981	+	Nonsense_Mutation	SNP	G	T	T	rs140479858	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:158261981G>T	uc003fbt.2	+	10	1033	c.922G>T	c.(922-924)GAG>TAG	p.E308*	RSRC1_uc003fbv.2_Nonsense_Mutation_p.E250*	NM_016625	NP_057709	Q96IZ7	RSRC1_HUMAN	arginine/serine-rich coiled-coil 1	308					nucleocytoplasmic transport	cytoplasm|nuclear speck	protein binding				0			Lung(72;0.00416)|LUSC - Lung squamous cell carcinoma(72;0.00575)			GTTATTTATCGAGAAAGCTGA	0.333													8	216	---	---	---	---	PASS
MFSD1	64747	broad.mit.edu	37	3	158541980	158541980	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:158541980C>A	uc003fcl.1	+	13	1273	c.1243C>A	c.(1243-1245)CGG>AGG	p.R415R	MFSD1_uc003fcm.1_RNA|MFSD1_uc003fcn.1_Silent_p.R318R|MFSD1_uc011bow.1_Silent_p.R376R|MFSD1_uc011box.1_Silent_p.R342R	NM_022736	NP_073573	Q9H3U5	MFSD1_HUMAN	major facilitator superfamily domain containing	415					transmembrane transport	integral to membrane					0			Lung(72;0.00372)|LUSC - Lung squamous cell carcinoma(72;0.00523)			ACTGGATTCTCGGGGGTATTT	0.368													11	386	---	---	---	---	PASS
SMC4	10051	broad.mit.edu	37	3	160141331	160141331	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:160141331G>T	uc003fdh.2	+	14	2251	c.2138G>T	c.(2137-2139)CGA>CTA	p.R713L	IFT80_uc003fda.2_Intron|SMC4_uc010hwc.1_Missense_Mutation_p.R477L|SMC4_uc003fdi.2_Missense_Mutation_p.R688L|SMC4_uc003fdj.2_Missense_Mutation_p.R713L|SMC4_uc010hwd.2_Missense_Mutation_p.R713L|SMC4_uc003fdl.2_Missense_Mutation_p.R416L	NM_001002800	NP_001002800	Q9NTJ3	SMC4_HUMAN	SMC4 structural maintenance of chromosomes	713	Flexible hinge.				cell division|mitotic chromosome condensation	condensin complex|cytoplasm|nucleus	ATP binding|protein heterodimerization activity			ovary(1)|breast(1)	2			Lung(72;0.00334)|LUSC - Lung squamous cell carcinoma(72;0.00523)			TTTGCTTTACGAGATACCTTA	0.343													8	276	---	---	---	---	PASS
SLITRK3	22865	broad.mit.edu	37	3	164907978	164907978	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:164907978C>A	uc003fej.3	-	2	1085	c.641G>T	c.(640-642)CGA>CTA	p.R214L	SLITRK3_uc003fek.2_Missense_Mutation_p.R214L	NM_014926	NP_055741	O94933	SLIK3_HUMAN	slit and trk like 3 protein precursor	214	Extracellular (Potential).|LRR 6.					integral to membrane				ovary(6)|skin(3)|pancreas(1)	10						TAGCATTCCTCGGTAAAAAAG	0.418										HNSCC(40;0.11)			8	95	---	---	---	---	PASS
WDR49	151790	broad.mit.edu	37	3	167272570	167272570	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:167272570C>A	uc003fev.1	-	6	974	c.668G>T	c.(667-669)GGA>GTA	p.G223V	WDR49_uc003feu.1_Missense_Mutation_p.G48V|WDR49_uc011bpd.1_Missense_Mutation_p.G276V|WDR49_uc003few.1_Intron	NM_178824	NP_849146	Q8IV35	WDR49_HUMAN	WD repeat domain 49	223	WD 4.									large_intestine(1)|ovary(1)|skin(1)	3						GTGACAATATCCATTGAAGTC	0.353													23	118	---	---	---	---	PASS
PDCD10	11235	broad.mit.edu	37	3	167413456	167413456	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:167413456C>A	uc003fex.2	-	6	721	c.323G>T	c.(322-324)CGA>CTA	p.R108L	PDCD10_uc003fez.2_Missense_Mutation_p.R108L|PDCD10_uc003fey.2_Missense_Mutation_p.R108L	NM_007217	NP_009148	Q9BUL8	PDC10_HUMAN	programmed cell death 10	108					angiogenesis|apoptosis|negative regulation of apoptosis|positive regulation of cell proliferation|positive regulation of MAP kinase activity	cytosol|Golgi membrane|plasma membrane	protein homodimerization activity|protein N-terminus binding			lung(1)|central_nervous_system(1)	2						TTTAAGTGCTCGTGCCTTTTC	0.368									Familial_Cerebral_Cavernous_Angioma				8	201	---	---	---	---	PASS
GOLIM4	27333	broad.mit.edu	37	3	167747050	167747050	+	Nonsense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:167747050G>A	uc003ffe.2	-	11	1818	c.1474C>T	c.(1474-1476)CAG>TAG	p.Q492*	GOLIM4_uc011bpe.1_Nonsense_Mutation_p.Q492*|GOLIM4_uc011bpf.1_Nonsense_Mutation_p.Q464*|GOLIM4_uc011bpg.1_Nonsense_Mutation_p.Q464*	NM_014498	NP_055313	O00461	GOLI4_HUMAN	golgi integral membrane protein 4	492	Glu-rich.|Gln-rich.|Lumenal (Potential).				transport	cis-Golgi network|endocytic vesicle|endosome membrane|Golgi cisterna membrane|Golgi lumen|integral to membrane|nucleus				breast(4)|skin(1)	5						TCTGCTCCCTGAACGATATCA	0.393													21	114	---	---	---	---	PASS
ARPM1	84517	broad.mit.edu	37	3	169485571	169485571	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:169485571C>A	uc003ffs.1	-	2	1143	c.768G>T	c.(766-768)GAG>GAT	p.E256D	TERC_uc003ffr.1_5'Flank	NM_032487	NP_115876	Q9BYD9	ARPM1_HUMAN	actin related protein M1	256						cytoplasm|cytoskeleton					0	all_cancers(22;9.55e-22)|all_epithelial(15;2.04e-26)|all_lung(20;5.05e-16)|Lung NSC(18;2.19e-15)|Ovarian(172;0.000223)|Breast(254;0.197)		Epithelial(2;4.03e-64)|all cancers(2;5.01e-59)|Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.00676)			AGAAGAGGGCCTCTGGACAAG	0.468													7	107	---	---	---	---	PASS
SLC7A14	57709	broad.mit.edu	37	3	170198327	170198327	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:170198327A>T	uc003fgz.2	-	7	2060	c.1744T>A	c.(1744-1746)TTC>ATC	p.F582I	CLDN11_uc011bpt.1_Intron|uc003fha.1_Intron	NM_020949	NP_066000	Q8TBB6	S7A14_HUMAN	solute carrier family 7 (cationic amino acid	582	Helical; (Potential).					integral to membrane	amino acid transmembrane transporter activity			ovary(2)|upper_aerodigestive_tract(1)|liver(1)|central_nervous_system(1)	5	all_cancers(22;2.41e-22)|all_epithelial(15;4.2e-27)|all_lung(20;1.17e-16)|Lung NSC(18;4.91e-16)|Ovarian(172;0.000902)|Breast(254;0.137)		Lung(28;6.23e-13)|LUSC - Lung squamous cell carcinoma(14;1.48e-12)			AAGATGATGAAGGAGCAGAAG	0.552													7	31	---	---	---	---	PASS
TNIK	23043	broad.mit.edu	37	3	170819284	170819284	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:170819284C>A	uc003fhh.2	-	22	2890	c.2545G>T	c.(2545-2547)GAG>TAG	p.E849*	TNIK_uc003fhi.2_Nonsense_Mutation_p.E794*|TNIK_uc003fhj.2_Nonsense_Mutation_p.E820*|TNIK_uc003fhk.2_Nonsense_Mutation_p.E841*|TNIK_uc003fhl.2_Nonsense_Mutation_p.E765*|TNIK_uc003fhm.2_Nonsense_Mutation_p.E786*|TNIK_uc003fhn.2_Nonsense_Mutation_p.E812*|TNIK_uc003fho.2_Nonsense_Mutation_p.E757*|TNIK_uc003fhg.2_Nonsense_Mutation_p.E27*	NM_015028	NP_055843	Q9UKE5	TNIK_HUMAN	TRAF2 and NCK interacting kinase isoform 1	849	Mediates interaction with NEDD4.				actin cytoskeleton reorganization|activation of JNKK activity|protein autophosphorylation|regulation of dendrite morphogenesis|Wnt receptor signaling pathway	cytoskeleton|nucleus|recycling endosome	ATP binding|protein binding|protein serine/threonine kinase activity|small GTPase regulator activity			ovary(4)|large_intestine(1)	5	all_cancers(22;2.55e-19)|all_lung(20;2.22e-14)|Ovarian(172;0.00197)|Breast(254;0.122)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)			TCATGGGTCTCGCTCTCTCCA	0.483													7	268	---	---	---	---	PASS
FNDC3B	64778	broad.mit.edu	37	3	171851309	171851309	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:171851309G>T	uc003fhy.2	+	3	332	c.160G>T	c.(160-162)GAG>TAG	p.E54*	FNDC3B_uc003fhz.3_Nonsense_Mutation_p.E54*|FNDC3B_uc003fia.2_5'UTR|FNDC3B_uc003fhx.2_RNA	NM_022763	NP_073600	Q53EP0	FND3B_HUMAN	fibronectin type III domain containing 3B	54						endoplasmic reticulum|integral to membrane				ovary(2)|breast(1)	3	all_cancers(22;1.01e-18)|Ovarian(172;0.00167)|Breast(254;0.165)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)	GBM - Glioblastoma multiforme(1;0.0494)		AATAAGAGCAGAGGATGGAAC	0.338													7	101	---	---	---	---	PASS
SPATA16	83893	broad.mit.edu	37	3	172835271	172835271	+	Missense_Mutation	SNP	C	G	G	rs143065627		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:172835271C>G	uc003fin.3	-	2	409	c.251G>C	c.(250-252)CGG>CCG	p.R84P		NM_031955	NP_114161	Q9BXB7	SPT16_HUMAN	spermatogenesis associated 16	84					cell differentiation|multicellular organismal development|spermatogenesis	Golgi apparatus	binding			ovary(2)|skin(1)	3	Ovarian(172;0.00319)|Breast(254;0.197)		LUSC - Lung squamous cell carcinoma(14;1.48e-14)|Lung(28;6.63e-14)			TTCTGCCTTCCGTTTAAAGGC	0.393													35	248	---	---	---	---	PASS
ZNF639	51193	broad.mit.edu	37	3	179051459	179051459	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179051459G>T	uc003fjq.1	+	6	1050	c.707G>T	c.(706-708)CGA>CTA	p.R236L	ZNF639_uc003fjr.1_Missense_Mutation_p.R236L	NM_016331	NP_057415	Q9UID6	ZN639_HUMAN	zinc finger protein 639	236	C2H2-type 2.				initiation of viral infection|negative regulation by host of viral transcription|negative regulation of transcription, DNA-dependent|positive regulation by host of viral transcription|positive regulation of cell growth|positive regulation of transcription, DNA-dependent	nucleus	protein self-association|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding				0	all_cancers(143;7.9e-17)|Ovarian(172;0.0172)|Breast(254;0.155)		OV - Ovarian serous cystadenocarcinoma(80;5.78e-26)|GBM - Glioblastoma multiforme(14;0.003)|BRCA - Breast invasive adenocarcinoma(182;0.0923)			AATGTGTGTCGAGTATGCAAG	0.348													6	78	---	---	---	---	PASS
USP13	8975	broad.mit.edu	37	3	179426590	179426590	+	Missense_Mutation	SNP	G	T	T	rs61760204		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179426590G>T	uc003fkh.2	+	6	731	c.650G>T	c.(649-651)CGA>CTA	p.R217L	USP13_uc003fkf.2_Missense_Mutation_p.R217L	NM_003940	NP_003931	Q92995	UBP13_HUMAN	ubiquitin thiolesterase 13	217	UBP-type.				ubiquitin-dependent protein catabolic process		cysteine-type endopeptidase activity|omega peptidase activity|protein binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity|zinc ion binding			ovary(1)	1	all_cancers(143;7.79e-15)|Ovarian(172;0.0338)|Breast(254;0.148)		OV - Ovarian serous cystadenocarcinoma(80;1e-25)|GBM - Glioblastoma multiforme(14;0.0169)			TGCGACCTGCGAGAAAACCTC	0.493													7	159	---	---	---	---	PASS
CCDC39	339829	broad.mit.edu	37	3	180359867	180359867	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180359867C>A	uc010hxe.2	-	13	1903	c.1788G>T	c.(1786-1788)ATG>ATT	p.M596I	CCDC39_uc003fkn.2_RNA	NM_181426	NP_852091	Q9UFE4	CCD39_HUMAN	coiled-coil domain containing 39	596	Potential.				axonemal dynein complex assembly|ciliary cell motility|cilium movement involved in determination of left/right asymmetry|flagellar cell motility	cilium axoneme|cytoplasm|cytoskeleton				ovary(4)	4	all_cancers(143;9.31e-15)|Ovarian(172;0.0212)		OV - Ovarian serous cystadenocarcinoma(80;5.62e-23)|GBM - Glioblastoma multiforme(14;0.000558)			TTCGCTCTTCCATTGCTGTGT	0.343													8	176	---	---	---	---	PASS
FXR1	8087	broad.mit.edu	37	3	180671624	180671624	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:180671624C>A	uc003fkq.2	+	9	898	c.876C>A	c.(874-876)CTC>CTA	p.L292L	FXR1_uc003fkp.2_Silent_p.L207L|FXR1_uc003fkr.2_Silent_p.L292L|FXR1_uc011bqj.1_Silent_p.L206L|FXR1_uc003fks.2_Silent_p.L206L|FXR1_uc011bqk.1_Silent_p.L243L|FXR1_uc011bql.1_Silent_p.L279L	NM_005087	NP_005078	P51114	FXR1_HUMAN	fragile X mental retardation-related protein 1	292	KH 2.				apoptosis|cell differentiation|muscle organ development	nucleolus|polysome				breast(1)	1	all_cancers(143;6.07e-14)|Ovarian(172;0.0212)		Epithelial(37;3.05e-35)|OV - Ovarian serous cystadenocarcinoma(80;2.4e-22)			CTAGGAATCTCGTTGGTAGGT	0.323													7	155	---	---	---	---	PASS
ATP11B	23200	broad.mit.edu	37	3	182553854	182553854	+	Missense_Mutation	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:182553854A>G	uc003flb.2	+	5	604	c.347A>G	c.(346-348)GAT>GGT	p.D116G	ATP11B_uc003fla.2_Missense_Mutation_p.D116G	NM_014616	NP_055431	Q9Y2G3	AT11B_HUMAN	ATPase, class VI, type 11B	116	Cytoplasmic (Potential).				aminophospholipid transport|ATP biosynthetic process	integral to membrane|nuclear inner membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			ovary(2)|pancreas(1)	3	all_cancers(143;9.04e-15)|Ovarian(172;0.0355)		all cancers(12;1.2e-42)|Epithelial(37;2.77e-36)|LUSC - Lung squamous cell carcinoma(7;7.58e-24)|Lung(8;4.66e-22)|OV - Ovarian serous cystadenocarcinoma(80;2.35e-20)			CATAACTCAGATAATGAAGTA	0.313													14	88	---	---	---	---	PASS
DCUN1D1	54165	broad.mit.edu	37	3	182679086	182679086	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:182679086C>A	uc003fld.1	-	4	497	c.448G>T	c.(448-450)GAA>TAA	p.E150*	DCUN1D1_uc011bqn.1_Nonsense_Mutation_p.E7*	NM_020640	NP_065691	Q96GG9	DCNL1_HUMAN	RP42 homolog	150	DCUN1.					ubiquitin ligase complex	protein binding			ovary(1)	1	all_cancers(143;9.04e-15)|Ovarian(172;0.0355)		all cancers(12;2.54e-44)|Epithelial(37;4.71e-38)|LUSC - Lung squamous cell carcinoma(7;5.04e-25)|Lung(8;5.03e-23)|OV - Ovarian serous cystadenocarcinoma(80;7.41e-21)			CGTCCTGGTTCTTTCAATTCT	0.308													13	498	---	---	---	---	PASS
DCUN1D1	54165	broad.mit.edu	37	3	182679095	182679095	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:182679095C>A	uc003fld.1	-	4	488	c.439G>T	c.(439-441)GAA>TAA	p.E147*	DCUN1D1_uc011bqn.1_Nonsense_Mutation_p.E4*	NM_020640	NP_065691	Q96GG9	DCNL1_HUMAN	RP42 homolog	147	DCUN1.					ubiquitin ligase complex	protein binding			ovary(1)	1	all_cancers(143;9.04e-15)|Ovarian(172;0.0355)		all cancers(12;2.54e-44)|Epithelial(37;4.71e-38)|LUSC - Lung squamous cell carcinoma(7;5.04e-25)|Lung(8;5.03e-23)|OV - Ovarian serous cystadenocarcinoma(80;7.41e-21)			TCTTTCAATTCTTGTTCCATC	0.299													13	529	---	---	---	---	PASS
MCCC1	56922	broad.mit.edu	37	3	182733349	182733349	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:182733349G>T	uc003fle.2	-	19	2192	c.2055C>A	c.(2053-2055)ACC>ACA	p.T685T	MCCC1_uc010hxi.2_RNA|MCCC1_uc011bqo.1_RNA|MCCC1_uc003flf.2_Silent_p.T568T|MCCC1_uc003flg.2_Silent_p.T576T	NM_020166	NP_064551	Q96RQ3	MCCA_HUMAN	methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)	685	Biotinyl-binding.				biotin metabolic process|leucine catabolic process	mitochondrial inner membrane|mitochondrial matrix	ATP binding|biotin binding|biotin carboxylase activity|metal ion binding|methylcrotonoyl-CoA carboxylase activity			ovary(1)|central_nervous_system(1)|skin(1)	3	all_cancers(143;1.84e-14)|Ovarian(172;0.0355)		all cancers(12;1.8e-44)|Epithelial(37;3.23e-38)|LUSC - Lung squamous cell carcinoma(7;5.04e-25)|Lung(8;5.03e-23)|OV - Ovarian serous cystadenocarcinoma(80;5.07e-21)		Biotin(DB00121)	GAGACTTTATGGTATGCTGCA	0.428													10	233	---	---	---	---	PASS
MCF2L2	23101	broad.mit.edu	37	3	183041131	183041131	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:183041131C>A	uc003fli.1	-	6	585	c.495G>T	c.(493-495)ATG>ATT	p.M165I	MCF2L2_uc003flj.1_Missense_Mutation_p.M165I|MCF2L2_uc003flp.1_Missense_Mutation_p.M200I	NM_015078	NP_055893	Q86YR7	MF2L2_HUMAN	Rho family guanine-nucleotide exchange factor	165	CRAL-TRIO.				regulation of Rho protein signal transduction	intracellular	Rho guanyl-nucleotide exchange factor activity			ovary(2)|large_intestine(2)|breast(1)	5	all_cancers(143;1.26e-12)|Ovarian(172;0.0355)		all cancers(12;3.35e-44)|Epithelial(37;6.48e-38)|LUSC - Lung squamous cell carcinoma(7;7.12e-25)|Lung(8;6.39e-23)|OV - Ovarian serous cystadenocarcinoma(80;6.75e-21)			CAGAGTTTACCATGATGATCT	0.358													8	136	---	---	---	---	PASS
CLCN2	1181	broad.mit.edu	37	3	184075157	184075157	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:184075157C>A	uc003foi.2	-	8	1015	c.891G>T	c.(889-891)CGG>CGT	p.R297R	CLCN2_uc003foh.2_5'Flank|CLCN2_uc010hya.1_Silent_p.R297R|CLCN2_uc011brl.1_Silent_p.R297R|CLCN2_uc011brm.1_Silent_p.R253R|CLCN2_uc011brn.1_Silent_p.R297R	NM_004366	NP_004357	P51788	CLCN2_HUMAN	chloride channel 2	297						chloride channel complex	voltage-gated chloride channel activity				0	all_cancers(143;6.66e-11)|Ovarian(172;0.0339)		Epithelial(37;2.22e-33)|OV - Ovarian serous cystadenocarcinoma(80;2.72e-22)		Lubiprostone(DB01046)	CACCTTCATCCCGGTTCCAGA	0.627													6	43	---	---	---	---	PASS
LIPH	200879	broad.mit.edu	37	3	185245287	185245287	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:185245287G>T	uc003fpm.2	-	4	723	c.613C>A	c.(613-615)CAT>AAT	p.H205N	LIPH_uc010hyh.2_Intron	NM_139248	NP_640341	Q8WWY8	LIPH_HUMAN	lipase, member H precursor	205			Missing (in LAH2).		lipid catabolic process	extracellular space|plasma membrane	heparin binding|phospholipase activity			ovary(1)|pancreas(1)	2	all_cancers(143;8.87e-11)|Ovarian(172;0.0386)		OV - Ovarian serous cystadenocarcinoma(80;1.31e-21)			GTGTCGGAATGGATGACATCA	0.517													7	118	---	---	---	---	PASS
EIF4A2	1974	broad.mit.edu	37	3	186504960	186504960	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186504960C>A	uc003fqs.2	+	8	855	c.816C>A	c.(814-816)ACC>ACA	p.T272T	EIF4A2_uc003fqt.2_RNA|EIF4A2_uc003fqu.2_Silent_p.T273T|EIF4A2_uc003fqv.2_Silent_p.T177T|EIF4A2_uc003fqw.2_Silent_p.T177T|EIF4A2_uc011bsb.1_Silent_p.T145T|SNORA63_uc010hyw.1_5'Flank|SNORA4_uc010hyx.1_5'Flank	NM_001967	NP_001958	Q14240	IF4A2_HUMAN	eukaryotic translation initiation factor 4A2	272	Helicase C-terminal.				interspecies interaction between organisms|nuclear-transcribed mRNA poly(A) tail shortening|regulation of translational initiation	cytosol|eukaryotic translation initiation factor 4F complex	ATP binding|ATP-dependent helicase activity|protein binding|translation initiation factor activity			ovary(2)|breast(2)	4	all_cancers(143;2.68e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;1.07e-20)	GBM - Glioblastoma multiforme(93;0.0704)		AGACACTGACCATTACACAGG	0.413			T	BCL6	NHL								8	169	---	---	---	---	PASS
RTP1	132112	broad.mit.edu	37	3	186917839	186917839	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186917839C>A	uc003frg.2	+	2	803	c.773C>A	c.(772-774)TCT>TAT	p.S258Y		NM_153708	NP_714919	P59025	RTP1_HUMAN	receptor transporting protein 1	258	Helical; (Potential).				protein insertion into membrane	cell surface|integral to membrane|plasma membrane	olfactory receptor binding			ovary(2)|breast(1)	3	all_cancers(143;5.33e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;5.56e-18)	GBM - Glioblastoma multiforme(93;0.0269)		CTGCAGTTCTCTTTCCGTAGC	0.562													12	73	---	---	---	---	PASS
MASP1	5648	broad.mit.edu	37	3	186959294	186959294	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:186959294C>A	uc003frh.1	-	10	1610	c.1278G>T	c.(1276-1278)GGG>GGT	p.G426G	MASP1_uc003fri.2_Silent_p.G426G|MASP1_uc003frj.2_Silent_p.G395G	NM_001879	NP_001870	P48740	MASP1_HUMAN	mannan-binding lectin serine protease 1 isoform	426	Sushi 2.				complement activation, lectin pathway|negative regulation of complement activation|proteolysis	extracellular space	calcium ion binding|calcium-dependent protein binding|protein binding|protein homodimerization activity|serine-type endopeptidase activity			ovary(2)|breast(1)|liver(1)	4	all_cancers(143;5.33e-12)|Ovarian(172;0.0339)		OV - Ovarian serous cystadenocarcinoma(80;3.49e-18)	GBM - Glioblastoma multiforme(93;0.0366)		GTAGGCTTCTCCCCAATACTT	0.478													7	125	---	---	---	---	PASS
CLDN16	10686	broad.mit.edu	37	3	190127775	190127775	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:190127775G>T	uc003fsi.2	+	5	936	c.868G>T	c.(868-870)GCC>TCC	p.A290S	CLDN16_uc010hze.2_3'UTR	NM_006580	NP_006571	Q9Y5I7	CLD16_HUMAN	claudin 16	290	Cytoplasmic (Potential).				calcium-independent cell-cell adhesion|cellular metal ion homeostasis|excretion	integral to membrane|tight junction	identical protein binding|magnesium ion transmembrane transporter activity|structural molecule activity			ovary(1)	1	all_cancers(143;3.61e-10)|Ovarian(172;0.0991)		Lung(62;2.23e-05)|LUSC - Lung squamous cell carcinoma(58;3.15e-05)	GBM - Glioblastoma multiforme(93;0.018)		GTCATACTCAGCCCCTCGCAC	0.438													6	83	---	---	---	---	PASS
FGF12	2257	broad.mit.edu	37	3	191888391	191888391	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:191888391C>A	uc003fsx.2	-	4	1295	c.469G>T	c.(469-471)GTG>TTG	p.V157L	FGF12_uc003fsy.2_Missense_Mutation_p.V95L	NM_021032	NP_066360	P61328	FGF12_HUMAN	fibroblast growth factor 12 isoform 1	157					cell-cell signaling|heart development|JNK cascade|nervous system development|signal transduction	extracellular space|nucleus	growth factor activity|heparin binding			ovary(1)|skin(1)|lung(1)|pancreas(1)	4	all_cancers(143;1.72e-08)|Ovarian(172;0.0634)|Breast(254;0.247)	Lung NSC(153;0.21)	LUSC - Lung squamous cell carcinoma(58;5.45e-06)|Lung(62;6.17e-06)	GBM - Glioblastoma multiforme(46;0.00032)		GAATAGATCACATAGTAGTTT	0.368													8	259	---	---	---	---	PASS
OPA1	4976	broad.mit.edu	37	3	193349413	193349413	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:193349413G>T	uc003ftm.2	+	6	871	c.637G>T	c.(637-639)GAG>TAG	p.E213*	OPA1_uc003ftg.2_Nonsense_Mutation_p.E268*|OPA1_uc003fth.2_Nonsense_Mutation_p.E232*|OPA1_uc003fti.2_Nonsense_Mutation_p.E250*|OPA1_uc003ftj.2_Nonsense_Mutation_p.E231*|OPA1_uc003ftk.2_Nonsense_Mutation_p.E214*|OPA1_uc003ftl.2_Nonsense_Mutation_p.E195*|OPA1_uc003ftn.2_Nonsense_Mutation_p.E177*	NM_015560	NP_056375	O60313	OPA1_HUMAN	optic atrophy 1 isoform 1	213	Mitochondrial intermembrane (By similarity).|Potential.				apoptosis|axon transport of mitochondrion|inner mitochondrial membrane organization|mitochondrial fission|mitochondrial fusion|positive regulation of anti-apoptosis|response to stimulus|visual perception	dendrite|integral to membrane|mitochondrial crista|mitochondrial intermembrane space|mitochondrial outer membrane	GTP binding|GTPase activity|magnesium ion binding|protein binding				0	all_cancers(143;9.56e-09)|Ovarian(172;0.0386)		OV - Ovarian serous cystadenocarcinoma(49;9.19e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;0.000162)		GTCAGACAAAGAGAAAATTGA	0.284													10	290	---	---	---	---	PASS
LSG1	55341	broad.mit.edu	37	3	194366966	194366966	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:194366966C>A	uc003fui.2	-	12	1865	c.1550G>T	c.(1549-1551)CGA>CTA	p.R517L		NM_018385	NP_060855	Q9H089	LSG1_HUMAN	large subunit GTPase 1	517					nuclear export|protein transport	Cajal body|endoplasmic reticulum	GTP binding|hydrolase activity				0	all_cancers(143;1.68e-08)|Ovarian(172;0.0634)		OV - Ovarian serous cystadenocarcinoma(49;4.34e-18)|LUSC - Lung squamous cell carcinoma(58;3.55e-06)|Lung(62;4.19e-06)	GBM - Glioblastoma multiforme(46;7.55e-06)		CATGAATCCTCGCATGTCTGT	0.448													5	118	---	---	---	---	PASS
TFRC	7037	broad.mit.edu	37	3	195780393	195780393	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:195780393G>T	uc003fvz.3	-	18	2219	c.1936C>A	c.(1936-1938)CGT>AGT	p.R646S	TFRC_uc003fwa.3_Missense_Mutation_p.R646S|TFRC_uc010hzy.2_Missense_Mutation_p.R565S|TFRC_uc011btr.1_Missense_Mutation_p.R364S	NM_003234	NP_003225	P02786	TFR1_HUMAN	transferrin receptor	646	Cell attachment site; required for binding to transferrin.|Extracellular (Potential).|Ligand-binding.			R->A,H: No binding to transferrin.|R->K: 5% binding to transferrin.	cellular iron ion homeostasis|endocytosis|interspecies interaction between organisms|proteolysis|transferrin transport|transmembrane transport	coated pit|endosome|integral to plasma membrane|melanosome	peptidase activity|transferrin receptor activity			ovary(3)	3	all_cancers(143;1.94e-08)|Ovarian(172;0.0634)|Breast(254;0.206)		Epithelial(36;1.36e-24)|all cancers(36;3.34e-22)|OV - Ovarian serous cystadenocarcinoma(49;1.17e-18)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.00233)		AAGTCTCCACGAGCAGAATAC	0.403			T	BCL6	NHL								5	110	---	---	---	---	PASS
UBXN7	26043	broad.mit.edu	37	3	196129834	196129834	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196129834G>T	uc003fwm.3	-	3	353	c.278C>A	c.(277-279)CCA>CAA	p.P93Q	UBXN7_uc003fwn.3_5'UTR|UBXN7_uc010iae.2_Intron|UBXN7_uc010iaf.2_Missense_Mutation_p.P93Q	NM_015562	NP_056377	O94888	UBXN7_HUMAN	UBX domain containing 7	93							protein binding			ovary(2)|pancreas(1)	3						ACCAAATAATGGTTCTGGTTC	0.338													12	320	---	---	---	---	PASS
DLG1	1739	broad.mit.edu	37	3	196867071	196867071	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:196867071G>T	uc003fxo.3	-	9	942	c.752C>A	c.(751-753)TCA>TAA	p.S251*	DLG1_uc011bub.1_Nonsense_Mutation_p.S135*|DLG1_uc011buc.1_Nonsense_Mutation_p.S135*|DLG1_uc011bud.1_5'UTR|DLG1_uc003fxn.3_Nonsense_Mutation_p.S251*|DLG1_uc011bue.1_Nonsense_Mutation_p.S218*|DLG1_uc010ial.2_Nonsense_Mutation_p.S251*|DLG1_uc011buf.1_RNA|DLG1_uc003fxp.2_RNA|DLG1_uc010iam.1_Nonsense_Mutation_p.S218*|DLG1_uc010ian.2_Nonsense_Mutation_p.S118*	NM_001098424	NP_001091894	Q12959	DLG1_HUMAN	discs, large homolog 1 isoform 1	251	PDZ 1.				actin filament organization|axon guidance|cell-cell adhesion|cortical actin cytoskeleton organization|endothelial cell proliferation|establishment or maintenance of cell polarity|interspecies interaction between organisms|mitotic cell cycle G1/S transition checkpoint|negative regulation of mitotic cell cycle|protein localization in plasma membrane|synaptic transmission|tight junction assembly	basolateral plasma membrane|cytosol|endoplasmic reticulum membrane|immunological synapse|MPP7-DLG1-LIN7 complex|nucleus|postsynaptic density|postsynaptic membrane|sarcolemma|tight junction	cytoskeletal protein binding|guanylate kinase activity|L27 domain binding|phosphatase binding|phosphoprotein phosphatase activity|potassium channel regulator activity|protein binding|protein C-terminus binding|protein kinase binding			ovary(3)	3	all_cancers(143;6.22e-10)|Ovarian(172;0.0418)|Breast(254;0.0589)	Lung NSC(153;0.133)	Epithelial(36;3.23e-24)|all cancers(36;2.15e-22)|OV - Ovarian serous cystadenocarcinoma(49;3.88e-19)|LUSC - Lung squamous cell carcinoma(58;1.51e-06)|Lung(62;1.95e-06)	GBM - Glioblastoma multiforme(46;0.0148)		GAAAATACTTGAGTCATCTCC	0.423													7	108	---	---	---	---	PASS
MIR571	693156	broad.mit.edu	37	4	343949	343949	+	RNA	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:343949C>A	hsa-mir-571|MI0003578	+			c.4C>A			ZNF141_uc003fzz.2_Intron|ZNF141_uc003gaa.2_Intron|ZNF141_uc003gab.2_Intron																	0						tcagaatcctcagtaagacca	0.010													6	52	---	---	---	---	PASS
ZNF721	170960	broad.mit.edu	37	4	438027	438027	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:438027G>T	uc003gag.2	-	3	920	c.229C>A	c.(229-231)CAG>AAG	p.Q77K	ABCA11P_uc003gac.2_Intron|ABCA11P_uc003gad.2_Intron|ABCA11P_uc011buv.1_Intron|ABCA11P_uc003gae.2_Intron|ABCA11P_uc010ibd.1_Intron|ZNF721_uc003gaf.3_Missense_Mutation_p.Q109K|ZNF721_uc010ibe.2_Missense_Mutation_p.Q65K	NM_133474	NP_597731	D9N162	D9N162_HUMAN	zinc finger protein 721	77						intracellular	nucleic acid binding|zinc ion binding			ovary(1)	1						ATTTTGCTCTGAGTATTTGAC	0.303													6	77	---	---	---	---	PASS
HTT	3064	broad.mit.edu	37	4	3189401	3189401	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:3189401G>T	uc011bvq.1	+	40	5164	c.5019G>T	c.(5017-5019)CTG>CTT	p.L1673L		NM_002111	NP_002102	P42858	HD_HUMAN	huntingtin	1671					establishment of mitotic spindle orientation|Golgi organization|retrograde vesicle-mediated transport, Golgi to ER|vesicle transport along microtubule	autophagic vacuole|axon|cytoplasmic vesicle membrane|cytosol|dendrite|endoplasmic reticulum|Golgi apparatus|late endosome|membrane fraction|nucleus|protein complex	beta-tubulin binding|dynactin binding|dynein intermediate chain binding|p53 binding|transcription factor binding			skin(2)|ovary(1)|lung(1)	4		all_epithelial(65;0.18)		UCEC - Uterine corpus endometrioid carcinoma (64;0.187)		CTGTTCAACTGTGGATATCGG	0.398													7	150	---	---	---	---	PASS
CRMP1	1400	broad.mit.edu	37	4	5837709	5837709	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:5837709G>T	uc003gip.2	-	12	1315	c.1214C>A	c.(1213-1215)TCG>TAG	p.S405*	CRMP1_uc003gin.1_Nonsense_Mutation_p.S317*|CRMP1_uc003giq.2_Nonsense_Mutation_p.S405*|CRMP1_uc003gir.2_Nonsense_Mutation_p.S400*|CRMP1_uc003gis.2_Nonsense_Mutation_p.S519*	NM_001313	NP_001304	Q14194	DPYL1_HUMAN	collapsin response mediator protein 1 isoform 2	405					axon guidance|pyrimidine base catabolic process	cytosol|microtubule organizing center|spindle	dihydropyrimidinase activity|protein binding			ovary(2)	2				Colorectal(103;0.0721)		GTCGGCATCCGAGCCCACGGC	0.517													6	56	---	---	---	---	PASS
GPR125	166647	broad.mit.edu	37	4	22422582	22422582	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:22422582G>T	uc003gqm.1	-	12	2001	c.1736C>A	c.(1735-1737)CCA>CAA	p.P579Q	GPR125_uc010ieo.1_Missense_Mutation_p.P453Q|GPR125_uc003gqn.1_Missense_Mutation_p.P353Q|GPR125_uc003gqo.2_Missense_Mutation_p.P579Q	NM_145290	NP_660333	Q8IWK6	GP125_HUMAN	G protein-coupled receptor 125 precursor	579	Extracellular (Potential).				neuropeptide signaling pathway	integral to membrane	G-protein coupled receptor activity			skin(1)	1		Breast(46;0.198)				GTTTCCCTCTGGATCCCGCCT	0.463													9	222	---	---	---	---	PASS
SEL1L3	23231	broad.mit.edu	37	4	25783963	25783963	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:25783963G>T	uc003gru.3	-	15	2510	c.2358C>A	c.(2356-2358)TAC>TAA	p.Y786*	SEL1L3_uc003grv.2_Nonsense_Mutation_p.Y193*	NM_015187	NP_056002	Q68CR1	SE1L3_HUMAN	sel-1 suppressor of lin-12-like 3	786	Sel1-like 5.					integral to membrane	binding				0						CTTTTAACCAGTACTTTGCTG	0.438													5	52	---	---	---	---	PASS
ARAP2	116984	broad.mit.edu	37	4	36214902	36214902	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:36214902C>A	uc003gsq.1	-	4	1342	c.1004G>T	c.(1003-1005)GGA>GTA	p.G335V	ARAP2_uc003gsr.1_Missense_Mutation_p.G335V	NM_015230	NP_056045	Q8WZ64	ARAP2_HUMAN	ArfGAP with RhoGAP domain, ankyrin repeat and PH	335					regulation of ARF GTPase activity|small GTPase mediated signal transduction	cytosol	ARF GTPase activator activity|phosphatidylinositol-3,4,5-trisphosphate binding|zinc ion binding			ovary(1)|pancreas(1)|skin(1)	3						AAAGGTCTCTCCATAAGGAAA	0.328													6	95	---	---	---	---	PASS
TBC1D1	23216	broad.mit.edu	37	4	38097700	38097700	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:38097700C>A	uc003gtb.2	+	14	2730	c.2387C>A	c.(2386-2388)GCT>GAT	p.A796D	TBC1D1_uc011byd.1_Missense_Mutation_p.A890D|TBC1D1_uc010ifd.2_Missense_Mutation_p.A583D	NM_015173	NP_055988	Q86TI0	TBCD1_HUMAN	TBC1 (tre-2/USP6, BUB2, cdc16) domain family,	796						nucleus	Rab GTPase activator activity			ovary(1)	1						ATGCACTCGGCTGTTGGGCAA	0.403													5	86	---	---	---	---	PASS
TLR10	81793	broad.mit.edu	37	4	38776168	38776168	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:38776168C>A	uc003gti.2	-	2	1423	c.1044G>T	c.(1042-1044)ACG>ACT	p.T348T	TLR10_uc003gtj.2_Silent_p.T348T|TLR10_uc003gtk.2_Silent_p.T348T	NM_030956	NP_112218	Q9BXR5	TLR10_HUMAN	toll-like receptor 10 precursor	348	LRR 8.|Extracellular (Potential).				inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway	integral to membrane|plasma membrane	transmembrane receptor activity			lung(1)|breast(1)	2						ATTGGAATTTCGTAGGATAAT	0.328													5	101	---	---	---	---	PASS
N4BP2	55728	broad.mit.edu	37	4	40123254	40123254	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:40123254C>A	uc003guy.3	+	9	3861	c.3523C>A	c.(3523-3525)CCT>ACT	p.P1175T	N4BP2_uc010ifq.2_Missense_Mutation_p.P1095T|N4BP2_uc010ifr.2_Missense_Mutation_p.P1095T	NM_018177	NP_060647	Q86UW6	N4BP2_HUMAN	Nedd4 binding protein 2	1175						cytoplasm	ATP binding|ATP-dependent polydeoxyribonucleotide 5'-hydroxyl-kinase activity|endonuclease activity|protein binding			lung(3)|breast(2)|kidney(2)|ovary(1)	8						TTCTAATTCTCCTGTGCCAGA	0.418													8	70	---	---	---	---	PASS
LIMCH1	22998	broad.mit.edu	37	4	41699182	41699182	+	Missense_Mutation	SNP	G	C	C	rs142431467		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:41699182G>C	uc003gvu.3	+	27	3286	c.3232G>C	c.(3232-3234)GGG>CGG	p.G1078R	LIMCH1_uc003gvv.3_Missense_Mutation_p.G1052R|LIMCH1_uc003gvw.3_Missense_Mutation_p.G1051R|LIMCH1_uc003gvx.3_Missense_Mutation_p.G1064R|LIMCH1_uc003gwe.3_Missense_Mutation_p.G975R|LIMCH1_uc003gvy.3_Missense_Mutation_p.G880R|LIMCH1_uc003gwa.3_Missense_Mutation_p.G892R|LIMCH1_uc003gvz.3_Missense_Mutation_p.G1462R|LIMCH1_uc011byu.1_Missense_Mutation_p.G911R|LIMCH1_uc003gwc.3_Missense_Mutation_p.G897R|LIMCH1_uc003gwd.3_Missense_Mutation_p.G885R|LIMCH1_uc011byv.1_Missense_Mutation_p.G828R|LIMCH1_uc011byw.1_Missense_Mutation_p.G351R|LIMCH1_uc010ifv.2_RNA	NM_014988	NP_055803	Q9UPQ0	LIMC1_HUMAN	LIM and calponin homology domains 1 isoform a	1078					actomyosin structure organization		actin binding|zinc ion binding			ovary(2)|pancreas(1)|skin(1)	4						CACAGGTGCCGGGCAGCCTAC	0.453													4	77	---	---	---	---	PASS
ATP8A1	10396	broad.mit.edu	37	4	42553231	42553231	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:42553231G>T	uc003gwr.2	-	18	1818	c.1586C>A	c.(1585-1587)TCG>TAG	p.S529*	ATP8A1_uc003gws.2_Nonsense_Mutation_p.S514*|ATP8A1_uc011byz.1_Nonsense_Mutation_p.S514*	NM_006095	NP_006086	Q9Y2Q0	AT8A1_HUMAN	ATPase, aminophospholipid transporter (APLT),	529	Cytoplasmic (Potential).				ATP biosynthetic process	chromaffin granule membrane|integral to membrane|plasma membrane	aminophospholipid transporter activity|ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|cation-transporting ATPase activity|magnesium ion binding|phospholipid-translocating ATPase activity			skin(2)|central_nervous_system(1)	3					Phosphatidylserine(DB00144)	TATAATCACCGAGTCGGGTGT	0.353													5	120	---	---	---	---	PASS
ATP8A1	10396	broad.mit.edu	37	4	42580325	42580325	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:42580325C>A	uc003gwr.2	-	12	1312	c.1080G>T	c.(1078-1080)TTG>TTT	p.L360F	ATP8A1_uc003gws.2_Missense_Mutation_p.L360F|ATP8A1_uc011byz.1_Missense_Mutation_p.L360F	NM_006095	NP_006086	Q9Y2Q0	AT8A1_HUMAN	ATPase, aminophospholipid transporter (APLT),	360	Helical; (Potential).				ATP biosynthetic process	chromaffin granule membrane|integral to membrane|plasma membrane	aminophospholipid transporter activity|ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|cation-transporting ATPase activity|magnesium ion binding|phospholipid-translocating ATPase activity			skin(2)|central_nervous_system(1)	3					Phosphatidylserine(DB00144)	CTAATGTAACCAATAAGCTGA	0.358													6	62	---	---	---	---	PASS
CORIN	10699	broad.mit.edu	37	4	47647201	47647201	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47647201C>A	uc003gxm.2	-	14	1947	c.1854G>T	c.(1852-1854)GAG>GAT	p.E618D	CORIN_uc011bzf.1_Missense_Mutation_p.E479D|CORIN_uc011bzg.1_Missense_Mutation_p.E551D|CORIN_uc011bzh.1_Missense_Mutation_p.E581D	NM_006587	NP_006578	Q9Y5Q5	CORIN_HUMAN	corin	618	Extracellular (Potential).|LDL-receptor class A 6.				peptide hormone processing|regulation of systemic arterial blood pressure by atrial natriuretic peptide	integral to membrane|plasma membrane	scavenger receptor activity|serine-type endopeptidase activity|serine-type exopeptidase activity			ovary(1)|central_nervous_system(1)	2						AAAGATCTCTCTCTTTACAAC	0.368													6	51	---	---	---	---	PASS
CORIN	10699	broad.mit.edu	37	4	47667239	47667239	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:47667239G>T	uc003gxm.2	-	11	1492	c.1399C>A	c.(1399-1401)CCC>ACC	p.P467T	CORIN_uc011bzf.1_Missense_Mutation_p.P328T|CORIN_uc011bzg.1_Missense_Mutation_p.P400T|CORIN_uc011bzh.1_Missense_Mutation_p.P430T|CORIN_uc011bzi.1_Missense_Mutation_p.P430T	NM_006587	NP_006578	Q9Y5Q5	CORIN_HUMAN	corin	467	Extracellular (Potential).|FZ 2.				peptide hormone processing|regulation of systemic arterial blood pressure by atrial natriuretic peptide	integral to membrane|plasma membrane	scavenger receptor activity|serine-type endopeptidase activity|serine-type exopeptidase activity	p.P467R(1)		ovary(1)|central_nervous_system(1)	2						CTGTTGTAGGGCAAATTCATG	0.353													13	62	---	---	---	---	PASS
LRRC66	339977	broad.mit.edu	37	4	52861072	52861072	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:52861072C>G	uc003gzi.2	-	4	2129	c.2116G>C	c.(2116-2118)GAT>CAT	p.D706H		NM_001024611	NP_001019782	Q68CR7	LRC66_HUMAN	leucine rich repeat containing 66	706						integral to membrane				ovary(1)|central_nervous_system(1)|skin(1)	3						GACCCCTCATCAGAGTCACAG	0.527													6	51	---	---	---	---	PASS
SPATA18	132671	broad.mit.edu	37	4	52948573	52948573	+	Nonsense_Mutation	SNP	C	A	A	rs146699723		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:52948573C>A	uc003gzl.2	+	10	1654	c.1376C>A	c.(1375-1377)TCG>TAG	p.S459*	SPATA18_uc010igl.1_RNA|SPATA18_uc011bzq.1_Nonsense_Mutation_p.S427*|SPATA18_uc003gzk.1_Nonsense_Mutation_p.S459*	NM_145263	NP_660306	Q8TC71	MIEAP_HUMAN	spermatogenesis associated 18 homolog	459					mitochondrial protein catabolic process|mitochondrion degradation by induced vacuole formation|response to DNA damage stimulus	mitochondrial outer membrane	protein binding			ovary(2)|skin(2)	4			GBM - Glioblastoma multiforme(4;1.77e-13)|LUSC - Lung squamous cell carcinoma(32;0.00204)			AGCTACGACTCGGATTTCACT	0.448													7	114	---	---	---	---	PASS
KIT	3815	broad.mit.edu	37	4	55594022	55594022	+	Missense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:55594022T>A	uc010igr.2	+	12	1895	c.1808T>A	c.(1807-1809)GTT>GAT	p.V603D	KIT_uc010igs.2_Missense_Mutation_p.V599D|KIT_uc010igt.1_Missense_Mutation_p.V52D	NM_000222	NP_000213	P10721	KIT_HUMAN	v-kit Hardy-Zuckerman 4 feline sarcoma viral	603	ATP (By similarity).|Protein kinase.|Cytoplasmic (Potential).				male gonad development|transmembrane receptor protein tyrosine kinase signaling pathway	extracellular space|integral to membrane	ATP binding|protein binding|receptor signaling protein tyrosine kinase activity			soft_tissue(3273)|haematopoietic_and_lymphoid_tissue(1572)|skin(99)|testis(49)|bone(21)|genital_tract(18)|kidney(17)|ovary(16)|salivary_gland(15)|large_intestine(11)|thymus(6)|lung(6)|central_nervous_system(4)|NS(3)|eye(2)|endometrium(2)|breast(1)|stomach(1)|autonomic_ganglia(1)|pancreas(1)	5118	all_cancers(7;0.00453)|all_lung(4;0.000565)|Lung NSC(11;0.00129)|all_epithelial(27;0.0104)|Glioma(25;0.08)|all_neural(26;0.101)		LUSC - Lung squamous cell carcinoma(32;0.000276)|Epithelial(7;0.209)	Colorectal(1;0.0276)|COAD - Colon adenocarcinoma(1;0.171)	Dasatinib(DB01254)|Imatinib(DB00619)|Sorafenib(DB00398)|Sunitinib(DB01268)	TTCGGGAAGGTTGTTGAGGCA	0.493		1	Mis|O		GIST|AML|TGCT|mastocytosis|mucosal melanoma	GIST|epithelioma	Piebald trait		Mast_Cell_disease_Familial_Clustering_of|Piebaldism|Gastrointestinal_Stromal_Tumors_Sporadic_Multiple_Primary|Familial_Gastrointestinal_Stromal_Tumors				19	58	---	---	---	---	PASS
EXOC1	55763	broad.mit.edu	37	4	56736987	56736987	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:56736987G>T	uc003hbe.1	+	6	905	c.747G>T	c.(745-747)ATG>ATT	p.M249I	EXOC1_uc003hbf.1_Missense_Mutation_p.M249I|EXOC1_uc003hbg.1_Missense_Mutation_p.M249I	NM_018261	NP_060731	Q9NV70	EXOC1_HUMAN	exocyst complex component 1 isoform 1	249	Potential.				exocytosis|protein transport	exocyst	protein binding			ovary(2)|skin(2)|lung(1)|central_nervous_system(1)	6	Glioma(25;0.08)|all_neural(26;0.101)					AAGAACAAATGGATCAGATCT	0.358													6	79	---	---	---	---	PASS
CEP135	9662	broad.mit.edu	37	4	56878050	56878050	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:56878050G>A	uc003hbi.2	+	21	2935	c.2701G>A	c.(2701-2703)GAG>AAG	p.E901K	CEP135_uc003hbj.2_Missense_Mutation_p.E607K	NM_025009	NP_079285	Q66GS9	CP135_HUMAN	centrosome protein 4	901	Potential.				centriole replication|centriole-centriole cohesion|G2/M transition of mitotic cell cycle	centriole|cytosol	protein C-terminus binding			ovary(2)|pancreas(1)|central_nervous_system(1)|skin(1)	5	Glioma(25;0.08)|all_neural(26;0.101)					CCATCAAGCTGAGGGAGAAAG	0.398													11	73	---	---	---	---	PASS
PPAT	5471	broad.mit.edu	37	4	57267592	57267592	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57267592G>T	uc003hbr.2	-	7	992	c.790C>A	c.(790-792)CAA>AAA	p.Q264K		NM_002703	NP_002694	Q06203	PUR1_HUMAN	phosphoribosyl pyrophosphate amidotransferase	264					glutamine metabolic process|nucleoside metabolic process|purine base biosynthetic process|purine ribonucleoside monophosphate biosynthetic process	cytosol	4 iron, 4 sulfur cluster binding|amidophosphoribosyltransferase activity|metal ion binding				0	Glioma(25;0.08)|all_neural(26;0.101)				L-Glutamine(DB00130)|Thioguanine(DB00352)	TCAAGAGTTTGGACATTGTGT	0.348													12	423	---	---	---	---	PASS
POLR2B	5431	broad.mit.edu	37	4	57887065	57887065	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:57887065G>T	uc003hcl.1	+	17	2367	c.2324G>T	c.(2323-2325)GGC>GTC	p.G775V	POLR2B_uc011cae.1_Missense_Mutation_p.G768V|POLR2B_uc011caf.1_Missense_Mutation_p.G700V|POLR2B_uc003hcm.1_Missense_Mutation_p.G268V	NM_000938	NP_000929	P30876	RPB2_HUMAN	DNA directed RNA polymerase II polypeptide B	775					mRNA capping|nuclear mRNA splicing, via spliceosome|positive regulation of viral transcription|protein phosphorylation|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|transcription-coupled nucleotide-excision repair|viral reproduction	DNA-directed RNA polymerase II, core complex	DNA binding|DNA-directed RNA polymerase activity|metal ion binding|protein binding|ribonucleoside binding			ovary(2)	2	Glioma(25;0.08)|all_neural(26;0.181)					TTCACTGCAGGCATCAACTCA	0.368													17	62	---	---	---	---	PASS
TMPRSS11A	339967	broad.mit.edu	37	4	68789880	68789880	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:68789880C>A	uc003hdr.1	-	6	616	c.495G>T	c.(493-495)ATG>ATT	p.M165I	LOC550112_uc003hdl.3_Intron|TMPRSS11A_uc003hds.1_Missense_Mutation_p.M162I	NM_182606	NP_872412	Q6ZMR5	TM11A_HUMAN	transmembrane protease, serine 11A isoform 1	165	SEA.|Extracellular (Potential).				cell cycle|proteolysis	extracellular region|integral to plasma membrane	serine-type endopeptidase activity			skin(1)	1						TTGATGAGCTCATTGCTGAAA	0.328													9	254	---	---	---	---	PASS
UGT2B7	7364	broad.mit.edu	37	4	69978240	69978240	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:69978240G>T	uc003heg.3	+	6	1422	c.1376G>T	c.(1375-1377)CGA>CTA	p.R459L	UGT2B7_uc010ihq.2_3'UTR	NM_001074	NP_001065	P16662	UD2B7_HUMAN	UDP glucuronosyltransferase 2B7 precursor	459					lipid metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glucuronosyltransferase activity			ovary(1)|skin(1)	2						CCCCTGGATCGAGCAGTCTTC	0.398													6	123	---	---	---	---	PASS
UGT2B28	54490	broad.mit.edu	37	4	70146440	70146440	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:70146440C>A	uc003hej.2	+	1	224	c.222C>A	c.(220-222)CTC>CTA	p.L74L	UGT2B28_uc010ihr.2_Silent_p.L74L	NM_053039	NP_444267	Q9BY64	UDB28_HUMAN	UDP glucuronosyltransferase 2 family,	74					xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	glucuronosyltransferase activity			skin(1)	1					Flunitrazepam(DB01544)	CTCTTAAACTCGAAGTTTATC	0.373													7	164	---	---	---	---	PASS
ADAMTS3	9508	broad.mit.edu	37	4	73154561	73154561	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73154561T>C	uc003hgk.1	-	21	2993	c.2956A>G	c.(2956-2958)ACG>GCG	p.T986A		NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	986	TSP type-1 4.				collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)			CTCACCTCCGTTCCTTCACCG	0.473													5	22	---	---	---	---	PASS
ADAMTS3	9508	broad.mit.edu	37	4	73188783	73188783	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:73188783C>A	uc003hgk.1	-	6	930	c.893G>T	c.(892-894)GGA>GTA	p.G298V		NM_014243	NP_055058	O15072	ATS3_HUMAN	ADAM metallopeptidase with thrombospondin type 1	298	Peptidase M12B.				collagen catabolic process|collagen fibril organization|proteolysis	proteinaceous extracellular matrix	heparin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2			Epithelial(6;4.97e-05)|OV - Ovarian serous cystadenocarcinoma(6;5.66e-05)|all cancers(17;0.000486)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)			TATATGCACTCCGAGGGACTC	0.368													39	220	---	---	---	---	PASS
ANKRD17	26057	broad.mit.edu	37	4	74124090	74124090	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:74124090C>T	uc003hgp.2	-	1	413	c.296G>A	c.(295-297)GGA>GAA	p.G99E	ANKRD17_uc003hgq.2_Missense_Mutation_p.G99E|ANKRD17_uc003hgr.2_Missense_Mutation_p.G99E	NM_032217	NP_115593	O75179	ANR17_HUMAN	ankyrin repeat domain protein 17 isoform a	99	Gly-rich.				interspecies interaction between organisms	cytoplasm|nucleus	RNA binding			ovary(5)|skin(3)|upper_aerodigestive_tract(1)|lung(1)	10	Breast(15;0.000295)		Epithelial(6;8.86e-07)|OV - Ovarian serous cystadenocarcinoma(6;6.22e-06)|all cancers(17;1.51e-05)|Lung(101;0.103)|LUSC - Lung squamous cell carcinoma(112;0.154)			accgccgcctccaccgccgcc	0.403													8	21	---	---	---	---	PASS
CNOT6L	246175	broad.mit.edu	37	4	78647416	78647416	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:78647416C>A	uc011ccd.1	-	11	1491	c.1360G>T	c.(1360-1362)GGA>TGA	p.G454*	CNOT6L_uc003hks.2_Nonsense_Mutation_p.G454*|CNOT6L_uc003hkt.1_Nonsense_Mutation_p.G297*	NM_144571	NP_653172	Q96LI5	CNO6L_HUMAN	CCR4-NOT transcription complex, subunit 6-like	454					nuclear-transcribed mRNA poly(A) tail shortening	cytosol	exonuclease activity|protein binding			large_intestine(1)	1						TCTGAGCTTCCATTCTTTCCA	0.403													8	194	---	---	---	---	PASS
ABCG2	9429	broad.mit.edu	37	4	89052213	89052213	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:89052213C>T	uc003hrg.2	-	5	1024	c.531G>A	c.(529-531)AAG>AAA	p.K177K	ABCG2_uc003hrh.2_Silent_p.K177K|ABCG2_uc003hrf.2_Silent_p.K47K	NM_004827	NP_004818	Q9UNQ0	ABCG2_HUMAN	ATP-binding cassette, sub-family G, member 2	177	ABC transporter.|Cytoplasmic (Potential).				cellular iron ion homeostasis|urate metabolic process	integral to membrane|plasma membrane	ATP binding|heme transporter activity|protein homodimerization activity|xenobiotic-transporting ATPase activity			central_nervous_system(1)	1		Hepatocellular(203;0.114)		OV - Ovarian serous cystadenocarcinoma(123;7.02e-05)	Imatinib(DB00619)|Mitoxantrone(DB01204)|Nicardipine(DB00622)|Nitrendipine(DB01054)|Rosuvastatin(DB01098)|Saquinavir(DB01232)|Topotecan(DB01030)	TCCACATTACCTTGGAGTCTG	0.408													43	140	---	---	---	---	PASS
SMARCAD1	56916	broad.mit.edu	37	4	95201832	95201832	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:95201832G>T	uc003htc.3	+	20	2763	c.2508G>T	c.(2506-2508)CAG>CAT	p.Q836H	SMARCAD1_uc003htb.3_Missense_Mutation_p.Q838H|SMARCAD1_uc003htd.3_Missense_Mutation_p.Q838H|SMARCAD1_uc010ila.2_Missense_Mutation_p.Q701H|SMARCAD1_uc011cdw.1_Missense_Mutation_p.Q406H	NM_020159	NP_064544	Q9H4L7	SMRCD_HUMAN	SWI/SNF-related, matrix-associated	836					chromatin modification|nucleotide metabolic process|positive regulation of transcription, DNA-dependent|protein homooligomerization|regulation of DNA recombination	nuclear matrix	ATP binding|DNA binding|helicase activity			skin(2)|ovary(1)|breast(1)	4				OV - Ovarian serous cystadenocarcinoma(123;4.33e-08)		TTTGTAAACAGTACCGACACA	0.358													7	132	---	---	---	---	PASS
MANBA	4126	broad.mit.edu	37	4	103647843	103647843	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:103647843G>T	uc003hwg.2	-						MANBA_uc011ces.1_Intron	NM_005908	NP_005899	O00462	MANBA_HUMAN	mannosidase, beta A, lysosomal precursor						carbohydrate metabolic process|protein modification process	lysosome	beta-mannosidase activity|cation binding			ovary(1)	1		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;4.44e-08)		TAAGAATCCTGTTGATACAAG	0.269													5	82	---	---	---	---	PASS
CENPE	1062	broad.mit.edu	37	4	104062989	104062989	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:104062989C>G	uc003hxb.1	-	35	5471	c.5381G>C	c.(5380-5382)AGA>ACA	p.R1794T	CENPE_uc003hxc.1_Missense_Mutation_p.R1769T|CENPE_uc003hxd.1_5'Flank	NM_001813	NP_001804	Q02224	CENPE_HUMAN	centromere protein E	1794	Potential.				blood coagulation|cell division|kinetochore assembly|microtubule-based movement|mitotic chromosome movement towards spindle pole|mitotic metaphase|mitotic metaphase plate congression|mitotic prometaphase|multicellular organismal development|positive regulation of protein kinase activity	condensed chromosome kinetochore|cytosol|microtubule|nucleus|spindle	ATP binding|kinetochore binding|microtubule motor activity			ovary(5)|breast(4)	9				OV - Ovarian serous cystadenocarcinoma(123;2.95e-08)		AACAATTCCTCTGAGTTTGTC	0.313													15	42	---	---	---	---	PASS
LEF1	51176	broad.mit.edu	37	4	108999527	108999527	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:108999527T>C	uc003hyt.1	-	8	1512	c.857A>G	c.(856-858)CAT>CGT	p.H286R	LEF1_uc011cfj.1_Missense_Mutation_p.H143R|LEF1_uc011cfk.1_Missense_Mutation_p.H190R|LEF1_uc003hyu.1_Missense_Mutation_p.H258R|LEF1_uc003hyv.1_Missense_Mutation_p.H258R|LEF1_uc010imb.1_RNA|LEF1_uc010ima.1_5'UTR|LEF1_uc003hyw.1_RNA	NM_016269	NP_057353	Q9UJU2	LEF1_HUMAN	lymphoid enhancer-binding factor 1 isoform 1	286					canonical Wnt receptor signaling pathway|cell chemotaxis|cellular response to interleukin-4|epithelial to mesenchymal transition|histone H3 acetylation|histone H4 acetylation|negative regulation of apoptosis in bone marrow|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cell-cell adhesion|negative regulation of DNA binding|negative regulation of estrogen receptor binding|negative regulation of interleukin-13 production|negative regulation of interleukin-4 production|negative regulation of interleukin-5 production|negative regulation of transcription, DNA-dependent|neutrophil differentiation|osteoblast differentiation|palate development|positive regulation by host of viral transcription|positive regulation of cell cycle process|positive regulation of cell growth|positive regulation of cell migration|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of cell proliferation in bone marrow|positive regulation of cell-cell adhesion|positive regulation of epithelial to mesenchymal transition|positive regulation of granulocyte differentiation|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|T-helper 1 cell differentiation	cytoplasm|protein-DNA complex|transcription factor complex	armadillo repeat domain binding|beta-catenin binding|C2H2 zinc finger domain binding|caspase inhibitor activity|DNA bending activity|enhancer binding|estrogen receptor activity|estrogen receptor binding|gamma-catenin binding|histone binding|sequence-specific DNA binding|transcription regulatory region DNA binding			large_intestine(1)	1				OV - Ovarian serous cystadenocarcinoma(123;0.000224)		TCTCTGTTCATGCTGAGGCTT	0.478													32	133	---	---	---	---	PASS
SEC24B	10427	broad.mit.edu	37	4	110447381	110447381	+	Splice_Site	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:110447381G>T	uc003hzk.2	+	17	2847	c.2792_splice	c.e17-1	p.G931_splice	SEC24B_uc003hzl.2_Splice_Site_p.G896_splice|SEC24B_uc011cfp.1_Splice_Site_p.G961_splice|SEC24B_uc011cfq.1_Splice_Site_p.G930_splice|SEC24B_uc011cfr.1_Splice_Site_p.G895_splice	NM_006323	NP_006314	O95487	SC24B_HUMAN	SEC24 (S. cerevisiae) homolog B isoform a						COPII vesicle coating|intracellular protein transport|post-translational protein modification|protein N-linked glycosylation via asparagine	COPII vesicle coat|cytosol|endoplasmic reticulum membrane|Golgi membrane|perinuclear region of cytoplasm	protein binding|transporter activity|zinc ion binding			ovary(2)|large_intestine(1)	3		Hepatocellular(203;0.217)		OV - Ovarian serous cystadenocarcinoma(123;3.03e-05)		CTCCTTTTTAGGTCTTTCAAT	0.338													8	121	---	---	---	---	PASS
C4orf21	55345	broad.mit.edu	37	4	113524748	113524748	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:113524748C>A	uc003iau.2	-	10	3119	c.2908G>T	c.(2908-2910)GAG>TAG	p.E970*	C4orf21_uc003iaw.2_Nonsense_Mutation_p.E970*	NM_018392	NP_060862	Q6ZU11	YD002_HUMAN	prematurely terminated mRNA decay factor-like	Error:Variant_position_missing_in_Q6ZU11_after_alignment						integral to membrane	zinc ion binding				0		Ovarian(17;0.156)		OV - Ovarian serous cystadenocarcinoma(123;0.000676)		TTTTCATACTCAGTGCTATCT	0.403													6	57	---	---	---	---	PASS
PDE5A	8654	broad.mit.edu	37	4	120488293	120488293	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:120488293C>A	uc003idh.2	-	4	993	c.838G>T	c.(838-840)GGT>TGT	p.G280C	PDE5A_uc003idf.2_Missense_Mutation_p.G238C|PDE5A_uc003idg.2_Missense_Mutation_p.G228C	NM_001083	NP_001074	O76074	PDE5A_HUMAN	phosphodiesterase 5A isoform 1	280	GAF 1.				platelet activation|signal transduction	cytosol	3',5'-cyclic-GMP phosphodiesterase activity|cGMP binding|zinc ion binding				0					Dipyridamole(DB00975)|Pentoxifylline(DB00806)|Sildenafil(DB00203)|Tadalafil(DB00820)|Theophylline(DB00277)|Vardenafil(DB00862)	TGGGCTACACCAACAACCTGG	0.358													6	68	---	---	---	---	PASS
FBXW7	55294	broad.mit.edu	37	4	153247367	153247367	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:153247367G>T	uc003ims.2	-	10	1584	c.1435C>A	c.(1435-1437)CGA>AGA	p.R479R	FBXW7_uc011cii.1_Silent_p.R479R|FBXW7_uc003imt.2_Silent_p.R479R|FBXW7_uc011cih.1_Silent_p.R303R|FBXW7_uc003imq.2_Silent_p.R399R|FBXW7_uc003imr.2_Silent_p.R361R	NM_033632	NP_361014	Q969H0	FBXW7_HUMAN	F-box and WD repeat domain containing 7 isoform	479	WD 3.				interspecies interaction between organisms|lipid homeostasis|negative regulation of DNA endoreduplication|negative regulation of hepatocyte proliferation|negative regulation of Notch signaling pathway|negative regulation of triglyceride biosynthetic process|positive regulation of epidermal growth factor receptor activity|positive regulation of ERK1 and ERK2 cascade|positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process|protein stabilization|protein ubiquitination|regulation of lipid storage|regulation of protein localization|SCF-dependent proteasomal ubiquitin-dependent protein catabolic process|sister chromatid cohesion|vasculature development	nucleolus|nucleolus|nucleoplasm|nucleoplasm|SCF ubiquitin ligase complex	protein binding|protein binding	p.R479Q(31)|p.R479L(6)|p.R479G(3)		haematopoietic_and_lymphoid_tissue(125)|large_intestine(99)|stomach(16)|lung(14)|endometrium(13)|ovary(9)|biliary_tract(8)|upper_aerodigestive_tract(5)|central_nervous_system(3)|kidney(3)|skin(3)|pancreas(3)|breast(2)|prostate(2)|cervix(1)|NS(1)|bone(1)	308	all_hematologic(180;0.093)	Acute lymphoblastic leukemia(8;0.000629)|all_hematologic(8;0.067)				GTGGCATCTCGAGAACCGCTA	0.398			Mis|N|D|F		colorectal|endometrial|T-ALL								5	50	---	---	---	---	PASS
FSTL5	56884	broad.mit.edu	37	4	162307405	162307405	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:162307405C>A	uc003iqh.2	-	16	2474	c.2038G>T	c.(2038-2040)GAC>TAC	p.D680Y	FSTL5_uc003iqi.2_Missense_Mutation_p.D679Y|FSTL5_uc010iqv.2_Missense_Mutation_p.D670Y|uc010iqu.1_RNA	NM_020116	NP_064501	Q8N475	FSTL5_HUMAN	follistatin-like 5 isoform a	680						extracellular region	calcium ion binding			ovary(2)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|skin(1)	8	all_hematologic(180;0.24)			COAD - Colon adenocarcinoma(41;0.179)		GTTACACCGTCCACCATGACC	0.498													6	29	---	---	---	---	PASS
CDKN2AIP	55602	broad.mit.edu	37	4	184367326	184367326	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:184367326C>A	uc003ivp.1	+	3	651	c.489C>A	c.(487-489)GCC>GCA	p.A163A	CDKN2AIP_uc003ivq.1_5'UTR	NM_017632	NP_060102	Q9NXV6	CARF_HUMAN	CDKN2A interacting protein	163					negative regulation of cell growth|positive regulation of signal transduction|regulation of protein stability	granular component|nucleoplasm	double-stranded RNA binding|p53 binding				0		all_lung(41;6.9e-12)|Lung NSC(41;1.28e-11)|Colorectal(36;0.00435)|Renal(120;0.0246)|Hepatocellular(41;0.0268)|Prostate(90;0.0283)|all_hematologic(60;0.0749)		all cancers(43;1.15e-26)|Epithelial(43;2.98e-22)|OV - Ovarian serous cystadenocarcinoma(60;7.64e-10)|GBM - Glioblastoma multiforme(59;4.22e-06)|Colorectal(24;5.87e-06)|STAD - Stomach adenocarcinoma(60;2.09e-05)|COAD - Colon adenocarcinoma(29;5.15e-05)|LUSC - Lung squamous cell carcinoma(40;0.00902)|READ - Rectum adenocarcinoma(43;0.155)		AAACCTCTGCCAAGACAGAAC	0.453													6	57	---	---	---	---	PASS
RWDD4A	201965	broad.mit.edu	37	4	184570716	184570716	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:184570716C>A	uc003ivt.1	-	5	595	c.369G>T	c.(367-369)TCG>TCT	p.S123S	RWDD4A_uc003ivu.1_RNA|RWDD4A_uc003ivv.1_Silent_p.S60S|RWDD4A_uc011ckl.1_RNA	NM_152682	NP_689895	Q6NW29	RWDD4_HUMAN	RWD domain containing 4A	123											0		all_lung(41;4.4e-14)|Lung NSC(41;1.03e-13)|Colorectal(36;0.00139)|all_hematologic(60;0.00756)|Hepatocellular(41;0.00826)|Renal(120;0.00988)|Prostate(90;0.0235)|all_neural(102;0.202)		all cancers(43;7.35e-27)|Epithelial(43;1.49e-22)|OV - Ovarian serous cystadenocarcinoma(60;5.76e-10)|GBM - Glioblastoma multiforme(59;5.54e-06)|Colorectal(24;7.92e-06)|STAD - Stomach adenocarcinoma(60;2.35e-05)|COAD - Colon adenocarcinoma(29;6.26e-05)|LUSC - Lung squamous cell carcinoma(40;0.00935)|READ - Rectum adenocarcinoma(43;0.166)		TATTGCTTATCGATGTCTAAA	0.333													6	99	---	---	---	---	PASS
FAT1	2195	broad.mit.edu	37	4	187539950	187539950	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187539950C>A	uc003izf.2	-	10	7978	c.7790G>T	c.(7789-7791)CGA>CTA	p.R2597L		NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	2597	Extracellular (Potential).|Cadherin 24.				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12						TTTGGTTGCTCGAAATTGTGG	0.463										HNSCC(5;0.00058)			4	27	---	---	---	---	PASS
FAT1	2195	broad.mit.edu	37	4	187541593	187541593	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:187541593C>A	uc003izf.2	-	10	6335	c.6147G>T	c.(6145-6147)GTG>GTT	p.V2049V		NM_005245	NP_005236	Q14517	FAT1_HUMAN	FAT tumor suppressor 1 precursor	2049	Extracellular (Potential).|Cadherin 18.				actin filament organization|anatomical structure morphogenesis|cell migration|cell-cell signaling|establishment or maintenance of cell polarity|homophilic cell adhesion	cell-cell junction|integral to plasma membrane|nucleus|perinuclear region of cytoplasm	calcium ion binding|protein binding			ovary(10)|central_nervous_system(1)|pancreas(1)	12						CTTCTACAACCACATCAAACG	0.498										HNSCC(5;0.00058)			7	108	---	---	---	---	PASS
C5orf49	134121	broad.mit.edu	37	5	7832092	7832092	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:7832092G>T	uc003jea.3	-	3	445	c.315C>A	c.(313-315)CGC>CGA	p.R105R		NM_001089584	NP_001083053	A4QMS7	CE049_HUMAN	hypothetical protein LOC134121	105											0						GCTGATTGATGCGCTTCCCAT	0.542													17	52	---	---	---	---	PASS
CDH12	1010	broad.mit.edu	37	5	21975501	21975501	+	Intron	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:21975501G>A	uc010iuc.2	-						CDH12_uc011cno.1_Intron|CDH12_uc003jgk.2_Intron	NM_004061	NP_004052	P55289	CAD12_HUMAN	cadherin 12, type 2 preproprotein						adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(2)	2						GGAGCTTTAGGGAagagaagg	0.333										HNSCC(59;0.17)			12	43	---	---	---	---	PASS
CDH10	1008	broad.mit.edu	37	5	24505300	24505300	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:24505300A>C	uc003jgr.1	-	8	1646	c.1314T>G	c.(1312-1314)AAT>AAG	p.N438K	CDH10_uc011cnu.1_Intron	NM_006727	NP_006718	Q9Y6N8	CAD10_HUMAN	cadherin 10, type 2 preproprotein	438	Cadherin 4.|Extracellular (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|pancreas(4)|breast(2)	12				STAD - Stomach adenocarcinoma(35;0.0556)		AAAGAGATCCATTTCCTGAAT	0.358										HNSCC(23;0.051)			8	50	---	---	---	---	PASS
CDH10	1008	broad.mit.edu	37	5	24505301	24505301	+	Missense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:24505301T>A	uc003jgr.1	-	8	1645	c.1313A>T	c.(1312-1314)AAT>ATT	p.N438I	CDH10_uc011cnu.1_Intron	NM_006727	NP_006718	Q9Y6N8	CAD10_HUMAN	cadherin 10, type 2 preproprotein	438	Cadherin 4.|Extracellular (Potential).				adherens junction organization|cell junction assembly|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(6)|pancreas(4)|breast(2)	12				STAD - Stomach adenocarcinoma(35;0.0556)		AAGAGATCCATTTCCTGAATG	0.353										HNSCC(23;0.051)			8	49	---	---	---	---	PASS
TTC23L	153657	broad.mit.edu	37	5	34850335	34850335	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:34850335C>A	uc003jiu.2	+	4	404	c.301C>A	c.(301-303)CGG>AGG	p.R101R		NM_144725	NP_653326	Q6PF05	TT23L_HUMAN	tetratricopeptide repeat domain 23-like	101							binding			central_nervous_system(1)	1						CATCCTTTCTCGGATTATTTT	0.453													6	126	---	---	---	---	PASS
CAPSL	133690	broad.mit.edu	37	5	35904754	35904754	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:35904754G>T	uc003jjt.1	-						CAPSL_uc003jju.1_Intron	NM_001042625	NP_001036090	Q8WWF8	CAPSL_HUMAN	calcyphosine-like							cytoplasm	calcium ion binding			skin(1)	1	all_lung(31;0.000268)		Lung(74;0.111)|COAD - Colon adenocarcinoma(61;0.14)|Epithelial(62;0.167)|Colorectal(62;0.202)			GTCACCTGCAGTGGAAAAGTT	0.453													5	41	---	---	---	---	PASS
C5orf34	375444	broad.mit.edu	37	5	43508755	43508755	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:43508755C>A	uc003jnz.1	-	4	526	c.209G>T	c.(208-210)CGA>CTA	p.R70L	C5orf34_uc011cpx.1_5'UTR	NM_198566	NP_940968	Q96MH7	CE034_HUMAN	hypothetical protein LOC375444	70										breast(1)	1	Lung NSC(6;2.07e-05)					ATCTAGGGCTCGCTGTAGTTG	0.294													5	129	---	---	---	---	PASS
ITGA1	3672	broad.mit.edu	37	5	52194218	52194218	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:52194218G>T	uc003jou.2	+						ITGA1_uc003jov.2_Intron	NM_181501	NP_852478	P56199	ITA1_HUMAN	integrin, alpha 1 precursor						axon guidance|cell-matrix adhesion|integrin-mediated signaling pathway|muscle contraction	integrin complex	collagen binding|receptor activity			ovary(2)|lung(1)	3		Lung NSC(810;5.05e-05)|Breast(144;0.0851)				ATTTAGGTAAGGTTTGGATAT	0.328													6	54	---	---	---	---	PASS
ERCC8	1161	broad.mit.edu	37	5	60194165	60194165	+	Missense_Mutation	SNP	G	T	T	rs141137570	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:60194165G>T	uc003jsm.3	-	9	851	c.781C>A	c.(781-783)CTC>ATC	p.L261I	ERCC8_uc003jsk.2_RNA|ERCC8_uc003jsl.3_Missense_Mutation_p.L203I|ERCC8_uc011cqp.1_Missense_Mutation_p.L108I	NM_000082	NP_000073	Q13216	ERCC8_HUMAN	excision repair cross-complementing rodent	261	WD 4.				positive regulation of DNA repair|proteasomal ubiquitin-dependent protein catabolic process|protein autoubiquitination|protein polyubiquitination|response to oxidative stress|response to UV|response to UV|transcription-coupled nucleotide-excision repair	Cul4A-RING ubiquitin ligase complex|nuclear matrix|nucleoplasm|nucleotide-excision repair complex|soluble fraction	protein binding|protein complex binding				0		Lung NSC(810;1.51e-06)|Prostate(74;0.0322)|Ovarian(174;0.0481)|Breast(144;0.077)				CCAACAGTGAGGAGGTGAAGT	0.343								Direct_reversal_of_damage|NER					6	62	---	---	---	---	PASS
SLC30A5	64924	broad.mit.edu	37	5	68400543	68400543	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:68400543G>T	uc003jvh.2	+	4	560	c.359G>T	c.(358-360)AGG>ATG	p.R120M	SLC30A5_uc003jvg.2_3'UTR|SLC30A5_uc011crc.1_RNA|SLC30A5_uc003jvi.2_Intron	NM_022902	NP_075053	Q8TAD4	ZNT5_HUMAN	solute carrier family 30 (zinc transporter),	120	Extracellular (Potential).				cellular zinc ion homeostasis|cobalt ion transport|regulation of proton transport|response to zinc ion	apical plasma membrane|Golgi apparatus|integral to plasma membrane|membrane fraction|secretory granule membrane	zinc ion binding|zinc ion transmembrane transporter activity			central_nervous_system(1)	1		Lung NSC(167;0.000986)|Prostate(74;0.00809)|Colorectal(97;0.0508)|Ovarian(174;0.16)		OV - Ovarian serous cystadenocarcinoma(47;1.24e-56)|Epithelial(20;1.12e-52)|all cancers(19;2.63e-48)|Lung(70;0.0177)		GGACCACTAAGGTAAATAAAA	0.299													8	136	---	---	---	---	PASS
BDP1	55814	broad.mit.edu	37	5	70757682	70757682	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:70757682G>C	uc003kbp.1	+	3	791	c.528G>C	c.(526-528)CAG>CAC	p.Q176H	BDP1_uc003kbn.1_Missense_Mutation_p.Q176H|BDP1_uc003kbo.2_Missense_Mutation_p.Q176H	NM_018429	NP_060899	A6H8Y1	BDP1_HUMAN	transcription factor-like nuclear regulator	176	Interaction with ZBTB43.|Potential.				regulation of transcription, DNA-dependent|transcription from RNA polymerase III promoter	nucleoplasm	DNA binding			skin(2)	2		Lung NSC(167;0.000422)|Prostate(74;0.00815)|Ovarian(174;0.0176)|Breast(144;0.198)		OV - Ovarian serous cystadenocarcinoma(47;5.28e-56)|Epithelial(20;2.31e-50)		ATGAAAGTCAGAGGCCACCAG	0.279													4	120	---	---	---	---	PASS
POLK	51426	broad.mit.edu	37	5	74892392	74892392	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:74892392C>A	uc003kdw.2	+	13	1970	c.1874C>A	c.(1873-1875)CCT>CAT	p.P625H	POLK_uc003kdx.2_RNA|POLK_uc003kdy.2_RNA|POLK_uc010izq.2_Missense_Mutation_p.P427H|POLK_uc003kec.2_Missense_Mutation_p.P535H|POLK_uc010izr.2_RNA|POLK_uc010izs.2_RNA|POLK_uc003ked.2_Intron|POLK_uc003kee.2_Intron|POLK_uc003kef.2_Missense_Mutation_p.P535H	NM_016218	NP_057302	Q9UBT6	POLK_HUMAN	DNA-directed DNA polymerase kappa	625	UBZ-type 1.				DNA replication|nucleotide-excision repair, DNA gap filling	nucleus	damaged DNA binding|DNA-directed DNA polymerase activity|metal ion binding			ovary(2)|kidney(2)	4		all_lung(232;0.0131)|Lung NSC(167;0.0282)|Ovarian(174;0.0798)|Prostate(461;0.184)		OV - Ovarian serous cystadenocarcinoma(47;2.9e-54)|all cancers(79;1.27e-42)		CTTACCTGTCCTGTTTGCTTT	0.373								DNA_polymerases_(catalytic_subunits)|Direct_reversal_of_damage					8	130	---	---	---	---	PASS
PDE8B	8622	broad.mit.edu	37	5	76621451	76621451	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:76621451C>A	uc003kfa.2	+	3	532	c.487C>A	c.(487-489)CGG>AGG	p.R163R	PDE8B_uc003kfb.2_Silent_p.R143R|PDE8B_uc003kfc.2_Silent_p.R163R|PDE8B_uc003kfd.2_Silent_p.R163R|PDE8B_uc003kfe.2_Silent_p.R163R	NM_003719	NP_003710	O95263	PDE8B_HUMAN	phosphodiesterase 8B isoform 1	163					cyclic nucleotide metabolic process|regulation of transcription, DNA-dependent	cytosol	3',5'-cyclic-AMP phosphodiesterase activity|metal ion binding|two-component response regulator activity				0		all_lung(232;0.00043)|Lung NSC(167;0.00114)|Ovarian(174;0.0107)|Prostate(461;0.0605)		OV - Ovarian serous cystadenocarcinoma(54;2.21e-49)|Epithelial(54;5.82e-43)|all cancers(79;4.06e-38)		CAATATTGCTCGGACTCCAGA	0.433													5	91	---	---	---	---	PASS
THBS4	7060	broad.mit.edu	37	5	79335928	79335928	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79335928G>T	uc003kgh.2	+	3	440	c.117G>T	c.(115-117)CAG>CAT	p.Q39H		NM_003248	NP_003239	P35443	TSP4_HUMAN	thrombospondin 4 precursor	39	TSP N-terminal.				endothelial cell-cell adhesion|myoblast migration|negative regulation of angiogenesis|positive regulation of endothelial cell proliferation|positive regulation of neutrophil chemotaxis|positive regulation of peptidyl-tyrosine phosphorylation	basement membrane|extracellular space	calcium ion binding|heparin binding|integrin binding|structural molecule activity				0		Lung NSC(167;0.00328)|all_lung(232;0.00355)|Ovarian(174;0.0261)		OV - Ovarian serous cystadenocarcinoma(54;6.3e-45)|Epithelial(54;1.77e-39)|all cancers(79;3.2e-34)		CTTCCAGTCAGAGGCTAAACC	0.483													7	103	---	---	---	---	PASS
SPZ1	84654	broad.mit.edu	37	5	79617057	79617057	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:79617057C>A	uc003kgn.2	+	1	1268	c.1023C>A	c.(1021-1023)CTC>CTA	p.L341L	uc011ctk.1_RNA	NM_032567	NP_115956	Q9BXG8	SPZ1_HUMAN	spermatogenic leucine zipper 1	341	Potential.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	DNA binding			ovary(1)	1		Lung NSC(167;0.0393)|all_lung(232;0.0428)|Ovarian(174;0.113)		OV - Ovarian serous cystadenocarcinoma(54;3.43e-47)|Epithelial(54;2.25e-41)|all cancers(79;4.19e-36)		TCAAGGAACTCCATCATCAGA	0.398													7	78	---	---	---	---	PASS
MSH3	4437	broad.mit.edu	37	5	80024667	80024667	+	Intron	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:80024667T>C	uc003kgz.2	+							NM_002439	NP_002430	P20585	MSH3_HUMAN	mutS homolog 3						maintenance of DNA repeat elements|meiotic mismatch repair|negative regulation of DNA recombination|positive regulation of helicase activity|reciprocal meiotic recombination|somatic recombination of immunoglobulin gene segments	MutSbeta complex|nuclear chromosome	ATP binding|DNA-dependent ATPase activity|double-strand/single-strand DNA junction binding|enzyme binding|loop DNA binding|Y-form DNA binding			lung(2)|ovary(1)|breast(1)	4		Lung NSC(167;0.00479)|all_lung(232;0.00507)|Ovarian(174;0.0261)|Breast(144;0.244)		OV - Ovarian serous cystadenocarcinoma(54;2.38e-45)|Epithelial(54;1.58e-38)|all cancers(79;4.93e-33)		TTCTGTTTTCTAGGTTCTCAA	0.254								MMR					32	118	---	---	---	---	PASS
MSH3	4437	broad.mit.edu	37	5	80063922	80063922	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:80063922C>A	uc003kgz.2	+	14	2320	c.2067C>A	c.(2065-2067)CTC>CTA	p.L689L		NM_002439	NP_002430	P20585	MSH3_HUMAN	mutS homolog 3	689					maintenance of DNA repeat elements|meiotic mismatch repair|negative regulation of DNA recombination|positive regulation of helicase activity|reciprocal meiotic recombination|somatic recombination of immunoglobulin gene segments	MutSbeta complex|nuclear chromosome	ATP binding|DNA-dependent ATPase activity|double-strand/single-strand DNA junction binding|enzyme binding|loop DNA binding|Y-form DNA binding			lung(2)|ovary(1)|breast(1)	4		Lung NSC(167;0.00479)|all_lung(232;0.00507)|Ovarian(174;0.0261)|Breast(144;0.244)		OV - Ovarian serous cystadenocarcinoma(54;2.38e-45)|Epithelial(54;1.58e-38)|all cancers(79;4.93e-33)		TAAAGATACTCAATGAACAAG	0.398								MMR					7	59	---	---	---	---	PASS
VCAN	1462	broad.mit.edu	37	5	82816290	82816290	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:82816290C>A	uc003kii.3	+	7	2521	c.2165C>A	c.(2164-2166)TCT>TAT	p.S722Y	VCAN_uc003kij.3_Intron|VCAN_uc010jau.2_Missense_Mutation_p.S722Y|VCAN_uc003kik.3_Intron	NM_004385	NP_004376	P13611	CSPG2_HUMAN	versican isoform 1 precursor	722	GAG-alpha (glucosaminoglycan attachment domain).				cell adhesion|cell recognition|glial cell migration	extracellular space|proteinaceous extracellular matrix	calcium ion binding|hyaluronic acid binding|sugar binding			ovary(7)|skin(6)|lung(2)|central_nervous_system(1)	16		Lung NSC(167;0.0216)|all_lung(232;0.0251)|Ovarian(174;0.142)		OV - Ovarian serous cystadenocarcinoma(54;2.47e-41)|Epithelial(54;2.51e-34)|all cancers(79;5.19e-29)		GAAGTCTTCTCTGGGATGAAA	0.363													6	37	---	---	---	---	PASS
MEF2C	4208	broad.mit.edu	37	5	88027589	88027589	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:88027589C>A	uc003kjj.2	-	7	1440	c.767G>T	c.(766-768)CGA>CTA	p.R256L	MEF2C_uc003kji.2_Missense_Mutation_p.R256L|MEF2C_uc003kjk.2_Missense_Mutation_p.R256L|MEF2C_uc003kjm.2_Missense_Mutation_p.R254L|MEF2C_uc003kjl.2_Missense_Mutation_p.R274L	NM_002397	NP_002388	Q06413	MEF2C_HUMAN	myocyte enhancer factor 2C isoform 1	256					apoptosis|B cell proliferation|innate immune response|learning or memory|muscle cell differentiation|muscle organ development|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|neuron development|positive regulation of muscle cell differentiation|positive regulation of survival gene product expression|positive regulation of transcription from RNA polymerase II promoter|regulation of germinal center formation|regulation of megakaryocyte differentiation|regulation of synaptic activity|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	nuclear speck	activating transcription factor binding|protein heterodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			lung(3)|breast(2)|ovary(1)|large_intestine(1)	7		all_cancers(142;6.67e-05)|all_epithelial(76;7.77e-07)|Lung NSC(167;0.00566)|all_lung(232;0.00732)|Colorectal(57;0.0959)|Ovarian(174;0.1)		OV - Ovarian serous cystadenocarcinoma(54;1.04e-33)|Epithelial(54;1.6e-28)|all cancers(79;2.9e-25)		AATAAGAACTCGGAGATCTGG	0.378										HNSCC(66;0.2)			5	55	---	---	---	---	PASS
GPR98	84059	broad.mit.edu	37	5	90001286	90001286	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:90001286G>T	uc003kju.2	+	37	8552	c.8456G>T	c.(8455-8457)AGT>ATT	p.S2819I	GPR98_uc003kjt.2_Missense_Mutation_p.S525I|GPR98_uc003kjv.2_Missense_Mutation_p.S419I	NM_032119	NP_115495	Q8WXG9	GPR98_HUMAN	G protein-coupled receptor 98 precursor	2819	Extracellular (Potential).				cell communication|cell-cell adhesion|maintenance of organ identity|neuropeptide signaling pathway|photoreceptor cell maintenance	cell surface|cytoplasm|integral to membrane|plasma membrane	calcium ion binding|G-protein coupled receptor activity			ovary(11)|central_nervous_system(3)|pancreas(2)	16		all_cancers(142;1.05e-09)|all_epithelial(76;1.81e-12)|all_lung(232;5.41e-06)|Lung NSC(167;1.72e-05)|Ovarian(174;0.00948)|Colorectal(57;0.133)|Breast(839;0.192)		OV - Ovarian serous cystadenocarcinoma(54;7.01e-30)|Epithelial(54;6.79e-25)|all cancers(79;1.88e-20)		GTAGAAGCCAGTGATGAACCA	0.413													6	129	---	---	---	---	PASS
PCSK1	5122	broad.mit.edu	37	5	95757591	95757591	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:95757591C>A	uc003kls.1	-	5	819	c.613G>T	c.(613-615)GAG>TAG	p.E205*		NM_000439	NP_000430	P29120	NEC1_HUMAN	proprotein convertase subtilisin/kexin type 1	205	Catalytic.				cell-cell signaling|cellular nitrogen compound metabolic process|energy reserve metabolic process|hormone biosynthetic process|peptide biosynthetic process|peptide hormone processing|regulation of insulin secretion	extracellular space|stored secretory granule|transport vesicle	serine-type endopeptidase activity			ovary(2)	2		all_cancers(142;2.67e-06)|all_epithelial(76;6.92e-09)|all_lung(232;0.00307)|Lung NSC(167;0.00452)|Ovarian(225;0.0112)|Colorectal(57;0.0341)|Breast(839;0.244)		all cancers(79;3.44e-16)	Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)	CACTTGTTCTCGTTTGTGGGA	0.338													7	161	---	---	---	---	PASS
CAST	831	broad.mit.edu	37	5	96076486	96076486	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:96076486C>A	uc003klz.1	+	11	830	c.668C>A	c.(667-669)TCG>TAG	p.S223*	CAST_uc003klt.2_Intron|CAST_uc003klu.2_Nonsense_Mutation_p.S306*|CAST_uc003klv.2_Nonsense_Mutation_p.S284*|CAST_uc003klw.2_Nonsense_Mutation_p.S287*|CAST_uc003klx.2_Nonsense_Mutation_p.S265*|CAST_uc003kly.2_Intron|CAST_uc011cuo.1_Nonsense_Mutation_p.S269*|CAST_uc011cuq.1_Nonsense_Mutation_p.S71*|CAST_uc011cur.1_Nonsense_Mutation_p.S209*|CAST_uc011cus.1_Intron|CAST_uc003kma.1_Nonsense_Mutation_p.S182*|CAST_uc011cut.1_Nonsense_Mutation_p.S151*|CAST_uc003kmb.2_Intron|CAST_uc003kmc.2_Nonsense_Mutation_p.S223*|CAST_uc003kmd.2_Nonsense_Mutation_p.S201*|CAST_uc003kme.2_Nonsense_Mutation_p.S182*|CAST_uc003kmf.2_Intron|CAST_uc003kmh.2_5'Flank|CAST_uc010jbj.2_5'Flank|CAST_uc010jbk.2_5'Flank|CAST_uc010jbl.1_5'Flank|CAST_uc003kmi.2_5'Flank|CAST_uc003kmj.2_5'Flank	NM_001042443	NP_001035908	P20810	ICAL_HUMAN	calpastatin isoform i	223							calcium-dependent cysteine-type endopeptidase inhibitor activity|protein binding			central_nervous_system(3)|ovary(1)|kidney(1)	5		all_cancers(142;5.27e-07)|all_epithelial(76;8.21e-10)|all_lung(232;0.000396)|Lung NSC(167;0.000539)|Ovarian(225;0.024)|Colorectal(57;0.0341)|Breast(839;0.244)		all cancers(79;6.85e-15)		GCAGACTCTTCGGTGAGTTTA	0.348													5	88	---	---	---	---	PASS
CHD1	1105	broad.mit.edu	37	5	98194017	98194017	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:98194017G>T	uc003knf.2	-	34	4802	c.4654C>A	c.(4654-4656)CAG>AAG	p.Q1552K	CHD1_uc010jbn.2_Missense_Mutation_p.Q278K	NM_001270	NP_001261	O14646	CHD1_HUMAN	chromodomain helicase DNA binding protein 1	1552					regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	cytoplasm|nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|methylated histone residue binding			lung(2)|ovary(1)|breast(1)|pancreas(1)	5		all_cancers(142;5.36e-08)|all_epithelial(76;6.97e-11)|Lung NSC(167;0.000693)|Prostate(80;0.000986)|all_lung(232;0.00119)|Ovarian(225;0.024)|Colorectal(57;0.117)		COAD - Colon adenocarcinoma(37;0.0717)	Epirubicin(DB00445)	TCATGGTACTGAGTTAAGTGT	0.353													7	114	---	---	---	---	PASS
NUDT12	83594	broad.mit.edu	37	5	102894709	102894709	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:102894709C>A	uc003koi.2	-	3	760	c.667G>T	c.(667-669)GGA>TGA	p.G223*	NUDT12_uc011cvb.1_Nonsense_Mutation_p.G205*	NM_031438	NP_113626	Q9BQG2	NUD12_HUMAN	nudix-type motif 12	223						nucleus|peroxisome	metal ion binding|NAD+ diphosphatase activity				0		all_cancers(142;6.38e-08)|all_epithelial(76;1.99e-10)|Prostate(80;0.0138)|Lung NSC(167;0.0212)|Colorectal(57;0.0247)|all_lung(232;0.0283)|Ovarian(225;0.0423)		Epithelial(69;9.3e-13)|COAD - Colon adenocarcinoma(37;0.0221)		GCAACCAATCCATCTTCCTCC	0.408													6	61	---	---	---	---	PASS
FAM13B	51306	broad.mit.edu	37	5	137346823	137346823	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137346823C>A	uc003lbz.2	-	6	1098	c.564G>T	c.(562-564)GTG>GTT	p.V188V	FAM13B_uc003lcb.2_Silent_p.V70V|FAM13B_uc003lca.2_Silent_p.V188V	NM_016603	NP_057687	Q9NYF5	FA13B_HUMAN	hypothetical protein LOC51306 isoform 1	188	Rho-GAP.				regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity				0						TCATGTCTTCCACATCTGTGT	0.333													7	90	---	---	---	---	PASS
KIF20A	10112	broad.mit.edu	37	5	137519972	137519972	+	Missense_Mutation	SNP	G	T	T	rs112052250		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:137519972G>T	uc003lcj.2	+	12	1893	c.1397G>T	c.(1396-1398)CGA>CTA	p.R466L	KIF20A_uc011cyo.1_Missense_Mutation_p.R448L	NM_005733	NP_005724	O95235	KI20A_HUMAN	kinesin family member 20A	466	Kinesin-motor.				cytokinesis|M phase of mitotic cell cycle|microtubule-based movement|protein transport|vesicle-mediated transport	Golgi apparatus|microtubule|nucleoplasm	ATP binding|microtubule motor activity|protein binding|transporter activity				0			KIRC - Kidney renal clear cell carcinoma(527;0.0101)|Kidney(363;0.0109)			AAGTTGACTCGAGTGTTCCAA	0.493													7	120	---	---	---	---	PASS
ANKHD1-EIF4EBP3	404734	broad.mit.edu	37	5	139818072	139818072	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:139818072G>T	uc003lfs.1	+	3	611	c.487G>T	c.(487-489)GGT>TGT	p.G163C	ANKHD1_uc003lfq.1_Missense_Mutation_p.G163C|ANKHD1_uc003lfr.2_Missense_Mutation_p.G163C|ANKHD1_uc003lfp.2_Intron|ANKHD1_uc003lfo.2_Missense_Mutation_p.G163C|ANKHD1_uc010jfk.2_Missense_Mutation_p.G163C	NM_020690	NP_065741	Q8IWZ2	Q8IWZ2_HUMAN	ANKHD1-EIF4EBP3 protein	163						cytoplasm|nucleus	RNA binding			ovary(6)	6			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			AACTGCTGATGGTAAAGCTTT	0.413													7	135	---	---	---	---	PASS
HARS2	23438	broad.mit.edu	37	5	140073541	140073541	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140073541C>A	uc003lgx.2	+	3	421	c.205C>A	c.(205-207)CAG>AAG	p.Q69K	HARS_uc003lgv.2_5'Flank|HARS_uc011czm.1_5'Flank|HARS_uc003lgw.2_5'Flank|HARS_uc011czn.1_5'Flank|HARS_uc010jfu.2_5'Flank|HARS_uc011czo.1_5'Flank|HARS_uc011czp.1_5'Flank|HARS_uc011czq.1_5'Flank|HARS2_uc010jfv.1_5'UTR|HARS2_uc011czr.1_Missense_Mutation_p.Q44K|HARS2_uc011czs.1_5'UTR|HARS2_uc011czt.1_Intron|HARS2_uc011czu.1_5'Flank	NM_012208	NP_036340	P49590	SYHM_HUMAN	histidyl-tRNA synthetase 2 precursor	69					histidyl-tRNA aminoacylation	mitochondrial matrix	ATP binding|histidine-tRNA ligase activity				0			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			TCTTAGTCCTCAGCATATGGT	0.413													10	181	---	---	---	---	PASS
PCDHA3	56145	broad.mit.edu	37	5	140180986	140180986	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140180986C>A	uc003lhf.2	+	1	204	c.204C>A	c.(202-204)TCC>TCA	p.S68S	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA2_uc011czy.1_Intron|PCDHA3_uc011czz.1_Silent_p.S68S	NM_018906	NP_061729	Q9Y5H8	PCDA3_HUMAN	protocadherin alpha 3 isoform 1 precursor	68	Cadherin 1.|Extracellular (Potential).				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(6)|skin(2)	8			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			GGGTGGCGTCCAAAAGACACG	0.622													6	62	---	---	---	---	PASS
PCDHB14	56122	broad.mit.edu	37	5	140604377	140604377	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140604377G>T	uc003ljb.2	+	1	1300	c.1300G>T	c.(1300-1302)GAG>TAG	p.E434*	PCDHB14_uc011dal.1_Nonsense_Mutation_p.E281*	NM_018934	NP_061757	Q9Y5E9	PCDBE_HUMAN	protocadherin beta 14 precursor	434	Cadherin 4.|Extracellular (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion|synapse assembly|synaptic transmission	integral to membrane|plasma membrane	calcium ion binding			ovary(1)	1			KIRC - Kidney renal clear cell carcinoma(527;0.00185)|Kidney(363;0.00339)			GCTGAAAACCGAGTACAACAT	0.537													6	64	---	---	---	---	PASS
ABLIM3	22885	broad.mit.edu	37	5	148618852	148618852	+	Intron	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:148618852G>C	uc003lpy.2	+						ABLIM3_uc003lpz.1_Intron|ABLIM3_uc003lqa.1_Intron|ABLIM3_uc003lqb.2_Intron|ABLIM3_uc003lqc.1_Intron|ABLIM3_uc003lqd.1_Intron|ABLIM3_uc003lqf.2_Intron|ABLIM3_uc003lqe.1_Intron	NM_014945	NP_055760	O94929	ABLM3_HUMAN	actin binding LIM protein family, member 3						axon guidance|cytoskeleton organization	cytoplasm	actin binding|zinc ion binding			ovary(2)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			TAATTCAGCTGATAGAGAATT	0.488													11	45	---	---	---	---	PASS
SLU7	10569	broad.mit.edu	37	5	159841435	159841435	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:159841435C>A	uc003lyg.2	-	3	370	c.215G>T	c.(214-216)TGG>TTG	p.W72L	SLU7_uc003lyh.1_Missense_Mutation_p.W72L|SLU7_uc003lyi.1_Missense_Mutation_p.W72L	NM_006425	NP_006416	O95391	SLU7_HUMAN	step II splicing factor SLU7	72					alternative nuclear mRNA splicing, via spliceosome|nuclear mRNA 3'-splice site recognition	catalytic step 2 spliceosome|cytoplasm|nuclear speck|small nuclear ribonucleoprotein complex	pre-mRNA 3'-splice site binding|second spliceosomal transesterification activity|zinc ion binding			ovary(1)	1	Renal(175;0.00196)	Medulloblastoma(196;0.0354)|all_neural(177;0.116)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)			ATCAATATACCATGGCACTGA	0.333													7	128	---	---	---	---	PASS
GABRA1	2554	broad.mit.edu	37	5	161281215	161281215	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:161281215C>T	uc010jiw.2	+	4	594	c.126C>T	c.(124-126)TTC>TTT	p.F42F	GABRA1_uc010jix.2_Silent_p.F42F|GABRA1_uc010jiy.2_Silent_p.F42F|GABRA1_uc003lyx.3_Silent_p.F42F|GABRA1_uc010jiz.2_Silent_p.F42F|GABRA1_uc010jja.2_Silent_p.F42F|GABRA1_uc010jjb.2_Silent_p.F42F	NM_000806	NP_000797	P14867	GBRA1_HUMAN	gamma-aminobutyric acid (GABA) A receptor, alpha	42	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)|pancreas(1)	3	Renal(175;0.00259)	Medulloblastoma(196;0.0208)|all_neural(177;0.0672)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.228)	Alprazolam(DB00404)|Butabarbital(DB00237)|Butalbital(DB00241)|Butethal(DB01353)|Chlordiazepoxide(DB00475)|Clobazam(DB00349)|Clonazepam(DB01068)|Clorazepate(DB00628)|Desflurane(DB01189)|Diazepam(DB00829)|Enflurane(DB00228)|Ethanol(DB00898)|Ethchlorvynol(DB00189)|Etomidate(DB00292)|Flumazenil(DB01205)|Flurazepam(DB00690)|Halazepam(DB00801)|Halothane(DB01159)|Hexobarbital(DB01355)|Isoflurane(DB00753)|Lorazepam(DB00186)|Meprobamate(DB00371)|Metharbital(DB00463)|Methohexital(DB00474)|Methoxyflurane(DB01028)|Methylphenobarbital(DB00849)|Methyprylon(DB01107)|Midazolam(DB00683)|Nitrazepam(DB01595)|Oxazepam(DB00842)|Pentobarbital(DB00312)|Phenobarbital(DB01174)|Picrotoxin(DB00466)|Prazepam(DB01588)|Primidone(DB00794)|Progabide(DB00837)|Propofol(DB00818)|Quazepam(DB01589)|Secobarbital(DB00418)|Sevoflurane(DB01236)|Talbutal(DB00306)|Thiamylal(DB01154)|Thiopental(DB00599)|Topiramate(DB00273)|Zaleplon(DB00962)|Zolpidem(DB00425)	CCACTGTCTTCACCAGGATTT	0.358													27	71	---	---	---	---	PASS
ODZ2	57451	broad.mit.edu	37	5	167630837	167630837	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:167630837G>T	uc010jjd.2	+	18	3547	c.3547G>T	c.(3547-3549)GGA>TGA	p.G1183*	ODZ2_uc003lzr.3_Nonsense_Mutation_p.G960*|ODZ2_uc003lzt.3_Nonsense_Mutation_p.G556*|ODZ2_uc010jje.2_Nonsense_Mutation_p.G454*	NM_001122679	NP_001116151			odz, odd Oz/ten-m homolog 2											ovary(6)|central_nervous_system(4)	10	Renal(175;0.00124)|Lung NSC(126;0.136)|all_lung(126;0.242)	Medulloblastoma(196;0.0241)|all_neural(177;0.026)	Kidney(164;7.53e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.0444)|OV - Ovarian serous cystadenocarcinoma(192;0.0694)|Epithelial(171;0.124)		TGTTAAAAGTGGTACGTGAAC	0.517													7	109	---	---	---	---	PASS
DRD1	1812	broad.mit.edu	37	5	174869505	174869505	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:174869505C>A	uc003mcz.2	-	2	1543	c.598G>T	c.(598-600)GTA>TTA	p.V200L		NM_000794	NP_000785	P21728	DRD1_HUMAN	dopamine receptor D1	200	Helical; Name=5; (Potential).				activation of adenylate cyclase activity by dopamine receptor signaling pathway|activation of phospholipase C activity by dopamine receptor signaling pathway|adult walking behavior|cerebral cortex GABAergic interneuron migration|elevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger|mating behavior|positive regulation of cAMP biosynthetic process|positive regulation of cell migration|positive regulation of potassium ion transport|positive regulation of release of sequestered calcium ion into cytosol|positive regulation of synaptic transmission, glutamatergic|prepulse inhibition|response to drug|synapse assembly|visual learning	endoplasmic reticulum membrane|membrane fraction	protein binding			ovary(2)|skin(1)	3	all_cancers(89;0.00895)|Renal(175;0.000159)|Lung NSC(126;0.00625)|all_lung(126;0.0104)	Medulloblastoma(196;0.0208)|all_neural(177;0.0277)|all_hematologic(541;0.214)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000183)		Acetophenazine(DB01063)|Amantadine(DB00915)|Apomorphine(DB00714)|Carphenazine(DB01038)|Chlorprothixene(DB01239)|Clozapine(DB00363)|Cocaine(DB00907)|Dopamine(DB00988)|Fenoldopam(DB00800)|Flupenthixol(DB00875)|Fluphenazine(DB00623)|Haloperidol(DB00502)|Levodopa(DB01235)|Lisuride(DB00589)|Loxapine(DB00408)|Methylergonovine(DB00353)|Minaprine(DB00805)|Olanzapine(DB00334)|Pegademase bovine(DB00061)|Pergolide(DB01186)|Perphenazine(DB00850)|Prochlorperazine(DB00433)|Promazine(DB00420)|Propiomazine(DB00777)|Quetiapine(DB01224)|Thiethylperazine(DB00372)|Thioridazine(DB00679)|Triflupromazine(DB00508)|Zuclopenthixol(DB01624)	AAGCTTATTACAGAGGATGAG	0.498													6	98	---	---	---	---	PASS
F12	2161	broad.mit.edu	37	5	176830259	176830259	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176830259G>T	uc003mgo.3	-	12	1576	c.1527C>A	c.(1525-1527)TTC>TTA	p.F509L	PFN3_uc003mgl.2_5'Flank|F12_uc011dfy.1_Nonsense_Mutation_p.S40*|F12_uc003mgn.3_Nonsense_Mutation_p.S40*|F12_uc010jkl.2_RNA	NM_000505	NP_000496	P00748	FA12_HUMAN	coagulation factor XII precursor	509	Peptidase S1.				Factor XII activation|fibrinolysis|innate immune response|positive regulation of blood coagulation|positive regulation of fibrinolysis|positive regulation of plasminogen activation|protein autoprocessing|response to misfolded protein|zymogen activation	extracellular space|plasma membrane	serine-type endopeptidase activity				0	all_cancers(89;2.04e-05)|Renal(175;0.000269)|Lung NSC(126;0.000832)|all_lung(126;0.00152)	all_neural(177;0.00409)|Medulloblastoma(196;0.00498)|all_hematologic(541;0.21)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)			GCCTACCCTCGAACTGGTGGC	0.667									Hereditary_Angioedema				4	32	---	---	---	---	PASS
COL23A1	91522	broad.mit.edu	37	5	177715338	177715338	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:177715338C>A	uc003mje.2	-	5	786	c.428G>T	c.(427-429)CGA>CTA	p.R143L		NM_173465	NP_775736	Q86Y22	CONA1_HUMAN	collagen, type XXIII, alpha 1	143	Extracellular (Potential).|Collagen-like 1.|Gly-rich.					collagen|integral to membrane|plasma membrane	protein binding			central_nervous_system(1)|skin(1)	2	all_cancers(89;0.00188)|Renal(175;0.000159)|Lung NSC(126;0.00814)|all_lung(126;0.0129)	all_neural(177;0.00802)|Medulloblastoma(196;0.0145)|all_hematologic(541;0.248)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)	OV - Ovarian serous cystadenocarcinoma(192;0.153)|all cancers(165;0.172)		GTAGCCATCTCGTCCTGATTG	0.418													5	108	---	---	---	---	PASS
EXOC2	55770	broad.mit.edu	37	6	562806	562806	+	Missense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:562806T>A	uc003mtd.2	-	17	1963	c.1829A>T	c.(1828-1830)GAC>GTC	p.D610V	EXOC2_uc003mte.2_Missense_Mutation_p.D610V|EXOC2_uc011dho.1_Missense_Mutation_p.D205V	NM_018303	NP_060773	Q96KP1	EXOC2_HUMAN	Sec5 protein	610					exocytosis|protein transport					breast(4)|ovary(2)|pancreas(1)	7	Ovarian(93;0.0733)	Breast(5;0.0014)|all_lung(73;0.0697)|all_hematologic(90;0.0897)		OV - Ovarian serous cystadenocarcinoma(45;0.0507)|BRCA - Breast invasive adenocarcinoma(62;0.14)		TCCTTCATTGTCAACAATCCA	0.259													9	50	---	---	---	---	PASS
PRPF4B	8899	broad.mit.edu	37	6	4031871	4031871	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:4031871C>A	uc003mvv.2	+	2	211	c.120C>A	c.(118-120)CAC>CAA	p.H40Q	PRPF4B_uc011dhv.1_RNA	NM_003913	NP_003904	Q13523	PRP4B_HUMAN	serine/threonine-protein kinase PRP4K	40	His-rich.|Arg/Lys-rich (basic).					catalytic step 2 spliceosome	ATP binding|protein binding|protein serine/threonine kinase activity			breast(5)	5	Ovarian(93;0.0925)	all_hematologic(90;0.0895)				AAAATAAGCACAGTCGTCACa	0.179													6	70	---	---	---	---	PASS
PRPF4B	8899	broad.mit.edu	37	6	4032230	4032230	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:4032230C>A	uc003mvv.2	+	2	570	c.479C>A	c.(478-480)TCT>TAT	p.S160Y	PRPF4B_uc011dhv.1_RNA	NM_003913	NP_003904	Q13523	PRP4B_HUMAN	serine/threonine-protein kinase PRP4K	160	Arg/Lys-rich (basic).					catalytic step 2 spliceosome	ATP binding|protein binding|protein serine/threonine kinase activity			breast(5)	5	Ovarian(93;0.0925)	all_hematologic(90;0.0895)				GGAAATAGGTCTAGTACTAGA	0.403													7	84	---	---	---	---	PASS
TXNDC5	81567	broad.mit.edu	37	6	7888999	7888999	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:7888999G>T	uc003mxv.2	-	7	934	c.902C>A	c.(901-903)GCG>GAG	p.A301E	TXNDC5_uc003mxw.2_Missense_Mutation_p.A258E|TXNDC5_uc010jnz.2_Missense_Mutation_p.A193E|TXNDC5_uc010joa.1_Missense_Mutation_p.A193E	NM_030810	NP_110437	Q8NBS9	TXND5_HUMAN	thioredoxin domain containing 5 isoform 1	301					anti-apoptosis|cell redox homeostasis|cellular membrane organization|glycerol ether metabolic process|post-Golgi vesicle-mediated transport	endoplasmic reticulum lumen|lysosomal lumen	electron carrier activity|isomerase activity|protein disulfide oxidoreductase activity				0	Ovarian(93;0.0398)					GGTCTCCGTCGCTCCAGTCTC	0.642													5	54	---	---	---	---	PASS
HIVEP1	3096	broad.mit.edu	37	6	12122673	12122673	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:12122673G>T	uc003nac.2	+	4	2824	c.2645G>T	c.(2644-2646)GGA>GTA	p.G882V	HIVEP1_uc011diq.1_RNA	NM_002114	NP_002105	P15822	ZEP1_HUMAN	human immunodeficiency virus type I enhancer	882					transcription, DNA-dependent	cytoplasm|nucleus	DNA binding|protein binding|zinc ion binding			ovary(3)|large_intestine(1)|central_nervous_system(1)|skin(1)	6	Breast(50;0.0639)|Ovarian(93;0.0816)	all_hematologic(90;0.117)				TTTGTATCGGGACCTAACGCT	0.453													6	65	---	---	---	---	PASS
MRS2	57380	broad.mit.edu	37	6	24423172	24423172	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:24423172G>A	uc003neb.2	+	10	1237	c.1115G>A	c.(1114-1116)AGA>AAA	p.R372K	MRS2_uc003nea.2_Missense_Mutation_p.R372K|MRS2_uc011djl.1_Missense_Mutation_p.R375K|MRS2_uc011djm.1_RNA|MRS2_uc011djn.1_Missense_Mutation_p.R322K|MRS2_uc003nec.2_Missense_Mutation_p.R249K	NM_020662	NP_065713	Q9HD23	MRS2_HUMAN	MRS2-like, magnesium homeostasis factor	372	Mitochondrial intermembrane (Potential).				ion transport	integral to membrane|mitochondrial inner membrane					0						TAGGACCATAGAATTTTTTGG	0.443													33	82	---	---	---	---	PASS
BTN3A1	11119	broad.mit.edu	37	6	26410260	26410260	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26410260C>A	uc003nhv.2	+	7	1332	c.964C>A	c.(964-966)CGG>AGG	p.R322R	BTN3A1_uc011dkj.1_Silent_p.R322R|BTN3A1_uc011dkk.1_Silent_p.R270R|BTN3A1_uc010jqj.2_Silent_p.R322R	NM_007048	NP_008979	O00481	BT3A1_HUMAN	butyrophilin, subfamily 3, member A1 isoform a	322	Cytoplasmic (Potential).|B30.2/SPRY.				lipid metabolic process	integral to membrane				upper_aerodigestive_tract(1)|ovary(1)	2						GTATGCATCTCGTAAGTGCCT	0.463													5	103	---	---	---	---	PASS
BTN2A3	54718	broad.mit.edu	37	6	26422436	26422436	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26422436G>T	uc011dkl.1	+						BTN2A3_uc011dkm.1_Intron					RecName: Full=Butyrophilin subfamily 2 member A3; Flags: Precursor;												0						GTAGGGATGTGTGCCACTTGC	0.537													5	51	---	---	---	---	PASS
BTN1A1	696	broad.mit.edu	37	6	26506973	26506973	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:26506973G>T	uc003nif.3	+	4	792	c.772G>T	c.(772-774)GGA>TGA	p.G258*		NM_001732	NP_001723	Q13410	BT1A1_HUMAN	butyrophilin, subfamily 1, member A1 precursor	258	Helical; (Potential).					extracellular region|integral to plasma membrane	receptor activity			ovary(1)|skin(1)	2						GATGGTTCTAGGACTTCTCAC	0.448													8	182	---	---	---	---	PASS
GPX6	257202	broad.mit.edu	37	6	28472238	28472238	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:28472238G>T	uc011dlj.1	-	6	547	c.497C>A	c.(496-498)TCA>TAA	p.S166*	GPX6_uc010jrg.1_RNA	NM_182701	NP_874360	P59796	GPX6_HUMAN	glutathione peroxidase 6 precursor	166					response to oxidative stress	extracellular region	glutathione peroxidase activity			ovary(3)|pancreas(1)|skin(1)	5					Glutathione(DB00143)	GAGTTGGCTTGATGAGCCCAA	0.458													9	38	---	---	---	---	PASS
OR2B3	442184	broad.mit.edu	37	6	29054191	29054191	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29054191C>A	uc003nlx.2	-	1	900	c.835G>T	c.(835-837)GGA>TGA	p.G279*		NM_001005226	NP_001005226			olfactory receptor, family 2, subfamily B,											skin(1)	1						GTGATGATTCCATAGAAGAGG	0.418													6	54	---	---	---	---	PASS
OR12D2	26529	broad.mit.edu	37	6	29365200	29365200	+	Missense_Mutation	SNP	T	A	A	rs61742210		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29365200T>A	uc003nmf.3	+	1	785	c.724T>A	c.(724-726)TCC>ACC	p.S242T		NM_013936	NP_039224	P58182	O12D2_HUMAN	olfactory receptor, family 12, subfamily D,	242	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1						CACTTGTGCCTCCCACTTCAT	0.433													13	107	---	---	---	---	PASS
ZFP57	346171	broad.mit.edu	37	6	29640398	29640398	+	Nonsense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:29640398C>T	uc011dlw.1	-	4	1641	c.1490G>A	c.(1489-1491)TGG>TAG	p.W497*	ZFP57_uc003nnl.3_Nonsense_Mutation_p.W477*	NM_001109809	NP_001103279	Q9NU63	ZFP57_HUMAN	zinc finger protein 57 homolog	413					DNA methylation involved in embryo development|regulation of gene expression by genetic imprinting|transcription, DNA-dependent		DNA binding|zinc ion binding			ovary(3)|skin(2)	5						TCCATGCTTCCATTCCTCCCC	0.567													6	28	---	---	---	---	PASS
PPP1R10	5514	broad.mit.edu	37	6	30572489	30572489	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30572489C>A	uc003nqn.1	-	12	1530	c.978G>T	c.(976-978)ACG>ACT	p.T326T	PPP1R10_uc010jsc.1_Intron	NM_002714	NP_002705	Q96QC0	PP1RA_HUMAN	protein phosphatase 1, regulatory subunit 10	326	Interaction with TOX4 (By similarity).				protein import into nucleus|transcription, DNA-dependent	PTW/PP1 phosphatase complex	DNA binding|protein phosphatase inhibitor activity|RNA binding|zinc ion binding			ovary(2)|lung(1)|kidney(1)	4						GTTCTGTGCTCGTTTTCCCTT	0.542													7	148	---	---	---	---	PASS
MDC1	9656	broad.mit.edu	37	6	30672302	30672302	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30672302G>A	uc003nrg.3	-	10	5098	c.4658C>T	c.(4657-4659)TCT>TTT	p.S1553F	MDC1_uc003nrf.3_Intron|MDC1_uc011dmp.1_Missense_Mutation_p.S1160F	NM_014641	NP_055456	Q14676	MDC1_HUMAN	mediator of DNA-damage checkpoint 1	1553	Interaction with the PRKDC complex.				cell cycle|double-strand break repair via homologous recombination|intra-S DNA damage checkpoint	focal adhesion|nucleoplasm	FHA domain binding|protein C-terminus binding			breast(2)|ovary(1)|kidney(1)	4						AGTGGCCCGAGATGTGGGCTC	0.577								Other_conserved_DNA_damage_response_genes					17	82	---	---	---	---	PASS
LST1	7940	broad.mit.edu	37	6	31556510	31556510	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:31556510G>T	uc003num.2	+	5	572	c.350G>T	c.(349-351)AGC>ATC	p.S117I	LST1_uc003nun.2_3'UTR|LST1_uc003nuo.2_Missense_Mutation_p.S62I|LST1_uc003nup.2_3'UTR|LST1_uc003nuq.2_Missense_Mutation_p.S72I|LST1_uc010jsx.2_RNA|LST1_uc003nuu.2_RNA|LST1_uc003nut.2_RNA|LST1_uc010jsw.2_Missense_Mutation_p.S108I	NM_007161	NP_009092	O00453	LST1_HUMAN	leukocyte specific transcript 1 isoform 1	Error:Variant_position_missing_in_O00453_after_alignment					cell morphogenesis|dendrite development|immune response|negative regulation of lymphocyte proliferation|regulation of cell shape	Golgi membrane|integral to membrane	protein binding				0						CTGTGGTCCAGCCAGTAAAAA	0.532													4	7	---	---	---	---	PASS
B3GALT4	8705	broad.mit.edu	37	6	33245953	33245953	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:33245953C>A	uc003odr.2	+	1	1037	c.757C>A	c.(757-759)CAC>AAC	p.H253N		NM_003782	NP_003773	O96024	B3GT4_HUMAN	UDP-Gal:betaGlcNAc beta	253	Lumenal (Potential).				protein glycosylation	Golgi membrane|integral to membrane	ganglioside galactosyltransferase activity|UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity			ovary(1)|breast(1)	2						GCAGTGGCCTCACACCTGGGG	0.657													6	27	---	---	---	---	PASS
ANKS1A	23294	broad.mit.edu	37	6	34937797	34937797	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:34937797G>T	uc003ojx.3	+	3	431	c.289G>T	c.(289-291)GAG>TAG	p.E97*	ANKS1A_uc011dss.1_Nonsense_Mutation_p.E97*|ANKS1A_uc011dst.1_5'UTR|ANKS1A_uc010jvp.1_5'UTR|ANKS1A_uc010jvq.1_RNA|ANKS1A_uc010jvr.1_5'Flank	NM_015245	NP_056060	Q92625	ANS1A_HUMAN	ankyrin repeat and sterile alpha motif domain	97	ANK 1.					cytoplasm	protein binding			ovary(3)|upper_aerodigestive_tract(1)	4						GGATGTGGTCGAGGTTCTTCT	0.493													5	68	---	---	---	---	PASS
TCP11	6954	broad.mit.edu	37	6	35088735	35088735	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:35088735G>T	uc003okd.2	-	6	886	c.705C>A	c.(703-705)TCC>TCA	p.S235S	TCP11_uc003ojz.1_Silent_p.S160S|TCP11_uc003oka.2_Silent_p.S160S|TCP11_uc003okb.2_Silent_p.S159S|TCP11_uc003okc.2_Silent_p.S159S|TCP11_uc011dsu.1_Silent_p.S217S|TCP11_uc011dsv.1_Silent_p.S184S|TCP11_uc011dsw.1_Silent_p.S189S	NM_001093728	NP_001087197	Q8WWU5	TCP11_HUMAN	t-complex 11 isoform 1	222					cell differentiation|multicellular organismal development|spermatogenesis	integral to membrane				ovary(3)|skin(2)	5						CATACTGAATGGAATGTTCCT	0.493													8	171	---	---	---	---	PASS
DNAH8	1769	broad.mit.edu	37	6	38819390	38819390	+	Silent	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38819390T>C	uc003ooe.1	+	37	5355	c.4755T>C	c.(4753-4755)TTT>TTC	p.F1585F		NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21						GATTCTTCTTTGTATCTGATC	0.363													10	47	---	---	---	---	PASS
DNAH8	1769	broad.mit.edu	37	6	38851097	38851097	+	Splice_Site	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:38851097G>T	uc003ooe.1	+	53	7951	c.7351_splice	c.e53-1	p.A2451_splice		NM_001371	NP_001362			dynein, axonemal, heavy polypeptide 8											skin(8)|ovary(7)|lung(2)|large_intestine(1)|central_nervous_system(1)|kidney(1)|pancreas(1)	21						TATGATTGCAGGCTGTTTTGC	0.333													25	97	---	---	---	---	PASS
SPATS1	221409	broad.mit.edu	37	6	44328258	44328258	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:44328258C>A	uc003oxk.2	+	3	710	c.363C>A	c.(361-363)GTC>GTA	p.V121V	SPATS1_uc003oxg.2_RNA|SPATS1_uc010jzb.2_Silent_p.V6V	NM_145026	NP_659463	Q496A3	SPAS1_HUMAN	spermatogenesis associated, serine-rich 1	121										skin(1)	1	all_lung(25;0.00469)|Ovarian(13;0.0273)|all_hematologic(164;0.208)		Colorectal(64;0.00337)|COAD - Colon adenocarcinoma(64;0.00536)			TGCCTGAAGTCCAAAAGGATA	0.468													21	68	---	---	---	---	PASS
PLA2G7	7941	broad.mit.edu	37	6	46672348	46672348	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:46672348G>T	uc010jzf.2	-	12	1544	c.1275C>A	c.(1273-1275)ACC>ACA	p.T425T		NM_005084	NP_005075	Q13093	PAFA_HUMAN	phospholipase A2, group VII	425					inflammatory response|lipid catabolic process	extracellular space	1-alkyl-2-acetylglycerophosphocholine esterase activity|phospholipid binding				0			Lung(136;0.192)			TGTGTTGATTGGTTGTGTTAA	0.308													7	86	---	---	---	---	PASS
MUT	4594	broad.mit.edu	37	6	49407971	49407971	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49407971G>T	uc003ozg.3	-	11	2159	c.1904C>A	c.(1903-1905)GCT>GAT	p.A635D		NM_000255	NP_000246	P22033	MUTA_HUMAN	methylmalonyl Coenzyme A mutase precursor	635	B12-binding.				fatty acid beta-oxidation	mitochondrial matrix	cobalamin binding|metal ion binding|methylmalonyl-CoA mutase activity				0	Lung NSC(77;0.0376)				Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)	AAATCCTGTAGCAATAACTTT	0.418													6	100	---	---	---	---	PASS
CRISP3	10321	broad.mit.edu	37	6	49700998	49700998	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49700998C>A	uc003ozs.2	-	6	446	c.431G>T	c.(430-432)TGG>TTG	p.W144L		NM_006061	NP_006052	P54108	CRIS3_HUMAN	cysteine-rich secretory protein 3 precursor	144					innate immune response	proteinaceous extracellular matrix|specific granule				skin(2)	2	Lung NSC(77;0.0161)		KIRC - Kidney renal clear cell carcinoma(2;0.106)|Kidney(12;0.156)			TGAAGAGTACCAAACAACCTA	0.338													8	105	---	---	---	---	PASS
PKHD1	5314	broad.mit.edu	37	6	51503701	51503701	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51503701C>A	uc003pah.1	-	64	11728	c.11452G>T	c.(11452-11454)GTC>TTC	p.V3818F		NM_138694	NP_619639	P08F94	PKHD1_HUMAN	fibrocystin isoform 1	3818	Extracellular (Potential).				cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity			lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)					GAGATCAAGACTGCCAAGTTG	0.343													8	192	---	---	---	---	PASS
PKHD1	5314	broad.mit.edu	37	6	51732720	51732720	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:51732720C>A	uc003pah.1	-	48	7950	c.7674G>T	c.(7672-7674)CGG>CGT	p.R2558R	PKHD1_uc010jzn.1_Silent_p.R541R|PKHD1_uc003pai.2_Silent_p.R2558R	NM_138694	NP_619639	P08F94	PKHD1_HUMAN	fibrocystin isoform 1	2558	Extracellular (Potential).				cell-cell adhesion|cilium assembly|homeostatic process|kidney development|negative regulation of cellular component movement	anchored to external side of plasma membrane|apical plasma membrane|integral to membrane|microtubule basal body	protein binding|receptor activity			lung(15)|ovary(15)|large_intestine(5)|central_nervous_system(3)|skin(3)|breast(2)|upper_aerodigestive_tract(1)	44	Lung NSC(77;0.0605)					CATGGACAACCCGACCAAAGC	0.433													7	28	---	---	---	---	PASS
EFHC1	114327	broad.mit.edu	37	6	52303306	52303306	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:52303306C>A	uc003pap.3	+	3	705	c.490C>A	c.(490-492)CAT>AAT	p.H164N	EFHC1_uc011dwv.1_Missense_Mutation_p.H73N|EFHC1_uc011dww.1_Missense_Mutation_p.H145N	NM_018100	NP_060570	Q5JVL4	EFHC1_HUMAN	EF-hand domain (C-terminal) containing 1	164	DM10 1.					axoneme|neuronal cell body	calcium ion binding|protein C-terminus binding			ovary(2)|skin(1)	3	Lung NSC(77;0.109)					TGACCATTACCATTGGAAAGA	0.408													7	78	---	---	---	---	PASS
ZNF451	26036	broad.mit.edu	37	6	56997877	56997877	+	Missense_Mutation	SNP	T	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56997877T>G	uc003pdm.1	+	6	686	c.462T>G	c.(460-462)AGT>AGG	p.S154R	ZNF451_uc003pdl.2_Missense_Mutation_p.S154R|ZNF451_uc003pdn.1_Missense_Mutation_p.S154R|uc003pdq.1_Intron|ZNF451_uc003pdk.1_Missense_Mutation_p.S154R	NM_001031623	NP_001026794	Q9Y4E5	ZN451_HUMAN	zinc finger protein 451 isoform 1	154					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding|zinc ion binding			ovary(1)|pancreas(1)	2	Lung NSC(77;0.145)		LUSC - Lung squamous cell carcinoma(124;0.0785)|Lung(124;0.13)			GAACAAAAAGTTCATTCCGAA	0.398													15	54	---	---	---	---	PASS
LGSN	51557	broad.mit.edu	37	6	63990650	63990650	+	Missense_Mutation	SNP	G	C	C	rs150005648		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:63990650G>C	uc003peh.2	-	4	840	c.806C>G	c.(805-807)TCT>TGT	p.S269C	LGSN_uc003pei.2_Intron	NM_016571	NP_057655	Q5TDP6	LGSN_HUMAN	lengsin, lens protein with glutamine synthetase	269					glutamine biosynthetic process		glutamate-ammonia ligase activity			skin(2)	2					L-Glutamic Acid(DB00142)	AGGCAGGAAAGAGATTTCCAT	0.453													7	30	---	---	---	---	PASS
BAI3	577	broad.mit.edu	37	6	69944957	69944957	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:69944957C>A	uc003pev.3	+	19	3089	c.2641C>A	c.(2641-2643)CTA>ATA	p.L881I	BAI3_uc010kak.2_Missense_Mutation_p.L881I|BAI3_uc011dxx.1_Missense_Mutation_p.L87I|BAI3_uc003pex.1_Missense_Mutation_p.L11I	NM_001704	NP_001695	O60242	BAI3_HUMAN	brain-specific angiogenesis inhibitor 3	881	Helical; Name=1; (Potential).				negative regulation of angiogenesis|neuropeptide signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(27)|ovary(8)|skin(6)|pancreas(4)|central_nervous_system(3)|urinary_tract(1)|breast(1)	50		all_lung(197;0.212)				TTCAGTTACCCTAATAGTAGG	0.358													33	131	---	---	---	---	PASS
COL19A1	1310	broad.mit.edu	37	6	70894801	70894801	+	Silent	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:70894801A>G	uc003pfc.1	+	46	2967	c.2850A>G	c.(2848-2850)GGA>GGG	p.G950G		NM_001858	NP_001849	Q14993	COJA1_HUMAN	alpha 1 type XIX collagen precursor	950	Triple-helical region 5 (COL5).				cell differentiation|cell-cell adhesion|extracellular matrix organization|skeletal system development	collagen	extracellular matrix structural constituent|protein binding, bridging			ovary(2)|breast(2)	4						GCCCCAAAGGAGAACGTGTAT	0.403													3	36	---	---	---	---	PASS
COL12A1	1303	broad.mit.edu	37	6	75861579	75861579	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:75861579G>T	uc003phs.2	-						COL12A1_uc003pht.2_Intron	NM_004370	NP_004361	Q99715	COCA1_HUMAN	collagen, type XII, alpha 1 long isoform						cell adhesion|collagen fibril organization|skeletal system development	collagen type XII|extracellular space	extracellular matrix structural constituent conferring tensile strength			ovary(6)|large_intestine(1)|breast(1)|skin(1)	9						TTTTCAGTGCGTACCAATAGC	0.398													6	124	---	---	---	---	PASS
FILIP1	27145	broad.mit.edu	37	6	76022793	76022793	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76022793C>A	uc003pia.2	-	5	3128	c.2755G>T	c.(2755-2757)GAG>TAG	p.E919*	FILIP1_uc003phy.1_Nonsense_Mutation_p.E919*|FILIP1_uc003phz.2_Nonsense_Mutation_p.E820*|FILIP1_uc010kbe.2_Nonsense_Mutation_p.E922*|FILIP1_uc003pib.1_Nonsense_Mutation_p.E671*	NM_015687	NP_056502	Q7Z7B0	FLIP1_HUMAN	filamin A interacting protein 1	919										skin(3)|ovary(1)	4						GTGCTGTTCTCGTGGTCTGGT	0.498													5	77	---	---	---	---	PASS
IMPG1	3617	broad.mit.edu	37	6	76660389	76660389	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:76660389C>G	uc003pik.1	-	13	1844	c.1714G>C	c.(1714-1716)GAG>CAG	p.E572Q		NM_001563	NP_001554	Q17R60	IMPG1_HUMAN	interphotoreceptor matrix proteoglycan 1	572	SEA 2.				visual perception	proteinaceous extracellular matrix	extracellular matrix structural constituent|receptor activity			ovary(2)|skin(1)	3		Acute lymphoblastic leukemia(125;0.0418)|all_hematologic(105;0.222)				ACTACCAGCTCTCGGCCCTTG	0.483													12	36	---	---	---	---	PASS
PHIP	55023	broad.mit.edu	37	6	79650528	79650528	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:79650528G>T	uc003pir.2	-	40	5574	c.5348C>A	c.(5347-5349)TCT>TAT	p.S1783Y	PHIP_uc003piq.2_Missense_Mutation_p.S807Y|PHIP_uc011dyp.1_Missense_Mutation_p.S1782Y|IRAK1BP1_uc010kbg.1_Intron|PHIP_uc003pio.3_Missense_Mutation_p.S669Y	NM_017934	NP_060404	Q8WWQ0	PHIP_HUMAN	pleckstrin homology domain interacting protein	1783					insulin receptor signaling pathway|negative regulation of apoptosis|positive regulation of cell proliferation|positive regulation of insulin-like growth factor receptor signaling pathway|positive regulation of mitosis	nucleus	insulin receptor binding			large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)|ovary(1)	6		all_cancers(76;0.00125)|Acute lymphoblastic leukemia(125;1.1e-05)|all_hematologic(105;0.00117)|all_epithelial(107;0.219)		BRCA - Breast invasive adenocarcinoma(397;0.231)		CTCCTCTTCAGAGTCATCCTC	0.423													13	500	---	---	---	---	PASS
UBE2CBP	90025	broad.mit.edu	37	6	83754351	83754351	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:83754351C>A	uc003pjp.2	-	4	501	c.393G>T	c.(391-393)CCG>CCT	p.P131P	UBE2CBP_uc011dyx.1_RNA|UBE2CBP_uc003pjr.2_Silent_p.P99P	NM_198920	NP_944602	Q7Z6J8	UB2CB_HUMAN	ubiquitin-conjugating enzyme E2C binding	131						cytoplasm	ligase activity			ovary(1)	1		all_cancers(76;0.000374)|Acute lymphoblastic leukemia(125;3.85e-06)|all_hematologic(105;0.0017)|all_epithelial(107;0.0548)		BRCA - Breast invasive adenocarcinoma(397;0.0944)		AGTTCTCACTCGGCAGTGGGA	0.408													5	99	---	---	---	---	PASS
PGM3	5238	broad.mit.edu	37	6	83885671	83885671	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:83885671G>T	uc003pjv.2	-						PGM3_uc003pjw.2_Intron|PGM3_uc011dyz.1_Intron	NM_015599	NP_056414	O95394	AGM1_HUMAN	phosphoglucomutase 3						dolichol-linked oligosaccharide biosynthetic process|embryo development ending in birth or egg hatching|glucose 1-phosphate metabolic process|hemopoiesis|post-translational protein modification|protein N-linked glycosylation via asparagine|UDP-N-acetylglucosamine biosynthetic process	cytosol	magnesium ion binding|phosphoacetylglucosamine mutase activity|phosphoglucomutase activity				0		all_cancers(76;0.000504)|Acute lymphoblastic leukemia(125;3.85e-06)|all_hematologic(105;0.0017)|all_epithelial(107;0.068)		BRCA - Breast invasive adenocarcinoma(397;0.0478)		CTATAATTAAGAGAACTTACA	0.358													5	29	---	---	---	---	PASS
NT5E	4907	broad.mit.edu	37	6	86201765	86201765	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:86201765C>A	uc003pko.3	+	8	1987	c.1431C>A	c.(1429-1431)ACC>ACA	p.T477T	NT5E_uc010kbr.2_Silent_p.T427T	NM_002526	NP_002517	P21589	5NTD_HUMAN	5' nucleotidase, ecto precursor	477					DNA metabolic process|purine base metabolic process|pyrimidine base metabolic process|pyrimidine nucleoside catabolic process	anchored to membrane|cytoplasm|membrane fraction|plasma membrane	5'-nucleotidase activity|nucleotide binding			ovary(3)|central_nervous_system(1)	4		all_cancers(76;0.000215)|Acute lymphoblastic leukemia(125;3.66e-08)|all_hematologic(105;8.61e-05)|all_epithelial(107;0.0427)		BRCA - Breast invasive adenocarcinoma(108;0.0417)	Pentoxifylline(DB00806)	TTCTTTGCACCAAGTGTCGAG	0.443													6	122	---	---	---	---	PASS
MDN1	23195	broad.mit.edu	37	6	90371226	90371226	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:90371226C>A	uc003pnn.1	-	88	14753	c.14637G>T	c.(14635-14637)TTG>TTT	p.L4879F		NM_014611	NP_055426	Q9NU22	MDN1_HUMAN	MDN1, midasin homolog	4879					protein complex assembly|regulation of protein complex assembly	nucleus	ATP binding|ATPase activity|unfolded protein binding			ovary(8)|skin(2)	10		all_cancers(76;1.47e-06)|Acute lymphoblastic leukemia(125;2.23e-10)|Prostate(29;5.55e-10)|all_hematologic(105;2.42e-06)|all_epithelial(107;0.00246)		BRCA - Breast invasive adenocarcinoma(108;0.0193)		CTGGAAGGTCCAAAGCCTCGG	0.478													7	93	---	---	---	---	PASS
POPDC3	64208	broad.mit.edu	37	6	105609377	105609377	+	Silent	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:105609377A>T	uc003prb.2	-	2	810	c.408T>A	c.(406-408)GTT>GTA	p.V136V	uc003pqz.2_Intron|POPDC3_uc003pra.2_Intron	NM_022361	NP_071756	Q9HBV1	POPD3_HUMAN	popeye protein 3	136						integral to membrane				skin(3)|ovary(2)	5		all_cancers(87;4.87e-05)|Acute lymphoblastic leukemia(125;1.9e-08)|all_hematologic(75;9.25e-07)|all_epithelial(87;0.0157)|Colorectal(196;0.202)|Lung NSC(302;0.238)				TTTCCAAAGTAACCACTTCAG	0.463													13	70	---	---	---	---	PASS
SCML4	256380	broad.mit.edu	37	6	108067950	108067950	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:108067950G>C	uc010kdf.2	-	4	681	c.430C>G	c.(430-432)CAG>GAG	p.Q144E	SCML4_uc003prz.3_Missense_Mutation_p.Q86E|SCML4_uc011eam.1_Missense_Mutation_p.Q144E|SCML4_uc003psa.3_Missense_Mutation_p.Q115E	NM_198081	NP_932347	Q8N228	SCML4_HUMAN	sex comb on midleg-like 4	144					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(1)	1		all_cancers(87;3.26e-06)|Acute lymphoblastic leukemia(125;3.08e-08)|all_hematologic(75;1.15e-06)|all_epithelial(87;0.00142)|Colorectal(196;0.0316)		BRCA - Breast invasive adenocarcinoma(108;0.01)|Epithelial(106;0.0509)|all cancers(137;0.0586)|OV - Ovarian serous cystadenocarcinoma(136;0.0758)		AGCTTCTGCTGGTGGGCGCAG	0.632													9	41	---	---	---	---	PASS
REV3L	5980	broad.mit.edu	37	6	111632452	111632452	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:111632452C>A	uc003puy.3	-	29	8938	c.8615G>T	c.(8614-8616)CGT>CTT	p.R2872L	REV3L_uc003pux.3_Missense_Mutation_p.R2794L|REV3L_uc003puz.3_Missense_Mutation_p.R2794L|REV3L_uc003pva.1_RNA|REV3L_uc003puw.3_5'Flank	NM_002912	NP_002903	O60673	DPOLZ_HUMAN	DNA polymerase zeta	2872					DNA-dependent DNA replication|translesion synthesis	nucleus|zeta DNA polymerase complex	DNA binding|DNA-directed DNA polymerase activity|metal ion binding|nucleotide binding			large_intestine(2)|ovary(2)|skin(2)	6		all_cancers(87;7.57e-06)|Acute lymphoblastic leukemia(125;2.46e-08)|all_hematologic(75;1.08e-06)|all_epithelial(87;0.00138)|Colorectal(196;0.021)		OV - Ovarian serous cystadenocarcinoma(136;0.0314)|Epithelial(106;0.057)|all cancers(137;0.0663)		CTTTAGAGAACGCTCAAGTAT	0.328								DNA_polymerases_(catalytic_subunits)|Direct_reversal_of_damage					7	169	---	---	---	---	PASS
LAMA4	3910	broad.mit.edu	37	6	112471822	112471822	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:112471822A>T	uc003pvu.2	-	17	2373	c.2064T>A	c.(2062-2064)GAT>GAA	p.D688E	LAMA4_uc003pvv.2_Missense_Mutation_p.D681E|LAMA4_uc003pvt.2_Missense_Mutation_p.D681E	NM_001105206	NP_001098676	Q16363	LAMA4_HUMAN	laminin, alpha 4 isoform 1 precursor	688	Domain II and I.|Potential.				cell adhesion|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	extracellular matrix structural constituent|receptor binding			ovary(4)|breast(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	9		all_cancers(87;0.000196)|all_hematologic(75;0.000114)|all_epithelial(87;0.00542)|Colorectal(196;0.0209)		all cancers(137;0.0335)|OV - Ovarian serous cystadenocarcinoma(136;0.0578)|Epithelial(106;0.0748)|BRCA - Breast invasive adenocarcinoma(108;0.242)		CCACTGCTTCATCACTGCCTG	0.488													9	73	---	---	---	---	PASS
NT5DC1	221294	broad.mit.edu	37	6	116544293	116544293	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:116544293C>A	uc003pwj.2	+	8	896	c.801C>A	c.(799-801)CTC>CTA	p.L267L	NT5DC1_uc003pwk.2_Silent_p.L259L|NT5DC1_uc003pwl.2_Silent_p.L217L	NM_152729	NP_689942	Q5TFE4	NT5D1_HUMAN	5'-nucleotidase, cytosolic II-like 1 protein	267							hydrolase activity|metal ion binding				0		all_cancers(87;0.00367)|all_epithelial(87;0.00449)|Colorectal(196;0.0469)		all cancers(137;0.0327)|OV - Ovarian serous cystadenocarcinoma(136;0.0445)|GBM - Glioblastoma multiforme(226;0.0719)|Epithelial(106;0.112)		TCCGGACACTCGGTAAGTTAC	0.408													5	87	---	---	---	---	PASS
ROS1	6098	broad.mit.edu	37	6	117638307	117638307	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:117638307G>T	uc003pxp.1	-	38	6333	c.6134C>A	c.(6133-6135)ACG>AAG	p.T2045K	ROS1_uc011ebi.1_RNA	NM_002944	NP_002935	P08922	ROS_HUMAN	proto-oncogene c-ros-1 protein precursor	2045	Protein kinase.|Cytoplasmic (Potential).				transmembrane receptor protein tyrosine kinase signaling pathway	membrane fraction|sodium:potassium-exchanging ATPase complex	ATP binding|transmembrane receptor protein tyrosine kinase activity			lung(8)|ovary(6)|central_nervous_system(3)|skin(3)|stomach(2)|breast(2)|large_intestine(1)	25		all_cancers(87;0.00846)|all_epithelial(87;0.0242)		GBM - Glioblastoma multiforme(226;0.0387)|OV - Ovarian serous cystadenocarcinoma(136;0.0954)|all cancers(137;0.137)		ACTGCCTACCGTTGCCATCCG	0.408			T	GOPC|ROS1	glioblastoma|NSCLC								5	118	---	---	---	---	PASS
ASF1A	25842	broad.mit.edu	37	6	119222018	119222018	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:119222018C>A	uc011ebn.1	+	2	534	c.197C>A	c.(196-198)CCC>CAC	p.P66H		NM_014034	NP_054753	Q9Y294	ASF1A_HUMAN	ASF1 anti-silencing function 1 homolog A	66	Interaction with histone H3, CHAF1B, and HIRA.				chromatin modification|DNA repair|loss of chromatin silencing|nucleosome assembly|transcription, DNA-dependent	chromatin remodeling complex	chromatin binding|histone binding				0		all_cancers(87;0.122)|all_epithelial(87;0.179)		GBM - Glioblastoma multiforme(226;0.0633)|OV - Ovarian serous cystadenocarcinoma(136;0.188)		GGTCCTGTTCCCGCAGGAAGG	0.343													8	170	---	---	---	---	PASS
HSF2	3298	broad.mit.edu	37	6	122743330	122743330	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:122743330G>T	uc003pyu.2	+	8	904	c.717G>T	c.(715-717)AGG>AGT	p.R239S	HSF2_uc003pyv.2_Missense_Mutation_p.R239S	NM_004506	NP_004497	Q03933	HSF2_HUMAN	heat shock transcription factor 2 isoform a	239					response to stress|transcription from RNA polymerase II promoter	cytoplasm|nucleus	sequence-specific DNA binding transcription factor activity|transcription coactivator activity				0				OV - Ovarian serous cystadenocarcinoma(136;0.00371)|all cancers(137;0.0299)|GBM - Glioblastoma multiforme(226;0.0586)		TAAAGCCAAGGGAGAGGATTT	0.313													8	117	---	---	---	---	PASS
ARHGAP18	93663	broad.mit.edu	37	6	129959562	129959562	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:129959562G>T	uc003qbr.2	-	3	618	c.529C>A	c.(529-531)CAA>AAA	p.Q177K	ARHGAP18_uc011ebw.1_Missense_Mutation_p.Q177K	NM_033515	NP_277050	Q8N392	RHG18_HUMAN	Rho GTPase activating protein 18	177					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity|protein binding			ovary(2)|skin(1)	3				OV - Ovarian serous cystadenocarcinoma(136;0.0621)|GBM - Glioblastoma multiforme(226;0.0638)|all cancers(137;0.074)		TCTCTCTGTTGAGCAAATATG	0.378													8	143	---	---	---	---	PASS
ENPP1	5167	broad.mit.edu	37	6	132171156	132171156	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132171156G>T	uc011ecf.1	+	3	360	c.340G>T	c.(340-342)GAG>TAG	p.E114*		NM_006208	NP_006199	P22413	ENPP1_HUMAN	ectonucleotide pyrophosphatase/phosphodiesterase	114	SMB 1.|Extracellular (Potential).				3'-phosphoadenosine 5'-phosphosulfate metabolic process|biomineral tissue development|cellular phosphate ion homeostasis|cellular response to insulin stimulus|generation of precursor metabolites and energy|immune response|inorganic diphosphate transport|negative regulation of cell growth|negative regulation of fat cell differentiation|negative regulation of glucose import|negative regulation of glycogen biosynthetic process|negative regulation of insulin receptor signaling pathway|negative regulation of protein autophosphorylation|nucleoside triphosphate catabolic process|phosphate metabolic process|sequestering of triglyceride|water-soluble vitamin metabolic process	basolateral plasma membrane|cell surface|extracellular space|integral to membrane	ATP binding|insulin receptor binding|metal ion binding|nucleic acid binding|nucleoside-triphosphate diphosphatase activity|nucleotide diphosphatase activity|phosphodiesterase I activity|polysaccharide binding|protein homodimerization activity|scavenger receptor activity			upper_aerodigestive_tract(2)|ovary(2)	4	Breast(56;0.0505)			GBM - Glioblastoma multiforme(226;0.0216)|OV - Ovarian serous cystadenocarcinoma(155;0.022)	Amifostine(DB01143)|Ribavirin(DB00811)	TCGCTGTTTCGAGAGAACATT	0.383													7	91	---	---	---	---	PASS
ENPP1	5167	broad.mit.edu	37	6	132203589	132203589	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:132203589G>T	uc011ecf.1	+	21	2225	c.2205G>T	c.(2203-2205)GTG>GTT	p.V735V		NM_006208	NP_006199	P22413	ENPP1_HUMAN	ectonucleotide pyrophosphatase/phosphodiesterase	735	Nuclease.|Extracellular (Potential).				3'-phosphoadenosine 5'-phosphosulfate metabolic process|biomineral tissue development|cellular phosphate ion homeostasis|cellular response to insulin stimulus|generation of precursor metabolites and energy|immune response|inorganic diphosphate transport|negative regulation of cell growth|negative regulation of fat cell differentiation|negative regulation of glucose import|negative regulation of glycogen biosynthetic process|negative regulation of insulin receptor signaling pathway|negative regulation of protein autophosphorylation|nucleoside triphosphate catabolic process|phosphate metabolic process|sequestering of triglyceride|water-soluble vitamin metabolic process	basolateral plasma membrane|cell surface|extracellular space|integral to membrane	ATP binding|insulin receptor binding|metal ion binding|nucleic acid binding|nucleoside-triphosphate diphosphatase activity|nucleotide diphosphatase activity|phosphodiesterase I activity|polysaccharide binding|protein homodimerization activity|scavenger receptor activity			upper_aerodigestive_tract(2)|ovary(2)	4	Breast(56;0.0505)			GBM - Glioblastoma multiforme(226;0.0216)|OV - Ovarian serous cystadenocarcinoma(155;0.022)	Amifostine(DB01143)|Ribavirin(DB00811)	ACACCAAAGTGAGTTACGGGT	0.383													7	115	---	---	---	---	PASS
BCLAF1	9774	broad.mit.edu	37	6	136597355	136597355	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:136597355G>T	uc003qgx.1	-	5	1561	c.1308C>A	c.(1306-1308)CTC>CTA	p.L436L	BCLAF1_uc003qgw.1_Intron|BCLAF1_uc003qgy.1_Silent_p.L434L|BCLAF1_uc011edc.1_Intron|BCLAF1_uc011edd.1_RNA|BCLAF1_uc011ede.1_Silent_p.L434L	NM_014739	NP_055554	Q9NYF8	BCLF1_HUMAN	BCL2-associated transcription factor 1 isoform	436					induction of apoptosis|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleolus	DNA binding|protein binding			ovary(1)	1	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00226)|OV - Ovarian serous cystadenocarcinoma(155;0.00331)		ACTTGTACTTGAGTCCTTCCT	0.393													8	178	---	---	---	---	PASS
BCLAF1	9774	broad.mit.edu	37	6	136597415	136597415	+	Silent	SNP	G	T	T	rs144315600		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:136597415G>T	uc003qgx.1	-	5	1501	c.1248C>A	c.(1246-1248)CTC>CTA	p.L416L	BCLAF1_uc003qgw.1_Intron|BCLAF1_uc003qgy.1_Silent_p.L414L|BCLAF1_uc011edc.1_Intron|BCLAF1_uc011edd.1_RNA|BCLAF1_uc011ede.1_Silent_p.L414L	NM_014739	NP_055554	Q9NYF8	BCLF1_HUMAN	BCL2-associated transcription factor 1 isoform	416					induction of apoptosis|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleolus	DNA binding|protein binding			ovary(1)	1	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00226)|OV - Ovarian serous cystadenocarcinoma(155;0.00331)		CCTGATCTGCGAGGACTGACT	0.418													8	250	---	---	---	---	PASS
HEBP2	23593	broad.mit.edu	37	6	138727204	138727204	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:138727204C>A	uc003qhw.1	+	3	632	c.335C>A	c.(334-336)CCC>CAC	p.P112H		NM_014320	NP_055135	Q9Y5Z4	HEBP2_HUMAN	heme binding protein 2	112						mitochondrion					0	Breast(32;0.0933)			GBM - Glioblastoma multiforme(68;0.000732)|OV - Ovarian serous cystadenocarcinoma(155;0.00171)		CTGTATATTCCCTCTGAACAG	0.428													8	95	---	---	---	---	PASS
SASH1	23328	broad.mit.edu	37	6	148865881	148865881	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:148865881A>T	uc003qme.1	+	18	3750	c.3275A>T	c.(3274-3276)GAT>GTT	p.D1092V	SASH1_uc011eeb.1_Missense_Mutation_p.D853V|SASH1_uc003qmf.1_Missense_Mutation_p.D502V	NM_015278	NP_056093	O94885	SASH1_HUMAN	SAM and SH3 domain containing 1	1092							protein binding			central_nervous_system(1)	1		Ovarian(120;0.0169)		OV - Ovarian serous cystadenocarcinoma(155;5.63e-11)|GBM - Glioblastoma multiforme(68;0.0701)		CGGGGAGTGGATCTAGAAACG	0.587													4	6	---	---	---	---	PASS
KATNA1	11104	broad.mit.edu	37	6	149959644	149959644	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:149959644G>T	uc003qmr.1	-	1	85	c.40C>A	c.(40-42)CGT>AGT	p.R14S	KATNA1_uc003qms.2_Missense_Mutation_p.R14S|KATNA1_uc003qmt.2_Missense_Mutation_p.R14S|KATNA1_uc011eed.1_Missense_Mutation_p.R14S	NM_007044	NP_008975	O75449	KTNA1_HUMAN	katanin p60 subunit A 1	14	Interaction with microtubule.|Interaction with KATNB1.				cell division|interphase of mitotic cell cycle|mitosis	microtubule|microtubule organizing center|spindle pole	ATP binding|microtubule binding|microtubule-severing ATPase activity|protein heterodimerization activity			skin(1)	1		Ovarian(120;0.0164)		OV - Ovarian serous cystadenocarcinoma(155;2.95e-12)|GBM - Glioblastoma multiforme(68;0.173)		GCATATTCACGAGCCAATTTT	0.348													8	167	---	---	---	---	PASS
ULBP3	79465	broad.mit.edu	37	6	150385786	150385786	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:150385786C>A	uc003qns.3	-	4	692	c.692G>T	c.(691-693)TGG>TTG	p.W231L	ULBP3_uc011eej.1_Missense_Mutation_p.W106L	NM_024518	NP_078794	Q9BZM4	N2DL3_HUMAN	UL16 binding protein 3 precursor	231					antigen processing and presentation|immune response|natural killer cell activation	anchored to membrane|MHC class I protein complex	MHC class I receptor activity				0		Ovarian(120;0.12)	BRCA - Breast invasive adenocarcinoma(37;0.193)	OV - Ovarian serous cystadenocarcinoma(155;2.45e-12)		GAGGAAGCTCCAGGGACTGAG	0.532													6	60	---	---	---	---	PASS
C6orf97	80129	broad.mit.edu	37	6	151894542	151894542	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:151894542C>A	uc003qol.2	+	6	1097	c.1008C>A	c.(1006-1008)GGC>GGA	p.G336G		NM_025059	NP_079335	Q8IYT3	CF097_HUMAN	hypothetical protein LOC80129	336											0		Ovarian(120;0.126)	BRCA - Breast invasive adenocarcinoma(37;0.111)	OV - Ovarian serous cystadenocarcinoma(155;1.48e-10)		TCCTTAGGGGCAGATTGAGCA	0.522													14	47	---	---	---	---	PASS
OPRM1	4988	broad.mit.edu	37	6	154412160	154412160	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:154412160C>A	uc003qpr.2	+	3	954	c.717C>A	c.(715-717)TTC>TTA	p.F239L	OPRM1_uc011efc.1_Missense_Mutation_p.F158L|OPRM1_uc011efd.1_Missense_Mutation_p.F139L|OPRM1_uc011efe.1_Missense_Mutation_p.F332L|OPRM1_uc003qpn.2_Missense_Mutation_p.F239L|OPRM1_uc003qpo.1_Missense_Mutation_p.F239L|OPRM1_uc011eff.1_Missense_Mutation_p.F239L|OPRM1_uc011efg.1_Missense_Mutation_p.F239L|OPRM1_uc011efh.1_Missense_Mutation_p.F239L|OPRM1_uc003qpq.1_Missense_Mutation_p.F239L|OPRM1_uc003qpt.1_Missense_Mutation_p.F239L|OPRM1_uc011efi.1_Missense_Mutation_p.F239L|OPRM1_uc003qpp.2_RNA|OPRM1_uc003qps.2_RNA|OPRM1_uc010kjg.2_Missense_Mutation_p.F139L|OPRM1_uc003qpu.2_Missense_Mutation_p.F139L	NM_000914	NP_000905	P35372	OPRM_HUMAN	opioid receptor, mu 1 isoform MOR-1	239	Helical; Name=5; (Potential).				behavior|negative regulation of cell proliferation|sensory perception	endoplasmic reticulum|Golgi apparatus|integral to plasma membrane	mu-opioid receptor activity|protein binding			ovary(1)	1		Ovarian(120;0.196)		OV - Ovarian serous cystadenocarcinoma(155;9.26e-11)|BRCA - Breast invasive adenocarcinoma(81;0.0154)	Alfentanil(DB00802)|Anileridine(DB00913)|Buprenorphine(DB00921)|Butorphanol(DB00611)|Codeine(DB00318)|Dezocine(DB01209)|Diphenoxylate(DB01081)|Fentanyl(DB00813)|Hydrocodone(DB00956)|Hydromorphone(DB00327)|Levallorphan(DB00504)|Levomethadyl Acetate(DB01227)|Levorphanol(DB00854)|Loperamide(DB00836)|Methadone(DB00333)|Methadyl Acetate(DB01433)|Morphine(DB00295)|Nalbuphine(DB00844)|Naloxone(DB01183)|Naltrexone(DB00704)|Oxycodone(DB00497)|Oxymorphone(DB01192)|Pentazocine(DB00652)|Propoxyphene(DB00647)|Remifentanil(DB00899)|Sufentanil(DB00708)|Tramadol(DB00193)	TCTGTGTTTTCATCTTCGCCT	0.433													7	96	---	---	---	---	PASS
LPA	4018	broad.mit.edu	37	6	161012070	161012070	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:161012070C>A	uc003qtl.2	-	24	3813	c.3693G>T	c.(3691-3693)ATG>ATT	p.M1231I		NM_005577	NP_005568	P08519	APOA_HUMAN	lipoprotein Lp(a) precursor	3739	Kringle 33.				blood circulation|lipid metabolic process|lipid transport|lipoprotein metabolic process|proteolysis|receptor-mediated endocytosis	plasma lipoprotein particle	apolipoprotein binding|endopeptidase inhibitor activity|fibronectin binding|heparin binding|serine-type endopeptidase activity			ovary(3)|skin(2)|pancreas(1)	6		Breast(66;0.000496)|Ovarian(120;0.0303)|Prostate(117;0.0965)		OV - Ovarian serous cystadenocarcinoma(65;2.5e-17)|BRCA - Breast invasive adenocarcinoma(81;6.48e-06)	Aminocaproic Acid(DB00513)	CATTGGGATCCATGGTATAAC	0.468													5	32	---	---	---	---	PASS
QKI	9444	broad.mit.edu	37	6	163836265	163836265	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:163836265A>T	uc003qui.2	+	1	591	c.40A>T	c.(40-42)ACC>TCC	p.T14S	QKI_uc003que.2_Missense_Mutation_p.T14S|QKI_uc003quf.2_Missense_Mutation_p.T14S|QKI_uc003qug.2_Missense_Mutation_p.T14S|QKI_uc003quh.2_Missense_Mutation_p.T14S|QKI_uc003quj.2_Missense_Mutation_p.T14S	NM_006775	NP_006766	Q96PU8	QKI_HUMAN	quaking homolog, KH domain RNA binding isoform	14					mRNA processing|mRNA transport|regulation of translation|RNA splicing	cytoplasm|nucleus|plasma membrane	RNA binding|SH3 domain binding			large_intestine(1)|ovary(1)	2		Breast(66;5e-05)|Prostate(117;0.0235)|all_neural(5;0.0416)|Ovarian(120;0.0448)|Glioma(2;0.203)		all cancers(1;4.4e-46)|OV - Ovarian serous cystadenocarcinoma(33;6.91e-23)|GBM - Glioblastoma multiforme(1;2.94e-19)|BRCA - Breast invasive adenocarcinoma(81;1.49e-06)|Kidney(3;0.000199)|KIRC - Kidney renal clear cell carcinoma(3;0.000234)		GCCGAAGCCCACCCCAGATTA	0.512													6	33	---	---	---	---	PASS
FAM120B	84498	broad.mit.edu	37	6	170627566	170627566	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:170627566G>T	uc003qxp.2	+	2	1196	c.1088G>T	c.(1087-1089)CGA>CTA	p.R363L	FAM120B_uc003qxo.1_Missense_Mutation_p.R363L|FAM120B_uc011ehd.1_Intron	NM_032448	NP_115824	Q96EK7	F120B_HUMAN	family with sequence similarity 120B	363					cell differentiation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding			ovary(1)	1		Breast(66;0.000338)|Esophageal squamous(34;0.241)		OV - Ovarian serous cystadenocarcinoma(33;3.94e-22)|BRCA - Breast invasive adenocarcinoma(81;6.47e-06)|GBM - Glioblastoma multiforme(31;0.0899)		GAATCCAGGCGAGAAGTTCCC	0.522													6	101	---	---	---	---	PASS
TNRC18	84629	broad.mit.edu	37	7	5391687	5391687	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:5391687C>A	uc003soi.3	-	17	5582	c.5233G>T	c.(5233-5235)GAG>TAG	p.E1745*	TNRC18_uc003soj.2_Nonsense_Mutation_p.E127*	NM_001080495	NP_001073964	O15417	TNC18_HUMAN	trinucleotide repeat containing 18	1745							DNA binding				0		Ovarian(82;0.142)		UCEC - Uterine corpus endometrioid carcinoma (126;0.195)|OV - Ovarian serous cystadenocarcinoma(56;5.32e-15)		GCGGGCCACTCGTCCTTCAGG	0.537													4	20	---	---	---	---	PASS
COL28A1	340267	broad.mit.edu	37	7	7572456	7572456	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:7572456C>A	uc003src.1	-	2	168	c.51G>T	c.(49-51)ACG>ACT	p.T17T	COL28A1_uc011jxe.1_5'UTR	NM_001037763	NP_001032852	Q2UY09	COSA1_HUMAN	collagen, type XXVIII precursor	17					cell adhesion	basement membrane|collagen	serine-type endopeptidase inhibitor activity			skin(3)	3		Ovarian(82;0.0789)		UCEC - Uterine corpus endometrioid carcinoma (126;0.228)		CTGTTTGACTCGTAAACGCTG	0.338													9	205	---	---	---	---	PASS
MIOS	54468	broad.mit.edu	37	7	7628158	7628158	+	Silent	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:7628158A>G	uc003srf.2	+	8	2156	c.1848A>G	c.(1846-1848)AGA>AGG	p.R616R	MIOS_uc003srg.2_Silent_p.R151R|MIOS_uc010ktq.2_Missense_Mutation_p.E14G	NM_019005	NP_061878	Q9NXC5	MIO_HUMAN	missing oocyte, meiosis regulator, homolog	616											0						TACGTGACAGAGTGGCATTTG	0.343													22	108	---	---	---	---	PASS
ETV1	2115	broad.mit.edu	37	7	13949310	13949310	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:13949310T>C	uc011jxq.1	-	11	1626	c.887A>G	c.(886-888)AAG>AGG	p.K296R	ETV1_uc011jxn.1_Missense_Mutation_p.K256R|ETV1_uc011jxo.1_Missense_Mutation_p.K193R|ETV1_uc011jxp.1_Missense_Mutation_p.K238R|ETV1_uc003ssw.3_Missense_Mutation_p.K273R|ETV1_uc003ssx.2_RNA|ETV1_uc011jxr.1_Missense_Mutation_p.K278R|ETV1_uc011jxs.1_Missense_Mutation_p.K278R|ETV1_uc010ktv.2_Missense_Mutation_p.R165G	NM_004956	NP_004947	P50549	ETV1_HUMAN	ets variant gene 1 isoform a	296					transcription from RNA polymerase II promoter	nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity		TMPRSS2/ETV1(24)|EWSR1/ETV1(7)	prostate(24)|soft_tissue(4)|bone(3)|lung(2)|central_nervous_system(1)|ovary(1)	35						CCTGGGGCCCTTTTCAAACAT	0.343			T	EWSR1|TMPRSS2|SLC45A3|C15orf21|HNRNPA2B1. ACSL3	Ewing sarcoma|prostate								4	203	---	---	---	---	PASS
TMEM195	392636	broad.mit.edu	37	7	15427143	15427143	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:15427143C>A	uc003stb.1	-	9	1015	c.845G>T	c.(844-846)TGG>TTG	p.W282L		NM_001004320	NP_001004320	Q6ZNB7	ALKMO_HUMAN	transmembrane protein 195	282					ether lipid metabolic process|fatty acid biosynthetic process|membrane lipid metabolic process	endoplasmic reticulum membrane|integral to membrane	glyceryl-ether monooxygenase activity|iron ion binding				0						GAATGTAGTCCATATGGAAAA	0.343													7	127	---	---	---	---	PASS
HDAC9	9734	broad.mit.edu	37	7	18688187	18688187	+	Missense_Mutation	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:18688187A>G	uc003suh.2	+	10	1380	c.1339A>G	c.(1339-1341)AAC>GAC	p.N447D	HDAC9_uc003sue.2_Missense_Mutation_p.N447D|HDAC9_uc011jyd.1_Missense_Mutation_p.N447D|HDAC9_uc003sui.2_Missense_Mutation_p.N450D|HDAC9_uc003suj.2_Missense_Mutation_p.N406D|HDAC9_uc011jya.1_Missense_Mutation_p.N444D|HDAC9_uc003sua.1_Missense_Mutation_p.N425D|HDAC9_uc011jyb.1_Missense_Mutation_p.N403D|HDAC9_uc003sud.1_Missense_Mutation_p.N447D|HDAC9_uc011jyc.1_Missense_Mutation_p.N406D|HDAC9_uc003suf.1_Missense_Mutation_p.N478D|HDAC9_uc010kud.1_Missense_Mutation_p.N450D|HDAC9_uc011jye.1_Missense_Mutation_p.N419D|HDAC9_uc011jyf.1_Missense_Mutation_p.N370D|HDAC9_uc010kue.1_Missense_Mutation_p.N190D	NM_058176	NP_478056	Q9UKV0	HDAC9_HUMAN	histone deacetylase 9 isoform 1	447					B cell differentiation|cellular response to insulin stimulus|heart development|histone H3 deacetylation|histone H4 deacetylation|inflammatory response|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription, DNA-dependent|peptidyl-lysine deacetylation|positive regulation of cell migration involved in sprouting angiogenesis|regulation of skeletal muscle fiber development|transcription, DNA-dependent	cytoplasm|histone deacetylase complex|histone methyltransferase complex|transcription factor complex	histone deacetylase activity (H3-K16 specific)|histone deacetylase binding|histone deacetylase binding|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|protein binding|protein kinase C binding|repressing transcription factor binding|transcription corepressor activity			lung(2)|central_nervous_system(2)|kidney(1)	5	all_lung(11;0.187)				Valproic Acid(DB00313)	CAGACCCCTGAACCGAACCCA	0.512													13	44	---	---	---	---	PASS
ABCB5	340273	broad.mit.edu	37	7	20683155	20683155	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:20683155C>A	uc010kuh.2	+	7	815	c.578C>A	c.(577-579)TCG>TAG	p.S193*		NM_001163941	NP_001157413	Q2M3G0	ABCB5_HUMAN	ATP-binding cassette, sub-family B, member 5	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment					regulation of membrane potential	apical plasma membrane|Golgi membrane|integral to plasma membrane|intercellular canaliculus	ATP binding|ATPase activity, coupled to transmembrane movement of substances|efflux transmembrane transporter activity			skin(2)|large_intestine(1)|haematopoietic_and_lymphoid_tissue(1)|ovary(1)|pancreas(1)	6						TCTACTTTTTCGATTGGCCTG	0.423													5	125	---	---	---	---	PASS
IL6	3569	broad.mit.edu	37	7	22767125	22767125	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:22767125G>T	uc011jyn.1	+	3	541	c.82G>T	c.(82-84)GCC>TCC	p.A28S	uc010kun.1_Intron|IL6_uc011jyo.1_Missense_Mutation_p.A28S|IL6_uc011jyp.1_Intron|IL6_uc003svj.3_Missense_Mutation_p.A28S|IL6_uc011jyq.1_Missense_Mutation_p.A82S	NM_000600	NP_000591	P05231	IL6_HUMAN	interleukin 6 precursor	28					acute-phase response|cellular response to hydrogen peroxide|defense response to Gram-negative bacterium|defense response to Gram-positive bacterium|defense response to virus|endocrine pancreas development|glucagon secretion|hepatic immune response|interleukin-6-mediated signaling pathway|negative regulation of apoptosis|negative regulation of cell proliferation|negative regulation of chemokine biosynthetic process|negative regulation of collagen biosynthetic process|negative regulation of fat cell differentiation|negative regulation of lipid storage|neuron projection development|neutrophil apoptosis|platelet activation|positive regulation of acute inflammatory response|positive regulation of anti-apoptosis|positive regulation of B cell activation|positive regulation of chemokine production|positive regulation of immunoglobulin secretion|positive regulation of interleukin-6 production|positive regulation of osteoblast differentiation|positive regulation of peptidyl-serine phosphorylation|positive regulation of sequence-specific DNA binding transcription factor activity|positive regulation of smooth muscle cell proliferation|positive regulation of T cell proliferation|positive regulation of transcription from RNA polymerase II promoter|positive regulation of translation|positive regulation of tyrosine phosphorylation of Stat3 protein|regulation of vascular endothelial growth factor production|response to glucocorticoid stimulus|response to peptidoglycan	extracellular space|interleukin-6 receptor complex	cytokine activity|growth factor activity|interleukin-6 receptor binding				0					Arsenic trioxide(DB01169)|Bicalutamide(DB01128)|Ginseng(DB01404)|Simvastatin(DB00641)	TGCCTTCCCTGCCCCAGTACC	0.597													7	29	---	---	---	---	PASS
KLHL7	55975	broad.mit.edu	37	7	23180511	23180511	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:23180511G>T	uc003svs.3	+	5	859	c.566G>T	c.(565-567)CGA>CTA	p.R189L	KLHL7_uc003svr.3_Missense_Mutation_p.R167L|KLHL7_uc011jys.1_Missense_Mutation_p.R113L|KLHL7_uc011jyt.1_5'UTR|KLHL7_uc003svt.2_Missense_Mutation_p.R141L|KLHL7_uc011jyv.1_5'UTR	NM_001031710	NP_001026880	Q8IXQ5	KLHL7_HUMAN	kelch-like 7 isoform 1	189						Golgi apparatus|nucleolus|plasma membrane					0						GATGTCAAGCGAGTAACACAT	0.363													7	101	---	---	---	---	PASS
GPNMB	10457	broad.mit.edu	37	7	23296619	23296619	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:23296619G>T	uc003swc.2	+	4	637	c.476G>T	c.(475-477)GGG>GTG	p.G159V	GPNMB_uc003swa.2_Missense_Mutation_p.G159V|GPNMB_uc003swb.2_Missense_Mutation_p.G159V|GPNMB_uc011jyy.1_Intron|GPNMB_uc011jyz.1_Missense_Mutation_p.G60V	NM_001005340	NP_001005340	Q14956	GPNMB_HUMAN	glycoprotein (transmembrane) nmb isoform a	159	Extracellular (Potential).				negative regulation of cell proliferation	melanosome				ovary(3)|breast(2)	5			GBM - Glioblastoma multiforme(13;0.154)			TTCCCTGATGGGAAACCTTTT	0.478													7	116	---	---	---	---	PASS
STK31	56164	broad.mit.edu	37	7	23794014	23794014	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:23794014C>A	uc003sws.3	+	10	1281	c.1214C>A	c.(1213-1215)CCA>CAA	p.P405Q	STK31_uc003swt.3_Missense_Mutation_p.P382Q|STK31_uc011jze.1_Missense_Mutation_p.P405Q|STK31_uc010kuq.2_Missense_Mutation_p.P382Q	NM_031414	NP_113602	Q9BXU1	STK31_HUMAN	serine/threonine kinase 31 isoform a	405							ATP binding|nucleic acid binding|protein serine/threonine kinase activity			skin(3)|lung(2)|ovary(2)|stomach(2)	9						TTTACTACTCCAGCTTCTTTG	0.378													11	188	---	---	---	---	PASS
NPY	4852	broad.mit.edu	37	7	24329197	24329197	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:24329197C>A	uc003sww.1	+	3	354	c.268C>A	c.(268-270)CGG>AGG	p.R90R		NM_000905	NP_000896	P01303	NPY_HUMAN	neuropeptide Y precursor	90					adult feeding behavior|calcium ion transport|cell proliferation|cellular component movement|central nervous system neuron development|cerebral cortex development|digestion|G-protein signaling, coupled to cyclic nucleotide second messenger|neuron projection development|neuropeptide signaling pathway|positive regulation of appetite|synaptic transmission	cell|extracellular space	calcium channel regulator activity|G-protein coupled receptor activity|neuropeptide hormone activity				0						TCCCAGAACTCGGTATGACAA	0.493													5	75	---	---	---	---	PASS
HOXA6	3203	broad.mit.edu	37	7	27187272	27187272	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27187272C>T	uc003syo.1	-	1	97	c.97G>A	c.(97-99)GAC>AAC	p.D33N	uc003syp.1_Intron|HOXA6_uc003syq.1_Intron	NM_024014	NP_076919	P31267	HXA6_HUMAN	homeobox A6	33						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity			ovary(1)|central_nervous_system(1)	2						CTCAGCGCGTCATAGCCAGCC	0.607													12	29	---	---	---	---	PASS
TAX1BP1	8887	broad.mit.edu	37	7	27868362	27868362	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27868362G>T	uc003szl.2	+	17	2442	c.2284G>T	c.(2284-2286)GAG>TAG	p.E762*	TAX1BP1_uc011jzo.1_Nonsense_Mutation_p.E720*|TAX1BP1_uc003szk.2_Nonsense_Mutation_p.E720*|TAX1BP1_uc011jzp.1_Nonsense_Mutation_p.E563*	NM_006024	NP_006015	Q86VP1	TAXB1_HUMAN	Tax1 (human T-cell leukemia virus type I)	762					anti-apoptosis|apoptosis|negative regulation of NF-kappaB transcription factor activity|negative regulation of type I interferon production	cytosol	identical protein binding|kinase binding|zinc ion binding			breast(1)	1			GBM - Glioblastoma multiforme(3;0.0823)			GATGTGCAGCGAGCAGTTCCC	0.418													6	124	---	---	---	---	PASS
MIR550-1	693133	broad.mit.edu	37	7	30329465	30329465	+	RNA	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:30329465G>A	hsa-mir-550-1|MI0003600	+			c.56G>A			ZNRF2_uc003tat.2_Intron																	0						GTTGTTGTAAGATAGTGTCTT	0.483													22	93	---	---	---	---	PASS
NEUROD6	63974	broad.mit.edu	37	7	31378807	31378807	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:31378807C>A	uc003tch.2	-	2	429	c.76G>T	c.(76-78)GAG>TAG	p.E26*		NM_022728	NP_073565	Q96NK8	NDF6_HUMAN	neurogenic differentiation 6	26					cell differentiation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding			ovary(2)	2						TTCTGGTCCTCGCATTCTCTA	0.373													9	262	---	---	---	---	PASS
NPSR1	387129	broad.mit.edu	37	7	34724182	34724182	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:34724182C>A	uc003teg.1	+	2	294	c.166C>A	c.(166-168)CTG>ATG	p.L56M	AAA1_uc010kwo.1_Intron|AAA1_uc010kwp.1_Intron|AAA1_uc003tdz.2_Intron|AAA1_uc010kwq.1_Intron|AAA1_uc003teb.1_Intron|AAA1_uc011kaq.1_Intron|NPSR1_uc003teh.1_Missense_Mutation_p.L56M|NPSR1_uc010kwt.1_Translation_Start_Site|NPSR1_uc010kwu.1_Translation_Start_Site|NPSR1_uc010kwv.1_Missense_Mutation_p.L56M|NPSR1_uc003tei.1_Missense_Mutation_p.L56M|NPSR1_uc010kww.1_Missense_Mutation_p.L56M|NPSR1_uc011kar.1_Missense_Mutation_p.L56M	NM_207172	NP_997055	Q6W5P4	NPSR1_HUMAN	G protein-coupled receptor for asthma	56	Helical; Name=1; (Potential).					cytoplasm|integral to membrane|plasma membrane	vasopressin receptor activity			skin(3)|pancreas(1)	4					Halothane(DB01159)	ATTGATAACTCTGTGGGTCCT	0.418													9	158	---	---	---	---	PASS
ANLN	54443	broad.mit.edu	37	7	36455406	36455406	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:36455406G>T	uc003tff.2	+	8	1639	c.1435G>T	c.(1435-1437)GGT>TGT	p.G479C	ANLN_uc011kaz.1_Missense_Mutation_p.G391C|ANLN_uc003tfg.2_Missense_Mutation_p.G479C|ANLN_uc010kxe.2_Missense_Mutation_p.G479C	NM_018685	NP_061155	Q9NQW6	ANLN_HUMAN	anillin, actin binding protein	479	Interaction with F-actin.				cytokinesis|mitosis|regulation of exit from mitosis|septin ring assembly	actomyosin contractile ring|nucleus	actin binding			ovary(2)|skin(1)	3						AAAACACCAAGGTGTTTCAAA	0.348													9	221	---	---	---	---	PASS
SFRP4	6424	broad.mit.edu	37	7	37951810	37951810	+	Missense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:37951810T>A	uc003tfo.3	-	4	1088	c.702A>T	c.(700-702)CAA>CAT	p.Q234H		NM_003014	NP_003005	Q6FHJ7	SFRP4_HUMAN	secreted frizzled-related  protein 4 precursor	234	NTR.				brain development|cell differentiation|decidualization|embryo development|epithelium development|gonad development|mammary gland involution|menstrual cycle phase|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of cell proliferation|negative regulation of JNK cascade|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of sodium-dependent phosphate transport|phosphate ion homeostasis|positive regulation of apoptosis|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of epidermal cell differentiation|positive regulation of gene expression|positive regulation of receptor internalization|vasculature development|Wnt receptor signaling pathway	cell surface|cytoplasm|extracellular space|nucleus	PDZ domain binding|Wnt receptor activity|Wnt-protein binding			lung(1)	1						TGAGCGGGACTTGAGTTCGAG	0.483													56	74	---	---	---	---	PASS
AMPH	273	broad.mit.edu	37	7	38502670	38502670	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:38502670C>A	uc003tgu.2	-	10	862	c.793G>T	c.(793-795)GAG>TAG	p.E265*	AMPH_uc003tgv.2_Nonsense_Mutation_p.E265*|AMPH_uc003tgt.2_Nonsense_Mutation_p.E18*	NM_001635	NP_001626	P49418	AMPH_HUMAN	amphiphysin isoform 1	265					endocytosis|synaptic transmission	actin cytoskeleton|cell junction|synaptic vesicle membrane				ovary(3)|liver(1)|skin(1)	5						GAAGGCTCCTCAGGCGGTGAT	0.562													8	114	---	---	---	---	PASS
VPS41	27072	broad.mit.edu	37	7	38869888	38869888	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:38869888C>A	uc003tgy.2	-	5	313	c.287G>T	c.(286-288)GGA>GTA	p.G96V	VPS41_uc003tgz.2_Intron|VPS41_uc010kxn.2_Missense_Mutation_p.G96V	NM_014396	NP_055211	P49754	VPS41_HUMAN	vacuolar protein sorting 41 isoform 1	96					Golgi vesicle transport|intracellular protein transport|vesicle-mediated transport	cytosol|Golgi-associated vesicle|HOPS complex|membrane fraction	zinc ion binding			skin(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	4						CATGTGCTCTCCACTTTCATC	0.428													147	247	---	---	---	---	PASS
RALA	5898	broad.mit.edu	37	7	39745754	39745754	+	Silent	SNP	G	T	T	rs147901344	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:39745754G>T	uc003thd.2	+	5	831	c.531G>T	c.(529-531)GCG>GCT	p.A177A		NM_005402	NP_005393	P11233	RALA_HUMAN	ras related v-ral simian leukemia viral oncogene	177					actin cytoskeleton reorganization|cell cycle|chemotaxis|cytokinesis|exocytosis|interspecies interaction between organisms|membrane raft localization|nerve growth factor receptor signaling pathway|positive regulation of filopodium assembly|Ras protein signal transduction|regulation of exocytosis	cell surface|cleavage furrow|cytosol|midbody|plasma membrane	Edg-2 lysophosphatidic acid receptor binding|GTP binding|GTPase activity			lung(1)|skin(1)	2						AAATTCGAGCGAGAAAGATGG	0.323													6	116	---	---	---	---	PASS
NPC1L1	29881	broad.mit.edu	37	7	44556514	44556514	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:44556514C>A	uc003tlb.2	-	17	3444	c.3388G>T	c.(3388-3390)GAG>TAG	p.E1130*	NPC1L1_uc003tlc.2_Nonsense_Mutation_p.E1103*|NPC1L1_uc011kbw.1_Nonsense_Mutation_p.E1057*|NPC1L1_uc003tla.2_Intron	NM_013389	NP_037521	Q9UHC9	NPCL1_HUMAN	Niemann-Pick C1-like protein 1 isoform 1	1130	Cytoplasmic (Potential).				cholesterol biosynthetic process|intestinal cholesterol absorption|lipoprotein metabolic process	apical plasma membrane|cytoplasmic vesicle membrane|integral to membrane	hedgehog receptor activity|protein binding			ovary(3)|central_nervous_system(1)|skin(1)	5					Ezetimibe(DB00973)	AGGTACTGCTCATAAAACACA	0.607													4	14	---	---	---	---	PASS
DDX56	54606	broad.mit.edu	37	7	44608558	44608558	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:44608558G>T	uc003tlg.2	-	11	1970	c.1327C>A	c.(1327-1329)CGG>AGG	p.R443R	DDX56_uc003tle.2_RNA|DDX56_uc003tlf.2_Silent_p.R379R|DDX56_uc003tlh.2_RNA|DDX56_uc010kyg.2_Silent_p.R403R|DDX56_uc010kyh.1_RNA	NM_019082	NP_061955	Q9NY93	DDX56_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 56	443					rRNA processing	nucleolus	ATP binding|ATP-dependent RNA helicase activity|identical protein binding|RNA binding			upper_aerodigestive_tract(1)	1						CTTGCCTCCCGAATGGCCTGC	0.537													6	163	---	---	---	---	PASS
POM121L12	285877	broad.mit.edu	37	7	53103589	53103589	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:53103589C>T	uc003tpz.2	+	1	241	c.225C>T	c.(223-225)ACC>ACT	p.T75T		NM_182595	NP_872401	Q8N7R1	P1L12_HUMAN	POM121 membrane glycoprotein-like 12	75											0						TGCCCAGCACCCACCTCATCG	0.711													11	16	---	---	---	---	PASS
POM121L12	285877	broad.mit.edu	37	7	53103999	53103999	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:53103999C>A	uc003tpz.2	+	1	651	c.635C>A	c.(634-636)CCC>CAC	p.P212H		NM_182595	NP_872401	Q8N7R1	P1L12_HUMAN	POM121 membrane glycoprotein-like 12	212											0						AACCTGCAGCCCCGGCCCTCT	0.672													9	55	---	---	---	---	PASS
VSTM2A	222008	broad.mit.edu	37	7	54610421	54610421	+	5'UTR	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:54610421G>T	uc010kzf.2	+	1					VSTM2A_uc010kze.2_5'UTR|VSTM2A_uc003tqc.3_5'UTR	NM_182546	NP_872352	Q8TAG5	VTM2A_HUMAN	V-set and transmembrane domain containing 2							extracellular region					0			STAD - Stomach adenocarcinoma(5;0.0525)			CTCCCTTTTTGGAATGATGGG	0.488													8	144	---	---	---	---	PASS
SUMF2	25870	broad.mit.edu	37	7	56141875	56141875	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:56141875C>A	uc003trv.2	+	4	436	c.405C>A	c.(403-405)CTC>CTA	p.L135L	PSPH_uc003trj.2_Intron|SUMF2_uc011kcv.1_RNA|SUMF2_uc011kcw.1_Silent_p.L135L|SUMF2_uc011kcx.1_Silent_p.L135L|SUMF2_uc003trt.2_Silent_p.L28L|SUMF2_uc011kcy.1_Intron|SUMF2_uc011kcz.1_Intron|SUMF2_uc003tru.2_RNA|SUMF2_uc011kda.1_Intron|SUMF2_uc003trx.2_Intron	NM_001130069	NP_001123541	Q8NBJ7	SUMF2_HUMAN	sulfatase modifying factor 2 isoform e	116						endoplasmic reticulum lumen	metal ion binding			ovary(1)|skin(1)	2	Breast(14;0.214)		Lung(13;0.00024)|LUSC - Lung squamous cell carcinoma(13;0.00099)			AGTCTGTACTCTGGTGGCTTC	0.557											OREG0018081	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	8	155	---	---	---	---	PASS
FKBP6	8468	broad.mit.edu	37	7	72754819	72754819	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:72754819C>T	uc003tya.2	+	6	900	c.768C>T	c.(766-768)CTC>CTT	p.L256L	FKBP6_uc003twz.2_Silent_p.L226L|FKBP6_uc011kew.1_Silent_p.L251L|FKBP6_uc010lbe.1_RNA	NM_003602	NP_003593	O75344	FKBP6_HUMAN	FK506 binding protein 6 isoform a	256	TPR 3.				protein folding	membrane	FK506 binding|peptidyl-prolyl cis-trans isomerase activity				0		Lung NSC(55;0.0908)|all_lung(88;0.198)				CCAAGGCCCTCTTCAGGTGTG	0.488													10	33	---	---	---	---	PASS
DTX2	113878	broad.mit.edu	37	7	76126661	76126661	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:76126661G>T	uc003uff.3	+	7	1573	c.1017G>T	c.(1015-1017)ACG>ACT	p.T339T	DTX2_uc011kgk.1_Silent_p.T248T|DTX2_uc003ufg.3_Silent_p.T339T|DTX2_uc003ufh.3_Silent_p.T339T|DTX2_uc003ufj.3_Intron|DTX2_uc003ufk.3_Intron|DTX2_uc003ufl.1_Silent_p.T2T|DTX2_uc003ufm.3_5'Flank	NM_020892	NP_065943	Q86UW9	DTX2_HUMAN	deltex 2 isoform a	339					Notch signaling pathway	cytoplasm|nucleus	protein binding|zinc ion binding			ovary(1)|skin(1)	2						CAGGCATGACGAGTGTTCTGA	0.597													7	147	---	---	---	---	PASS
CCDC146	57639	broad.mit.edu	37	7	76891505	76891505	+	Missense_Mutation	SNP	C	A	A	rs148455218		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:76891505C>A	uc003uga.2	+	9	1181	c.1054C>A	c.(1054-1056)CGT>AGT	p.R352S	CCDC146_uc010ldp.2_Missense_Mutation_p.R98S	NM_020879	NP_065930	Q8IYE0	CC146_HUMAN	coiled-coil domain containing 146	352										ovary(1)|central_nervous_system(1)	2		all_cancers(73;0.128)|all_lung(88;0.0986)|all_epithelial(88;0.163)|Myeloproliferative disorder(862;0.205)				TGAACTTTCTCGTAAGCAAAG	0.403													6	105	---	---	---	---	PASS
PCLO	27445	broad.mit.edu	37	7	82545331	82545331	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:82545331C>A	uc003uhx.2	-	7	12260	c.11971G>T	c.(11971-11973)GTT>TTT	p.V3991F	PCLO_uc003uhv.2_Missense_Mutation_p.V3991F|PCLO_uc010lec.2_Missense_Mutation_p.V956F	NM_033026	NP_149015	Q9Y6V0	PCLO_HUMAN	piccolo isoform 1	3922					cytoskeleton organization|synaptic vesicle exocytosis	cell junction|cytoskeleton|synaptic vesicle	calcium ion binding|calcium-dependent phospholipid binding|profilin binding|transporter activity			ovary(7)	7						TCCGTAGAAACAGGTGCTATC	0.413													10	315	---	---	---	---	PASS
ABCB4	5244	broad.mit.edu	37	7	87081012	87081012	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:87081012C>G	uc003uiv.1	-	7	711	c.635G>C	c.(634-636)AGA>ACA	p.R212T	ABCB4_uc003uiw.1_Missense_Mutation_p.R212T|ABCB4_uc003uix.1_Missense_Mutation_p.R212T	NM_018849	NP_061337	P21439	MDR3_HUMAN	ATP-binding cassette, subfamily B, member 4	212	ABC transmembrane type-1 1.|Extracellular (By similarity).				cellular lipid metabolic process	apical plasma membrane|Golgi membrane|integral to plasma membrane|intercellular canaliculus|membrane fraction	ATP binding|xenobiotic-transporting ATPase activity			ovary(4)|skin(1)|pancreas(1)	6	Esophageal squamous(14;0.0058)|all_lung(186;0.201)|Lung NSC(181;0.203)					CTTCCATCCTCTGATGAATCC	0.453													16	57	---	---	---	---	PASS
ZNF804B	219578	broad.mit.edu	37	7	88965209	88965209	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:88965209C>T	uc011khi.1	+	4	3451	c.2913C>T	c.(2911-2913)GGC>GGT	p.G971G		NM_181646	NP_857597	A4D1E1	Z804B_HUMAN	zinc finger protein 804B	971						intracellular	zinc ion binding			ovary(5)|skin(3)|pancreas(2)|upper_aerodigestive_tract(1)	11	all_hematologic(106;0.125)|Lung NSC(181;0.15)|all_lung(186;0.151)		STAD - Stomach adenocarcinoma(171;0.0513)			CACCATCAGGCTGTAACAGAC	0.403										HNSCC(36;0.09)			58	78	---	---	---	---	PASS
C7orf63	79846	broad.mit.edu	37	7	89887459	89887459	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:89887459G>T	uc010lep.2	+	3	479	c.228G>T	c.(226-228)CAG>CAT	p.Q76H	C7orf63_uc003ukf.2_RNA|C7orf63_uc003ukg.2_5'UTR|C7orf63_uc011khj.1_Missense_Mutation_p.Q76H|C7orf63_uc010leo.2_Missense_Mutation_p.Q76H	NM_001039706	NP_001034795	A5D8W1	CG063_HUMAN	hypothetical protein LOC79846 isoform 1	76							binding			ovary(1)	1						AACTGGTACAGTGTTATCAGA	0.259													5	75	---	---	---	---	PASS
PEX1	5189	broad.mit.edu	37	7	92140260	92140260	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:92140260G>T	uc003uly.2	-	8	1681	c.1585C>A	c.(1585-1587)CAA>AAA	p.Q529K	PEX1_uc011khr.1_Missense_Mutation_p.Q321K|PEX1_uc010ley.2_Missense_Mutation_p.Q529K|PEX1_uc011khs.1_Missense_Mutation_p.Q207K|PEX1_uc011kht.1_RNA	NM_000466	NP_000457	O43933	PEX1_HUMAN	peroxin1	529					microtubule-based peroxisome localization|protein import into peroxisome matrix	cytosol|nucleus|peroxisomal membrane	ATP binding|ATPase activity, coupled|protein C-terminus binding|protein complex binding			ovary(1)|central_nervous_system(1)	2	all_cancers(62;9.35e-11)|all_epithelial(64;4.59e-10)|Breast(17;0.00201)|all_lung(186;0.0438)|Lung NSC(181;0.0592)	Breast(660;0.000932)|all_neural(109;0.00391)|Myeloproliferative disorder(862;0.0122)|Ovarian(593;0.023)|Medulloblastoma(109;0.123)	GBM - Glioblastoma multiforme(5;4.06e-06)|STAD - Stomach adenocarcinoma(4;4.51e-05)|all cancers(6;5.32e-05)|LUSC - Lung squamous cell carcinoma(200;0.225)|Lung(22;0.23)			GCTATTACTTGTATTGTAGTC	0.284													6	87	---	---	---	---	PASS
COL1A2	1278	broad.mit.edu	37	7	94042391	94042391	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:94042391C>A	uc003ung.1	+						COL1A2_uc011kib.1_Intron	NM_000089	NP_000080	P08123	CO1A2_HUMAN	alpha 2 type I collagen precursor						axon guidance|blood vessel development|collagen fibril organization|leukocyte migration|odontogenesis|platelet activation|regulation of blood pressure|Rho protein signal transduction|skeletal system development|skin morphogenesis|transforming growth factor beta receptor signaling pathway	collagen type I|extracellular space|plasma membrane	extracellular matrix structural constituent|identical protein binding|platelet-derived growth factor binding|protein binding, bridging		COL1A2/PLAG1(3)	soft_tissue(3)|central_nervous_system(3)|ovary(2)|skin(1)	9	all_cancers(62;2.46e-09)|all_epithelial(64;2.7e-08)		STAD - Stomach adenocarcinoma(171;0.0031)		Collagenase(DB00048)	CATTTTTACTCTAGGGTGATC	0.388										HNSCC(75;0.22)			9	142	---	---	---	---	PASS
LMTK2	22853	broad.mit.edu	37	7	97822171	97822171	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:97822171C>A	uc003upd.1	+	11	2687	c.2394C>A	c.(2392-2394)CTC>CTA	p.L798L		NM_014916	NP_055731	Q8IWU2	LMTK2_HUMAN	lemur tyrosine kinase 2 precursor	798					early endosome to late endosome transport|endocytic recycling|peptidyl-serine phosphorylation|peptidyl-threonine phosphorylation|protein autophosphorylation|receptor recycling|transferrin transport	early endosome|Golgi apparatus|integral to membrane|perinuclear region of cytoplasm|recycling endosome	ATP binding|myosin VI binding|protein phosphatase inhibitor activity|protein serine/threonine kinase activity|protein tyrosine kinase activity			lung(9)|stomach(3)|pancreas(2)|large_intestine(1)|breast(1)	16	all_cancers(62;3.23e-09)|all_epithelial(64;7.65e-10)|Lung NSC(181;0.00902)|all_lung(186;0.0104)|Esophageal squamous(72;0.0125)					ATGTCATGCTCACAGGTGACA	0.498													8	110	---	---	---	---	PASS
TRRAP	8295	broad.mit.edu	37	7	98601960	98601960	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98601960C>A	uc003upp.2	+	67	10624	c.10415C>A	c.(10414-10416)TCG>TAG	p.S3472*	TRRAP_uc011kis.1_Nonsense_Mutation_p.S3443*|TRRAP_uc003upr.2_Nonsense_Mutation_p.S3178*	NM_003496	NP_003487	Q9Y4A5	TRRAP_HUMAN	transformation/transcription domain-associated	3472					histone deubiquitination|histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	NuA4 histone acetyltransferase complex|PCAF complex|STAGA complex|transcription factor TFTC complex	phosphotransferase activity, alcohol group as acceptor|protein binding|transcription cofactor activity			ovary(9)|large_intestine(8)|central_nervous_system(6)|skin(6)|stomach(5)|upper_aerodigestive_tract(1)|lung(1)|liver(1)	37	all_cancers(62;6.96e-09)|all_epithelial(64;4.86e-09)|Lung NSC(181;0.01)|all_lung(186;0.016)|Esophageal squamous(72;0.0274)		STAD - Stomach adenocarcinoma(171;0.215)			AGCAATTTCTCGGCACAGACA	0.478													6	147	---	---	---	---	PASS
ZKSCAN5	23660	broad.mit.edu	37	7	99128838	99128838	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99128838C>A	uc003uqv.2	+	7	1610	c.1486C>A	c.(1486-1488)CAA>AAA	p.Q496K	ZKSCAN5_uc010lfx.2_Missense_Mutation_p.Q496K|ZKSCAN5_uc003uqw.2_Missense_Mutation_p.Q496K|ZKSCAN5_uc003uqx.2_Missense_Mutation_p.Q423K|ZKSCAN5_uc003uqy.2_Missense_Mutation_p.Q232K	NM_145102	NP_659570	Q9Y2L8	ZKSC5_HUMAN	zinc finger with KRAB and SCAN domains 5	496					viral reproduction	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1	all_cancers(62;2.54e-08)|all_epithelial(64;2.55e-09)|Lung NSC(181;0.0053)|all_lung(186;0.00895)|Esophageal squamous(72;0.0166)					AAATGTTTCTCAAGTTCAAGA	0.363													9	252	---	---	---	---	PASS
PCOLCE	5118	broad.mit.edu	37	7	100201832	100201832	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100201832C>A	uc003uvo.2	+	3	653	c.455C>A	c.(454-456)TCG>TAG	p.S152*	uc011kjy.1_5'Flank|PCOLCE_uc011kkb.1_Nonsense_Mutation_p.S152*|PCOLCE_uc010lhb.1_Intron|PCOLCE_uc003uvp.1_5'Flank	NM_002593	NP_002584	Q15113	PCOC1_HUMAN	procollagen C-endopeptidase enhancer	152					multicellular organismal development	extracellular space	collagen binding|heparin binding|peptidase activator activity				0	Lung NSC(181;0.0261)|all_lung(186;0.0392)|Esophageal squamous(72;0.0439)					CGGGCCACCTCGGGCACTGGT	0.522													4	31	---	---	---	---	PASS
MUC17	140453	broad.mit.edu	37	7	100677874	100677874	+	Silent	SNP	G	T	T	rs147962629	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100677874G>T	uc003uxp.1	+	3	3230	c.3177G>T	c.(3175-3177)ACG>ACT	p.T1059T	MUC17_uc010lho.1_RNA	NM_001040105	NP_001035194	Q685J3	MUC17_HUMAN	mucin 17 precursor	1059	Extracellular (Potential).|Ser-rich.|59 X approximate tandem repeats.|15.					extracellular region|integral to membrane|plasma membrane	extracellular matrix constituent, lubricant activity			ovary(14)|skin(8)|breast(3)|lung(2)	27	Lung NSC(181;0.136)|all_lung(186;0.182)					GTTCTGAAACGAGCACACTTT	0.502													7	221	---	---	---	---	PASS
MUC17	140453	broad.mit.edu	37	7	100681823	100681823	+	Missense_Mutation	SNP	G	C	C	rs147490705	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100681823G>C	uc003uxp.1	+	3	7179	c.7126G>C	c.(7126-7128)GGT>CGT	p.G2376R	MUC17_uc010lho.1_RNA	NM_001040105	NP_001035194	Q685J3	MUC17_HUMAN	mucin 17 precursor	2376	Extracellular (Potential).|59 X approximate tandem repeats.|38.|Ser-rich.					extracellular region|integral to membrane|plasma membrane	extracellular matrix constituent, lubricant activity			ovary(14)|skin(8)|breast(3)|lung(2)	27	Lung NSC(181;0.136)|all_lung(186;0.182)					TTCTCAAGCCGGTTCATCTCC	0.488													4	166	---	---	---	---	PASS
PLOD3	8985	broad.mit.edu	37	7	100855549	100855549	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:100855549G>T	uc003uyd.2	-	10	1568	c.1112C>A	c.(1111-1113)GCC>GAC	p.A371D	PLOD3_uc010lhs.2_5'UTR	NM_001084	NP_001075	O60568	PLOD3_HUMAN	procollagen-lysine, 2-oxoglutarate 5-dioxygenase	371					protein modification process	rough endoplasmic reticulum membrane	iron ion binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|procollagen-lysine 5-dioxygenase activity|protein binding			ovary(1)|skin(1)	2	Lung NSC(181;0.168)|all_lung(186;0.215)				Succinic acid(DB00139)|Vitamin C(DB00126)	CATGTCCCTGGCCTCGCCTGG	0.662													5	54	---	---	---	---	PASS
NRCAM	4897	broad.mit.edu	37	7	107830082	107830082	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:107830082C>A	uc003vfb.2	-						NRCAM_uc003vfc.2_Intron|NRCAM_uc011kmk.1_Intron|NRCAM_uc003vfd.2_Intron|NRCAM_uc003vfe.2_Intron	NM_001037132	NP_001032209	Q92823	NRCAM_HUMAN	neuronal cell adhesion molecule isoform A						angiogenesis|axon guidance|axonal fasciculation|cell-cell adhesion|central nervous system development|clustering of voltage-gated sodium channels|neuron migration|positive regulation of neuron differentiation|regulation of axon extension|synapse assembly	external side of plasma membrane|integral to plasma membrane	ankyrin binding			ovary(3)|breast(2)	5						CAAATAATACCACATACTTGT	0.408													6	65	---	---	---	---	PASS
MET	4233	broad.mit.edu	37	7	116380911	116380911	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:116380911G>T	uc003vij.2	+	5	1720	c.1533G>T	c.(1531-1533)ACG>ACT	p.T511T	MET_uc010lkh.2_Silent_p.T511T|MET_uc011knc.1_Silent_p.T511T|MET_uc011knd.1_Silent_p.T511T|MET_uc011kne.1_Intron|MET_uc011knf.1_Silent_p.T511T|MET_uc011kng.1_Silent_p.T511T|MET_uc011knh.1_Silent_p.T511T|MET_uc011kni.1_Silent_p.T511T|MET_uc011knj.1_Silent_p.T81T|MET_uc011knb.1_Silent_p.T511T	NM_000245	NP_000236	P08581	MET_HUMAN	met proto-oncogene isoform b precursor	511	Extracellular (Potential).|Sema.				axon guidance|cell proliferation	basal plasma membrane|integral to plasma membrane	ATP binding|hepatocyte growth factor receptor activity|protein binding			upper_aerodigestive_tract(63)|lung(41)|kidney(18)|NS(10)|ovary(5)|thyroid(4)|central_nervous_system(4)|stomach(3)|liver(3)|pleura(2)|large_intestine(2)|breast(2)|testis(1)|skin(1)	159	all_cancers(3;1.25e-07)|all_epithelial(6;4.07e-08)|Lung NSC(10;0.00108)|all_lung(10;0.00125)	Ovarian(593;0.133)	GBM - Glioblastoma multiforme(2;2.31e-07)|all cancers(2;0.000419)|STAD - Stomach adenocarcinoma(10;0.000512)			CACAGATCACGAAGATCCCAT	0.443			Mis		papillary renal|head-neck squamous cell 	papillary renal			Hereditary_Papillary_Renal_Carcinoma_(type_1)				5	103	---	---	---	---	PASS
ASB15	142685	broad.mit.edu	37	7	123270074	123270074	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:123270074C>A	uc003vku.1	+	11	1787	c.1495C>A	c.(1495-1497)CGT>AGT	p.R499S	ASB15_uc003vkw.1_Missense_Mutation_p.R499S	NM_080928	NP_563616	Q8WXK1	ASB15_HUMAN	ankyrin repeat and SOCS box-containing 15	499					intracellular signal transduction					skin(2)|lung(1)	3						CAGAGTTACTCGTGTACTAAT	0.358													7	135	---	---	---	---	PASS
SPAM1	6677	broad.mit.edu	37	7	123593690	123593690	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:123593690G>A	uc003vld.2	+	4	468	c.66G>A	c.(64-66)CAG>CAA	p.Q22Q	SPAM1_uc003vle.2_Silent_p.Q22Q|SPAM1_uc011koa.1_5'Flank|SPAM1_uc003vlf.3_Silent_p.Q22Q|SPAM1_uc010lku.2_Silent_p.Q22Q	NM_153189	NP_694859	P38567	HYALP_HUMAN	sperm adhesion molecule 1 isoform 2	22					binding of sperm to zona pellucida|carbohydrate metabolic process|cell adhesion|fusion of sperm to egg plasma membrane	anchored to membrane|plasma membrane	hyalurononglucosaminidase activity			ovary(3)|kidney(1)	4					Hyaluronidase(DB00070)	GAGTATCCCAGATAGTTTTCA	0.393													14	36	---	---	---	---	PASS
CALU	813	broad.mit.edu	37	7	128399070	128399070	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:128399070C>A	uc003vns.2	+	4	713	c.561C>A	c.(559-561)TAC>TAA	p.Y187*	CALU_uc003vnq.2_Nonsense_Mutation_p.Y187*|CALU_uc003vnr.2_Nonsense_Mutation_p.Y187*	NM_001130674	NP_001124146	O43852	CALU_HUMAN	calumenin isoform b precursor	187					platelet activation|platelet degranulation	extracellular region|Golgi apparatus|melanosome|sarcoplasmic reticulum lumen	calcium ion binding|protein binding				0						AGTATGACTACATGAAAGATA	0.448													8	140	---	---	---	---	PASS
KLHDC10	23008	broad.mit.edu	37	7	129769365	129769365	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:129769365C>A	uc003vpj.1	+	9	1203	c.1068C>A	c.(1066-1068)CTC>CTA	p.L356L	KLHDC10_uc003vpk.1_Silent_p.L327L|KLHDC10_uc010lmb.1_Silent_p.L253L	NM_014997	NP_055812	Q6PID8	KLD10_HUMAN	kelch domain containing 10	356	Kelch 5.										0						GGGTGAAGCTCCCAGCTACCA	0.398													6	75	---	---	---	---	PASS
PLXNA4	91584	broad.mit.edu	37	7	131848963	131848963	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:131848963C>T	uc003vra.3	-	24	4667	c.4438G>A	c.(4438-4440)GAG>AAG	p.E1480K		NM_020911	NP_065962	Q9HCM2	PLXA4_HUMAN	plexin A4 isoform 1	1480	Cytoplasmic (Potential).					integral to membrane|intracellular|plasma membrane				ovary(1)	1						TAGCGGGCCTCGCCCGTGATG	0.592													9	21	---	---	---	---	PASS
KIAA1549	57670	broad.mit.edu	37	7	138603934	138603934	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138603934C>A	uc011kql.1	-	2	487	c.438G>T	c.(436-438)ACG>ACT	p.T146T	KIAA1549_uc003vuk.3_Silent_p.T96T|KIAA1549_uc011kqj.1_Silent_p.T146T	NM_020910	NP_065961	Q9HCM3	K1549_HUMAN	hypothetical protein LOC57670 isoform 1	146						integral to membrane			KIAA1549/BRAF(229)	central_nervous_system(229)|pancreas(1)	230						CCTCTTTACTCGTCACTGACA	0.453			O	BRAF	pilocytic astrocytoma								8	180	---	---	---	---	PASS
TTC26	79989	broad.mit.edu	37	7	138874078	138874078	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:138874078G>T	uc003vus.2	+	18	1679	c.1565G>T	c.(1564-1566)CGA>CTA	p.R522L	TTC26_uc011kqn.1_Silent_p.S477S|TTC26_uc011kqo.1_Missense_Mutation_p.R491L|TTC26_uc011kqp.1_Missense_Mutation_p.R417L|TTC26_uc003vut.2_Missense_Mutation_p.R382L|TTC26_uc011kqq.1_Missense_Mutation_p.R391L	NM_024926	NP_079202	A0AVF1	TTC26_HUMAN	tetratricopeptide repeat domain 26 isoform 1	522							binding			ovary(1)	1						GAGACCCTTCGAGAAGTGCTC	0.363													6	227	---	---	---	---	PASS
TBXAS1	6916	broad.mit.edu	37	7	139611111	139611111	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:139611111C>A	uc011kqv.1	+	4	491	c.327C>A	c.(325-327)ACC>ACA	p.T109T	TBXAS1_uc003vvh.2_Silent_p.T109T|TBXAS1_uc010lne.2_Silent_p.T41T|TBXAS1_uc011kqu.1_Silent_p.T60T|TBXAS1_uc003vvi.2_Silent_p.T109T|TBXAS1_uc003vvj.2_Silent_p.T109T|TBXAS1_uc011kqw.1_Silent_p.T89T|TBXAS1_uc011kqx.1_Silent_p.T109T	NM_001130966	NP_001124438	P24557	THAS_HUMAN	thromboxane A synthase 1, platelet isoform	108	Cytoplasmic (Potential).				hormone biosynthetic process|prostaglandin biosynthetic process|xenobiotic metabolic process	endoplasmic reticulum lumen|endoplasmic reticulum membrane|integral to membrane	electron carrier activity|heme binding|monooxygenase activity|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen|thromboxane-A synthase activity			ovary(2)|breast(1)	3	Melanoma(164;0.0142)					GTAACTTTACCAACAGAATGG	0.433													7	90	---	---	---	---	PASS
ADCK2	90956	broad.mit.edu	37	7	140373931	140373931	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:140373931C>A	uc003vvy.1	+	1	979	c.801C>A	c.(799-801)CTC>CTA	p.L267L	ADCK2_uc003vvz.2_Silent_p.L267L	NM_052853	NP_443085	Q7Z695	ADCK2_HUMAN	aarF domain containing kinase 2	267	Protein kinase.					integral to membrane	ATP binding|protein serine/threonine kinase activity				0	Melanoma(164;0.00956)					CAGAAAATCTCGCAGACCAGT	0.577													4	35	---	---	---	---	PASS
WEE2	494551	broad.mit.edu	37	7	141408871	141408871	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:141408871C>A	uc003vwn.2	+	1	719	c.313C>A	c.(313-315)CTG>ATG	p.L105M	FLJ40852_uc011krh.1_Intron|FLJ40852_uc010lnm.2_Intron|FLJ40852_uc010lnn.2_Intron|FLJ40852_uc003vwm.3_Intron|FLJ40852_uc010lno.2_Intron	NM_001105558	NP_001099028	P0C1S8	WEE2_HUMAN	WEE1 homolog 2	105					egg activation|female meiosis|female pronucleus assembly|meiotic metaphase II|meiotic prophase I|mitosis|negative regulation of oocyte development|regulation of meiosis I	centrosome|nucleus	ATP binding|magnesium ion binding|non-membrane spanning protein tyrosine kinase activity|protein serine/threonine kinase activity			ovary(1)|stomach(1)	2	Melanoma(164;0.0171)					GAGCAAGCTGCTGCCCAGTGA	0.517													30	32	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	7	142028424	142028424	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142028424G>T	uc011kro.1	+						uc011krp.1_Intron|uc011krr.1_Intron|uc003vxl.1_RNA					SubName: Full=V_segment translation product; Flags: Fragment;																		TCCATGTACTGGTATCGACAA	0.498													8	82	---	---	---	---	PASS
ZYX	7791	broad.mit.edu	37	7	143079679	143079679	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:143079679C>A	uc003wcw.2	+						ZYX_uc011ktd.1_Intron|ZYX_uc003wcx.2_Intron|ZYX_uc011kte.1_Intron|ZYX_uc011ktf.1_Intron	NM_001010972	NP_001010972	Q15942	ZYX_HUMAN	zyxin						cell adhesion|cell-cell signaling|interspecies interaction between organisms|signal transduction	cell-cell adherens junction|cytoplasm|focal adhesion|integral to plasma membrane|nucleus|stress fiber	protein binding|zinc ion binding				0	Melanoma(164;0.205)					GACCTCTGACCCTCTAGCCCA	0.552													8	116	---	---	---	---	PASS
CNTNAP2	26047	broad.mit.edu	37	7	146818203	146818203	+	Missense_Mutation	SNP	T	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:146818203T>G	uc003weu.1	+	6	1403	c.887T>G	c.(886-888)ATG>AGG	p.M296R		NM_014141	NP_054860	Q9UHC6	CNTP2_HUMAN	cell recognition molecule Caspr2 precursor	296	Laminin G-like 1.|Extracellular (Potential).				behavior|cell adhesion|clustering of voltage-gated potassium channels|limbic system development|neuron recognition|signal transduction|striatum development|superior temporal gyrus development|thalamus development|transmission of nerve impulse	axolemma|cell body fiber|dendrite|juxtaparanode region of axon|voltage-gated potassium channel complex	receptor binding			ovary(9)|central_nervous_system(1)|pancreas(1)	11	Melanoma(164;0.153)	all_cancers(3;3.51e-10)|all_epithelial(3;1.4e-05)|Myeloproliferative disorder(3;0.00452)|Lung NSC(3;0.0067)|all_lung(3;0.00794)	OV - Ovarian serous cystadenocarcinoma(82;0.0319)			GACAGGAGCATGCAGCACTTC	0.478										HNSCC(39;0.1)			10	33	---	---	---	---	PASS
CNTNAP2	26047	broad.mit.edu	37	7	147259238	147259238	+	Nonsense_Mutation	SNP	G	T	T	rs141064983	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:147259238G>T	uc003weu.1	+	12	2302	c.1786G>T	c.(1786-1788)GAG>TAG	p.E596*		NM_014141	NP_054860	Q9UHC6	CNTP2_HUMAN	cell recognition molecule Caspr2 precursor	596	Extracellular (Potential).|Fibrinogen C-terminal.				behavior|cell adhesion|clustering of voltage-gated potassium channels|limbic system development|neuron recognition|signal transduction|striatum development|superior temporal gyrus development|thalamus development|transmission of nerve impulse	axolemma|cell body fiber|dendrite|juxtaparanode region of axon|voltage-gated potassium channel complex	receptor binding			ovary(9)|central_nervous_system(1)|pancreas(1)	11	Melanoma(164;0.153)	all_cancers(3;3.51e-10)|all_epithelial(3;1.4e-05)|Myeloproliferative disorder(3;0.00452)|Lung NSC(3;0.0067)|all_lung(3;0.00794)	OV - Ovarian serous cystadenocarcinoma(82;0.0319)			AGCTATCTACGAGCCTTCCTG	0.448										HNSCC(39;0.1)			4	46	---	---	---	---	PASS
CNTNAP2	26047	broad.mit.edu	37	7	147336352	147336352	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:147336352G>T	uc003weu.1	+	13	2568	c.2052G>T	c.(2050-2052)CAG>CAT	p.Q684H		NM_014141	NP_054860	Q9UHC6	CNTP2_HUMAN	cell recognition molecule Caspr2 precursor	684	Extracellular (Potential).|Fibrinogen C-terminal.				behavior|cell adhesion|clustering of voltage-gated potassium channels|limbic system development|neuron recognition|signal transduction|striatum development|superior temporal gyrus development|thalamus development|transmission of nerve impulse	axolemma|cell body fiber|dendrite|juxtaparanode region of axon|voltage-gated potassium channel complex	receptor binding			ovary(9)|central_nervous_system(1)|pancreas(1)	11	Melanoma(164;0.153)	all_cancers(3;3.51e-10)|all_epithelial(3;1.4e-05)|Myeloproliferative disorder(3;0.00452)|Lung NSC(3;0.0067)|all_lung(3;0.00794)	OV - Ovarian serous cystadenocarcinoma(82;0.0319)			ACTGCGAGCAGTATGTCTCCT	0.463										HNSCC(39;0.1)			4	25	---	---	---	---	PASS
GIMAP7	168537	broad.mit.edu	37	7	150217741	150217741	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:150217741C>A	uc003whk.2	+	2	809	c.679C>A	c.(679-681)CAA>AAA	p.Q227K		NM_153236	NP_694968	Q8NHV1	GIMA7_HUMAN	GTPase, IMAP family member 7	227							GTP binding			pancreas(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(82;0.0218)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)		CTACACTGACCAATTAAATGA	0.323													7	93	---	---	---	---	PASS
MLL3	58508	broad.mit.edu	37	7	151880108	151880108	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:151880108G>T	uc003wla.2	-	35	5435	c.5216C>A	c.(5215-5217)CCT>CAT	p.P1739H	MLL3_uc003wkz.2_Missense_Mutation_p.P800H	NM_170606	NP_733751	Q8NEZ4	MLL3_HUMAN	myeloid/lymphoid or mixed-lineage leukemia 3	1739	Gln-rich.				intracellular signal transduction|regulation of transcription, DNA-dependent|transcription, DNA-dependent		DNA binding|protein binding|zinc ion binding			large_intestine(27)|pancreas(13)|ovary(9)|central_nervous_system(8)|breast(3)|upper_aerodigestive_tract(1)|urinary_tract(1)|skin(1)	63	all_neural(206;0.187)	all_hematologic(28;0.0592)|Prostate(32;0.0906)	OV - Ovarian serous cystadenocarcinoma(82;0.00715)	UCEC - Uterine corpus endometrioid carcinoma (81;0.0597)|BRCA - Breast invasive adenocarcinoma(188;0.0462)		TTGCTTTAAAGGATCTTTAAA	0.338			N		medulloblastoma								9	201	---	---	---	---	PASS
DNAJB6	10049	broad.mit.edu	37	7	157177706	157177706	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:157177706C>A	uc003wnk.2	+						DNAJB6_uc003wnj.2_Intron|DNAJB6_uc003wnl.2_Intron|DNAJB6_uc011kvy.1_Intron|DNAJB6_uc011kvz.1_Intron|DNAJB6_uc010lqt.2_Intron	NM_058246	NP_490647	O75190	DNJB6_HUMAN	DnaJ (Hsp40) homolog, subfamily B, member 6						intermediate filament organization|negative regulation of caspase activity|protein folding|response to unfolded protein	nucleus|perinuclear region of cytoplasm	ATPase activator activity|chaperone binding|heat shock protein binding|unfolded protein binding			ovary(2)	2	all_neural(206;0.181)	all_epithelial(9;0.000606)|all_hematologic(28;0.00287)|Acute lymphoblastic leukemia(9;0.0647)|Ovarian(593;0.196)	OV - Ovarian serous cystadenocarcinoma(82;0.00399)	UCEC - Uterine corpus endometrioid carcinoma (81;0.172)		CAAAGAGGTACTGTGGTATTC	0.413													6	50	---	---	---	---	PASS
CSMD1	64478	broad.mit.edu	37	8	3165276	3165276	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:3165276C>A	uc011kwk.1	-	25	4284	c.3894G>T	c.(3892-3894)CCG>CCT	p.P1298P	CSMD1_uc011kwj.1_Silent_p.P690P|CSMD1_uc003wqe.2_Silent_p.P454P	NM_033225	NP_150094	Q96PZ7	CSMD1_HUMAN	CUB and Sushi multiple domains 1 precursor	1298	Extracellular (Potential).|CUB 8.					integral to membrane				breast(20)|large_intestine(5)	25		all_cancers(1;5.7e-41)|all_epithelial(1;2.54e-36)|Lung NSC(1;7.54e-11)|all_lung(1;3.2e-10)|Hepatocellular(1;3.78e-05)|Breast(1;0.000196)|Myeloproliferative disorder(4;0.000374)|Esophageal squamous(1;0.0157)|Ovarian(12;0.091)|Renal(68;0.144)|Colorectal(14;0.234)		all cancers(1;5.03e-41)|Epithelial(1;4.78e-31)|Lung(1;1.14e-14)|LUSC - Lung squamous cell carcinoma(1;2.34e-14)|GBM - Glioblastoma multiforme(1;4.49e-10)|Colorectal(4;1.18e-07)|OV - Ovarian serous cystadenocarcinoma(1;3.2e-07)|BRCA - Breast invasive adenocarcinoma(1;6.17e-07)|COAD - Colon adenocarcinoma(4;0.000539)|READ - Rectum adenocarcinoma(4;0.00896)|Kidney(5;0.00957)|KIRC - Kidney renal clear cell carcinoma(5;0.0689)		TGTTGTCATACGGAGCTGGAT	0.468													5	91	---	---	---	---	PASS
MCPH1	79648	broad.mit.edu	37	8	6289033	6289033	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:6289033G>T	uc003wqi.2	+	4	315	c.247G>T	c.(247-249)GGA>TGA	p.G83*	MCPH1_uc003wqh.2_Nonsense_Mutation_p.G83*|MCPH1_uc011kwl.1_Nonsense_Mutation_p.G83*	NM_024596	NP_078872	Q8NEM0	MCPH1_HUMAN	microcephalin	83	BRCT 1.					microtubule organizing center				central_nervous_system(1)|skin(1)	2		Hepatocellular(245;0.0663)		Colorectal(4;0.0505)		CAGGACAGCTGGAGCACACAT	0.318													7	126	---	---	---	---	PASS
EFHA2	286097	broad.mit.edu	37	8	16921702	16921702	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:16921702C>A	uc003wxd.2	+	2	533	c.491C>A	c.(490-492)ACT>AAT	p.T164N		NM_181723	NP_859074	Q86XE3	EFHA2_HUMAN	EF-hand domain family, member A2	164						integral to membrane	calcium ion binding			skin(1)	1				Colorectal(111;0.0686)|COAD - Colon adenocarcinoma(73;0.239)		TTATTCATGACTCCGTATGAT	0.353													6	100	---	---	---	---	PASS
NAT2	10	broad.mit.edu	37	8	18258273	18258273	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:18258273G>T	uc003wyw.1	+	2	867	c.760G>T	c.(760-762)GAG>TAG	p.E254*		NM_000015	NP_000006	P11245	ARY2_HUMAN	N-acetyltransferase 2	254					xenobiotic metabolic process	cytosol	arylamine N-acetyltransferase activity			ovary(1)|skin(1)	2				Colorectal(111;0.0531)|COAD - Colon adenocarcinoma(73;0.21)		AGATCTGGTCGAGTTTAAAAC	0.408									Naso-/Oropharyngeal/Laryngeal_Cancer_Familial_Clustering_of				5	66	---	---	---	---	PASS
HR	55806	broad.mit.edu	37	8	21984736	21984736	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:21984736G>T	uc003xas.2	-	3	1884	c.1219C>A	c.(1219-1221)CGG>AGG	p.R407R	HR_uc003xat.2_Silent_p.R407R	NM_005144	NP_005135	O43593	HAIR_HUMAN	hairless protein isoform a	407							DNA binding|metal ion binding|sequence-specific DNA binding transcription factor activity			large_intestine(1)|ovary(1)	2		Breast(100;0.000162)|Acute lymphoblastic leukemia(644;0.0775)|Prostate(55;0.116)		KIRC - Kidney renal clear cell carcinoma(542;1.19e-05)|BRCA - Breast invasive adenocarcinoma(99;3.56e-05)|Colorectal(74;0.00191)|COAD - Colon adenocarcinoma(73;0.0615)|READ - Rectum adenocarcinoma(644;0.1)		GCCCGGAGCCGAGCAACCGGC	0.652													4	44	---	---	---	---	PASS
EGR3	1960	broad.mit.edu	37	8	22548495	22548495	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:22548495G>C	uc003xcm.1	-	2	1013	c.655C>G	c.(655-657)CGG>GGG	p.R219G	EGR3_uc011kzn.1_Missense_Mutation_p.R181G|EGR3_uc011kzo.1_Missense_Mutation_p.R165G	NM_004430	NP_004421	Q06889	EGR3_HUMAN	early growth response 3	219					circadian rhythm|muscle organ development	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		Prostate(55;0.0421)|Breast(100;0.102)		Colorectal(74;0.0145)|BRCA - Breast invasive adenocarcinoma(99;0.053)|COAD - Colon adenocarcinoma(73;0.0608)		GGGTTGACCCGGATGGGGTCC	0.602													9	36	---	---	---	---	PASS
NEFM	4741	broad.mit.edu	37	8	24771448	24771448	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:24771448G>T	uc003xed.3	+	1	175	c.142G>T	c.(142-144)GTG>TTG	p.V48L	NEFM_uc011lac.1_Missense_Mutation_p.V48L|NEFM_uc010lue.2_5'Flank|uc010luc.1_3'UTR	NM_005382	NP_005373	P07197	NFM_HUMAN	neurofilament, medium polypeptide 150kDa isoform	48	Head.					neurofilament	protein binding|structural constituent of cytoskeleton			breast(1)	1		Prostate(55;0.157)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0197)|Epithelial(17;2.44e-10)|Colorectal(74;0.0108)|COAD - Colon adenocarcinoma(73;0.0375)		GCCCAGCACCGTGTCCTCCTC	0.692													4	17	---	---	---	---	PASS
RBPMS	11030	broad.mit.edu	37	8	30332342	30332342	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:30332342G>T	uc003xic.1	+	2	779	c.114G>T	c.(112-114)CGG>CGT	p.R38R	RBPMS_uc003xid.1_Silent_p.R38R|RBPMS_uc003xie.1_Silent_p.R38R|RBPMS_uc003xif.1_5'Flank|RBPMS_uc011lba.1_Silent_p.R38R|RBPMS_uc003xib.2_Silent_p.R38R|RBPMS_uc010lvh.1_5'UTR	NM_006867	NP_006858	Q93062	RBPMS_HUMAN	RNA-binding protein with multiple splicing	38	RRM.				positive regulation of pathway-restricted SMAD protein phosphorylation|positive regulation of SMAD protein import into nucleus|regulation of transcription, DNA-dependent|RNA processing|transcription, DNA-dependent	cytoplasm|nucleus	nucleotide binding|poly(A) RNA binding|protein binding|transcription coactivator activity			ovary(1)	1				KIRC - Kidney renal clear cell carcinoma(542;0.144)|Kidney(114;0.172)		TCAAACCTCGGGAGCTCTATC	0.398													7	148	---	---	---	---	PASS
GPR124	25960	broad.mit.edu	37	8	37697062	37697062	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:37697062G>T	uc003xkj.2	+	16	2796	c.2433G>T	c.(2431-2433)TTG>TTT	p.L811F	GPR124_uc010lvy.2_Missense_Mutation_p.L594F	NM_032777	NP_116166	Q96PE1	GP124_HUMAN	G protein-coupled receptor 124 precursor	811	Helical; Name=2; (Potential).				central nervous system development|endothelial cell migration|neuropeptide signaling pathway|regulation of angiogenesis|regulation of chemotaxis|sprouting angiogenesis	integral to membrane|plasma membrane	G-protein coupled receptor activity			large_intestine(2)|ovary(2)|skin(1)	5			BRCA - Breast invasive adenocarcinoma(5;2.75e-24)|LUSC - Lung squamous cell carcinoma(8;3.5e-10)			TGCTGAACTTGTGCTTCCACA	0.582													4	21	---	---	---	---	PASS
RAB11FIP1	80223	broad.mit.edu	37	8	37732086	37732086	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:37732086C>A	uc003xkm.1	-	3	1613	c.1569G>T	c.(1567-1569)CCG>CCT	p.P523P	RAB11FIP1_uc010lvz.1_Silent_p.P371P|RAB11FIP1_uc003xkn.1_Silent_p.P523P|RAB11FIP1_uc003xkl.1_5'Flank|RAB11FIP1_uc003xko.1_5'Flank|RAB11FIP1_uc003xkp.1_Silent_p.P371P	NM_001002814	NP_001002814	Q6WKZ4	RFIP1_HUMAN	RAB11 family interacting protein 1 isoform 3	523					protein transport	centrosome|phagocytic vesicle membrane|recycling endosome	protein binding			ovary(1)|central_nervous_system(1)|skin(1)	3		Lung NSC(58;0.118)|all_lung(54;0.195)	LUSC - Lung squamous cell carcinoma(8;3.62e-11)			TTGGAGGTCTCGGTTCAGACT	0.552													5	62	---	---	---	---	PASS
PLEKHA2	59339	broad.mit.edu	37	8	38810819	38810819	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:38810819G>T	uc003xmi.3	+	9	941	c.707G>T	c.(706-708)CGA>CTA	p.R236L	PLEKHA2_uc011lce.1_Missense_Mutation_p.R186L	NM_021623	NP_067636	Q9HB19	PKHA2_HUMAN	pleckstrin homology domain containing, family A	236	PH 2.				positive regulation of cell-matrix adhesion	cytoplasm|nucleus|plasma membrane|protein complex	fibronectin binding|laminin binding				0		all_lung(54;0.0413)|Lung NSC(58;0.115)|Hepatocellular(245;0.152)	LUSC - Lung squamous cell carcinoma(45;4.68e-08)|COAD - Colon adenocarcinoma(9;0.235)			CACCAGGACCGAGAACCACTG	0.463													6	117	---	---	---	---	PASS
ADAM2	2515	broad.mit.edu	37	8	39627087	39627087	+	Missense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:39627087T>A	uc003xnj.2	-	12	1111	c.1036A>T	c.(1036-1038)AGT>TGT	p.S346C	ADAM2_uc003xnk.2_Missense_Mutation_p.S327C|ADAM2_uc011lck.1_Missense_Mutation_p.S346C|ADAM2_uc003xnl.2_Missense_Mutation_p.S220C	NM_001464	NP_001455	Q99965	ADAM2_HUMAN	ADAM metallopeptidase domain 2 proprotein	346	Extracellular (Potential).|Peptidase M12B.				cell adhesion|fusion of sperm to egg plasma membrane|proteolysis	integral to plasma membrane	integrin binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)	2		all_cancers(7;2.38e-28)|all_epithelial(6;8.85e-21)|all_lung(54;1.24e-07)|Lung NSC(58;1.94e-07)|Hepatocellular(245;0.00745)|Breast(189;0.00908)|Renal(179;0.0183)|Colorectal(162;0.246)	LUSC - Lung squamous cell carcinoma(45;0.000149)	READ - Rectum adenocarcinoma(644;0.0689)|Kidney(114;0.162)		TTCACACCACTGAAATGACTA	0.383													6	19	---	---	---	---	PASS
NKAIN3	286183	broad.mit.edu	37	8	63492131	63492131	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:63492131C>A	uc010lyq.1	+	2	220	c.88C>A	c.(88-90)CTT>ATT	p.L30I		NM_173688	NP_775959	Q8N8D7	NKAI3_HUMAN	Na+/K+ transporting ATPase interacting 3	30						integral to membrane|plasma membrane					0	Breast(64;0.127)	Lung NSC(129;0.187)				CTTTGACTTCCTTGGTTTCCA	0.363													9	172	---	---	---	---	PASS
PDE7A	5150	broad.mit.edu	37	8	66639131	66639131	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:66639131G>T	uc003xvq.2	-	9	911	c.899C>A	c.(898-900)TCA>TAA	p.S300*	PDE7A_uc003xvr.2_Nonsense_Mutation_p.S300*|PDE7A_uc003xvp.2_Nonsense_Mutation_p.S274*	NM_002604	NP_002595	Q13946	PDE7A_HUMAN	phosphodiesterase 7A isoform b	300	Catalytic (By similarity).					cell fraction|cytosol	3',5'-cyclic-AMP phosphodiesterase activity|metal ion binding				0			Epithelial(68;0.0509)|BRCA - Breast invasive adenocarcinoma(89;0.111)|all cancers(69;0.168)|OV - Ovarian serous cystadenocarcinoma(28;0.238)		Dyphylline(DB00651)|Ketotifen(DB00920)	TGGCAGATGTGAGAATAAGCC	0.348													8	194	---	---	---	---	PASS
CSPP1	79848	broad.mit.edu	37	8	67998343	67998343	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:67998343C>A	uc003xxi.2	+	4	440	c.409C>A	c.(409-411)CAG>AAG	p.Q137K	CSPP1_uc003xxg.1_Missense_Mutation_p.Q137K|CSPP1_uc003xxh.1_RNA|CSPP1_uc003xxj.2_Missense_Mutation_p.Q137K|CSPP1_uc003xxk.2_5'UTR	NM_001077204	NP_001070672	Q1MSJ5	CSPP1_HUMAN	centrosome spindle pole associated protein 1	137						centrosome|microtubule|spindle				ovary(3)|breast(2)	5	Breast(64;0.214)	Lung NSC(129;0.0908)|all_lung(136;0.152)	Epithelial(68;0.00145)|OV - Ovarian serous cystadenocarcinoma(28;0.00589)|all cancers(69;0.0069)|BRCA - Breast invasive adenocarcinoma(89;0.153)			TTATCTTACTCAGGTAATGAG	0.303													7	120	---	---	---	---	PASS
TRAM1	23471	broad.mit.edu	37	8	71495456	71495456	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:71495456G>A	uc003xyo.1	-	10	1164	c.994C>T	c.(994-996)CCA>TCA	p.P332S	TRAM1_uc011lfc.1_Missense_Mutation_p.P301S	NM_014294	NP_055109	Q15629	TRAM1_HUMAN	translocation associated membrane protein 1	332	Cytoplasmic (Potential).				cotranslational protein targeting to membrane|transmembrane transport	endoplasmic reticulum membrane|integral to membrane	protein binding|receptor activity			ovary(1)	1			Epithelial(68;0.00679)|all cancers(69;0.0324)|OV - Ovarian serous cystadenocarcinoma(28;0.0509)			TTCACAGCTGGTGCCTGAAAA	0.398													15	45	---	---	---	---	PASS
TRPA1	8989	broad.mit.edu	37	8	72958840	72958840	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:72958840C>A	uc003xza.2	-	17	2144	c.1969G>T	c.(1969-1971)GAG>TAG	p.E657*	uc011lff.1_Intron|uc003xyy.2_Intron	NM_007332	NP_015628	O75762	TRPA1_HUMAN	ankyrin-like protein 1	657	Cytoplasmic (Potential).					integral to plasma membrane				ovary(4)|lung(1)|kidney(1)	6			Epithelial(68;0.223)		Menthol(DB00825)	AAATTATACTCGATCTGTAGA	0.299													5	102	---	---	---	---	PASS
RALYL	138046	broad.mit.edu	37	8	85441608	85441608	+	Missense_Mutation	SNP	T	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:85441608T>G	uc003ycq.3	+	3	468	c.52T>G	c.(52-54)TCC>GCC	p.S18A	RALYL_uc003ycr.3_Missense_Mutation_p.S18A|RALYL_uc003ycs.3_Missense_Mutation_p.S18A|RALYL_uc010lzy.2_Missense_Mutation_p.S18A|RALYL_uc003yct.3_Missense_Mutation_p.S31A	NM_001100392	NP_001093862	Q86SE5	RALYL_HUMAN	RALY RNA binding protein-like isoform 2	18							identical protein binding|nucleotide binding|RNA binding			ovary(1)	1						TGACCCCAAGTCCATCAACTC	0.358													4	16	---	---	---	---	PASS
POP1	10940	broad.mit.edu	37	8	99149137	99149137	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:99149137C>A	uc003yij.3	+	9	1417	c.1317C>A	c.(1315-1317)TCC>TCA	p.S439S	POP1_uc011lgv.1_Silent_p.S439S|POP1_uc003yik.2_Silent_p.S439S	NM_001145860	NP_001139332	Q99575	POP1_HUMAN	processing of precursor 1	439					tRNA 5'-leader removal|tRNA catabolic process	nucleolar ribonuclease P complex|ribonuclease MRP complex	identical protein binding|ribonuclease MRP activity|ribonuclease P activity			ovary(1)|breast(1)	2	Breast(36;1.78e-06)		OV - Ovarian serous cystadenocarcinoma(57;0.145)			GGCCACTTTCCCACTCCATCC	0.383													7	132	---	---	---	---	PASS
RGS22	26166	broad.mit.edu	37	8	101065022	101065022	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101065022C>A	uc003yjb.1	-						RGS22_uc003yja.1_Intron|RGS22_uc003yjc.1_Intron|RGS22_uc011lgz.1_Intron|RGS22_uc010mbo.1_Intron	NM_015668	NP_056483	Q8NE09	RGS22_HUMAN	regulator of G-protein signaling 22						negative regulation of signal transduction	cytoplasm|plasma membrane	GTPase activator activity|signal transducer activity			ovary(3)|skin(2)|breast(1)|central_nervous_system(1)	7			Epithelial(11;6.71e-08)|all cancers(13;4.19e-06)|OV - Ovarian serous cystadenocarcinoma(57;0.000469)|STAD - Stomach adenocarcinoma(118;0.169)			CATGAATGTACACCCTACCTG	0.383													6	91	---	---	---	---	PASS
RNF19A	25897	broad.mit.edu	37	8	101271234	101271234	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101271234C>A	uc003yjj.1	-	11	2384	c.2067G>T	c.(2065-2067)ACG>ACT	p.T689T	RNF19A_uc003yjk.1_Silent_p.T689T	NM_015435	NP_056250	Q9NV58	RN19A_HUMAN	ring finger protein 19	689	Interaction with CASR.				microtubule cytoskeleton organization|protein modification process	centrosome|integral to membrane	ligase activity|transcription factor binding|zinc ion binding			ovary(2)|central_nervous_system(1)|skin(1)	4	all_cancers(14;3.5e-05)|all_epithelial(15;8.91e-08)|Lung NSC(17;0.000615)|all_lung(17;0.00166)		Epithelial(11;3.06e-11)|all cancers(13;5.78e-09)|OV - Ovarian serous cystadenocarcinoma(57;2.24e-05)|STAD - Stomach adenocarcinoma(118;0.0525)			TGTCCTCTCTCGTCTCATTTA	0.423											OREG0018897	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	6	161	---	---	---	---	PASS
PABPC1	26986	broad.mit.edu	37	8	101724590	101724590	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:101724590C>A	uc003yjs.1	-	7	1476	c.972G>T	c.(970-972)AAG>AAT	p.K324N	PABPC1_uc011lhc.1_Missense_Mutation_p.K292N|PABPC1_uc011lhd.1_Missense_Mutation_p.K279N|PABPC1_uc003yjt.1_Missense_Mutation_p.K321N|PABPC1_uc003yju.2_RNA	NM_002568	NP_002559	P11940	PABP1_HUMAN	poly(A) binding protein, cytoplasmic 1	324	RRM 4.				mRNA polyadenylation|mRNA stabilization|negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|nuclear-transcribed mRNA poly(A) tail shortening|translation	catalytic step 2 spliceosome|cytosol	nucleotide binding|poly(A) RNA binding|protein C-terminus binding|translation activator activity				0	all_cancers(14;6.8e-05)|all_epithelial(15;3.16e-07)|Lung NSC(17;0.000453)|all_lung(17;0.00125)		Epithelial(11;6.37e-11)|all cancers(13;1.11e-08)|OV - Ovarian serous cystadenocarcinoma(57;3.91e-05)|STAD - Stomach adenocarcinoma(118;0.206)			GTTTTCTTACCTTTGCACTAG	0.308													10	288	---	---	---	---	PASS
UBR5	51366	broad.mit.edu	37	8	103341406	103341406	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:103341406C>A	uc003ykr.1	-	11	1271	c.1238G>T	c.(1237-1239)CGA>CTA	p.R413L	UBR5_uc003yks.1_Missense_Mutation_p.R413L	NM_015902	NP_056986	O95071	UBR5_HUMAN	ubiquitin protein ligase E3 component n-recognin	413					cell proliferation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of catenin import into nucleus|positive regulation of protein import into nucleus, translocation|progesterone receptor signaling pathway|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|response to DNA damage stimulus	nucleus|soluble fraction	protein binding|RNA binding|ubiquitin-ubiquitin ligase activity|zinc ion binding			lung(16)|ovary(4)|large_intestine(3)|breast(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)	28	all_cancers(14;8e-07)|all_epithelial(15;2.18e-08)|Lung NSC(17;2.55e-05)|all_lung(17;8.85e-05)		OV - Ovarian serous cystadenocarcinoma(57;0.000442)			AAATGTTGCTCGTGGATGATG	0.308													6	202	---	---	---	---	PASS
UBR5	51366	broad.mit.edu	37	8	103359276	103359276	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:103359276G>T	uc003ykr.1	-	6	464	c.431C>A	c.(430-432)TCT>TAT	p.S144Y	UBR5_uc003yks.1_Missense_Mutation_p.S144Y	NM_015902	NP_056986	O95071	UBR5_HUMAN	ubiquitin protein ligase E3 component n-recognin	144					cell proliferation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of catenin import into nucleus|positive regulation of protein import into nucleus, translocation|progesterone receptor signaling pathway|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|response to DNA damage stimulus	nucleus|soluble fraction	protein binding|RNA binding|ubiquitin-ubiquitin ligase activity|zinc ion binding			lung(16)|ovary(4)|large_intestine(3)|breast(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)	28	all_cancers(14;8e-07)|all_epithelial(15;2.18e-08)|Lung NSC(17;2.55e-05)|all_lung(17;8.85e-05)		OV - Ovarian serous cystadenocarcinoma(57;0.000442)			TGACCTACCAGAGGATCCTCC	0.502													9	126	---	---	---	---	PASS
FZD6	8323	broad.mit.edu	37	8	104330888	104330888	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:104330888C>A	uc003ylh.2	+	3	532	c.248C>A	c.(247-249)CCA>CAA	p.P83Q	FZD6_uc003yli.2_Missense_Mutation_p.P83Q|FZD6_uc003ylj.2_Missense_Mutation_p.P83Q|FZD6_uc011lhn.1_Missense_Mutation_p.P49Q|FZD6_uc011lho.1_Intron|FZD6_uc011lhp.1_Missense_Mutation_p.P28Q	NM_003506	NP_003497	O60353	FZD6_HUMAN	frizzled 6 isoform a precursor	83	FZ.|Extracellular (Potential).				angiogenesis|axonogenesis|cell proliferation in midbrain|establishment of planar polarity|G-protein signaling, coupled to cGMP nucleotide second messenger|gonad development|inner ear morphogenesis|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of sequence-specific DNA binding transcription factor activity|neural tube closure|non-canonical Wnt receptor signaling pathway	apical part of cell|apicolateral plasma membrane|cytoplasm|integral to plasma membrane|neuron projection membrane	G-protein coupled receptor activity|PDZ domain binding|Wnt receptor activity|Wnt-protein binding			central_nervous_system(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(57;2.86e-05)|STAD - Stomach adenocarcinoma(118;0.197)			GCATTTGTACCAACCTGCATA	0.353													7	116	---	---	---	---	PASS
FZD6	8323	broad.mit.edu	37	8	104340586	104340586	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:104340586G>T	uc003ylh.2	+	5	1767	c.1483G>T	c.(1483-1485)GGA>TGA	p.G495*	FZD6_uc003yli.2_Nonsense_Mutation_p.G495*|FZD6_uc003ylj.2_Nonsense_Mutation_p.G495*|FZD6_uc011lhn.1_Nonsense_Mutation_p.G461*|FZD6_uc011lho.1_Nonsense_Mutation_p.G190*|FZD6_uc011lhp.1_Nonsense_Mutation_p.G440*	NM_003506	NP_003497	O60353	FZD6_HUMAN	frizzled 6 isoform a precursor	495	Cytoplasmic (Potential).				angiogenesis|axonogenesis|cell proliferation in midbrain|establishment of planar polarity|G-protein signaling, coupled to cGMP nucleotide second messenger|gonad development|inner ear morphogenesis|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of sequence-specific DNA binding transcription factor activity|neural tube closure|non-canonical Wnt receptor signaling pathway	apical part of cell|apicolateral plasma membrane|cytoplasm|integral to plasma membrane|neuron projection membrane	G-protein coupled receptor activity|PDZ domain binding|Wnt receptor activity|Wnt-protein binding			central_nervous_system(1)|skin(1)	2			OV - Ovarian serous cystadenocarcinoma(57;2.86e-05)|STAD - Stomach adenocarcinoma(118;0.197)			CTTCTGGGTTGGAAGCAAAAA	0.348													7	104	---	---	---	---	PASS
RIMS2	9699	broad.mit.edu	37	8	104897584	104897584	+	Missense_Mutation	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:104897584A>G	uc003yls.2	+	2	332	c.91A>G	c.(91-93)AGA>GGA	p.R31G	RIMS2_uc003ylp.2_Missense_Mutation_p.R253G|RIMS2_uc003ylw.2_Missense_Mutation_p.R61G|RIMS2_uc003ylq.2_Missense_Mutation_p.R61G|RIMS2_uc003ylr.2_Missense_Mutation_p.R61G	NM_014677	NP_055492	Q9UQ26	RIMS2_HUMAN	regulating synaptic membrane exocytosis 2	284					intracellular protein transport	cell junction|presynaptic membrane	metal ion binding|Rab GTPase binding			ovary(6)|lung(2)|breast(2)|skin(2)|large_intestine(1)|central_nervous_system(1)|pancreas(1)	15			OV - Ovarian serous cystadenocarcinoma(57;7.7e-07)|STAD - Stomach adenocarcinoma(118;0.229)			AAGGGAAGAAAGAGAGGAATA	0.403										HNSCC(12;0.0054)			7	30	---	---	---	---	PASS
ENY2	56943	broad.mit.edu	37	8	110355665	110355665	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110355665C>A	uc003ynd.2	+	5	323	c.261C>A	c.(259-261)CTC>CTA	p.L87L	ENY2_uc003ync.2_Silent_p.L82L	NM_020189	NP_064574	Q9NPA8	ENY2_HUMAN	enhancer of yellow 2 homolog	87					histone deubiquitination|mRNA transport|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	SAGA complex	ligand-dependent nuclear receptor transcription coactivator activity				0	all_neural(195;0.219)		OV - Ovarian serous cystadenocarcinoma(57;9.05e-13)			AGAAGGAGCTCCTACAAAGAA	0.338													7	190	---	---	---	---	PASS
PKHD1L1	93035	broad.mit.edu	37	8	110476645	110476645	+	Silent	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110476645A>T	uc003yne.2	+	49	7688	c.7584A>T	c.(7582-7584)ATA>ATT	p.I2528I		NM_177531	NP_803875	Q86WI1	PKHL1_HUMAN	fibrocystin L precursor	2528	PbH1 1.|Extracellular (Potential).				immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)			CATTTTTTATAGAAGATGGTA	0.388										HNSCC(38;0.096)			5	37	---	---	---	---	PASS
PKHD1L1	93035	broad.mit.edu	37	8	110509432	110509432	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:110509432C>A	uc003yne.2	+	65	10634	c.10530C>A	c.(10528-10530)GCC>GCA	p.A3510A		NM_177531	NP_803875	Q86WI1	PKHL1_HUMAN	fibrocystin L precursor	3510	Extracellular (Potential).				immune response	cytosol|extracellular space|integral to membrane	receptor activity			ovary(9)|central_nervous_system(2)|large_intestine(1)|breast(1)|pancreas(1)	14			OV - Ovarian serous cystadenocarcinoma(57;9.88e-13)			ATGGAATGGCCATTTTTCCAA	0.353										HNSCC(38;0.096)			8	121	---	---	---	---	PASS
CSMD3	114788	broad.mit.edu	37	8	113241017	113241017	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113241017A>C	uc003ynu.2	-	70	11091	c.10932T>G	c.(10930-10932)TTT>TTG	p.F3644L	CSMD3_uc003yns.2_Missense_Mutation_p.F2846L|CSMD3_uc003ynt.2_Missense_Mutation_p.F3604L|CSMD3_uc011lhx.1_Missense_Mutation_p.F3475L	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	3644	Helical; (Potential).					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63						CAAATCCTGCAAATATAAGTG	0.308										HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			12	90	---	---	---	---	PASS
CSMD3	114788	broad.mit.edu	37	8	113484930	113484930	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:113484930C>A	uc003ynu.2	-	32	5444	c.5285G>T	c.(5284-5286)TGT>TTT	p.C1762F	CSMD3_uc003yns.2_Missense_Mutation_p.C1034F|CSMD3_uc003ynt.2_Missense_Mutation_p.C1722F|CSMD3_uc011lhx.1_Missense_Mutation_p.C1658F	NM_198123	NP_937756	Q7Z407	CSMD3_HUMAN	CUB and Sushi multiple domains 3 isoform 1	1762	Extracellular (Potential).|CUB 10.					integral to membrane|plasma membrane				ovary(21)|lung(11)|skin(11)|kidney(8)|large_intestine(6)|upper_aerodigestive_tract(2)|central_nervous_system(2)|urinary_tract(1)|breast(1)	63						ACGACTTCCACAGGGCGCTAG	0.318										HNSCC(6;0.00088)|TCGA Ovarian(7;0.080)			6	74	---	---	---	---	PASS
EIF3H	8667	broad.mit.edu	37	8	117658799	117658799	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:117658799C>A	uc003yoa.2	-	7	898	c.872G>T	c.(871-873)CGA>CTA	p.R291L	EIF3H_uc003yob.2_Missense_Mutation_p.R305L	NM_003756	NP_003747	O15372	EIF3H_HUMAN	eukaryotic translation initiation factor 3,	291					regulation of translational initiation	cytosol|eukaryotic translation initiation factor 3 complex	protein binding|translation initiation factor activity			lung(3)	3	all_cancers(13;3.98e-22)|Lung NSC(37;0.000183)|Ovarian(258;0.0172)					GGGTTCTCCTCGGCTCTGGCG	0.517													6	128	---	---	---	---	PASS
FBXO32	114907	broad.mit.edu	37	8	124546943	124546943	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:124546943C>A	uc003yqr.2	-	2	420	c.228G>T	c.(226-228)CAG>CAT	p.Q76H	FBXO32_uc003yqq.2_5'Flank|FBXO32_uc010mdk.2_Missense_Mutation_p.Q76H	NM_058229	NP_478136	Q969P5	FBX32_HUMAN	F-box only protein 32 isoform 1	76										skin(3)|breast(2)|lung(1)	6	Lung NSC(37;1.13e-13)|Ovarian(258;0.00838)		STAD - Stomach adenocarcinoma(47;0.00288)			ATGGCTTACACTGAGTTTTGG	0.368													6	90	---	---	---	---	PASS
TATDN1	83940	broad.mit.edu	37	8	125531059	125531059	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:125531059C>A	uc003yrd.2	-	4	244	c.202G>T	c.(202-204)GGT>TGT	p.G68C	TATDN1_uc003yre.2_RNA|TATDN1_uc010mdm.2_Missense_Mutation_p.G21C|TATDN1_uc003yrf.2_Missense_Mutation_p.G68C	NM_032026	NP_114415	Q6P1N9	TATD1_HUMAN	TatD DNase domain containing 1 isoform a	68						nucleus	endodeoxyribonuclease activity, producing 5'-phosphomonoesters|metal ion binding				0	Ovarian(258;0.00438)|all_neural(195;0.0779)|Hepatocellular(40;0.108)		STAD - Stomach adenocarcinoma(47;0.00288)			ATGAGGATACCATTTGTTTGT	0.299													7	128	---	---	---	---	PASS
ZNF572	137209	broad.mit.edu	37	8	125989495	125989495	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:125989495C>G	uc003yrr.2	+	3	1140	c.985C>G	c.(985-987)CAA>GAA	p.Q329E		NM_152412	NP_689625	Q7Z3I7	ZN572_HUMAN	zinc finger protein 572	329	C2H2-type 8.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			large_intestine(1)|ovary(1)	2	Ovarian(258;0.0028)|all_neural(195;0.00294)|Hepatocellular(40;0.108)		STAD - Stomach adenocarcinoma(47;0.000918)|COAD - Colon adenocarcinoma(160;0.205)			AAAGCCTTATCAATGTCCAGA	0.358										HNSCC(60;0.17)			4	58	---	---	---	---	PASS
KCNQ3	3786	broad.mit.edu	37	8	133150167	133150167	+	Silent	SNP	G	T	T	rs143511163	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:133150167G>T	uc003ytj.2	-	12	1890	c.1665C>A	c.(1663-1665)CTC>CTA	p.L555L	KCNQ3_uc010mdt.2_Silent_p.L555L	NM_004519	NP_004510	O43525	KCNQ3_HUMAN	potassium voltage-gated channel KQT-like protein	555					axon guidance|synaptic transmission	voltage-gated potassium channel complex	voltage-gated potassium channel activity			ovary(2)|breast(1)|central_nervous_system(1)|skin(1)	5	Esophageal squamous(12;0.00507)|Ovarian(258;0.00579)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.000311)			AAAGCATGTCGAGATGCCCGG	0.458													6	110	---	---	---	---	PASS
COL22A1	169044	broad.mit.edu	37	8	139668172	139668172	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:139668172G>T	uc003yvd.2	-	45	3748	c.3301C>A	c.(3301-3303)CTG>ATG	p.L1101M	COL22A1_uc011ljo.1_Missense_Mutation_p.L381M	NM_152888	NP_690848	Q8NFW1	COMA1_HUMAN	collagen, type XXII, alpha 1	1101	Pro-rich.|Gly-rich.				cell adhesion	collagen|cytoplasm	structural molecule activity			ovary(11)|pancreas(1)|skin(1)	13	all_epithelial(106;1.55e-12)|Lung NSC(106;1.67e-05)|all_lung(105;3.39e-05)|Ovarian(258;0.00672)|Acute lymphoblastic leukemia(118;0.155)		BRCA - Breast invasive adenocarcinoma(115;0.0517)			CCTGGAGACAGTAGTGAAGAG	0.378										HNSCC(7;0.00092)			7	196	---	---	---	---	PASS
GSDMD	79792	broad.mit.edu	37	8	144644930	144644930	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144644930G>A	uc010mfe.2	+	14	2014	c.1311G>A	c.(1309-1311)CCG>CCA	p.P437P	GSDMD_uc003yyf.2_Silent_p.P485P|GSDMD_uc003yyg.2_Silent_p.P437P|GSDMD_uc003yyh.2_Silent_p.P368P	NM_024736	NP_079012	P57764	GSDMD_HUMAN	gasdermin D	437				SGMLVPELAIPVVYLLGALTMLSETQHKLLAEALESQTLLG PLELVGSLLEQSAPWQERSTMSLPPGLLGNSWGEGAPAWVL LDECGLELGEDTPHVCWEPQAQGRMCALYASLALLSGLSQE P -> PECWCRNSLSLLSTCWG (in Ref. 1; AAG22861).							0						AAGGAGCACCGGCCTGGGTCT	0.697													3	1	---	---	---	---	PASS
ZNF623	9831	broad.mit.edu	37	8	144733436	144733436	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144733436G>T	uc003yzd.2	+	1	1483	c.1394G>T	c.(1393-1395)GGG>GTG	p.G465V	ZNF623_uc011lkp.1_Missense_Mutation_p.G425V|ZNF623_uc003yzc.2_Missense_Mutation_p.G425V	NM_014789	NP_055604	O75123	ZN623_HUMAN	zinc finger protein 623 isoform 1	465	C2H2-type 13.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	all_cancers(97;3.74e-11)|all_epithelial(106;2.62e-09)|Lung NSC(106;0.00013)|all_lung(105;0.000374)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;2.46e-41)|Epithelial(56;5.28e-40)|all cancers(56;5.23e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.146)			AGTTATTGTGGGAAAGGCTTT	0.418													6	56	---	---	---	---	PASS
PUF60	22827	broad.mit.edu	37	8	144898966	144898966	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144898966G>T	uc003yzs.2	-	12	1468	c.1404C>A	c.(1402-1404)AAC>AAA	p.N468K	SCRIB_uc003yzo.1_5'Flank|SCRIB_uc003yzp.1_5'Flank|PUF60_uc003yzr.2_Missense_Mutation_p.N408K|PUF60_uc003yzt.2_Missense_Mutation_p.N451K|PUF60_uc003yzq.2_Missense_Mutation_p.N425K	NM_078480	NP_510965	Q9UHX1	PUF60_HUMAN	poly-U binding splicing factor 60KDa isoform a	468	RRM 3; atypical.|Inhibits homodimerization.|Inhibits transcriptional repression, interaction with ERCC3 and apoptosis induction.				apoptosis|mRNA processing|regulation of transcription, DNA-dependent|RNA splicing|transcription, DNA-dependent	nucleus|ribonucleoprotein complex	DNA binding|nucleotide binding|protein binding|RNA binding				0	all_cancers(97;2.31e-11)|all_epithelial(106;1.58e-09)|Lung NSC(106;0.00013)|all_lung(105;0.000374)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		OV - Ovarian serous cystadenocarcinoma(54;2.46e-41)|Epithelial(56;1.23e-39)|all cancers(56;6.82e-35)|Colorectal(110;0.055)|BRCA - Breast invasive adenocarcinoma(115;0.18)			GGTCCACCATGTTGCGCAGAA	0.632													5	32	---	---	---	---	PASS
PLEC	5339	broad.mit.edu	37	8	144993558	144993558	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:144993558G>T	uc003zaf.1	-	32	11012	c.10842C>A	c.(10840-10842)CCC>CCA	p.P3614P	PLEC_uc003zab.1_Silent_p.P3477P|PLEC_uc003zac.1_Silent_p.P3481P|PLEC_uc003zad.2_Silent_p.P3477P|PLEC_uc003zae.1_Silent_p.P3445P|PLEC_uc003zag.1_Silent_p.P3455P|PLEC_uc003zah.2_Silent_p.P3463P|PLEC_uc003zaj.2_Silent_p.P3504P	NM_201380	NP_958782	Q15149	PLEC_HUMAN	plectin isoform 1	3614	Globular 2.|Plectin 15.				cellular component disassembly involved in apoptosis|hemidesmosome assembly	cytosol|focal adhesion|hemidesmosome|intermediate filament cytoskeleton|sarcolemma	actin binding|structural constituent of muscle|structural constituent of muscle			large_intestine(2)|ovary(2)|pancreas(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	9						GGCTGTGCACGGGGTCGATGA	0.677													4	17	---	---	---	---	PASS
RPL8	6132	broad.mit.edu	37	8	146017419	146017419	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:146017419C>A	uc003zeb.2	-	2	207	c.96G>T	c.(94-96)GTG>GTT	p.V32V	RPL8_uc003zdz.2_RNA|RPL8_uc003zea.2_Silent_p.V32V|RPL8_uc003zec.2_Silent_p.V32V|RPL8_uc010mgc.2_Silent_p.V32V|RPL8_uc011lll.1_5'Flank	NM_033301	NP_150644	P62917	RL8_HUMAN	ribosomal protein L8	32					endocrine pancreas development|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit	rRNA binding|structural constituent of ribosome				0	all_cancers(97;1.03e-11)|all_epithelial(106;6.69e-11)|Lung NSC(106;4.08e-05)|all_lung(105;0.000125)|Ovarian(258;0.0173)|Acute lymphoblastic leukemia(118;0.155)		Epithelial(56;5.47e-39)|OV - Ovarian serous cystadenocarcinoma(54;6.38e-39)|all cancers(56;5.47e-34)|BRCA - Breast invasive adenocarcinoma(115;0.0355)|Colorectal(110;0.055)	GBM - Glioblastoma multiforme(99;0.191)		CAGCGAAATCCACGGCGCGCA	0.701													4	10	---	---	---	---	PASS
CBWD1	55871	broad.mit.edu	37	9	172184	172184	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:172184C>A	uc003zga.3	-						CBWD1_uc003zgb.3_Intron|CBWD1_uc003zgc.3_Intron|CBWD1_uc011llr.1_Intron	NM_018491	NP_060961	Q9BRT8	CBWD1_HUMAN	COBW domain containing 1 isoform 1								ATP binding|protein binding			ovary(1)	1	all_lung(41;0.218)	all_cancers(5;3.04e-16)|all_epithelial(5;4.68e-12)|all_lung(10;1.94e-10)|Lung NSC(10;3.61e-10)|Acute lymphoblastic leukemia(5;0.00439)|Breast(48;0.0148)|all_hematologic(5;0.024)|Prostate(43;0.122)	Kidney(42;0.112)|KIRC - Kidney renal clear cell carcinoma(5;0.157)	all cancers(5;0.000704)|Lung(218;0.00755)|GBM - Glioblastoma multiforme(5;0.0149)|Epithelial(6;0.0154)		TGGAGAATACCAAAACATAAT	0.338													9	194	---	---	---	---	PASS
SMARCA2	6595	broad.mit.edu	37	9	2033005	2033005	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:2033005C>A	uc003zhc.2	+	3	378	c.279C>A	c.(277-279)TCC>TCA	p.S93S	SMARCA2_uc003zhd.2_Silent_p.S93S|SMARCA2_uc010mha.2_Silent_p.S84S	NM_003070	NP_003061	P51531	SMCA2_HUMAN	SWI/SNF-related matrix-associated	93					chromatin remodeling|negative regulation of cell growth|negative regulation of transcription from RNA polymerase II promoter|nervous system development	intermediate filament cytoskeleton|nBAF complex|npBAF complex|nuclear chromatin|nucleoplasm|SWI/SNF complex|WINAC complex	ATP binding|DNA-dependent ATPase activity|helicase activity|protein binding|RNA polymerase II transcription coactivator activity|transcription regulatory region DNA binding			ovary(2)|central_nervous_system(1)	3		all_lung(10;2.06e-09)|Lung NSC(10;2.43e-09)		GBM - Glioblastoma multiforme(50;0.0475)		ATTGTGGATCCATGAAGGGCA	0.483													6	79	---	---	---	---	PASS
UHRF2	115426	broad.mit.edu	37	9	6460735	6460735	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:6460735C>A	uc003zjy.2	+	4	1147	c.807C>A	c.(805-807)ACC>ACA	p.T269T	UHRF2_uc003zjz.2_RNA|UHRF2_uc003zka.1_Silent_p.T46T	NM_152896	NP_690856	Q96PU4	UHRF2_HUMAN	ubiquitin-like with PHD and ring finger domains	269	Interaction with PCNP.				cell cycle|cell differentiation|cell proliferation|protein autoubiquitination|regulation of cell cycle|ubiquitin-dependent protein catabolic process	nucleus	DNA binding|histone binding|ubiquitin-protein ligase activity|zinc ion binding			large_intestine(2)|ovary(1)	3		Acute lymphoblastic leukemia(23;0.158)		GBM - Glioblastoma multiforme(50;0.0392)|Lung(218;0.129)		CAGAAATTACCACATTGAAGA	0.348													7	107	---	---	---	---	PASS
GLDC	2731	broad.mit.edu	37	9	6595065	6595065	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:6595065G>T	uc003zkc.2	-	9	1403	c.1210C>A	c.(1210-1212)CTG>ATG	p.L404M		NM_000170	NP_000161	P23378	GCSP_HUMAN	glycine dehydrogenase (decarboxylating)	404					glycine catabolic process	mitochondrion	electron carrier activity|glycine dehydrogenase (decarboxylating) activity|lyase activity|pyridoxal phosphate binding			ovary(2)	2		Acute lymphoblastic leukemia(23;0.161)		GBM - Glioblastoma multiforme(50;0.0421)|Lung(218;0.134)	Glycine(DB00145)|Pyridoxal Phosphate(DB00114)	ATATGCTCCAGCCCATGGGAA	0.393													7	272	---	---	---	---	PASS
MLLT3	4300	broad.mit.edu	37	9	20414343	20414343	+	Silent	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:20414343A>G	uc003zoe.2	-	5	760	c.501T>C	c.(499-501)AGT>AGC	p.S167S	MLLT3_uc011lne.1_Silent_p.S135S|MLLT3_uc011lnf.1_Silent_p.S164S|MLLT3_uc003zof.2_5'UTR|MLLT3_uc011lng.1_Missense_Mutation_p.V129A	NM_004529	NP_004520	P42568	AF9_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	167	Poly-Ser.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	protein binding			lung(2)|ovary(1)	3				GBM - Glioblastoma multiforme(3;4.35e-105)|Lung(42;3.48e-06)|LUSC - Lung squamous cell carcinoma(42;7.92e-05)		tgctgctgctactgctgctgc	0.139			T	MLL	ALL								4	28	---	---	---	---	PASS
C9orf82	79886	broad.mit.edu	37	9	26884875	26884875	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:26884875C>A	uc003zqc.2	-	4	610	c.598G>T	c.(598-600)GGA>TGA	p.G200*	C9orf82_uc003zqb.2_Nonsense_Mutation_p.G55*	NM_024828	NP_079104	Q9H8G2	CI082_HUMAN	hypothetical protein LOC79886	200											0		all_neural(3;3.53e-10)|Glioma(3;2.71e-09)		Lung(42;1.39e-05)|LUSC - Lung squamous cell carcinoma(38;0.000114)		GAGTCCATTCCATTGTCACCT	0.284													9	292	---	---	---	---	PASS
TAF1L	138474	broad.mit.edu	37	9	32630222	32630222	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:32630222A>T	uc003zrg.1	-	1	5446	c.5356T>A	c.(5356-5358)TTC>ATC	p.F1786I		NM_153809	NP_722516	Q8IZX4	TAF1L_HUMAN	TBP-associated factor RNA polymerase 1-like	1786					male meiosis|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription initiation, DNA-dependent	transcription factor TFIID complex	DNA binding|histone acetyltransferase activity|protein serine/threonine kinase activity|TBP-class protein binding			lung(8)|skin(6)|central_nervous_system(4)|large_intestine(3)|ovary(2)|stomach(1)|breast(1)|pancreas(1)	26			LUSC - Lung squamous cell carcinoma(29;0.0181)	GBM - Glioblastoma multiforme(74;0.00301)		ATAGCAGAGAAAGGATTGTCT	0.458													39	61	---	---	---	---	PASS
UBAP2	55833	broad.mit.edu	37	9	33948493	33948493	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:33948493C>A	uc003ztq.1	-	13	1262	c.1149G>T	c.(1147-1149)CCG>CCT	p.P383P	UBAP2_uc011loc.1_Silent_p.P292P|UBAP2_uc011lod.1_Silent_p.P116P|UBAP2_uc011loe.1_Silent_p.P138P|UBAP2_uc011lof.1_Silent_p.P308P|UBAP2_uc011log.1_Silent_p.P329P|UBAP2_uc003ztr.2_Silent_p.P255P|UBAP2_uc003zts.2_Silent_p.P16P	NM_018449	NP_060919	Q5T6F2	UBAP2_HUMAN	ubiquitin associated protein 2	383										ovary(3)	3			LUSC - Lung squamous cell carcinoma(29;0.00575)	GBM - Glioblastoma multiforme(74;0.168)		GGCCCAAACTCGGAGCTTTCA	0.488													6	149	---	---	---	---	PASS
C9orf23	138716	broad.mit.edu	37	9	34610925	34610925	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:34610925C>A	uc003zuu.2	-	2	650	c.369G>T	c.(367-369)CGG>CGT	p.R123R	C9orf23_uc003zuv.2_Silent_p.R123R	NM_148179	NP_680545	Q8N5L8	CI023_HUMAN	hypothetical protein LOC138716	123							nucleic acid binding				0	all_epithelial(49;0.0863)		STAD - Stomach adenocarcinoma(86;0.178)	GBM - Glioblastoma multiforme(74;0.0385)		CCAGGGGGTCCCGGCTGAGCA	0.652													5	23	---	---	---	---	PASS
CREB3	10488	broad.mit.edu	37	9	35736299	35736299	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35736299G>T	uc003zxv.2	+	8	1225	c.772G>T	c.(772-774)GAG>TAG	p.E258*	CREB3_uc010mla.2_Nonsense_Mutation_p.E177*	NM_006368	NP_006359	O43889	CREB3_HUMAN	cAMP responsive element binding protein 3	282	Lumenal (Potential).				chemotaxis|induction of positive chemotaxis|interspecies interaction between organisms|negative regulation of cell cycle|positive regulation of calcium ion transport|positive regulation of cell migration|positive regulation of transcription, DNA-dependent|reactivation of latent virus|regulation of cell proliferation	cytosol|endoplasmic reticulum|endoplasmic reticulum membrane|Golgi apparatus|integral to membrane|integral to membrane|nucleus|nucleus	cAMP response element binding protein binding|CCR1 chemokine receptor binding|DNA binding|protein dimerization activity|protein homodimerization activity|sequence-specific DNA binding transcription factor activity|sequence-specific DNA binding transcription factor activity				0	all_epithelial(49;0.167)		Lung(28;0.00276)|LUSC - Lung squamous cell carcinoma(32;0.00418)|STAD - Stomach adenocarcinoma(86;0.194)	GBM - Glioblastoma multiforme(74;0.0285)		CCTGCCAGCTGAGCATGGAGG	0.537											OREG0019176	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	7	107	---	---	---	---	PASS
MSMP	692094	broad.mit.edu	37	9	35754006	35754006	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35754006G>T	uc003zyb.1	-	1	267	c.121C>A	c.(121-123)CAA>AAA	p.Q41K		NM_001044264	NP_001037729	Q1L6U9	MSMP_HUMAN	PC3-secreted microprotein precursor	41						extracellular region					0						CCTTGAGCTTGGAAGTAGCAC	0.562													8	169	---	---	---	---	PASS
NPR2	4882	broad.mit.edu	37	9	35808587	35808587	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:35808587C>A	uc003zyd.2	+	19	2794	c.2794C>A	c.(2794-2796)CGT>AGT	p.R932S	NPR2_uc010mlb.2_Missense_Mutation_p.R908S|SPAG8_uc003zye.2_Intron	NM_003995	NP_003986	P20594	ANPRB_HUMAN	natriuretic peptide receptor B precursor	932	Guanylate cyclase.|Cytoplasmic (Potential).				intracellular signal transduction|ossification|receptor guanylyl cyclase signaling pathway|regulation of blood pressure	integral to membrane|plasma membrane	GTP binding|guanylate cyclase activity|natriuretic peptide receptor activity|protein kinase activity|transmembrane receptor activity			ovary(2)|stomach(1)	3	all_epithelial(49;0.161)		LUSC - Lung squamous cell carcinoma(32;0.00521)|Lung(28;0.00697)|STAD - Stomach adenocarcinoma(86;0.194)		Erythrityl Tetranitrate(DB01613)|Nesiritide(DB04899)	AGAAATTGCTCGTATGGCCCT	0.542													4	37	---	---	---	---	PASS
CNTNAP3	79937	broad.mit.edu	37	9	39086791	39086791	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:39086791G>T	uc004abi.2	-	20	3515	c.3276C>A	c.(3274-3276)ACC>ACA	p.T1092T	CNTNAP3_uc004abj.2_Silent_p.T1011T|CNTNAP3_uc011lqr.1_RNA|CNTNAP3_uc004abk.1_Silent_p.T1092T	NM_033655	NP_387504	Q9BZ76	CNTP3_HUMAN	cell recognition molecule CASPR3 precursor	1092	Laminin G-like 4.|Extracellular (Potential).				cell adhesion|cell recognition|signal transduction	extracellular region|integral to membrane|plasma membrane	receptor binding			ovary(1)	1				GBM - Glioblastoma multiforme(29;0.02)|Lung(182;0.0681)		TAAAATCAAAGGTAAATGCAT	0.338													7	90	---	---	---	---	PASS
TRPM6	140803	broad.mit.edu	37	9	77442742	77442742	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:77442742G>A	uc004ajl.1	-	7	1031	c.793C>T	c.(793-795)CTC>TTC	p.L265F	TRPM6_uc004ajk.1_Missense_Mutation_p.L260F|TRPM6_uc010mpb.1_RNA|TRPM6_uc010mpc.1_Missense_Mutation_p.L265F|TRPM6_uc010mpd.1_Missense_Mutation_p.L265F|TRPM6_uc010mpe.1_Missense_Mutation_p.L265F|TRPM6_uc004ajn.1_Missense_Mutation_p.L265F	NM_017662	NP_060132	Q9BX84	TRPM6_HUMAN	transient receptor potential cation channel,	265	Cytoplasmic (Potential).				response to toxin	integral to membrane	ATP binding|calcium channel activity|metal ion binding|protein binding|protein serine/threonine kinase activity			lung(3)|stomach(2)|haematopoietic_and_lymphoid_tissue(1)|central_nervous_system(1)|skin(1)	8						TTCCTTCTGAGCTTCATTTCA	0.522													17	42	---	---	---	---	PASS
GCNT1	2650	broad.mit.edu	37	9	79117357	79117357	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:79117357G>T	uc010mpf.2	+	3	401	c.60G>T	c.(58-60)ATG>ATT	p.M20I	GCNT1_uc010mpg.2_Missense_Mutation_p.M20I|GCNT1_uc010mph.2_Missense_Mutation_p.M20I|GCNT1_uc004akf.3_Missense_Mutation_p.M20I|GCNT1_uc010mpi.2_Missense_Mutation_p.M20I|GCNT1_uc004akh.3_Missense_Mutation_p.M20I	NM_001490	NP_001481	Q02742	GCNT1_HUMAN	beta-1,3-galactosyl-O-glycosyl-glycoprotein	20	Helical; Signal-anchor for type II membrane protein; (Potential).				protein O-linked glycosylation	Golgi membrane|integral to membrane	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity				0						ACTACTTTATGGTTCTTGTTT	0.408													7	105	---	---	---	---	PASS
PSAT1	29968	broad.mit.edu	37	9	80921340	80921340	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:80921340G>T	uc004ala.2	+	5	576	c.508G>T	c.(508-510)GGA>TGA	p.G170*	PSAT1_uc004alb.2_Nonsense_Mutation_p.G170*	NM_058179	NP_478059	Q9Y617	SERC_HUMAN	phosphoserine aminotransferase 1 isoform 1	170					L-serine biosynthetic process|pyridoxine biosynthetic process		O-phospho-L-serine:2-oxoglutarate aminotransferase activity|pyridoxal phosphate binding			ovary(1)	1					L-Glutamic Acid(DB00142)|Pyridoxal Phosphate(DB00114)|Pyridoxine(DB00165)	CGATGTCAAGGGAGCAGTACT	0.498													8	212	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	9	84676594	84676594	+	Intron	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:84676594C>T	uc010mpu.1	-							NM_001164339	NP_001157811			hypothetical protein LOC404770																		AGCTGGAAATCAGACCGGGTT	0.562													6	50	---	---	---	---	PASS
RASEF	158158	broad.mit.edu	37	9	85619503	85619503	+	Splice_Site	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:85619503T>A	uc004amo.1	-	9	1375	c.1114_splice	c.e9-1	p.H372_splice		NM_152573	NP_689786	Q8IZ41	RASEF_HUMAN	RAS and EF-hand domain containing						protein transport|small GTPase mediated signal transduction	perinuclear region of cytoplasm	calcium ion binding|GTP binding			upper_aerodigestive_tract(1)|lung(1)|breast(1)	3						ATTTATATGCTGTAATATAGA	0.323													6	54	---	---	---	---	PASS
UBQLN1	29979	broad.mit.edu	37	9	86293468	86293468	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:86293468C>A	uc004amv.2	-	5	1332	c.758G>T	c.(757-759)AGG>ATG	p.R253M	UBQLN1_uc004amw.2_Missense_Mutation_p.R253M	NM_013438	NP_038466	Q9UMX0	UBQL1_HUMAN	ubiquilin 1 isoform 1	253					apoptosis|regulation of protein ubiquitination|response to hypoxia	endoplasmic reticulum|nucleus|perinuclear region of cytoplasm|proteasome complex	kinase binding				0						GTCCTGGTTCCTCATCATCTC	0.418													12	357	---	---	---	---	PASS
HNRNPK	3190	broad.mit.edu	37	9	86588865	86588865	+	Silent	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:86588865A>C	uc004ang.3	-	8	578	c.354T>G	c.(352-354)ACT>ACG	p.T118T	HNRNPK_uc011lsw.1_5'UTR|HNRNPK_uc004and.3_5'UTR|HNRNPK_uc004ank.3_Silent_p.T118T|HNRNPK_uc004anf.3_Silent_p.T118T|HNRNPK_uc004anh.3_Intron|HNRNPK_uc011lsx.1_Intron|HNRNPK_uc004ani.3_Silent_p.T118T|HNRNPK_uc004anj.3_Silent_p.T118T|HNRNPK_uc004ann.3_Intron|HNRNPK_uc004anl.3_Silent_p.T118T|HNRNPK_uc004anm.3_Silent_p.T118T	NM_031262	NP_112552	P61978	HNRPK_HUMAN	heterogeneous nuclear ribonucleoprotein K	118	5 X 4 AA repeats of G-X-G-G.|Necessary for interaction with DDX1.|2 X 22 AA approximate repeats.|Interaction with ASFV p30.				interspecies interaction between organisms|positive regulation of low-density lipoprotein particle receptor biosynthetic process|positive regulation of receptor-mediated endocytosis|regulation of lipid transport by positive regulation of transcription from an RNA polymerase II promoter|regulation of low-density lipoprotein particle clearance|signal transduction	catalytic step 2 spliceosome|cytoplasm|heterogeneous nuclear ribonucleoprotein complex|nuclear chromatin|nucleoplasm	protein binding|RNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription|single-stranded DNA binding			skin(1)	1						GGCTGGTTGCAGTGGGTGATG	0.468													12	35	---	---	---	---	PASS
FAM120A	23196	broad.mit.edu	37	9	96259804	96259804	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96259804G>T	uc004atw.2	+	4	881	c.856G>T	c.(856-858)GTT>TTT	p.V286F	FAM120A_uc004atv.2_Missense_Mutation_p.V286F|FAM120A_uc004atx.2_Missense_Mutation_p.V68F|FAM120A_uc004aty.2_Missense_Mutation_p.V68F	NM_014612	NP_055427	Q9NZB2	F120A_HUMAN	oxidative stress-associated Src activator	286						cytoplasm|plasma membrane	RNA binding				0						GATCAAAGCCGTTGCTGACTA	0.463													7	43	---	---	---	---	PASS
RNF20	56254	broad.mit.edu	37	9	104309491	104309491	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:104309491C>A	uc004bbn.2	+	8	1057	c.967C>A	c.(967-969)CGG>AGG	p.R323R		NM_019592	NP_062538	Q5VTR2	BRE1A_HUMAN	ring finger protein 20	323	Potential.				histone H2B ubiquitination|histone monoubiquitination|negative regulation of cell migration|positive regulation of transcription, DNA-dependent|protein polyubiquitination|ubiquitin-dependent protein catabolic process	nucleolus|ubiquitin ligase complex	histone binding|p53 binding|transcription coactivator activity|ubiquitin protein ligase binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(1)|breast(1)|kidney(1)|skin(1)	8		all_hematologic(171;8.99e-06)|Acute lymphoblastic leukemia(62;0.000365)|Myeloproliferative disorder(762;0.0255)		OV - Ovarian serous cystadenocarcinoma(323;2.88e-19)|STAD - Stomach adenocarcinoma(157;0.00311)		TATCAATGCTCGGAAGGTAAA	0.433													5	104	---	---	---	---	PASS
SMC2	10592	broad.mit.edu	37	9	106891965	106891965	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:106891965G>T	uc004bbv.2	+	21	3118	c.2830G>T	c.(2830-2832)GAG>TAG	p.E944*	SMC2_uc004bbw.2_Nonsense_Mutation_p.E944*|SMC2_uc011lvl.1_Nonsense_Mutation_p.E944*|SMC2_uc004bbx.2_Nonsense_Mutation_p.E944*|SMC2_uc004bby.2_RNA	NM_001042551	NP_001036016	O95347	SMC2_HUMAN	structural maintenance of chromosomes 2	944					cell division|mitotic chromosome condensation|symbiosis, encompassing mutualism through parasitism	condensin complex|cytoplasm|nuclear chromosome	ATP binding|protein heterodimerization activity			ovary(4)|skin(2)|haematopoietic_and_lymphoid_tissue(1)|lung(1)|breast(1)	9						GATTAATGCAGAGAGACACCT	0.368													9	175	---	---	---	---	PASS
C9orf84	158401	broad.mit.edu	37	9	114520464	114520464	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:114520464G>A	uc004bfr.2	-	5	551	c.416C>T	c.(415-417)TCT>TTT	p.S139F	C9orf84_uc011lwt.1_RNA|C9orf84_uc004bfs.1_Missense_Mutation_p.S203F|C9orf84_uc004bfq.2_Missense_Mutation_p.S100F|C9orf84_uc010mug.2_Missense_Mutation_p.S85F	NM_173521	NP_775792	Q5VXU9	CI084_HUMAN	hypothetical protein LOC158401 isoform 1	139										ovary(2)	2						TTCTTGAAGAGAGAAACATTC	0.264													5	31	---	---	---	---	PASS
SLC31A1	1317	broad.mit.edu	37	9	116022625	116022625	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:116022625C>A	uc004bgu.2	+	5	631	c.445C>A	c.(445-447)CTC>ATC	p.L149I	FKBP15_uc010muu.1_Intron|SLC31A1_uc004bgv.3_Intron	NM_001859	NP_001850	O15431	COPT1_HUMAN	solute carrier family 31 (copper transporters),	149	Helical; (Potential).					integral to plasma membrane	copper ion transmembrane transporter activity				0						AAGCTACTTCCTCATGCTCAT	0.512													8	74	---	---	---	---	PASS
OR1J4	26219	broad.mit.edu	37	9	125281654	125281654	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:125281654C>A	uc011lyw.1	+	1	235	c.235C>A	c.(235-237)CCA>ACA	p.P79T		NM_001004452	NP_001004452	Q8NGS1	OR1J4_HUMAN	olfactory receptor, family 1, subfamily J,	79	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity				0						TGTCACTGTCCCAAAGATGTT	0.438													7	126	---	---	---	---	PASS
HSPA5	3309	broad.mit.edu	37	9	127999307	127999307	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:127999307C>A	uc004bpn.2	-	8	1785	c.1529G>T	c.(1528-1530)CGA>CTA	p.R510L		NM_005347	NP_005338	P11021	GRP78_HUMAN	heat shock 70kDa protein 5	510					anti-apoptosis|cellular response to glucose starvation|ER-associated protein catabolic process|platelet activation|platelet degranulation|regulation of protein folding in endoplasmic reticulum	cell surface|endoplasmic reticulum chaperone complex|endoplasmic reticulum lumen|ER-Golgi intermediate compartment|integral to endoplasmic reticulum membrane|melanosome|midbody|nucleus|perinuclear region of cytoplasm	ATP binding|ATPase activity|calcium ion binding|caspase inhibitor activity|chaperone binding|misfolded protein binding|protein binding, bridging|protein domain specific binding|ubiquitin protein ligase binding|unfolded protein binding			ovary(3)|skin(1)	4					Antihemophilic Factor(DB00025)	AGCTGTCACTCGAAGAATACC	0.443										Prostate(1;0.17)			6	122	---	---	---	---	PASS
HSPA5	3309	broad.mit.edu	37	9	128001526	128001526	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:128001526G>A	uc004bpn.2	-	5	946	c.690C>T	c.(688-690)TTC>TTT	p.F230F		NM_005347	NP_005338	P11021	GRP78_HUMAN	heat shock 70kDa protein 5	230					anti-apoptosis|cellular response to glucose starvation|ER-associated protein catabolic process|platelet activation|platelet degranulation|regulation of protein folding in endoplasmic reticulum	cell surface|endoplasmic reticulum chaperone complex|endoplasmic reticulum lumen|ER-Golgi intermediate compartment|integral to endoplasmic reticulum membrane|melanosome|midbody|nucleus|perinuclear region of cytoplasm	ATP binding|ATPase activity|calcium ion binding|caspase inhibitor activity|chaperone binding|misfolded protein binding|protein binding, bridging|protein domain specific binding|ubiquitin protein ligase binding|unfolded protein binding			ovary(3)|skin(1)	4					Antihemophilic Factor(DB00025)	GAGACACATCGAAGGTTCCGC	0.488										Prostate(1;0.17)			10	27	---	---	---	---	PASS
DOLPP1	57171	broad.mit.edu	37	9	131846978	131846978	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:131846978G>T	uc004bxc.2	+	2	136	c.108G>T	c.(106-108)CTG>CTT	p.L36L	DOLPP1_uc004bxd.2_Silent_p.L36L|DOLPP1_uc004bxe.2_RNA|DOLPP1_uc004bxf.2_5'Flank	NM_020438	NP_065171	Q86YN1	DOPP1_HUMAN	dolichyl pyrophosphate phosphatase 1 isoform a	36	Helical; (Potential).				dolichyl diphosphate biosynthetic process|post-translational protein modification|protein N-linked glycosylation via asparagine	integral to endoplasmic reticulum membrane	dolichyldiphosphatase activity			skin(1)	1						TTGCCTACCTGAGCCTCAGCC	0.567													10	264	---	---	---	---	PASS
TOR1B	27348	broad.mit.edu	37	9	132566464	132566464	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:132566464C>A	uc004byk.1	+	2	372	c.312C>A	c.(310-312)ACC>ACA	p.T104T		NM_014506	NP_055321	O14657	TOR1B_HUMAN	torsin family 1, member B (torsin B) precursor	104					chaperone mediated protein folding requiring cofactor|response to unfolded protein	endoplasmic reticulum lumen	ATP binding|nucleoside-triphosphatase activity|unfolded protein binding				0		Ovarian(14;0.0586)				AACCACTGACCCTTTCCTTAC	0.468													7	82	---	---	---	---	PASS
TOR1A	1861	broad.mit.edu	37	9	132576405	132576405	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:132576405C>A	uc004byl.2	-	5	922	c.845G>T	c.(844-846)CGA>CTA	p.R282L	TOR1A_uc004bym.2_RNA	NM_000113	NP_000104	O14656	TOR1A_HUMAN	torsin A precursor	282					chaperone mediated protein folding requiring cofactor|response to unfolded protein	endoplasmic reticulum lumen|nuclear membrane	ATP binding|serine-type endopeptidase activity|unfolded protein binding			central_nervous_system(1)	1		Ovarian(14;0.00556)				CATTTCCACTCGGATACACAT	0.453													6	122	---	---	---	---	PASS
SETX	23064	broad.mit.edu	37	9	135145048	135145048	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135145048C>A	uc004cbk.2	-	25	7424	c.7241G>T	c.(7240-7242)CGA>CTA	p.R2414L	SETX_uc004cbj.2_Missense_Mutation_p.R2033L|SETX_uc010mzt.2_Missense_Mutation_p.R2000L	NM_015046	NP_055861	Q7Z333	SETX_HUMAN	senataxin	2414					cell death|double-strand break repair|RNA processing	cytoplasm|nucleolus|nucleoplasm	ATP binding|DNA helicase activity			ovary(2)|skin(1)	3		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;6.82e-06)|Epithelial(140;0.000171)		GTACTTGGCTCGTGTGATGGT	0.438													7	211	---	---	---	---	PASS
SETX	23064	broad.mit.edu	37	9	135218091	135218091	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135218091G>T	uc004cbk.2	-	5	667	c.484C>A	c.(484-486)CAT>AAT	p.H162N		NM_015046	NP_055861	Q7Z333	SETX_HUMAN	senataxin	162					cell death|double-strand break repair|RNA processing	cytoplasm|nucleolus|nucleoplasm	ATP binding|DNA helicase activity			ovary(2)|skin(1)	3		Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;6.82e-06)|Epithelial(140;0.000171)		TCATTGGGATGGACTAAAAAC	0.393													9	207	---	---	---	---	PASS
TSC1	7248	broad.mit.edu	37	9	135796754	135796754	+	Silent	SNP	G	T	T	rs118203434		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:135796754G>T	uc004cca.2	-	8	967	c.733C>A	c.(733-735)CGA>AGA	p.R245R	TSC1_uc004ccb.3_Silent_p.R245R|TSC1_uc011mcq.1_Silent_p.R194R|TSC1_uc011mcr.1_Silent_p.R124R|TSC1_uc011mcs.1_Silent_p.R124R|TSC1_uc004ccc.1_Silent_p.R245R|TSC1_uc004ccd.2_Silent_p.R245R|TSC1_uc004cce.1_Silent_p.R245R	NM_000368	NP_000359	Q92574	TSC1_HUMAN	tuberous sclerosis 1 protein isoform 1	245					activation of Rho GTPase activity|cell cycle arrest|cell-matrix adhesion|insulin receptor signaling pathway|negative regulation of cell proliferation|negative regulation of protein ubiquitination|negative regulation of TOR signaling cascade|negative regulation of translation|positive regulation of focal adhesion assembly|regulation of phosphoprotein phosphatase activity|regulation of stress fiber assembly|rRNA export from nucleus	cell cortex|lamellipodium|membrane|TSC1-TSC2 complex	chaperone binding|protein N-terminus binding			lung(4)|central_nervous_system(3)|breast(2)|haematopoietic_and_lymphoid_tissue(1)|urinary_tract(1)|skin(1)|ovary(1)|bone(1)	14				OV - Ovarian serous cystadenocarcinoma(145;4.32e-08)|Epithelial(140;2.72e-06)		CTATACCTTCGAGGGTCCAGT	0.393			D|Mis|N|F|S			hamartoma|renal cell			Tuberous_Sclerosis				5	55	---	---	---	---	PASS
CAMSAP1	157922	broad.mit.edu	37	9	138714106	138714106	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:138714106G>T	uc004cgr.3	-	11	2401	c.2401C>A	c.(2401-2403)CAG>AAG	p.Q801K	CAMSAP1_uc004cgq.3_Missense_Mutation_p.Q691K|CAMSAP1_uc010nbg.2_Missense_Mutation_p.Q523K	NM_015447	NP_056262	Q5T5Y3	CAMP1_HUMAN	calmodulin regulated spectrin-associated protein	801						cytoplasm|microtubule				ovary(1)|central_nervous_system(1)|pancreas(1)	3				OV - Ovarian serous cystadenocarcinoma(145;1.4e-06)|Epithelial(140;1.11e-05)		CTGCTCATCTGAGAGGCTGTG	0.577													7	105	---	---	---	---	PASS
CACNA1B	774	broad.mit.edu	37	9	140911629	140911629	+	Intron	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:140911629C>G	uc004cog.2	+						CACNA1B_uc011mfd.1_Intron	NM_000718	NP_000709	Q00975	CAC1B_HUMAN	calcium channel, voltage-dependent, N type,						membrane depolarization|synaptic transmission	voltage-gated calcium channel complex	ATP binding|protein C-terminus binding|voltage-gated calcium channel activity			breast(3)|large_intestine(2)|ovary(1)	6	all_cancers(76;0.166)			OV - Ovarian serous cystadenocarcinoma(145;1.16e-05)|Epithelial(140;0.000476)	Amlodipine(DB00381)|Gabapentin(DB00996)	TCTCGCAGCTCATCTGTCTCC	0.463													5	26	---	---	---	---	PASS
NET1	10276	broad.mit.edu	37	10	5495514	5495514	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:5495514C>A	uc001iia.2	+	8	897	c.759C>A	c.(757-759)CTC>CTA	p.L253L	NET1_uc010qar.1_Silent_p.L72L|NET1_uc001iib.2_Silent_p.L199L|NET1_uc010qas.1_Silent_p.L72L	NM_001047160	NP_001040625	Q7Z628	ARHG8_HUMAN	neuroepithelial cell transforming gene 1 isoform	253	DH.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of cell growth|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|nucleus	Rho guanyl-nucleotide exchange factor activity			breast(1)	1						GTCACATTCTCGTGAGCTGGG	0.413													5	68	---	---	---	---	PASS
DHTKD1	55526	broad.mit.edu	37	10	12159705	12159705	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:12159705G>T	uc001ild.3	+	14	2452	c.2353G>T	c.(2353-2355)GGA>TGA	p.G785*		NM_018706	NP_061176	Q96HY7	DHTK1_HUMAN	dehydrogenase E1 and transketolase domain	785					glycolysis	mitochondrion	oxoglutarate dehydrogenase (succinyl-transferring) activity|thiamine pyrophosphate binding			ovary(1)|central_nervous_system(1)	2		Renal(717;0.228)	BRCA - Breast invasive adenocarcinoma(52;0.188)			AATGGCACCAGGAACAACATT	0.428													7	126	---	---	---	---	PASS
CAMK1D	57118	broad.mit.edu	37	10	12856243	12856243	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:12856243G>T	uc001ilo.2	+	7	926	c.691G>T	c.(691-693)GAG>TAG	p.E231*	CAMK1D_uc001iln.2_Nonsense_Mutation_p.E231*	NM_153498	NP_705718	Q8IU85	KCC1D_HUMAN	calcium/calmodulin-dependent protein kinase ID	231	Protein kinase.					calcium- and calmodulin-dependent protein kinase complex|cytoplasm|nucleus	ATP binding|calmodulin binding|calmodulin-dependent protein kinase activity			ovary(1)|stomach(1)	2				GBM - Glioblastoma multiforme(1;3.16e-05)		CAAGCTCTTTGAGCAGATCCT	0.512													6	64	---	---	---	---	PASS
SEPHS1	22929	broad.mit.edu	37	10	13361282	13361282	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:13361282C>A	uc001imk.2	-	9	1398	c.1039G>T	c.(1039-1041)GAA>TAA	p.E347*	SEPHS1_uc001imh.2_Nonsense_Mutation_p.E271*|SEPHS1_uc010qbs.1_Nonsense_Mutation_p.E299*|SEPHS1_uc001imi.2_Nonsense_Mutation_p.E345*|SEPHS1_uc001imj.2_3'UTR|SEPHS1_uc010qbt.1_Nonsense_Mutation_p.E280*	NM_012247	NP_036379	P49903	SPS1_HUMAN	selenophosphate synthetase 1	347					protein modification process		ATP binding|GTP binding|selenide, water dikinase activity			skin(1)	1						TGGTGGCCTTCACCATATTTG	0.507													9	265	---	---	---	---	PASS
OLAH	55301	broad.mit.edu	37	10	15107628	15107628	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:15107628G>A	uc001inu.2	+	6	702	c.448G>A	c.(448-450)GAA>AAA	p.E150K	ACBD7_uc010qby.1_Intron|OLAH_uc001int.2_Missense_Mutation_p.E203K	NM_001039702	NP_001034791	Q9NV23	SAST_HUMAN	oleoyl-ACP hydrolase isoform 2	150					fatty acid biosynthetic process		myristoyl-[acyl-carrier-protein] hydrolase activity|oleoyl-[acyl-carrier-protein] hydrolase activity|palmitoyl-[acyl-carrier-protein] hydrolase activity				0						ATTGTCAGAAGAACAAATAAG	0.413													8	55	---	---	---	---	PASS
OLAH	55301	broad.mit.edu	37	10	15115133	15115133	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:15115133G>C	uc001inu.2	+	8	957	c.703G>C	c.(703-705)GGG>CGG	p.G235R	ACBD7_uc010qby.1_Intron|OLAH_uc001int.2_Missense_Mutation_p.G288R	NM_001039702	NP_001034791	Q9NV23	SAST_HUMAN	oleoyl-ACP hydrolase isoform 2	235					fatty acid biosynthetic process		myristoyl-[acyl-carrier-protein] hydrolase activity|oleoyl-[acyl-carrier-protein] hydrolase activity|palmitoyl-[acyl-carrier-protein] hydrolase activity				0						CCAGCTTCCAGGGGGTCACTT	0.343													11	85	---	---	---	---	PASS
CUBN	8029	broad.mit.edu	37	10	16955880	16955880	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:16955880C>A	uc001ioo.2	-	48	7515	c.7463G>T	c.(7462-7464)AGG>ATG	p.R2488M		NM_001081	NP_001072	O60494	CUBN_HUMAN	cubilin precursor	2488	CUB 18.				cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)	GGTGATCCGCCTTCCCTCCGG	0.522													20	72	---	---	---	---	PASS
CUBN	8029	broad.mit.edu	37	10	16994270	16994270	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:16994270C>A	uc001ioo.2	-							NM_001081	NP_001072	O60494	CUBN_HUMAN	cubilin precursor						cholesterol metabolic process|cobalamin transport|hormone biosynthetic process|lipoprotein metabolic process|receptor-mediated endocytosis|tissue homeostasis|vitamin D metabolic process	brush border membrane|cytosol|endosome membrane|extrinsic to external side of plasma membrane|lysosomal lumen|lysosomal membrane	calcium ion binding|cobalamin binding|protein homodimerization activity|receptor activity|transporter activity			ovary(9)|breast(4)|pancreas(2)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)|kidney(1)	19					Cyanocobalamin(DB00115)|Hydroxocobalamin(DB00200)	ATTTTTGTTACTTACATGGAG	0.443													6	100	---	---	---	---	PASS
MLLT10	8028	broad.mit.edu	37	10	22002776	22002776	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:22002776C>T	uc001iqs.2	+	15	2171	c.1823C>T	c.(1822-1824)TCC>TTC	p.S608F	MLLT10_uc001iqt.2_Missense_Mutation_p.S592F|MLLT10_uc001iqv.2_RNA|MLLT10_uc001iqy.2_Missense_Mutation_p.S592F|MLLT10_uc001ira.2_Missense_Mutation_p.S49F|MLLT10_uc001irb.2_RNA	NM_004641	NP_004632	P55197	AF10_HUMAN	myeloid/lymphoid or mixed-lineage leukemia	608	DNA-binding.				positive regulation of transcription from RNA polymerase II promoter	cytoplasm|nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			lung(1)|skin(1)	2						ACTCCTGTCTCCAGCTCTCAC	0.448			T	MLL|PICALM|CDK6	AL								16	78	---	---	---	---	PASS
BMI1	648	broad.mit.edu	37	10	22615393	22615393	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:22615393G>T	uc001irh.2	+	2	654	c.15G>T	c.(13-15)ACG>ACT	p.T5T	BMI1_uc009xkg.2_Silent_p.T148T	NM_005180	NP_005171	P35226	BMI1_HUMAN	BMI1 polycomb ring finger oncogene	5					hemopoiesis|negative regulation of transcription from RNA polymerase II promoter|positive regulation of fibroblast proliferation|positive regulation of ubiquitin-protein ligase activity|segment specification|transcription, DNA-dependent	cytoplasm|nucleolus|PcG protein complex|ubiquitin ligase complex	RING-like zinc finger domain binding|zinc ion binding			ovary(1)|skin(1)	2						ATCGAACAACGAGAATCAAGA	0.388													5	63	---	---	---	---	PASS
KIAA1462	57608	broad.mit.edu	37	10	30316780	30316780	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:30316780C>A	uc001iux.2	-	2	2356	c.2297G>T	c.(2296-2298)AGG>ATG	p.R766M	KIAA1462_uc001iuy.2_Intron|KIAA1462_uc001iuz.2_Missense_Mutation_p.R628M|KIAA1462_uc009xle.1_Missense_Mutation_p.R766M	NM_020848	NP_065899	Q9P266	K1462_HUMAN	hypothetical protein LOC57608	766										ovary(4)	4						CAAGGAAGTCCTTGAGAACGC	0.607													5	21	---	---	---	---	PASS
KIF5B	3799	broad.mit.edu	37	10	32324501	32324501	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:32324501G>T	uc001iwe.3	-	10	1381	c.911C>A	c.(910-912)CCA>CAA	p.P304Q		NM_004521	NP_004512	P33176	KINH_HUMAN	kinesin family member 5B	304	Kinesin-motor.				stress granule disassembly|vesicle transport along microtubule	kinesin complex|microtubule|perinuclear region of cytoplasm|vesicle	ATP binding|microtubule binding|microtubule motor activity		KIF5B/ALK(4)	lung(4)|ovary(1)	5		Prostate(175;0.0137)				GTATGATGATGGAGAGCAGCA	0.338													8	100	---	---	---	---	PASS
ANKRD30A	91074	broad.mit.edu	37	10	37438709	37438709	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:37438709C>A	uc001iza.1	+	11	1508	c.1409C>A	c.(1408-1410)GCC>GAC	p.A470D		NM_052997	NP_443723	Q9BXX3	AN30A_HUMAN	ankyrin repeat domain 30A	526						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(7)|breast(1)|skin(1)	9						ATTTAGCCTGCCATTGAAATG	0.279													34	173	---	---	---	---	PASS
PCDH15	65217	broad.mit.edu	37	10	55912957	55912957	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55912957C>T	uc001jju.1	-	14	2082	c.1687G>A	c.(1687-1689)GGG>AGG	p.G563R	PCDH15_uc010qhq.1_Missense_Mutation_p.G568R|PCDH15_uc010qhr.1_Missense_Mutation_p.G563R|PCDH15_uc010qhs.1_Missense_Mutation_p.G575R|PCDH15_uc010qht.1_Missense_Mutation_p.G570R|PCDH15_uc010qhu.1_Missense_Mutation_p.G563R|PCDH15_uc001jjv.1_Missense_Mutation_p.G541R|PCDH15_uc010qhv.1_Missense_Mutation_p.G563R|PCDH15_uc010qhw.1_Missense_Mutation_p.G526R|PCDH15_uc010qhx.1_Missense_Mutation_p.G563R|PCDH15_uc010qhy.1_Missense_Mutation_p.G568R|PCDH15_uc010qhz.1_Missense_Mutation_p.G563R|PCDH15_uc010qia.1_Missense_Mutation_p.G541R|PCDH15_uc010qib.1_Missense_Mutation_p.G541R|PCDH15_uc001jjw.2_Missense_Mutation_p.G563R	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	563	Cadherin 5.|Extracellular (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				GTGATAAGCCCTGTTGTTTTA	0.527										HNSCC(58;0.16)			7	51	---	---	---	---	PASS
PCDH15	65217	broad.mit.edu	37	10	55913005	55913005	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:55913005C>A	uc001jju.1	-	14	2034	c.1639G>T	c.(1639-1641)GAA>TAA	p.E547*	PCDH15_uc010qhq.1_Nonsense_Mutation_p.E552*|PCDH15_uc010qhr.1_Nonsense_Mutation_p.E547*|PCDH15_uc010qhs.1_Nonsense_Mutation_p.E559*|PCDH15_uc010qht.1_Nonsense_Mutation_p.E554*|PCDH15_uc010qhu.1_Nonsense_Mutation_p.E547*|PCDH15_uc001jjv.1_Nonsense_Mutation_p.E525*|PCDH15_uc010qhv.1_Nonsense_Mutation_p.E547*|PCDH15_uc010qhw.1_Nonsense_Mutation_p.E510*|PCDH15_uc010qhx.1_Nonsense_Mutation_p.E547*|PCDH15_uc010qhy.1_Nonsense_Mutation_p.E552*|PCDH15_uc010qhz.1_Nonsense_Mutation_p.E547*|PCDH15_uc010qia.1_Nonsense_Mutation_p.E525*|PCDH15_uc010qib.1_Nonsense_Mutation_p.E525*|PCDH15_uc001jjw.2_Nonsense_Mutation_p.E547*	NM_033056	NP_149045	Q96QU1	PCD15_HUMAN	protocadherin 15 isoform CD1-4 precursor	547	Cadherin 5.|Extracellular (Potential).				equilibrioception|homophilic cell adhesion|photoreceptor cell maintenance|sensory perception of sound	extracellular region|extracellular space|integral to membrane|photoreceptor outer segment|plasma membrane|stereocilium|synapse	calcium ion binding			pancreas(5)|ovary(4)|upper_aerodigestive_tract(2)|skin(2)	13		Melanoma(3;0.117)|Lung SC(717;0.238)				ACAAGGATTTCATATGTGATC	0.478										HNSCC(58;0.16)			17	64	---	---	---	---	PASS
FAM13C	220965	broad.mit.edu	37	10	61011407	61011407	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:61011407G>T	uc001jkn.2	-	14	1696	c.1562C>A	c.(1561-1563)ACT>AAT	p.T521N	FAM13C_uc001jko.2_Missense_Mutation_p.T423N|FAM13C_uc010qid.1_Missense_Mutation_p.T437N|FAM13C_uc010qie.1_Missense_Mutation_p.T438N|FAM13C_uc010qif.1_Missense_Mutation_p.T543N	NM_198215	NP_937858	Q8NE31	FA13C_HUMAN	hypothetical protein LOC220965 isoform 1	521										ovary(2)	2						GTCAGCCCTAGTTTCTCGGAG	0.393													7	164	---	---	---	---	PASS
NRBF2	29982	broad.mit.edu	37	10	64893254	64893254	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:64893254C>A	uc001jmj.3	+	1	248	c.24C>A	c.(22-24)CTC>CTA	p.L8L	NRBF2_uc010qip.1_Missense_Mutation_p.Q27K	NM_030759	NP_110386	Q96F24	NRBF2_HUMAN	nuclear receptor binding factor 2	8					regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|transcription, DNA-dependent	cytoplasm|nucleoplasm	protein binding				0	Prostate(12;0.0119)|all_hematologic(501;0.191)					AAGGACCCCTCAACCTGGTGA	0.632													4	12	---	---	---	---	PASS
CTNNA3	29119	broad.mit.edu	37	10	69299393	69299393	+	Silent	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69299393T>C	uc009xpn.1	-	4	450	c.327A>G	c.(325-327)ACA>ACG	p.T109T	CTNNA3_uc001jmw.2_Silent_p.T109T|CTNNA3_uc001jmx.3_Silent_p.T109T|CTNNA3_uc009xpo.1_Intron|CTNNA3_uc001jna.2_Silent_p.T121T	NM_001127384	NP_001120856	Q9UI47	CTNA3_HUMAN	catenin, alpha 3	109	Potential.				cell-cell adhesion	actin cytoskeleton|cytoplasm|fascia adherens	cadherin binding|structural molecule activity			skin(3)|ovary(2)|pancreas(1)|lung(1)|central_nervous_system(1)	8						AGGGGTCATCTGTAAATCTCT	0.443													10	53	---	---	---	---	PASS
CTNNA3	29119	broad.mit.edu	37	10	69299394	69299394	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69299394G>T	uc009xpn.1	-	4	449	c.326C>A	c.(325-327)ACA>AAA	p.T109K	CTNNA3_uc001jmw.2_Missense_Mutation_p.T109K|CTNNA3_uc001jmx.3_Missense_Mutation_p.T109K|CTNNA3_uc009xpo.1_Intron|CTNNA3_uc001jna.2_Missense_Mutation_p.T121K	NM_001127384	NP_001120856	Q9UI47	CTNA3_HUMAN	catenin, alpha 3	109	Potential.				cell-cell adhesion	actin cytoskeleton|cytoplasm|fascia adherens	cadherin binding|structural molecule activity			skin(3)|ovary(2)|pancreas(1)|lung(1)|central_nervous_system(1)	8						GGGGTCATCTGTAAATCTCTC	0.443													11	52	---	---	---	---	PASS
SIRT1	23411	broad.mit.edu	37	10	69651214	69651214	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:69651214C>A	uc001jnd.2	+	4	897	c.844C>A	c.(844-846)CGC>AGC	p.R282S	SIRT1_uc010qis.1_5'UTR|SIRT1_uc009xpp.2_Missense_Mutation_p.R90S|SIRT1_uc001jne.2_5'UTR	NM_012238	NP_036370	Q96EB6	SIRT1_HUMAN	sirtuin 1 isoform a	282	Deacetylase sirtuin-type.				apoptosis|cell aging|cellular response to hydrogen peroxide|cellular response to starvation|chromatin silencing at rDNA|DNA repair|DNA replication|establishment of chromatin silencing|histone H3 deacetylation|interspecies interaction between organisms|maintenance of chromatin silencing|muscle organ development|negative regulation of androgen receptor signaling pathway|negative regulation of cell growth|negative regulation of DNA damage response, signal transduction by p53 class mediator|negative regulation of fat cell differentiation|negative regulation of helicase activity|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of transcription from RNA polymerase II promoter|peptidyl-lysine acetylation|peptidyl-lysine deacetylation|positive regulation of anti-apoptosis|positive regulation of chromatin silencing|positive regulation of DNA repair|regulation of apoptosis|regulation of cell proliferation|regulation of endodeoxyribonuclease activity|regulation of protein import into nucleus, translocation|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|rRNA processing|transcription, DNA-dependent|triglyceride mobilization|white fat cell differentiation	chromatin silencing complex|cytoplasm|nuclear euchromatin|nuclear heterochromatin|nuclear inner membrane|nucleolus|PML body|rDNA heterochromatin	bHLH transcription factor binding|histone binding|HLH domain binding|identical protein binding|mitogen-activated protein kinase binding|NAD+ binding|NAD-dependent histone deacetylase activity (H3-K9 specific)|p53 binding|protein C-terminus binding|transcription corepressor activity|zinc ion binding				0						TATTTATGCTCGCCTTGCTGT	0.378													6	142	---	---	---	---	PASS
TET1	80312	broad.mit.edu	37	10	70411606	70411606	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70411606G>T	uc001jok.3	+	5	4785	c.4280G>T	c.(4279-4281)CGA>CTA	p.R1427L		NM_030625	NP_085128	Q8NFU7	TET1_HUMAN	CXXC finger 6	1427					DNA demethylation|inner cell mass cell differentiation|negative regulation of methylation-dependent chromatin silencing|stem cell maintenance		iron ion binding|methylcytosine dioxygenase activity|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|structure-specific DNA binding|zinc ion binding			ovary(5)|lung(2)|prostate(1)|breast(1)	9						TCCACAGATCGAGTTATACAA	0.418													6	162	---	---	---	---	PASS
STOX1	219736	broad.mit.edu	37	10	70644837	70644837	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:70644837C>A	uc001jos.2	+	3	1372	c.1285C>A	c.(1285-1287)CGA>AGA	p.R429R	STOX1_uc001jor.2_Intron|STOX1_uc009xpy.2_Intron|STOX1_uc001joq.2_Silent_p.R319R	NM_001130161	NP_001123633	Q6ZVD7	STOX1_HUMAN	storkhead box 1 isoform a	429						cytoplasm|nucleolus	DNA binding			kidney(1)|skin(1)	2						GGGCCATTCTCGAAGGGATAG	0.512													6	154	---	---	---	---	PASS
CAMK2G	818	broad.mit.edu	37	10	75620621	75620621	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:75620621G>T	uc001jvv.1	-	3	287	c.163C>A	c.(163-165)CGG>AGG	p.R55R	CAMK2G_uc001jvm.1_Silent_p.R63R|CAMK2G_uc001jvo.1_Silent_p.R63R|CAMK2G_uc001jvq.1_Silent_p.R63R|CAMK2G_uc001jvr.1_Silent_p.R63R|CAMK2G_uc001jvp.1_Silent_p.R63R|CAMK2G_uc001jvs.1_Silent_p.R63R|CAMK2G_uc001jvt.1_RNA|CAMK2G_uc001jvu.1_Silent_p.R63R|CAMK2G_uc010qkv.1_5'UTR	NM_172171	NP_751911	Q13555	KCC2G_HUMAN	calcium/calmodulin-dependent protein kinase II	63	Protein kinase.				insulin secretion|interferon-gamma-mediated signaling pathway|synaptic transmission	calcium- and calmodulin-dependent protein kinase complex|cytosol|endocytic vesicle membrane|nucleoplasm|plasma membrane	ATP binding|calcium-dependent protein serine/threonine phosphatase activity|calmodulin binding|calmodulin-dependent protein kinase activity			lung(1)|stomach(1)	2	Prostate(51;0.0112)					CGACATATCCGAGCCTCACGT	0.433													5	122	---	---	---	---	PASS
SAMD8	142891	broad.mit.edu	37	10	76928351	76928351	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:76928351C>A	uc001jwx.1	+	4	830	c.727C>A	c.(727-729)CGC>AGC	p.R243S	SAMD8_uc001jwy.1_Missense_Mutation_p.R243S	NM_144660	NP_653261	Q96LT4	SAMD8_HUMAN	sterile alpha motif domain containing 8	243	Helical; (Potential).				sphingomyelin biosynthetic process	integral to membrane					0	all_cancers(46;0.0207)|all_epithelial(25;0.00126)|Prostate(51;0.0112)|Ovarian(15;0.0348)					ATTCTTGCTTCGCTGCTTTAC	0.453													5	118	---	---	---	---	PASS
IFIT5	24138	broad.mit.edu	37	10	91177842	91177842	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:91177842C>A	uc010qnh.1	+	2	1117	c.886C>A	c.(886-888)CAA>AAA	p.Q296K	IFIT5_uc010qng.1_Missense_Mutation_p.Q248K	NM_012420	NP_036552	Q13325	IFIT5_HUMAN	interferon-induced protein with	296							binding				0						CTACAGGGCACAAATGATCCA	0.408													6	79	---	---	---	---	PASS
PLCE1	51196	broad.mit.edu	37	10	96018841	96018841	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:96018841G>T	uc001kjk.2	+	13	4382	c.3748G>T	c.(3748-3750)GAG>TAG	p.E1250*	PLCE1_uc010qnx.1_Nonsense_Mutation_p.E1234*|PLCE1_uc001kjm.2_Nonsense_Mutation_p.E942*	NM_016341	NP_057425	Q9P212	PLCE1_HUMAN	phospholipase C, epsilon 1 isoform 1	1250					activation of MAPK activity|activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger|activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|calcium-mediated signaling|cell proliferation|cytoskeleton organization|diacylglycerol biosynthetic process|elevation of cytosolic calcium ion concentration|epidermal growth factor receptor signaling pathway|glomerulus development|heart development|lipid catabolic process|Ras protein signal transduction|regulation of cell growth|regulation of G-protein coupled receptor protein signaling pathway|regulation of Ras protein signal transduction|regulation of smooth muscle contraction	cytosol|Golgi membrane|membrane fraction|plasma membrane	calcium ion binding|guanyl-nucleotide exchange factor activity|phosphatidylinositol phospholipase C activity|Ras GTPase binding|receptor signaling protein activity			ovary(2)|skin(1)	3		Colorectal(252;0.0458)				ATCTGGCTCCGAGTCAGCCCC	0.483													5	78	---	---	---	---	PASS
TCTN3	26123	broad.mit.edu	37	10	97423886	97423886	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:97423886C>T	uc001klb.3	-	14	2006	c.1762G>A	c.(1762-1764)GTC>ATC	p.V588I	TCTN3_uc001kla.3_Missense_Mutation_p.V432I|TCTN3_uc010qoi.1_Missense_Mutation_p.V440I	NM_015631	NP_056446	Q6NUS6	TECT3_HUMAN	tectonic 3 isoform a precursor	588	Helical; (Potential).				apoptosis	integral to membrane					0		Colorectal(252;0.0815)		Epithelial(162;1.69e-07)|all cancers(201;5.63e-06)		ATGGGAGAGACTGAGCATTTT	0.438													41	101	---	---	---	---	PASS
EXOSC1	51013	broad.mit.edu	37	10	99198446	99198446	+	Missense_Mutation	SNP	C	A	A	rs141065374		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:99198446C>A	uc001kni.2	-	5	352	c.326G>T	c.(325-327)CGA>CTA	p.R109L	EXOSC1_uc009xvp.1_Intron	NM_016046	NP_057130	Q9Y3B2	EXOS1_HUMAN	exosomal core protein CSL4	109	S1 motif.				exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay|rRNA processing	cytosol|exosome (RNase complex)|nucleolus	protein binding|RNA binding				0		Renal(717;0.000147)|Colorectal(252;0.00205)|Ovarian(717;0.00965)		all cancers(201;8.29e-42)|Epithelial(162;5.7e-33)|BRCA - Breast invasive adenocarcinoma(275;0.000315)|Kidney(138;0.000832)|KIRC - Kidney renal clear cell carcinoma(50;0.00269)|STAD - Stomach adenocarcinoma(243;0.202)		TTCAGTTGCTCGGACATCTTC	0.229													8	269	---	---	---	---	PASS
FAM178A	55719	broad.mit.edu	37	10	102716225	102716225	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:102716225C>A	uc001krt.3	+	18	3890	c.3348C>A	c.(3346-3348)CTC>CTA	p.L1116L	FAM178A_uc001krs.2_Silent_p.L1116L	NM_018121	NP_060591	Q8IX21	F178A_HUMAN	hypothetical protein LOC55719 isoform 1	1116											0						TTGTGCTACTCTGTGGGGCTT	0.308													8	124	---	---	---	---	PASS
SUFU	51684	broad.mit.edu	37	10	104352370	104352370	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:104352370C>A	uc001kvy.1	+	4	632	c.486C>A	c.(484-486)TCC>TCA	p.S162S	SUFU_uc001kvw.1_Silent_p.S162S|SUFU_uc001kvx.2_Silent_p.S162S	NM_016169	NP_057253	Q9UMX1	SUFU_HUMAN	suppressor of fused	162					negative regulation of transcription from RNA polymerase II promoter|proteolysis|skeletal system development	cytoplasm|nucleus	identical protein binding|protein binding|signal transducer activity|transcription corepressor activity|transcription factor binding			central_nervous_system(4)|skin(2)|breast(1)	7		Colorectal(252;0.207)		Epithelial(162;1.36e-08)|all cancers(201;3.81e-07)|BRCA - Breast invasive adenocarcinoma(275;0.242)		ACCATGTGTCCTGGCACAGCC	0.542			D|F|S		medulloblastoma	medulloblastoma			Medulloblastoma_associated_with_Germline_SUFU_Mutation				6	69	---	---	---	---	PASS
TAF5	6877	broad.mit.edu	37	10	105147936	105147936	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105147936C>A	uc001kwv.2	+	11	2382	c.2359C>A	c.(2359-2361)CGA>AGA	p.R787R	TAF5_uc010qqq.1_Silent_p.R732R	NM_006951	NP_008882	Q15542	TAF5_HUMAN	TBP-associated factor 5	787				R -> L (in Ref. 8; AAH52268).	histone acetylation|interspecies interaction between organisms|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|viral reproduction	actin cytoskeleton|transcription factor TFIID complex|transcription factor TFTC complex	protein dimerization activity|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding			ovary(2)	2		Colorectal(252;0.0747)|Breast(234;0.128)		Epithelial(162;1.83e-09)|all cancers(201;1.4e-08)|BRCA - Breast invasive adenocarcinoma(275;0.198)		TCATTTTACTCGAAGAAACCT	0.378													5	49	---	---	---	---	PASS
SLK	9748	broad.mit.edu	37	10	105778545	105778545	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105778545G>T	uc001kxo.1	+	15	3045	c.3011G>T	c.(3010-3012)CGA>CTA	p.R1004L	SLK_uc001kxp.1_Missense_Mutation_p.R973L	NM_014720	NP_055535	Q9H2G2	SLK_HUMAN	serine/threonine kinase 2	1004	Potential.				apoptosis|nucleotide-excision repair	cytoplasm|plasma membrane	ATP binding|DNA binding|nuclease activity|protein serine/threonine kinase activity			ovary(2)|stomach(2)|skin(2)|lung(1)|kidney(1)	8		Colorectal(252;0.178)		Epithelial(162;5.81e-10)|all cancers(201;2.35e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0165)		CTTCTAGCTCGAGAAGCTGCA	0.353													5	87	---	---	---	---	PASS
C10orf79	80217	broad.mit.edu	37	10	105921789	105921789	+	Missense_Mutation	SNP	G	T	T	rs145489927		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:105921789G>T	uc001kxw.2	-	26	3460	c.3344C>A	c.(3343-3345)ACA>AAA	p.T1115K	C10orf79_uc009xxq.2_Missense_Mutation_p.T423K	NM_025145	NP_079421	Q8NDM7	WDR96_HUMAN	hypothetical protein LOC80217	1115											0		Colorectal(252;0.178)		Epithelial(162;4.83e-10)|all cancers(201;2.26e-08)|BRCA - Breast invasive adenocarcinoma(275;0.0194)		TCGGAGTCTTGTACTGGCATC	0.468													7	154	---	---	---	---	PASS
PNLIPRP1	5407	broad.mit.edu	37	10	118352021	118352021	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118352021G>A	uc001lco.1	+	4	316	c.298G>A	c.(298-300)GGA>AGA	p.G100R	PNLIPRP1_uc001lcp.2_Missense_Mutation_p.G100R|PNLIPRP1_uc001lcn.2_Missense_Mutation_p.G100R|PNLIPRP1_uc009xys.1_RNA	NM_006229	NP_006220	P54315	LIPR1_HUMAN	pancreatic lipase-related protein 1 precursor	100					lipid metabolic process		calcium ion binding|triglyceride lipase activity			ovary(1)|breast(1)	2				all cancers(201;0.0161)		CATAGACAAAGGAGATGAGAG	0.483													32	62	---	---	---	---	PASS
PNLIPRP1	5407	broad.mit.edu	37	10	118352022	118352022	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:118352022G>T	uc001lco.1	+	4	317	c.299G>T	c.(298-300)GGA>GTA	p.G100V	PNLIPRP1_uc001lcp.2_Missense_Mutation_p.G100V|PNLIPRP1_uc001lcn.2_Missense_Mutation_p.G100V|PNLIPRP1_uc009xys.1_RNA	NM_006229	NP_006220	P54315	LIPR1_HUMAN	pancreatic lipase-related protein 1 precursor	100					lipid metabolic process		calcium ion binding|triglyceride lipase activity			ovary(1)|breast(1)	2				all cancers(201;0.0161)		ATAGACAAAGGAGATGAGAGC	0.478													32	61	---	---	---	---	PASS
DMBT1	1755	broad.mit.edu	37	10	124399962	124399962	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124399962G>T	uc001lgk.1	+	52	7068	c.6962G>T	c.(6961-6963)AGT>ATT	p.S2321I	DMBT1_uc001lgl.1_Missense_Mutation_p.S2311I|DMBT1_uc001lgm.1_Missense_Mutation_p.S1693I|DMBT1_uc009xzz.1_Missense_Mutation_p.S2320I|DMBT1_uc010qtx.1_Missense_Mutation_p.S1041I|DMBT1_uc009yab.1_Missense_Mutation_p.S1024I|DMBT1_uc009yac.1_Missense_Mutation_p.S615I	NM_007329	NP_015568	Q9UGM3	DMBT1_HUMAN	deleted in malignant brain tumors 1 isoform b	2321	ZP.				epithelial cell differentiation|induction of bacterial agglutination|innate immune response|interspecies interaction between organisms|protein transport|response to virus	extrinsic to membrane|phagocytic vesicle membrane|zymogen granule membrane	calcium-dependent protein binding|Gram-negative bacterial cell surface binding|Gram-positive bacterial cell surface binding|pattern recognition receptor activity|scavenger receptor activity|zymogen binding			central_nervous_system(7)	7		all_neural(114;0.0765)|Lung NSC(174;0.132)|all_lung(145;0.163)|Breast(234;0.238)				CTAATCCGGAGTGGGTAAGGA	0.433													4	21	---	---	---	---	PASS
BUB3	9184	broad.mit.edu	37	10	124921780	124921780	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:124921780G>T	uc001lhe.2	+	6	847	c.605G>T	c.(604-606)CGA>CTA	p.R202L	BUB3_uc009yah.2_Missense_Mutation_p.R154L|BUB3_uc001lhf.3_Missense_Mutation_p.R202L|BUB3_uc001lhd.2_Missense_Mutation_p.R202L|BUB3_uc010qud.1_Missense_Mutation_p.R122L	NM_004725	NP_004716	O43684	BUB3_HUMAN	budding uninhibited by benzimidazoles 3 isoform	202					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|attachment of spindle microtubules to kinetochore|cell division|meiosis|mitotic cell cycle spindle assembly checkpoint|mitotic prometaphase|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	condensed chromosome kinetochore|cytosol|nucleus	protein binding			ovary(1)	1		all_neural(114;0.0765)|Colorectal(57;0.102)|all_lung(145;0.11)|Lung NSC(174;0.163)				ATTGAAGGCCGAGTGGCAGTT	0.393													8	191	---	---	---	---	PASS
MKI67	4288	broad.mit.edu	37	10	129903464	129903464	+	Nonsense_Mutation	SNP	C	A	A	rs148027445		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:129903464C>A	uc001lke.2	-	13	6835	c.6640G>T	c.(6640-6642)GAG>TAG	p.E2214*	MKI67_uc001lkf.2_Nonsense_Mutation_p.E1854*|MKI67_uc009yav.1_Nonsense_Mutation_p.E1789*|MKI67_uc009yaw.1_Nonsense_Mutation_p.E1364*	NM_002417	NP_002408	P46013	KI67_HUMAN	antigen identified by monoclonal antibody Ki-67	2214	16 X 122 AA approximate repeats.|11.				cell proliferation	nucleolus	ATP binding|protein C-terminus binding			ovary(4)|central_nervous_system(2)|skin(1)	7		all_epithelial(44;2.12e-05)|all_lung(145;0.00679)|Lung NSC(174;0.00998)|all_neural(114;0.0936)|Colorectal(57;0.14)|Breast(234;0.166)|Melanoma(40;0.203)				GTAGTTTTCTCATGAGTCGTG	0.498													11	163	---	---	---	---	PASS
GLRX3	10539	broad.mit.edu	37	10	131959237	131959237	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:131959237G>T	uc001lkm.1	+	4	476	c.454G>T	c.(454-456)GGA>TGA	p.G152*	GLRX3_uc001lkn.1_Nonsense_Mutation_p.G152*|GLRX3_uc001lko.2_RNA	NM_006541	NP_006532	O76003	GLRX3_HUMAN	glutaredoxin 3	152	Glutaredoxin 1.				cell redox homeostasis|negative regulation of cardiac muscle hypertrophy|regulation of the force of heart contraction	cell cortex	electron carrier activity|iron-sulfur cluster binding|metal ion binding|protein disulfide oxidoreductase activity				0		all_cancers(35;9.59e-07)|all_epithelial(44;1.48e-06)|Lung NSC(174;0.00566)|all_lung(145;0.00949)|Colorectal(57;0.142)|all_neural(114;0.16)|Breast(234;0.173)|Glioma(114;0.222)		OV - Ovarian serous cystadenocarcinoma(35;0.00218)		GTTTATGAAAGGAACTCCTCA	0.453													7	64	---	---	---	---	PASS
TNNT3	7140	broad.mit.edu	37	11	1946497	1946497	+	Intron	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:1946497C>T	uc001luu.3	+						TNNT3_uc001lun.2_Missense_Mutation_p.H27Y|TNNT3_uc001luw.3_Intron|TNNT3_uc001luo.3_Intron|TNNT3_uc001lup.3_Missense_Mutation_p.H27Y|TNNT3_uc001luq.3_Intron|TNNT3_uc001lur.2_Intron|TNNT3_uc010qxf.1_Missense_Mutation_p.H27Y|TNNT3_uc010qxg.1_Intron|TNNT3_uc001lut.1_RNA|TNNT3_uc001lus.1_RNA	NM_006757	NP_006748	P45378	TNNT3_HUMAN	troponin T3, skeletal, fast isoform 1						muscle filament sliding|regulation of ATPase activity|regulation of striated muscle contraction|skeletal muscle contraction	cytosol|troponin complex	calcium-dependent protein binding|tropomyosin binding|troponin C binding|troponin I binding			ovary(1)	1		all_epithelial(84;0.000138)|Breast(177;0.000962)|Ovarian(85;0.0014)|Medulloblastoma(188;0.0109)|all_neural(188;0.0299)|Lung NSC(207;0.229)		BRCA - Breast invasive adenocarcinoma(625;0.00253)|Lung(200;0.0333)|LUSC - Lung squamous cell carcinoma(625;0.0826)		TGCAGAAGTCCATGAGGAAGG	0.647													4	9	---	---	---	---	PASS
CD81	975	broad.mit.edu	37	11	2415351	2415351	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:2415351G>A	uc001lwf.1	+	3	441	c.208G>A	c.(208-210)GCT>ACT	p.A70T	CD81_uc001lwg.1_Missense_Mutation_p.A63T|CD81_uc001lwh.1_5'Flank	NM_004356	NP_004347	P60033	CD81_HUMAN	CD81 antigen	70	Helical; (Potential).				activation of MAPK activity|cell proliferation|phosphatidylinositol biosynthetic process|positive regulation of 1-phosphatidylinositol 4-kinase activity|positive regulation of cell proliferation|positive regulation of peptidyl-tyrosine phosphorylation|protein localization|regulation of immune response|virion attachment, binding of host cell surface receptor	integral to plasma membrane	protein binding				0		all_epithelial(84;0.000161)|Breast(177;0.000962)|Medulloblastoma(188;0.00106)|Ovarian(85;0.0014)|all_neural(188;0.0137)|Lung NSC(207;0.209)		BRCA - Breast invasive adenocarcinoma(625;0.000338)|LUSC - Lung squamous cell carcinoma(625;0.191)		CGCTGTGGGCGCTGTCATGAT	0.652													5	27	---	---	---	---	PASS
OR52I2	143502	broad.mit.edu	37	11	4608225	4608225	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4608225G>T	uc010qyh.1	+	1	183	c.183G>T	c.(181-183)CTG>CTT	p.L61L		NM_001005170	NP_001005170	Q8NH67	O52I2_HUMAN	olfactory receptor, family 52, subfamily I,	61	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			pancreas(1)	1		Medulloblastoma(188;0.0075)|Breast(177;0.0461)|all_neural(188;0.0577)		Epithelial(150;8.45e-12)|BRCA - Breast invasive adenocarcinoma(625;0.0285)|LUSC - Lung squamous cell carcinoma(625;0.19)		CTATCTCACTGAGTGCCATGT	0.498													7	133	---	---	---	---	PASS
OR52I2	143502	broad.mit.edu	37	11	4608295	4608295	+	Silent	SNP	C	A	A	rs140300674	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:4608295C>A	uc010qyh.1	+	1	253	c.253C>A	c.(253-255)CGG>AGG	p.R85R		NM_001005170	NP_001005170	Q8NH67	O52I2_HUMAN	olfactory receptor, family 52, subfamily I,	85	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			pancreas(1)	1		Medulloblastoma(188;0.0075)|Breast(177;0.0461)|all_neural(188;0.0577)		Epithelial(150;8.45e-12)|BRCA - Breast invasive adenocarcinoma(625;0.0285)|LUSC - Lung squamous cell carcinoma(625;0.19)		GGATTCCACTCGGCATGAGCC	0.498													6	135	---	---	---	---	PASS
OR52D1	390066	broad.mit.edu	37	11	5510553	5510553	+	Missense_Mutation	SNP	C	A	A	rs142747961	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:5510553C>A	uc010qzg.1	+	1	617	c.617C>A	c.(616-618)GCT>GAT	p.A206D	HBG2_uc001mak.1_Intron|HBE1_uc001mam.1_Intron|OR51B5_uc001maq.1_Intron	NM_001005163	NP_001005163	Q9H346	O52D1_HUMAN	olfactory receptor, family 52, subfamily D,	206	Helical; Name=5; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			central_nervous_system(1)	1		Medulloblastoma(188;0.0075)|all_neural(188;0.0572)|Breast(177;0.0675)		Epithelial(150;3.46e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)		CTAACTGTGGCTCTGCTGGCC	0.493													20	102	---	---	---	---	PASS
APBB1	322	broad.mit.edu	37	11	6422308	6422308	+	Intron	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6422308G>A	uc001mdb.1	-						APBB1_uc001mcz.1_Intron|APBB1_uc001mdd.3_Intron|APBB1_uc001mda.2_Intron|APBB1_uc001mdc.1_Intron|APBB1_uc010rab.1_Intron|APBB1_uc010rac.1_RNA|APBB1_uc010rad.1_3'UTR	NM_001164	NP_001155	O00213	APBB1_HUMAN	amyloid beta A4 precursor protein-binding,						apoptosis|axonogenesis|cell cycle arrest|histone H4 acetylation|negative regulation of cell growth|negative regulation of S phase of mitotic cell cycle|negative regulation of thymidylate synthase biosynthetic process|positive regulation of apoptosis|positive regulation of transcription, DNA-dependent|response to DNA damage stimulus|signal transduction|transcription, DNA-dependent	cytoplasm|growth cone|lamellipodium|nucleus|plasma membrane|synapse	beta-amyloid binding|chromatin binding|histone binding|proline-rich region binding|transcription factor binding			breast(2)	2		Medulloblastoma(188;0.00263)|all_neural(188;0.026)|Breast(177;0.029)		Epithelial(150;6.49e-08)|BRCA - Breast invasive adenocarcinoma(625;0.194)		TTCCACTATGGGAAAGAAGAG	0.522													21	68	---	---	---	---	PASS
DNHD1	144132	broad.mit.edu	37	11	6519958	6519958	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6519958G>T	uc001mdw.3	+	3	1077	c.513G>T	c.(511-513)CAG>CAT	p.Q171H	DNHD1_uc001mdp.2_Missense_Mutation_p.Q171H	NM_144666	NP_653267	Q96M86	DNHD1_HUMAN	dynein heavy chain domain 1 isoform 1	171					microtubule-based movement	dynein complex	microtubule motor activity			ovary(2)	2		Medulloblastoma(188;0.00776)|all_neural(188;0.0652)|Breast(177;0.171)		Epithelial(150;3.93e-08)|BRCA - Breast invasive adenocarcinoma(625;0.13)		TGCAGGCCCAGTGGAGCAGGC	0.607													5	58	---	---	---	---	PASS
RRP8	23378	broad.mit.edu	37	11	6621950	6621950	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6621950C>T	uc001med.2	-	5	1182	c.1103G>A	c.(1102-1104)GGA>GAA	p.G368E		NM_015324	NP_056139	O43159	RRP8_HUMAN	ribosomal RNA processing 8, methyltransferase,	368					chromatin modification|chromatin silencing at rDNA|rRNA processing|transcription, DNA-dependent	chromatin silencing complex|nucleolus|rDNA heterochromatin	methylated histone residue binding|S-adenosylmethionine-dependent methyltransferase activity				0						GATGTTGGTTCCCATCAGTGA	0.493													10	66	---	---	---	---	PASS
DCHS1	8642	broad.mit.edu	37	11	6650040	6650040	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:6650040G>T	uc001mem.1	-	13	5593	c.5183C>A	c.(5182-5184)TCA>TAA	p.S1728*		NM_003737	NP_003728	Q96JQ0	PCD16_HUMAN	dachsous 1 precursor	1728	Cadherin 16.|Extracellular (Potential).				calcium-dependent cell-cell adhesion|homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(3)|large_intestine(1)|pancreas(1)	5		Medulloblastoma(188;0.00263)|all_neural(188;0.026)		Epithelial(150;6.35e-09)|BRCA - Breast invasive adenocarcinoma(625;0.135)		CTGAGGAGGTGAGCCCCTGTC	0.527													4	7	---	---	---	---	PASS
STK33	65975	broad.mit.edu	37	11	8486319	8486319	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:8486319G>T	uc001mgi.1	-	3	1309	c.390C>A	c.(388-390)GTC>GTA	p.V130V	STK33_uc001mgj.1_Silent_p.V130V|STK33_uc001mgk.1_Silent_p.V130V|STK33_uc010rbn.1_Silent_p.V89V|STK33_uc001mgl.3_5'UTR|STK33_uc009yfp.2_Intron	NM_030906	NP_112168	Q9BYT3	STK33_HUMAN	serine/threonine kinase 33	130	Protein kinase.|ATP (By similarity).					Golgi apparatus|nucleus|perinuclear region of cytoplasm	ATP binding|protein serine/threonine kinase activity			ovary(2)|lung(2)|pancreas(1)|central_nervous_system(1)|skin(1)	7				Epithelial(150;2.13e-06)|BRCA - Breast invasive adenocarcinoma(625;0.239)		TCGCTTCAATGACTATTCCAA	0.388													7	111	---	---	---	---	PASS
CTR9	9646	broad.mit.edu	37	11	10777349	10777349	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:10777349G>T	uc001mja.2	+							NM_014633	NP_055448	Q6PD62	CTR9_HUMAN	SH2 domain binding protein 1						histone H2B ubiquitination|histone monoubiquitination	Cdc73/Paf1 complex|nuclear speck				ovary(2)	2				all cancers(16;1.64e-07)|Epithelial(150;2.47e-07)|BRCA - Breast invasive adenocarcinoma(625;0.111)		CTTGGTAAGTGGTCTTTGGCA	0.388													6	74	---	---	---	---	PASS
NUCB2	4925	broad.mit.edu	37	11	17333433	17333433	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17333433G>T	uc001mmw.2	+	9	1020	c.775G>T	c.(775-777)GGA>TGA	p.G259*	NUCB2_uc001mmv.1_Nonsense_Mutation_p.G259*|NUCB2_uc009ygz.2_Nonsense_Mutation_p.G259*	NM_005013	NP_005004	P80303	NUCB2_HUMAN	nucleobindin 2 precursor	259	1.|Binds to necdin (By similarity).|EF-hand 1.					cytosol|ER-Golgi intermediate compartment|extracellular space|Golgi apparatus|plasma membrane	calcium ion binding|DNA binding				0						CAATAGTGATGGATTCCTGGA	0.264													10	227	---	---	---	---	PASS
USH1C	10083	broad.mit.edu	37	11	17526211	17526211	+	Intron	SNP	G	T	T	rs146451547	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17526211G>T	uc001mnf.2	-						USH1C_uc001mne.2_Missense_Mutation_p.Q723K|USH1C_uc009yhb.2_Intron|USH1C_uc001mng.2_Intron|USH1C_uc001mnd.2_Intron	NM_005709	NP_005700	Q9Y6N9	USH1C_HUMAN	harmonin isoform a						equilibrioception|G2/M transition of mitotic cell cycle|photoreceptor cell maintenance|sensory perception of sound	apical part of cell|cytoplasm|stereocilium	protein binding			ovary(1)	1						AATGCTGTCTGATAAACCACC	0.502											OREG0020811	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	5	40	---	---	---	---	PASS
USH1C	10083	broad.mit.edu	37	11	17554802	17554802	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:17554802T>C	uc001mnf.2	-	2	213	c.104A>G	c.(103-105)CAG>CGG	p.Q35R	USH1C_uc001mne.2_Missense_Mutation_p.Q35R|USH1C_uc009yhb.2_Missense_Mutation_p.Q35R|USH1C_uc001mng.2_RNA|USH1C_uc001mnd.2_5'UTR	NM_005709	NP_005700	Q9Y6N9	USH1C_HUMAN	harmonin isoform a	35					equilibrioception|G2/M transition of mitotic cell cycle|photoreceptor cell maintenance|sensory perception of sound	apical part of cell|cytoplasm|stereocilium	protein binding			ovary(1)	1						GCACACTTACTGGTGGTACAT	0.502													4	23	---	---	---	---	PASS
NELL1	4745	broad.mit.edu	37	11	21592429	21592429	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:21592429C>A	uc001mqe.2	+	18	2253	c.2100C>A	c.(2098-2100)CAC>CAA	p.H700Q	NELL1_uc001mqf.2_Missense_Mutation_p.H653Q|NELL1_uc009yid.2_Missense_Mutation_p.H728Q|NELL1_uc010rdo.1_Missense_Mutation_p.H643Q|NELL1_uc010rdp.1_Missense_Mutation_p.H413Q|NELL1_uc001mqh.2_Missense_Mutation_p.H245Q	NM_006157	NP_006148	Q92832	NELL1_HUMAN	nel-like 1 isoform 1 precursor	700	VWFC 4.				cell adhesion|nervous system development	extracellular region	calcium ion binding|structural molecule activity			ovary(2)|large_intestine(1)	3						AAAATGGTCACAAGCTGTATC	0.463													6	116	---	---	---	---	PASS
FANCF	2188	broad.mit.edu	37	11	22646316	22646316	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:22646316C>A	uc001mql.1	-	1	1072	c.1041G>T	c.(1039-1041)TGG>TGT	p.W347C		NM_022725	NP_073562	Q9NPI8	FANCF_HUMAN	Fanconi anemia, complementation group F	347					DNA repair	nucleoplasm	protein binding			skin(1)	1						AGAGGTCTGTCCAGATGCTAA	0.468			N|F			AML|leukemia		Direct_reversal_of_damage|Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia		OREG0020844	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	11	110	---	---	---	---	PASS
SLC5A12	159963	broad.mit.edu	37	11	26718757	26718757	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:26718757C>A	uc001mra.2	-	8	1307	c.994G>T	c.(994-996)GGA>TGA	p.G332*	SLC5A12_uc001mrb.2_RNA|SLC5A12_uc001mrc.3_Nonsense_Mutation_p.G332*	NM_178498	NP_848593	Q1EHB4	SC5AC_HUMAN	solute carrier family 5 (sodium/glucose	332	Helical; (Potential).				sodium ion transport	apical plasma membrane|integral to membrane	symporter activity			ovary(1)|skin(1)	2						CCTGGCAGTCCTGGCATTGTG	0.358													7	112	---	---	---	---	PASS
EIF3M	10480	broad.mit.edu	37	11	32616471	32616471	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:32616471G>T	uc001mtu.2	+	7	672	c.629G>T	c.(628-630)CGA>CTA	p.R210L	EIF3M_uc010ref.1_Missense_Mutation_p.R78L	NM_006360	NP_006351	Q7L2H7	EIF3M_HUMAN	eukaryotic translation initiation factor 3,	210				RA -> EP (in Ref. 2; AAC17108).		eukaryotic translation initiation factor 3 complex	protein binding|translation initiation factor activity			ovary(1)|breast(1)|skin(1)	3	Breast(20;0.109)					TGTATTGTACGAGCATTGAAA	0.328													5	85	---	---	---	---	PASS
CCDC73	493860	broad.mit.edu	37	11	32697516	32697516	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:32697516G>T	uc001mtv.2	-	8	525	c.481C>A	c.(481-483)CTG>ATG	p.L161M	CCDC73_uc001mtw.1_Missense_Mutation_p.L161M	NM_001008391	NP_001008392	Q6ZRK6	CCD73_HUMAN	sarcoma antigen NY-SAR-79	161	Potential.									ovary(1)|central_nervous_system(1)	2	Breast(20;0.112)					ATTTCACTCAGTTGCTTATGA	0.308													6	125	---	---	---	---	PASS
QSER1	79832	broad.mit.edu	37	11	32997982	32997982	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:32997982G>T	uc001mty.2	+	13	5437	c.5170G>T	c.(5170-5172)GGA>TGA	p.G1724*	QSER1_uc001mtz.1_Nonsense_Mutation_p.G1485*	NM_001076786	NP_001070254	Q2KHR3	QSER1_HUMAN	glutamine and serine rich 1	1724										ovary(3)|central_nervous_system(2)|skin(1)	6	Breast(20;0.158)					TGAAAAATTTGGAGAACTTCT	0.353													20	68	---	---	---	---	PASS
API5	8539	broad.mit.edu	37	11	43348096	43348096	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:43348096G>T	uc010rfh.1	+	7	963	c.790G>T	c.(790-792)GAG>TAG	p.E264*	API5_uc010rfg.1_Nonsense_Mutation_p.E253*|API5_uc001mxf.2_Nonsense_Mutation_p.E264*|API5_uc010rfi.1_Nonsense_Mutation_p.E210*|API5_uc001mxg.2_Nonsense_Mutation_p.E138*	NM_001142930	NP_001136402	Q9BZZ5	API5_HUMAN	apoptosis inhibitor 5 isoform a	264					anti-apoptosis|apoptosis	cytoplasm|spliceosomal complex	fibroblast growth factor binding			large_intestine(1)|ovary(1)|central_nervous_system(1)	3						ATATTTCTGTGAGCAGGTTCT	0.388													8	186	---	---	---	---	PASS
ALKBH3	221120	broad.mit.edu	37	11	43923276	43923276	+	Splice_Site	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:43923276G>T	uc001mxs.2	+	8	1112	c.669_splice	c.e8+1	p.P223_splice	ALKBH3_uc009ykp.2_Splice_Site|ALKBH3_uc001mxt.2_Splice_Site|ALKBH3_uc009ykq.2_Splice_Site_p.P76_splice	NM_139178	NP_631917	Q96Q83	ALKB3_HUMAN	AlkB homolog 3						DNA dealkylation involved in DNA repair|oxidative single-stranded DNA demethylation	mitochondrion|nucleoplasm	damaged DNA binding|DNA-N1-methyladenine dioxygenase activity|ferrous iron binding|L-ascorbic acid binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen				0					Vitamin C(DB00126)	GCCACCACCAGTGAGTATTCT	0.433								Direct_reversal_of_damage					7	76	---	---	---	---	PASS
ACCS	84680	broad.mit.edu	37	11	44098922	44098922	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:44098922G>T	uc009yks.1	+	7	794	c.650G>T	c.(649-651)AGT>ATT	p.S217I	EXT2_uc010rfo.1_Intron|ACCS_uc010rfm.1_Missense_Mutation_p.Q129H|ACCS_uc010rfn.1_3'UTR|ACCS_uc001mxx.2_Missense_Mutation_p.S217I	NM_001127219	NP_001120691	Q96QU6	1A1L1_HUMAN	1-aminocyclopropane-1-carboxylate synthase	217							1-aminocyclopropane-1-carboxylate synthase activity|protein homodimerization activity|pyridoxal phosphate binding|transferase activity, transferring nitrogenous groups			breast(2)|ovary(1)|lung(1)	4						TACCTGGACAGTGAGGTAAGA	0.562													5	63	---	---	---	---	PASS
OR4A15	81328	broad.mit.edu	37	11	55136162	55136162	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55136162G>C	uc010rif.1	+	1	803	c.803G>C	c.(802-804)TGT>TCT	p.C268S		NM_001005275	NP_001005275	Q8NGL6	O4A15_HUMAN	olfactory receptor, family 4, subfamily A,	268	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2						TTCTACACCTGTGCATCCCAC	0.423													12	81	---	---	---	---	PASS
OR8H3	390152	broad.mit.edu	37	11	55890145	55890145	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:55890145C>A	uc001nii.1	+	1	297	c.297C>A	c.(295-297)GCC>GCA	p.A99A		NM_001005201	NP_001005201	Q8N146	OR8H3_HUMAN	olfactory receptor, family 8, subfamily H,	99	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)	2	Esophageal squamous(21;0.00693)					GCTGCTTTGCCCAGATGTTCT	0.443													17	202	---	---	---	---	PASS
CTNND1	1500	broad.mit.edu	37	11	57506250	57506250	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:57506250G>T	uc001nlf.1	+						TMX2_uc001nlc.1_Intron|TMX2_uc001nld.1_Intron|TMX2_uc001nle.1_Intron|C11orf31_uc010rjx.1_5'Flank	NM_001085462	NP_001078931	O60716	CTND1_HUMAN	catenin, delta 1 isoform 1A						adherens junction organization|cell junction assembly|negative regulation of canonical Wnt receptor signaling pathway|regulation of transcription, DNA-dependent|transcription, DNA-dependent|Wnt receptor signaling pathway	cytosol|midbody|nucleus	cadherin binding|protein binding|receptor binding			breast(4)|ovary(1)|kidney(1)	6		all_epithelial(135;0.155)				TAAGTGAGTAGTGCAAAGGGA	0.458													6	90	---	---	---	---	PASS
GLYATL1	92292	broad.mit.edu	37	11	58722700	58722700	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:58722700C>A	uc001nnf.2	+	7	741	c.365C>A	c.(364-366)TCA>TAA	p.S122*	uc001nng.1_Intron|GLYATL1_uc001nnh.1_Nonsense_Mutation_p.S153*|GLYATL1_uc001nni.1_Nonsense_Mutation_p.S122*|GLYATL1_uc001nnj.1_Nonsense_Mutation_p.S122*			Q969I3	GLYL1_HUMAN	SubName: Full=Glycine acyltransferase family-C; SubName: Full=Glycine-N-acyltransferase-like 1, isoform CRA_a;	122						mitochondrion	glycine N-acyltransferase activity			ovary(1)	1					Glycine(DB00145)	TTTTCAAAGTCAGTGAAAGTA	0.448													7	113	---	---	---	---	PASS
DDB1	1642	broad.mit.edu	37	11	61070621	61070621	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:61070621G>T	uc001nrc.3	-	23	3065	c.2839C>A	c.(2839-2841)CGA>AGA	p.R947R	DDB1_uc010rle.1_Silent_p.R258R|DDB1_uc010rlf.1_Silent_p.R947R	NM_001923	NP_001914	Q16531	DDB1_HUMAN	damage-specific DNA binding protein 1	947	Interaction with CDT1 and CUL4A.				cell cycle checkpoint|interspecies interaction between organisms|nucleotide-excision repair, DNA damage removal|proteasomal ubiquitin-dependent protein catabolic process|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	Cul4A-RING ubiquitin ligase complex|Cul4B-RING ubiquitin ligase complex|cytoplasm|nucleoplasm	damaged DNA binding|protein binding			ovary(2)|lung(1)|central_nervous_system(1)	4						TTAAAGTCTCGAGCAATCTTA	0.418								NER					7	101	---	---	---	---	PASS
MALAT1	378938	broad.mit.edu	37	11	65266456	65266456	+	RNA	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:65266456G>T	uc010roh.1	+	1		c.1224G>T				NR_002819				Homo sapiens clone alpha1 mRNA sequence.												0						GAAGGTGATCGAATTCCGGTG	0.498													6	111	---	---	---	---	PASS
PACS1	55690	broad.mit.edu	37	11	66006656	66006656	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66006656C>A	uc001oha.1	+	21	2471	c.2337C>A	c.(2335-2337)TCC>TCA	p.S779S	PACS1_uc010rou.1_Silent_p.S315S	NM_018026	NP_060496	Q6VY07	PACS1_HUMAN	phosphofurin acidic cluster sorting protein 1	779					interspecies interaction between organisms|regulation of defense response to virus by virus|viral reproduction	cytosol	protein binding			ovary(6)	6						CTGTGCCCTCCACATCACCAC	0.617													5	31	---	---	---	---	PASS
TBX10	347853	broad.mit.edu	37	11	67400523	67400523	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:67400523C>A	uc001omp.2	-	5	689	c.601G>T	c.(601-603)GTG>TTG	p.V201L		NM_005995	NP_005986	O75333	TBX10_HUMAN	T-box 10	201	T-box.			FV -> LL (in Ref. 3; AAC23481).	anatomical structure morphogenesis|regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0						CGTGGGTCCACGAAGACCACG	0.562													5	90	---	---	---	---	PASS
TPCN2	219931	broad.mit.edu	37	11	68822717	68822717	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:68822717C>A	uc001oos.2	+	4	442	c.326C>A	c.(325-327)GCG>GAG	p.A109E	TPCN2_uc009ysk.1_RNA|TPCN2_uc001oor.2_Intron|TPCN2_uc010rqg.1_Missense_Mutation_p.A109E	NM_139075	NP_620714	Q8NHX9	TPC2_HUMAN	two pore segment channel 2	109	Extracellular (Potential).				cellular calcium ion homeostasis|smooth muscle contraction	endosome membrane|integral to membrane|lysosomal membrane	NAADP-sensitive calcium-release channel activity|voltage-gated calcium channel activity				0			STAD - Stomach adenocarcinoma(18;0.0208)|LUAD - Lung adenocarcinoma(13;0.0713)			ACCAGCACGGCGGACGTGCGC	0.587													18	46	---	---	---	---	PASS
FCHSD2	9873	broad.mit.edu	37	11	72695219	72695219	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:72695219C>A	uc009ytl.2	-	8	840	c.619G>T	c.(619-621)GCA>TCA	p.A207S	FCHSD2_uc010rrg.1_Missense_Mutation_p.A47S|FCHSD2_uc001oth.3_Missense_Mutation_p.A151S|FCHSD2_uc001oti.2_Missense_Mutation_p.A166S	NM_014824	NP_055639	O94868	FCSD2_HUMAN	FCH and double SH3 domains 2	207							protein binding			ovary(1)	1			BRCA - Breast invasive adenocarcinoma(5;3.3e-05)			TCATTCCTTGCGTGGGTAGCT	0.373													16	51	---	---	---	---	PASS
P2RY6	5031	broad.mit.edu	37	11	73007627	73007627	+	Nonsense_Mutation	SNP	G	T	T	rs61745521	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:73007627G>T	uc001otm.2	+	4	469	c.64G>T	c.(64-66)GAG>TAG	p.E22*	P2RY6_uc001otn.2_Nonsense_Mutation_p.E22*|P2RY6_uc001oto.2_Nonsense_Mutation_p.E22*|P2RY6_uc001otp.2_Nonsense_Mutation_p.E22*|P2RY6_uc001otq.2_Nonsense_Mutation_p.E22*|P2RY6_uc001otr.2_Nonsense_Mutation_p.E22*|P2RY6_uc001ots.2_Nonsense_Mutation_p.E22*	NM_176796	NP_789766	Q15077	P2RY6_HUMAN	pyrimidinergic receptor P2Y6	22	Extracellular (Potential).				activation of phospholipase C activity by G-protein coupled receptor protein signaling pathway coupled to IP3 second messenger	integral to plasma membrane	purinergic nucleotide receptor activity, G-protein coupled			ovary(1)	1						TGTCTACCGCGAGAACTTCAA	0.607													5	83	---	---	---	---	PASS
MOGAT2	80168	broad.mit.edu	37	11	75442295	75442295	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:75442295C>G	uc010rru.1	+	6	969	c.969C>G	c.(967-969)TTC>TTG	p.F323L	MOGAT2_uc010rrv.1_Missense_Mutation_p.F241L	NM_025098	NP_079374	Q3SYC2	MOGT2_HUMAN	monoacylglycerol O-acyltransferase 2	323					glycerol metabolic process	endoplasmic reticulum membrane|integral to membrane	2-acylglycerol O-acyltransferase activity			ovary(2)	2	Ovarian(111;0.103)					AACTTAAGTTCAACATCCCTG	0.552													3	42	---	---	---	---	PASS
GDPD4	220032	broad.mit.edu	37	11	76969502	76969502	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:76969502C>A	uc001oyf.2	-	10	1044	c.793G>T	c.(793-795)GAG>TAG	p.E265*		NM_182833	NP_878253	Q6W3E5	GDPD4_HUMAN	glycerophosphodiester phosphodiesterase domain	265	GDPD.|Extracellular (Potential).				glycerol metabolic process|lipid metabolic process	integral to membrane	glycerophosphodiester phosphodiesterase activity|metal ion binding			skin(1)	1						GCAGGGTTCTCGCAGGCAGAT	0.458													7	135	---	---	---	---	PASS
TYR	7299	broad.mit.edu	37	11	88911731	88911731	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:88911731G>A	uc001pcs.2	+	1	692	c.610G>A	c.(610-612)GCA>ACA	p.A204T		NM_000372	NP_000363	P14679	TYRO_HUMAN	tyrosinase precursor	204	Lumenal, melanosome (Potential).				eye pigment biosynthetic process|melanin biosynthetic process from tyrosine|visual perception	Golgi-associated vesicle|integral to membrane|lysosome|melanosome membrane|perinuclear region of cytoplasm	copper ion binding|monophenol monooxygenase activity|protein heterodimerization activity|protein homodimerization activity			ovary(2)|central_nervous_system(1)	3		Acute lymphoblastic leukemia(157;2.33e-05)|all_hematologic(158;0.0033)			Azelaic Acid(DB00548)|Mimosine(DB01055)|NADH(DB00157)	TGCCCATGAAGCACCAGCTTT	0.428									Oculocutaneous_Albinism				23	87	---	---	---	---	PASS
ANKRD49	54851	broad.mit.edu	37	11	94230054	94230054	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:94230054G>T	uc001pew.2	+	2	334	c.195G>T	c.(193-195)TTG>TTT	p.L65F	ANKRD49_uc001pex.2_Missense_Mutation_p.L65F|ANKRD49_uc001pey.2_5'Flank	NM_017704	NP_060174	Q8WVL7	ANR49_HUMAN	fetal globin inducing factor	65					positive regulation of transcription, DNA-dependent					central_nervous_system(1)	1		Acute lymphoblastic leukemia(157;2.31e-05)|all_hematologic(158;0.00824)				GGTATCGATTGCAAGAAAAAA	0.388													18	80	---	---	---	---	PASS
AMOTL1	154810	broad.mit.edu	37	11	94563321	94563321	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:94563321G>T	uc001pfb.2	+	5	1689	c.1519G>T	c.(1519-1521)GAG>TAG	p.E507*	AMOTL1_uc001pfc.2_Nonsense_Mutation_p.E457*	NM_130847	NP_570899	Q8IY63	AMOL1_HUMAN	angiomotin like 1	507	Potential.					cytoplasm|tight junction	identical protein binding			ovary(1)|breast(1)	2		Acute lymphoblastic leukemia(157;2.38e-05)|all_hematologic(158;0.00824)				ATTGGAAGGCGAGATTAGAAG	0.418													4	29	---	---	---	---	PASS
MTMR2	8898	broad.mit.edu	37	11	95580966	95580966	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:95580966C>A	uc001pfu.2	-	10	1344	c.1091G>T	c.(1090-1092)CGA>CTA	p.R364L	MTMR2_uc001pfv.2_Missense_Mutation_p.R292L|MTMR2_uc001pfs.2_Missense_Mutation_p.R292L|MTMR2_uc001pft.2_Missense_Mutation_p.R292L|MTMR2_uc010ruj.1_Missense_Mutation_p.R347L	NM_016156	NP_057240	Q13614	MTMR2_HUMAN	myotubularin-related protein 2 isoform 1	364	Myotubularin phosphatase.					nucleus	inositol or phosphatidylinositol phosphatase activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity			pancreas(1)	1		Acute lymphoblastic leukemia(157;2.31e-05)|all_hematologic(158;0.00824)				CTTAAGTTTTCGTAATGATTC	0.398													5	84	---	---	---	---	PASS
BIRC2	329	broad.mit.edu	37	11	102221671	102221671	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:102221671C>A	uc001pgy.2	+	3	2391	c.992C>A	c.(991-993)CCA>CAA	p.P331Q	BIRC2_uc010ruq.1_Missense_Mutation_p.P282Q|BIRC2_uc010rur.1_Missense_Mutation_p.P331Q	NM_001166	NP_001157	Q13490	BIRC2_HUMAN	baculoviral IAP repeat-containing protein 2	331	BIR 3.				cell surface receptor linked signaling pathway|cellular component disassembly involved in apoptosis|positive regulation of I-kappaB kinase/NF-kappaB cascade|proteasomal ubiquitin-dependent protein catabolic process|protein polyubiquitination	CD40 receptor complex|cytosol|internal side of plasma membrane	protein N-terminus binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|lung(1)|breast(1)	3	all_cancers(8;0.00044)|all_epithelial(12;0.00348)|Lung NSC(15;0.227)	Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.0093)	Lung(13;0.109)|Epithelial(9;0.11)|LUSC - Lung squamous cell carcinoma(19;0.151)	BRCA - Breast invasive adenocarcinoma(274;0.0144)		AAGTGGTTTCCAAGGTAATTG	0.373													8	157	---	---	---	---	PASS
MMP8	4317	broad.mit.edu	37	11	102592222	102592222	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:102592222C>A	uc001phe.2	-	4	631	c.532G>T	c.(532-534)GGA>TGA	p.G178*	MMP8_uc010rut.1_Nonsense_Mutation_p.G113*|MMP8_uc010ruu.1_Nonsense_Mutation_p.G155*	NM_002424	NP_002415	P22894	MMP8_HUMAN	matrix metalloproteinase 8 preproprotein	178					collagen catabolic process|proteolysis	extracellular space|proteinaceous extracellular matrix	metalloendopeptidase activity|serine-type endopeptidase activity|zinc ion binding			ovary(3)|breast(1)	4	all_cancers(8;0.00092)|all_epithelial(12;0.00389)|Lung NSC(15;0.227)	all_hematologic(158;0.00092)|Acute lymphoblastic leukemia(157;0.000967)	Epithelial(9;0.0555)|Lung(13;0.0828)|LUSC - Lung squamous cell carcinoma(19;0.151)|all cancers(10;0.189)	BRCA - Breast invasive adenocarcinoma(274;0.0141)		GCAAGGATTCCATTGGGTCCA	0.428													6	56	---	---	---	---	PASS
AASDHPPT	60496	broad.mit.edu	37	11	105961333	105961333	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:105961333C>A	uc001pjc.1	+	3	605	c.459C>A	c.(457-459)ACC>ACA	p.T153T	AASDHPPT_uc010rvn.1_Intron|AASDHPPT_uc001pjd.1_Silent_p.T6T	NM_015423	NP_056238	Q9NRN7	ADPPT_HUMAN	aminoadipate-semialdehyde	153					macromolecule biosynthetic process|pantothenate metabolic process	cytosol	holo-[acyl-carrier-protein] synthase activity|magnesium ion binding|protein binding				0		Melanoma(852;0.000878)|Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.0017)|Breast(348;0.0321)		BRCA - Breast invasive adenocarcinoma(274;5.78e-05)|Epithelial(105;0.00622)|all cancers(92;0.041)		GAAAGTTTACCAACAAAGAAT	0.289													8	174	---	---	---	---	PASS
CWF19L2	143884	broad.mit.edu	37	11	107288944	107288944	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:107288944G>A	uc010rvp.1	-	9	1533	c.1503C>T	c.(1501-1503)ATC>ATT	p.I501I	CWF19L2_uc001pjh.3_RNA|CWF19L2_uc009yxo.2_RNA	NM_152434	NP_689647	Q2TBE0	C19L2_HUMAN	CWF19-like 2, cell cycle control	501							catalytic activity				0		Melanoma(852;1.75e-05)|all_epithelial(67;6.27e-05)|Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.0017)|Breast(348;0.0258)		Epithelial(105;7.18e-06)|BRCA - Breast invasive adenocarcinoma(274;1.65e-05)|all cancers(92;1.76e-05)		TCTCTGCTTTGATAATCTTGG	0.363													19	50	---	---	---	---	PASS
NPAT	4863	broad.mit.edu	37	11	108044369	108044369	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:108044369G>A	uc001pjz.3	-	13	1444	c.1342C>T	c.(1342-1344)CCT>TCT	p.P448S	NPAT_uc001pka.2_Missense_Mutation_p.P243S	NM_002519	NP_002510	Q14207	NPAT_HUMAN	nuclear protein,  ataxia-telangiectasia locus	448					positive regulation of transcription, DNA-dependent|regulation of transcription involved in G1/S phase of mitotic cell cycle	Cajal body	protein C-terminus binding|protein N-terminus binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription corepressor activity			ovary(2)	2		all_cancers(61;2.31e-10)|all_epithelial(67;1.11e-06)|Melanoma(852;2.55e-06)|Acute lymphoblastic leukemia(157;3.95e-05)|all_hematologic(158;0.00014)|Breast(348;0.0258)|all_neural(303;0.072)		BRCA - Breast invasive adenocarcinoma(274;1.05e-05)|Epithelial(105;3.01e-05)|all cancers(92;0.000816)|Colorectal(284;0.116)		TTCAAATTAGGCACGGACTCA	0.368													14	96	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	11	113107031	113107031	+	IGR	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:113107031C>T								NCAM1 (-42126 upstream) : NCAM1 (-275036 downstream)																							AGATAGCCCTCCTCCACGTAA	0.388													6	49	---	---	---	---	PASS
DSCAML1	57453	broad.mit.edu	37	11	117647597	117647597	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:117647597G>A	uc001prh.1	-	3	602	c.600C>T	c.(598-600)AAC>AAT	p.N200N	DSCAML1_uc001pri.1_Silent_p.N4N	NM_020693	NP_065744	Q8TD84	DSCL1_HUMAN	Down syndrome cell adhesion molecule like 1	140	Extracellular (Potential).|Ig-like C2-type 2.				axonogenesis|brain development|cell fate determination|dorsal/ventral pattern formation|embryonic skeletal system morphogenesis|homophilic cell adhesion	cell surface|integral to membrane|plasma membrane	protein homodimerization activity			ovary(3)|large_intestine(2)|skin(2)|upper_aerodigestive_tract(1)	8	all_hematologic(175;0.0487)	Breast(348;0.0424)|Medulloblastoma(222;0.0523)|all_hematologic(192;0.232)		BRCA - Breast invasive adenocarcinoma(274;9.12e-06)|Epithelial(105;0.00172)		AGACGGCCACGTTGCCACGCA	0.517													4	24	---	---	---	---	PASS
TRAPPC4	51399	broad.mit.edu	37	11	118889906	118889906	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:118889906G>T	uc010ryo.1	+	2	494	c.229G>T	c.(229-231)GCC>TCC	p.A77S	RPS25_uc001pun.2_5'Flank|TRAPPC4_uc010ryn.1_Missense_Mutation_p.A77S|TRAPPC4_uc010ryp.1_Missense_Mutation_p.A77S|TRAPPC4_uc001pup.2_RNA|TRAPPC4_uc010ryq.1_Missense_Mutation_p.A77S	NM_016146	NP_057230	Q9Y296	TPPC4_HUMAN	trafficking protein particle complex 4	77					dendrite development|ER to Golgi vesicle-mediated transport	cis-Golgi network|dendrite|endoplasmic reticulum|Golgi stack|synaptic vesicle	protein binding				0	all_hematologic(175;0.0839)	Medulloblastoma(222;0.0523)|all_neural(223;0.224)|all_hematologic(192;0.243)		BRCA - Breast invasive adenocarcinoma(274;7.58e-05)		CAGGTACACGGCCGACGGGAA	0.567													5	22	---	---	---	---	PASS
THY1	7070	broad.mit.edu	37	11	119290994	119290994	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:119290994G>T	uc001pwq.2	-	2	174	c.140C>A	c.(139-141)CCC>CAC	p.P47H	uc001pwo.2_Intron|uc001pwp.1_Intron|THY1_uc001pwr.2_Missense_Mutation_p.P47H|THY1_uc001pws.2_RNA	NM_006288	NP_006279	P04216	THY1_HUMAN	Thy-1 cell surface antigen preproprotein	47	Ig-like V-type.				angiogenesis|cell-cell adhesion|cytoskeleton organization|focal adhesion assembly|negative regulation of axonogenesis|negative regulation of cell migration|negative regulation of protein kinase activity|negative regulation of T cell receptor signaling pathway|positive regulation of release of sequestered calcium ion into cytosol|positive regulation of T cell activation|retinal cone cell development|T cell receptor signaling pathway	endoplasmic reticulum|growth cone|integral to plasma membrane|membrane raft	GPI anchor binding|integrin binding|Rho GTPase activator activity				0		Medulloblastoma(222;0.0523)|Breast(348;0.174)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;3.83e-05)		GTACTGGATGGGTGAACTGCT	0.587													5	42	---	---	---	---	PASS
ARHGEF12	23365	broad.mit.edu	37	11	120329949	120329949	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:120329949G>T	uc001pxl.1	+	26	2454	c.2447G>T	c.(2446-2448)CGA>CTA	p.R816L	ARHGEF12_uc009zat.2_Missense_Mutation_p.R797L|ARHGEF12_uc010rzn.1_Missense_Mutation_p.R713L|ARHGEF12_uc009zau.1_Missense_Mutation_p.R713L	NM_015313	NP_056128	Q9NZN5	ARHGC_HUMAN	Rho guanine nucleotide exchange factor (GEF) 12	816	DH.				apoptosis|axon guidance|G-protein coupled receptor protein signaling pathway|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|membrane	G-protein-coupled receptor binding|GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			lung(2)|breast(2)|skin(2)|ovary(1)	7		Breast(109;0.000813)|Medulloblastoma(222;0.0425)|Hepatocellular(160;0.0831)|all_hematologic(192;0.107)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.231)		TTCTATCAGCGAGTATCCAGA	0.378			T	MLL	AML								7	140	---	---	---	---	PASS
ARHGEF12	23365	broad.mit.edu	37	11	120348243	120348243	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:120348243C>A	uc001pxl.1	+						ARHGEF12_uc009zat.2_Intron|ARHGEF12_uc010rzn.1_Silent_p.L1077L|ARHGEF12_uc009zau.1_Intron	NM_015313	NP_056128	Q9NZN5	ARHGC_HUMAN	Rho guanine nucleotide exchange factor (GEF) 12						apoptosis|axon guidance|G-protein coupled receptor protein signaling pathway|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cytosol|membrane	G-protein-coupled receptor binding|GTPase activator activity|Rho guanyl-nucleotide exchange factor activity			lung(2)|breast(2)|skin(2)|ovary(1)	7		Breast(109;0.000813)|Medulloblastoma(222;0.0425)|Hepatocellular(160;0.0831)|all_hematologic(192;0.107)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.231)		CAGGTACACTCTTCTGAAGAG	0.284			T	MLL	AML								6	57	---	---	---	---	PASS
TECTA	7007	broad.mit.edu	37	11	120996091	120996091	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:120996091C>T	uc010rzo.1	+	7	1284	c.1284C>T	c.(1282-1284)GCC>GCT	p.A428A		NM_005422	NP_005413	O75443	TECTA_HUMAN	tectorin alpha precursor	428	VWFD 1.				cell-matrix adhesion|sensory perception of sound	anchored to membrane|plasma membrane|proteinaceous extracellular matrix				breast(6)|ovary(2)|skin(2)	10	all_hematologic(175;0.208)	Breast(109;0.000766)|Medulloblastoma(222;0.0427)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;8.04e-06)|OV - Ovarian serous cystadenocarcinoma(223;0.166)		TATCTACTGCCGTGGAAACAG	0.473													6	160	---	---	---	---	PASS
UBASH3B	84959	broad.mit.edu	37	11	122646964	122646964	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:122646964C>A	uc001pyi.3	+	2	559	c.199C>A	c.(199-201)CAG>AAG	p.Q67K		NM_032873	NP_116262	Q8TF42	UBS3B_HUMAN	ubiquitin associated and SH3 domain containing,	67	UBA.					cytoplasm|nucleus	protein tyrosine phosphatase activity			central_nervous_system(1)	1		Breast(109;0.00254)|Medulloblastoma(222;0.00877)|Lung NSC(97;0.0183)|all_lung(97;0.0186)|all_neural(223;0.0381)|all_hematologic(192;0.104)		BRCA - Breast invasive adenocarcinoma(274;1.37e-05)|OV - Ovarian serous cystadenocarcinoma(99;0.0463)		AAGAAGTGTTCAGGCAGCATG	0.403													6	62	---	---	---	---	PASS
TMEM225	338661	broad.mit.edu	37	11	123756134	123756134	+	5'UTR	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123756134G>A	uc001pzi.2	-	1						NM_001013743	NP_001013765	Q6GV28	TM225_HUMAN	transmembrane protein 225							integral to membrane				upper_aerodigestive_tract(1)|pancreas(1)|skin(1)	3						ATGCACCATTGTGAGTGAAAA	0.393													9	23	---	---	---	---	PASS
OR10G4	390264	broad.mit.edu	37	11	123887073	123887073	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123887073G>T	uc010sac.1	+	1	792	c.792G>T	c.(790-792)ATG>ATT	p.M264I		NM_001004462	NP_001004462	Q8NGN3	O10G4_HUMAN	olfactory receptor, family 10, subfamily G,	264	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)|ovary(1)|central_nervous_system(1)	4		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0401)		CAGGCTCCATGGATGCCATGG	0.517													7	46	---	---	---	---	PASS
OR10G8	219869	broad.mit.edu	37	11	123900523	123900523	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:123900523C>A	uc001pzp.1	+	1	194	c.194C>A	c.(193-195)TCG>TAG	p.S65*		NM_001004464	NP_001004464	Q8NGN5	O10G8_HUMAN	olfactory receptor, family 10, subfamily G,	65	Helical; Name=2; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2		Breast(109;0.00867)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.22)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.0521)		ACCAACCTGTCGTTCATTGAC	0.532													5	59	---	---	---	---	PASS
EI24	9538	broad.mit.edu	37	11	125450000	125450000	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:125450000G>T	uc001qca.2	+	8	815	c.573G>T	c.(571-573)GTG>GTT	p.V191V	EI24_uc001qcb.2_Silent_p.V191V|EI24_uc010sbd.1_RNA|EI24_uc009zbl.2_Silent_p.V191V|EI24_uc001qcc.2_RNA|EI24_uc010sbe.1_Silent_p.V177V|EI24_uc010sbf.1_RNA	NM_004879	NP_004870	O14681	EI24_HUMAN	etoposide induced 2.4 isoform 1	191	Helical; (Potential).				apoptosis|autophagy|induction of apoptosis|negative regulation of cell growth	endoplasmic reticulum membrane|integral to membrane|nuclear membrane				ovary(1)	1	all_hematologic(175;0.228)	Breast(109;0.0021)|Lung NSC(97;0.0126)|all_lung(97;0.0132)|Medulloblastoma(222;0.0425)|all_neural(223;0.112)		BRCA - Breast invasive adenocarcinoma(274;5.64e-07)|OV - Ovarian serous cystadenocarcinoma(99;0.0975)		GAATGTTTGTGAGTCTCTTTC	0.433													8	177	---	---	---	---	PASS
WNK1	65125	broad.mit.edu	37	12	991098	991098	+	Silent	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:991098A>C	uc001qio.3	+	14	3738	c.3231A>C	c.(3229-3231)TCA>TCC	p.S1077S	WNK1_uc001qip.3_Silent_p.S830S|WNK1_uc001qir.3_Silent_p.S250S	NM_018979	NP_061852	Q9H4A3	WNK1_HUMAN	WNK lysine deficient protein kinase 1	1077					intracellular protein kinase cascade|ion transport|neuron development	cytoplasm	ATP binding|protein binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			stomach(6)|breast(6)|ovary(5)|lung(4)|large_intestine(1)|central_nervous_system(1)	23	all_cancers(10;0.00611)|all_epithelial(11;0.00825)|all_lung(10;0.0331)|Ovarian(42;0.0512)|Lung NSC(10;0.0632)		Epithelial(1;1.74e-08)|all cancers(1;7.04e-08)|OV - Ovarian serous cystadenocarcinoma(31;0.000423)|BRCA - Breast invasive adenocarcinoma(9;0.0149)|Colorectal(1;0.0197)			ATGTTGCTTCAGGTATGAGTG	0.393													10	40	---	---	---	---	PASS
WNK1	65125	broad.mit.edu	37	12	994585	994585	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:994585G>T	uc001qio.3	+	19	5122	c.4615G>T	c.(4615-4617)GGA>TGA	p.G1539*	WNK1_uc001qip.3_Nonsense_Mutation_p.G1292*|WNK1_uc001qir.3_Nonsense_Mutation_p.G712*	NM_018979	NP_061852	Q9H4A3	WNK1_HUMAN	WNK lysine deficient protein kinase 1	1539					intracellular protein kinase cascade|ion transport|neuron development	cytoplasm	ATP binding|protein binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			stomach(6)|breast(6)|ovary(5)|lung(4)|large_intestine(1)|central_nervous_system(1)	23	all_cancers(10;0.00611)|all_epithelial(11;0.00825)|all_lung(10;0.0331)|Ovarian(42;0.0512)|Lung NSC(10;0.0632)		Epithelial(1;1.74e-08)|all cancers(1;7.04e-08)|OV - Ovarian serous cystadenocarcinoma(31;0.000423)|BRCA - Breast invasive adenocarcinoma(9;0.0149)|Colorectal(1;0.0197)			CAGTACAACTGGATTGGCTTT	0.478													9	236	---	---	---	---	PASS
WNK1	65125	broad.mit.edu	37	12	1005356	1005356	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:1005356G>C	uc001qio.3	+	24	6210	c.5703G>C	c.(5701-5703)GAG>GAC	p.E1901D	WNK1_uc001qip.3_Missense_Mutation_p.E1653D|WNK1_uc001qir.3_Missense_Mutation_p.E1074D	NM_018979	NP_061852	Q9H4A3	WNK1_HUMAN	WNK lysine deficient protein kinase 1	1901					intracellular protein kinase cascade|ion transport|neuron development	cytoplasm	ATP binding|protein binding|protein kinase inhibitor activity|protein serine/threonine kinase activity			stomach(6)|breast(6)|ovary(5)|lung(4)|large_intestine(1)|central_nervous_system(1)	23	all_cancers(10;0.00611)|all_epithelial(11;0.00825)|all_lung(10;0.0331)|Ovarian(42;0.0512)|Lung NSC(10;0.0632)		Epithelial(1;1.74e-08)|all cancers(1;7.04e-08)|OV - Ovarian serous cystadenocarcinoma(31;0.000423)|BRCA - Breast invasive adenocarcinoma(9;0.0149)|Colorectal(1;0.0197)			GTAGTCCAGAGAGTACCTTGG	0.468													7	53	---	---	---	---	PASS
CD163L1	283316	broad.mit.edu	37	12	7550894	7550894	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:7550894A>C	uc001qsy.2	-	7	1721	c.1695T>G	c.(1693-1695)TGT>TGG	p.C565W	CD163L1_uc010sge.1_Missense_Mutation_p.C575W	NM_174941	NP_777601	Q9NR16	C163B_HUMAN	scavenger receptor cysteine-rich type 1	565	SRCR 5.|Extracellular (Potential).					extracellular region|integral to membrane|plasma membrane	scavenger receptor activity			ovary(8)|skin(2)|central_nervous_system(1)	11						CTCTGTGTACACAATTATGCT	0.378													17	82	---	---	---	---	PASS
NECAP1	25977	broad.mit.edu	37	12	8242616	8242616	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:8242616C>A	uc001qtx.2	+	2	258	c.180C>A	c.(178-180)CTC>CTA	p.L60L	NECAP1_uc001qty.2_5'UTR	NM_015509	NP_056324	Q8NC96	NECP1_HUMAN	NECAP endocytosis associated 1	60					endocytosis|protein transport	clathrin coated vesicle membrane|plasma membrane				ovary(1)	1				Kidney(36;0.0915)		ATATCAAACTCGAGGATAAAG	0.428													5	96	---	---	---	---	PASS
CLEC6A	93978	broad.mit.edu	37	12	8608750	8608750	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:8608750C>A	uc001qum.1	+							NM_001007033	NP_001007034	Q6EIG7	CLC6A_HUMAN	dectin-2						defense response to fungus|innate immune response|positive regulation of cytokine secretion|positive regulation of I-kappaB kinase/NF-kappaB cascade	integral to membrane	sugar binding			breast(1)	1	Lung SC(5;0.184)					TGAGTATTTCCTCAGTTTCAG	0.443													7	119	---	---	---	---	PASS
CSDA	8531	broad.mit.edu	37	12	10853928	10853928	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:10853928C>A	uc001qyt.2	-	9	1321	c.1078G>T	c.(1078-1080)GAG>TAG	p.E360*	CSDA_uc001qyu.2_Nonsense_Mutation_p.E291*	NM_003651	NP_003642	P16989	DBPA_HUMAN	cold shock domain protein A isoform a	360					negative regulation of transcription from RNA polymerase II promoter|response to cold	cytoplasm|nucleus	double-stranded DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity			ovary(2)|lung(1)|large_intestine(1)	4	Glioma(1;0.155)					GCAGGGTTCTCAGTTGGTGCT	0.498													6	69	---	---	---	---	PASS
TAS2R46	259292	broad.mit.edu	37	12	11214162	11214162	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:11214162G>T	uc001qzp.1	-	1	732	c.732C>A	c.(730-732)TCC>TCA	p.S244S	PRR4_uc009zhp.2_Intron|PRH1_uc001qzb.3_Intron|PRH1_uc001qzc.2_Intron|PRB4_uc001qzf.1_Intron|PRH1_uc001qzj.2_Intron	NM_176887	NP_795368	P59540	T2R46_HUMAN	taste receptor, type 2, member 46	244	Helical; Name=6; (Potential).				sensory perception of taste	cilium membrane|integral to membrane	G-protein coupled receptor activity			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(49;0.0344)	BRCA - Breast invasive adenocarcinoma(232;0.196)		ACATGATTATGGACAGAAAGT	0.428													9	182	---	---	---	---	PASS
TAS2R42	353164	broad.mit.edu	37	12	11338923	11338923	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:11338923C>A	uc001qzr.1	-	1	621	c.621G>T	c.(619-621)TTG>TTT	p.L207F	PRB4_uc001qzf.1_Intron	NM_181429	NP_852094	Q7RTR8	T2R42_HUMAN	taste receptor, type 2, member 42	207	Helical; Name=5; (Potential).				sensory perception of taste	integral to membrane	G-protein coupled receptor activity			ovary(1)	1			OV - Ovarian serous cystadenocarcinoma(49;0.0455)			TATGTCTCACCAAGGACAGAA	0.408													6	87	---	---	---	---	PASS
GUCY2C	2984	broad.mit.edu	37	12	14778782	14778782	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:14778782G>T	uc001rcd.2	-	21	2454	c.2317C>A	c.(2317-2319)CGA>AGA	p.R773R		NM_004963	NP_004954	P25092	GUC2C_HUMAN	guanylate cyclase 2C precursor	773	Cytoplasmic (Potential).				intracellular signal transduction|receptor guanylyl cyclase signaling pathway	integral to membrane	ATP binding|GTP binding|guanylate cyclase activity|protein binding|protein kinase activity|receptor activity			ovary(4)|skin(2)	6						TCCAGGTTTCGAGAATATAGC	0.383													7	136	---	---	---	---	PASS
PIK3C2G	5288	broad.mit.edu	37	12	18656284	18656284	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:18656284C>A	uc001rdt.2	+	22	3079	c.2963C>A	c.(2962-2964)CCA>CAA	p.P988Q	PIK3C2G_uc010sia.1_RNA|PIK3C2G_uc010sib.1_Missense_Mutation_p.P1029Q|PIK3C2G_uc010sic.1_Missense_Mutation_p.P807Q	NM_004570	NP_004561	O75747	P3C2G_HUMAN	phosphoinositide-3-kinase, class 2 gamma	988	PI3K/PI4K.				cell communication|phosphatidylinositol-mediated signaling	membrane|phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol binding|phosphatidylinositol-4-phosphate 3-kinase activity			lung(8)|central_nervous_system(6)|breast(3)|stomach(2)|ovary(2)	21		Hepatocellular(102;0.194)				CTGATAGGACCATTGAAAGAA	0.378													6	46	---	---	---	---	PASS
GYS2	2998	broad.mit.edu	37	12	21693481	21693481	+	Missense_Mutation	SNP	G	A	A	rs148617918		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21693481G>A	uc001rfb.2	-	14	1927	c.1672C>T	c.(1672-1674)CGT>TGT	p.R558C		NM_021957	NP_068776	P54840	GYS2_HUMAN	glycogen synthase 2	558					glucose metabolic process|glycogen biosynthetic process|response to glucose stimulus	cortical actin cytoskeleton|cytosol|ectoplasm|insoluble fraction|soluble fraction	glycogen (starch) synthase activity|protein homodimerization activity			lung(1)|skin(1)	2						TCTGGAGAACGGAACCGCCTG	0.413													24	86	---	---	---	---	PASS
LDHB	3945	broad.mit.edu	37	12	21788614	21788614	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21788614G>A	uc001rfc.2	-	7	885	c.867C>T	c.(865-867)TTC>TTT	p.F289F	LDHB_uc001rfd.2_Silent_p.F289F|LDHB_uc001rfe.2_Silent_p.F289F	NM_002300	NP_002291	P07195	LDHB_HUMAN	L-lactate dehydrogenase B	289					glycolysis|pyruvate metabolic process	cytosol	L-lactate dehydrogenase activity			breast(2)|ovary(1)	3					NADH(DB00157)	GAAGGCTCAGGAAGACTTCAT	0.403													7	22	---	---	---	---	PASS
KIF21A	55605	broad.mit.edu	37	12	39716583	39716583	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:39716583G>T	uc001rly.2	-	27	3704	c.3558C>A	c.(3556-3558)CTC>CTA	p.L1186L	KIF21A_uc001rlv.2_Silent_p.L191L|KIF21A_uc001rlw.2_Silent_p.L503L|KIF21A_uc001rlx.2_Silent_p.L1173L|KIF21A_uc001rlz.2_Silent_p.L1150L|KIF21A_uc010skl.1_Silent_p.L1166L	NM_017641	NP_060111	Q7Z4S6	KI21A_HUMAN	kinesin family member 21A	1186					microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(4)|pancreas(1)|lung(1)|skin(1)	7		Lung NSC(34;0.179)|all_lung(34;0.213)				CAACAGGTGTGAGAGGGCCAG	0.502													8	107	---	---	---	---	PASS
KIF21A	55605	broad.mit.edu	37	12	39751147	39751147	+	Silent	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:39751147A>T	uc001rly.2	-	9	1454	c.1308T>A	c.(1306-1308)CGT>CGA	p.R436R	KIF21A_uc001rlx.2_Silent_p.R436R|KIF21A_uc001rlz.2_Silent_p.R436R|KIF21A_uc010skl.1_Silent_p.R436R|KIF21A_uc001rma.1_Silent_p.R444R	NM_017641	NP_060111	Q7Z4S6	KI21A_HUMAN	kinesin family member 21A	436	Potential.				microtubule-based movement	cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(4)|pancreas(1)|lung(1)|skin(1)	7		Lung NSC(34;0.179)|all_lung(34;0.213)				TAATTCTTACACGCAGGTTAT	0.408													10	87	---	---	---	---	PASS
CNTN1	1272	broad.mit.edu	37	12	41323798	41323798	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:41323798C>A	uc001rmm.1	+	7	810	c.697C>A	c.(697-699)CCT>ACT	p.P233T	CNTN1_uc009zjy.1_Missense_Mutation_p.P233T|CNTN1_uc001rmn.1_Missense_Mutation_p.P222T|CNTN1_uc001rmo.2_Missense_Mutation_p.P233T	NM_001843	NP_001834	Q12860	CNTN1_HUMAN	contactin 1 isoform 1 precursor	233					axon guidance|cell adhesion|Notch signaling pathway	anchored to membrane|membrane fraction|plasma membrane				lung(4)|ovary(3)|large_intestine(1)|skin(1)	9	all_cancers(12;2.07e-06)|all_epithelial(1;4.26e-06)|Breast(8;0.0716)	Lung NSC(34;0.0211)|all_lung(34;0.0294)				CATTCCAATACCTGAACGTAA	0.368													22	91	---	---	---	---	PASS
TMEM117	84216	broad.mit.edu	37	12	44238497	44238497	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:44238497C>A	uc001rod.2	+	2	109	c.43C>A	c.(43-45)CGC>AGC	p.R15S	TMEM117_uc001roe.2_5'UTR|TMEM117_uc009zkc.2_Missense_Mutation_p.R15S	NM_032256	NP_115632	Q9H0C3	TM117_HUMAN	transmembrane protein 117	15						endoplasmic reticulum|integral to membrane					0	Lung SC(27;0.192)			GBM - Glioblastoma multiforme(48;0.124)		TCCCTGGTCTCGCATGATTGT	0.403													5	103	---	---	---	---	PASS
SFRS2IP	9169	broad.mit.edu	37	12	46316732	46316732	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46316732G>T	uc001rox.2	-	13	4399	c.4112C>A	c.(4111-4113)TCG>TAG	p.S1371*	SFRS2IP_uc001row.2_Nonsense_Mutation_p.S1056*	NM_004719	NP_004710	Q99590	SCAFB_HUMAN	splicing factor, arginine/serine-rich 2,	1371					spliceosome assembly	nucleus	protein binding|zinc ion binding				0	Lung SC(27;0.192)|Renal(347;0.236)	Lung NSC(34;0.209)	OV - Ovarian serous cystadenocarcinoma(5;0.00691)	GBM - Glioblastoma multiforme(48;0.1)		GTCTGTCTTCGAGCTATCTGC	0.403													8	168	---	---	---	---	PASS
SLC38A1	81539	broad.mit.edu	37	12	46601397	46601397	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:46601397C>A	uc001rpa.2	-	7	654	c.396G>T	c.(394-396)ATG>ATT	p.M132I	SLC38A1_uc001rpb.2_Missense_Mutation_p.M132I|SLC38A1_uc001rpc.2_Missense_Mutation_p.M132I|SLC38A1_uc001rpd.2_Missense_Mutation_p.M132I|SLC38A1_uc001rpe.2_Missense_Mutation_p.M132I|SLC38A1_uc010slh.1_Missense_Mutation_p.M105I|SLC38A1_uc009zkj.1_Missense_Mutation_p.M132I	NM_030674	NP_109599	Q9H2H9	S38A1_HUMAN	amino acid transporter system A1	132	Helical; (Potential).				cellular nitrogen compound metabolic process|neurotransmitter uptake	integral to membrane|plasma membrane	sodium:amino acid symporter activity			ovary(2)|skin(2)|central_nervous_system(1)	5	Lung SC(27;0.137)|Renal(347;0.236)		all cancers(1;0.00805)|OV - Ovarian serous cystadenocarcinoma(5;0.0106)|Epithelial(2;0.0344)			TTTCATACACCATGCAGCCTA	0.398													7	128	---	---	---	---	PASS
PFKM	5213	broad.mit.edu	37	12	48538878	48538878	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:48538878G>T	uc001rrc.2	+	21	2227	c.2057G>T	c.(2056-2058)TGG>TTG	p.W686L	PFKM_uc001rra.1_Missense_Mutation_p.W371L|PFKM_uc001rrb.1_Missense_Mutation_p.W757L|PFKM_uc001rrd.2_Missense_Mutation_p.W371L|PFKM_uc001rre.1_Missense_Mutation_p.W686L|PFKM_uc001rrg.1_Missense_Mutation_p.W655L	NM_000289	NP_000280	P08237	K6PF_HUMAN	phosphofructokinase, muscle	686			W -> C (in GSD7; Japanese).		fructose 6-phosphate metabolic process|glycolysis|muscle cell homeostasis	6-phosphofructokinase complex|apical plasma membrane	6-phosphofructokinase activity|ATP binding|identical protein binding|kinase binding|metal ion binding|protein C-terminus binding			ovary(2)|upper_aerodigestive_tract(1)|kidney(1)	4						GCTATGAACTGGATGTCTGGG	0.493													6	77	---	---	---	---	PASS
KRT73	319101	broad.mit.edu	37	12	53009982	53009982	+	Missense_Mutation	SNP	G	T	T	rs116369374	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:53009982G>T	uc001sas.2	-	2	665	c.630C>A	c.(628-630)AGC>AGA	p.S210R		NM_175068	NP_778238	Q86Y46	K2C73_HUMAN	keratin 73	210	Coil 1B.|Rod.					keratin filament	structural molecule activity			large_intestine(2)|ovary(2)|skin(2)	6				BRCA - Breast invasive adenocarcinoma(357;0.189)		CTTCGCGCACGCTCCTCAGCT	0.622													17	48	---	---	---	---	PASS
OR6C75	390323	broad.mit.edu	37	12	55759010	55759010	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:55759010G>T	uc010spk.1	+	1	116	c.116G>T	c.(115-117)GGG>GTG	p.G39V		NM_001005497	NP_001005497	A6NL08	O6C75_HUMAN	olfactory receptor, family 6, subfamily C,	39	Helical; Name=1; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(2)|large_intestine(1)	3						AGTGTGACTGGGAACCTGATC	0.423													8	132	---	---	---	---	PASS
SRGAP1	57522	broad.mit.edu	37	12	64410791	64410791	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:64410791C>A	uc010ssp.1	+	4	544	c.488C>A	c.(487-489)ACG>AAG	p.T163K	SRGAP1_uc001srt.2_Missense_Mutation_p.T163K|SRGAP1_uc001srv.2_Missense_Mutation_p.T123K	NM_020762	NP_065813	Q7Z6B7	SRGP1_HUMAN	SLIT-ROBO Rho GTPase activating protein 1	163					axon guidance	cytosol				ovary(2)|central_nervous_system(2)	4			GBM - Glioblastoma multiforme(3;0.000139)|BRCA - Breast invasive adenocarcinoma(9;0.225)	GBM - Glioblastoma multiforme(28;0.0608)		GAGCTTTATACGGTAAGGACA	0.303													6	91	---	---	---	---	PASS
GNS	2799	broad.mit.edu	37	12	65113900	65113900	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:65113900G>T	uc001ssg.3	-	13	1652	c.1482C>A	c.(1480-1482)ACC>ACA	p.T494T	GNS_uc001ssf.2_Silent_p.T438T|GNS_uc010ssq.1_Silent_p.T526T|GNS_uc010ssr.1_Silent_p.T474T	NM_002076	NP_002067	P15586	GNS_HUMAN	glucosamine (N-acetyl)-6-sulfatase precursor	494						lysosome	metal ion binding|N-acetylglucosamine-6-sulfatase activity|protein binding			central_nervous_system(1)	1	Lung NSC(1;7.25e-14)|all_lung(1;1.25e-12)		LUAD - Lung adenocarcinoma(6;0.115)	GBM - Glioblastoma multiforme(28;0.0435)		CTGGGTCTATGGTTTTAGCAA	0.448													8	170	---	---	---	---	PASS
RAP1B	5908	broad.mit.edu	37	12	69050930	69050930	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:69050930G>T	uc001sub.2	+	7	681	c.518G>T	c.(517-519)GGG>GTG	p.G173V	RAP1B_uc010ste.1_Missense_Mutation_p.G107V|RAP1B_uc001suc.2_Missense_Mutation_p.G173V|RAP1B_uc010stf.1_Missense_Mutation_p.G154V|RAP1B_uc010stg.1_Missense_Mutation_p.G131V|RAP1B_uc010sth.1_Missense_Mutation_p.G131V|RAP1B_uc010sti.1_Missense_Mutation_p.G126V	NM_001089704	NP_001083173	P61224	RAP1B_HUMAN	SubName: Full=Ras-related protein Rap-1A; SubName: Full=cDNA FLJ75985, highly similar to Homo sapiens RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2, mRNA; SubName: Full=RAP1A, member of RAS oncogene family;	173					blood coagulation|energy reserve metabolic process|regulation of establishment of cell polarity|regulation of insulin secretion	cell-cell junction|cytosol	GDP binding|GTP binding|GTPase activity|protein binding				0	Breast(13;1.24e-05)		Lung(24;0.000131)|LUAD - Lung adenocarcinoma(15;0.00107)|STAD - Stomach adenocarcinoma(21;0.00694)	GBM - Glioblastoma multiforme(7;0.000306)		CCAGTGCCTGGGAAGGCTCGC	0.383													8	182	---	---	---	---	PASS
PTPRR	5801	broad.mit.edu	37	12	71286515	71286515	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:71286515C>A	uc001swi.1	-	2	717	c.301G>T	c.(301-303)GGT>TGT	p.G101C		NM_002849	NP_002840	Q15256	PTPRR_HUMAN	protein tyrosine phosphatase, receptor type, R	101	Extracellular (Potential).				in utero embryonic development	cell surface|Golgi apparatus|integral to membrane|nucleus|perinuclear region of cytoplasm|plasma membrane	protein kinase binding|transmembrane receptor protein tyrosine phosphatase activity			skin(2)|ovary(1)	3			GBM - Glioblastoma multiforme(2;5.67e-07)|Lung(24;0.00283)|OV - Ovarian serous cystadenocarcinoma(12;0.00578)|LUSC - Lung squamous cell carcinoma(43;0.132)	COAD - Colon adenocarcinoma(1;0.136)		AGATCTTGACCATCCATGGCC	0.448													7	119	---	---	---	---	PASS
LGR5	8549	broad.mit.edu	37	12	71978100	71978100	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:71978100G>T	uc001swl.2	+	18	2358	c.2310G>T	c.(2308-2310)CTG>CTT	p.L770L	LGR5_uc001swm.2_Silent_p.L746L|LGR5_uc001swn.1_Intron	NM_003667	NP_003658	O75473	LGR5_HUMAN	leucine-rich repeat-containing G protein-coupled	770	Helical; Name=6; (Potential).					integral to plasma membrane	protein-hormone receptor activity			lung(4)|skin(3)|ovary(1)|pancreas(1)	9						ACATTGCCCTGTTGCTCTTCA	0.423													6	99	---	---	---	---	PASS
ZDHHC17	23390	broad.mit.edu	37	12	77222167	77222167	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:77222167C>A	uc001syk.1	+							NM_015336	NP_056151	Q8IUH5	ZDH17_HUMAN	huntingtin interacting protein 14						lipoprotein transport|positive regulation of I-kappaB kinase/NF-kappaB cascade	Golgi-associated vesicle membrane|integral to membrane	magnesium ion transmembrane transporter activity|protein binding|protein-cysteine S-palmitoleyltransferase activity|signal transducer activity|zinc ion binding				0						TTGTGTTTTACAGATCCTTTT	0.318													7	201	---	---	---	---	PASS
NAV3	89795	broad.mit.edu	37	12	78513071	78513071	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:78513071C>T	uc001syp.2	+	15	3268	c.3095C>T	c.(3094-3096)TCA>TTA	p.S1032L	NAV3_uc001syo.2_Missense_Mutation_p.S1032L|NAV3_uc010sub.1_Missense_Mutation_p.S532L|NAV3_uc009zsf.2_Missense_Mutation_p.S40L	NM_014903	NP_055718	Q8IVL0	NAV3_HUMAN	neuron navigator 3	1032	Ser-rich.					nuclear outer membrane	ATP binding|nucleoside-triphosphatase activity			large_intestine(6)|ovary(5)|lung(2)|breast(1)|skin(1)|kidney(1)|pancreas(1)	17						CTAAAAGGATCATCTCTACAA	0.438										HNSCC(70;0.22)			21	109	---	---	---	---	PASS
NAV3	89795	broad.mit.edu	37	12	78562613	78562613	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:78562613G>T	uc001syp.2	+	24	5121	c.4948G>T	c.(4948-4950)GGA>TGA	p.G1650*	NAV3_uc001syo.2_Nonsense_Mutation_p.G1650*|NAV3_uc010sub.1_Nonsense_Mutation_p.G1136*|NAV3_uc009zsf.2_Nonsense_Mutation_p.G481*	NM_014903	NP_055718	Q8IVL0	NAV3_HUMAN	neuron navigator 3	1650	Potential.					nuclear outer membrane	ATP binding|nucleoside-triphosphatase activity			large_intestine(6)|ovary(5)|lung(2)|breast(1)|skin(1)|kidney(1)|pancreas(1)	17						GGCTATTCAGGGAGCACTGAA	0.378										HNSCC(70;0.22)			7	121	---	---	---	---	PASS
MYF5	4617	broad.mit.edu	37	12	81111130	81111130	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:81111130G>T	uc001szg.2	+	1	423	c.288G>T	c.(286-288)CTG>CTT	p.L96L		NM_005593	NP_005584	P13349	MYF5_HUMAN	myogenic factor 5	96	Helix-loop-helix motif.				muscle cell fate commitment|positive regulation of muscle cell differentiation|skeletal muscle tissue development	nucleoplasm	DNA binding|protein heterodimerization activity|sequence-specific enhancer binding RNA polymerase II transcription factor activity			ovary(1)	1						GGAGGCGCCTGAAGAAGGTCA	0.602													5	21	---	---	---	---	PASS
TMTC2	160335	broad.mit.edu	37	12	83324281	83324281	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:83324281G>T	uc001szt.2	+	4	1987	c.1555G>T	c.(1555-1557)GCT>TCT	p.A519S	TMTC2_uc001szr.1_Missense_Mutation_p.A519S|TMTC2_uc001szs.1_Missense_Mutation_p.A519S|TMTC2_uc010suk.1_Missense_Mutation_p.A274S	NM_152588	NP_689801	Q8N394	TMTC2_HUMAN	transmembrane and tetratricopeptide repeat	519	TPR 2.					endoplasmic reticulum|integral to membrane	binding			ovary(2)	2						CTATAGAAATGCTTTGTACTA	0.423													5	45	---	---	---	---	PASS
POC1B	282809	broad.mit.edu	37	12	89818973	89818973	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:89818973C>A	uc001tbc.2	-	11	1402	c.1297G>T	c.(1297-1299)GAG>TAG	p.E433*	POC1B_uc001tba.2_Nonsense_Mutation_p.E391*|POC1B_uc001tbb.2_Nonsense_Mutation_p.E303*|POC1B_uc010sun.1_RNA|POC1B_uc009zsp.2_RNA|POC1B_uc009zsq.2_RNA	NM_172240	NP_758440	Q8TC44	POC1B_HUMAN	WD repeat domain 51B	433	Potential.				cell projection organization	centriole|microtubule basal body				ovary(1)	1						ATAATATGCTCTAAAGCATCA	0.428													8	123	---	---	---	---	PASS
EEA1	8411	broad.mit.edu	37	12	93251254	93251254	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:93251254C>A	uc001tck.2	-	4	518	c.253G>T	c.(253-255)GTA>TTA	p.V85L		NM_003566	NP_003557	Q15075	EEA1_HUMAN	early endosome antigen 1, 162kD	85	Potential.				early endosome to late endosome transport|synaptic vesicle to endosome fusion|vesicle fusion	cytosol|early endosome membrane|extrinsic to plasma membrane|membrane fraction	1-phosphatidylinositol binding|calmodulin binding|GTP-dependent protein binding|protein homodimerization activity|zinc ion binding			ovary(2)|skin(1)	3						AGCAGTGTTACATCATCTCTA	0.308													8	245	---	---	---	---	PASS
TMPO	7112	broad.mit.edu	37	12	98938209	98938209	+	Intron	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:98938209C>T	uc001tfj.2	+						TMPO_uc001tfk.2_Intron|TMPO_uc001tfl.2_Intron	NM_001032283	NP_001027454	P42167	LAP2B_HUMAN	thymopoietin isoform beta							integral to membrane|nuclear inner membrane	DNA binding|lamin binding			ovary(2)	2						GTTTTGTTTTCAAACTAACAG	0.343													6	40	---	---	---	---	PASS
APAF1	317	broad.mit.edu	37	12	99076989	99076989	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:99076989C>T	uc001tfz.2	+	15	2692	c.2115C>T	c.(2113-2115)TGC>TGT	p.C705C	APAF1_uc001tfy.2_Silent_p.C694C|APAF1_uc001tga.2_Silent_p.C694C|APAF1_uc001tgb.2_Silent_p.C705C|APAF1_uc001tgc.2_Intron|APAF1_uc009zto.2_Silent_p.C114C	NM_181861	NP_863651	O14727	APAF_HUMAN	apoptotic peptidase activating factor 1 isoform	705	WD 3.				activation of caspase activity by cytochrome c|defense response|induction of apoptosis by intracellular signals|nervous system development	cytosol|Golgi apparatus|nucleus	ATP binding|caspase activator activity|protein binding			ovary(2)|lung(1)	3					Adenosine triphosphate(DB00171)	TCAATTGCTGCCATTTCACCA	0.373													11	72	---	---	---	---	PASS
STAB2	55576	broad.mit.edu	37	12	104097053	104097053	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104097053G>T	uc001tjw.2	+	35	4028	c.3842G>T	c.(3841-3843)CGA>CTA	p.R1281L		NM_017564	NP_060034	Q8WWQ8	STAB2_HUMAN	stabilin 2 precursor	1281	Extracellular (Potential).				angiogenesis|cell adhesion|defense response to bacterium|receptor-mediated endocytosis	cytoplasm|external side of plasma membrane|integral to plasma membrane	Gram-negative bacterial cell surface binding|hyaluronic acid binding|low-density lipoprotein receptor activity|protein disulfide oxidoreductase activity|scavenger receptor activity			ovary(9)|skin(5)	14						ACTATTATACGAGTAAGTTCT	0.368													5	79	---	---	---	---	PASS
APPL2	55198	broad.mit.edu	37	12	105597489	105597489	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:105597489C>A	uc001tlf.1	-	9	914	c.696G>T	c.(694-696)ATG>ATT	p.M232I	APPL2_uc010swt.1_Missense_Mutation_p.M189I|APPL2_uc001tlg.1_5'UTR|APPL2_uc010swu.1_Missense_Mutation_p.M238I|APPL2_uc009zuq.2_Missense_Mutation_p.M189I	NM_018171	NP_060641	Q8NEU8	DP13B_HUMAN	adaptor protein, phosphotyrosine interaction, PH	232	Required for RAB5A binding (By similarity).				cell cycle|cell proliferation|signal transduction	early endosome membrane|nucleus	protein binding			upper_aerodigestive_tract(1)	1						ACCTTTGAACCATGTCTGCAA	0.448													9	135	---	---	---	---	PASS
RIC8B	55188	broad.mit.edu	37	12	107236523	107236523	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:107236523C>A	uc001tlx.2	+	5	1118	c.993C>A	c.(991-993)ACC>ACA	p.T331T	RIC8B_uc001tlw.2_Silent_p.T331T|RIC8B_uc001tly.2_Silent_p.T291T|RIC8B_uc001tlz.2_RNA|RIC8B_uc009zur.2_RNA	NM_018157	NP_060627	Q9NVN3	RIC8B_HUMAN	resistance to inhibitors of cholinesterase 8	331					regulation of G-protein coupled receptor protein signaling pathway	cell cortex|cytosol|plasma membrane	G-protein alpha-subunit binding|guanyl-nucleotide exchange factor activity			ovary(1)	1						AAAACAATACCATGGTATACA	0.398													6	54	---	---	---	---	PASS
ACACB	32	broad.mit.edu	37	12	109637324	109637324	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109637324C>T	uc001tob.2	+	18	2864	c.2745C>T	c.(2743-2745)CAC>CAT	p.H915H	ACACB_uc001toc.2_Silent_p.H915H	NM_001093	NP_001084	O00763	ACACB_HUMAN	acetyl-Coenzyme A carboxylase beta	915	Biotinyl-binding.				acetyl-CoA metabolic process|carnitine shuttle|energy reserve metabolic process|fatty acid biosynthetic process|positive regulation of cellular metabolic process|protein homotetramerization|regulation of fatty acid oxidation	cytosol|endomembrane system|Golgi apparatus|membrane	acetyl-CoA carboxylase activity|ATP binding|biotin carboxylase activity|metal ion binding|protein binding			ovary(5)|upper_aerodigestive_tract(1)|pancreas(1)|skin(1)	8					Biotin(DB00121)	ATGGGGGCCACGTTGAGGCTG	0.572													14	34	---	---	---	---	PASS
SDS	10993	broad.mit.edu	37	12	113830792	113830792	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:113830792C>G	uc001tvg.2	-	8	1063	c.941G>C	c.(940-942)CGG>CCG	p.R314P		NM_006843	NP_006834	P20132	SDHL_HUMAN	serine dehydratase	314					gluconeogenesis|L-serine catabolic process|pyruvate biosynthetic process	cytoplasm	L-serine ammonia-lyase activity|L-threonine ammonia-lyase activity|protein homodimerization activity|pyridoxal phosphate binding			pancreas(1)	1					L-Serine(DB00133)|Pyridoxal Phosphate(DB00114)	CTTGAGCGCCCGCAGCTGGGC	0.622													4	86	---	---	---	---	PASS
TBX3	6926	broad.mit.edu	37	12	115118836	115118836	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:115118836G>T	uc001tvt.1	-	2	1469	c.505C>A	c.(505-507)CGG>AGG	p.R169R	TBX3_uc001tvu.1_Silent_p.R169R|TBX3_uc010syw.1_Silent_p.R169R	NM_016569	NP_057653	O15119	TBX3_HUMAN	T-box 3 protein isoform 2	169	T-box; first part.				anterior/posterior axis specification, embryo|anti-apoptosis|cell aging|embryonic arm morphogenesis|embryonic digit morphogenesis|female genitalia development|follicle-stimulating hormone secretion|luteinizing hormone secretion|male genitalia development|mesoderm morphogenesis|negative regulation of myoblast differentiation|negative regulation of transcription, DNA-dependent|positive regulation of cell cycle|positive regulation of cell proliferation|regulation of transcription from RNA polymerase II promoter|skeletal system development	nucleus	sequence-specific DNA binding			ovary(2)|skin(1)	3	Medulloblastoma(191;0.163)|all_neural(191;0.178)			BRCA - Breast invasive adenocarcinoma(302;0.0574)		ACCATCCACCGAGAATTGTGA	0.453													5	102	---	---	---	---	PASS
POP5	51367	broad.mit.edu	37	12	121017127	121017127	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:121017127C>A	uc001tys.2	-	5	518	c.486G>T	c.(484-486)ATG>ATT	p.M162I	POP5_uc001tyt.2_Missense_Mutation_p.M112I	NM_015918	NP_057002	Q969H6	POP5_HUMAN	processing of precursor 5 isoform a	162					tRNA processing		protein binding|ribonuclease P activity				0	all_neural(191;0.077)|Medulloblastoma(191;0.0922)					AGGTTCACTCCATTGCTTCTG	0.532													6	49	---	---	---	---	PASS
ANAPC5	51433	broad.mit.edu	37	12	121775156	121775156	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:121775156G>T	uc001uag.2	-	6	819	c.697C>A	c.(697-699)CCA>ACA	p.P233T	ANAPC5_uc001uae.2_5'Flank|ANAPC5_uc010szv.1_5'Flank|ANAPC5_uc001uaf.2_RNA|ANAPC5_uc001uah.2_Missense_Mutation_p.P134T|ANAPC5_uc001uai.1_5'UTR	NM_016237	NP_057321	Q9UJX4	APC5_HUMAN	anaphase-promoting complex subunit 5 isoform a	233					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|cell division|G2/M transition of mitotic cell cycle|mitotic anaphase|mitotic cell cycle spindle assembly checkpoint|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|protein K11-linked ubiquitination	anaphase-promoting complex|cytosol|nucleoplasm	protein phosphatase binding|ubiquitin-protein ligase activity			skin(3)|breast(2)|kidney(1)	6	all_neural(191;0.0684)|Medulloblastoma(191;0.0922)					AAGGAAGCTGGAGTGAGGGCC	0.358													8	122	---	---	---	---	PASS
SBNO1	55206	broad.mit.edu	37	12	123780467	123780467	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:123780467C>A	uc010tap.1	-	31	4170	c.4170G>T	c.(4168-4170)TTG>TTT	p.L1390F	SBNO1_uc009zxv.2_RNA|SBNO1_uc010tao.1_Missense_Mutation_p.L1389F|SBNO1_uc010taq.1_Missense_Mutation_p.L341F	NM_018183	NP_060653	A3KN83	SBNO1_HUMAN	sno, strawberry notch homolog 1	1390							ATP binding|DNA binding|hydrolase activity			breast(5)|skin(2)|ovary(1)|kidney(1)	9	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000701)|Epithelial(86;0.00197)		ATGCGTTGCTCAAGTTGGTGA	0.428													11	241	---	---	---	---	PASS
DDX55	57696	broad.mit.edu	37	12	124092221	124092221	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:124092221C>A	uc001ufi.2	+						DDX55_uc001ufh.2_5'UTR|DDX55_uc001ufj.1_Intron|DDX55_uc001ufk.2_5'UTR	NM_020936	NP_065987	Q8NHQ9	DDX55_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 55								ATP binding|ATP-dependent helicase activity|RNA binding			ovary(1)	1	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000142)|Epithelial(86;0.000637)|all cancers(50;0.00772)		TGAGTTTGCTCGTGTCTGCTT	0.478													6	145	---	---	---	---	PASS
P2RX2	22953	broad.mit.edu	37	12	133198319	133198319	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:133198319G>T	uc001ukj.1	+	11	1177	c.1177G>T	c.(1177-1179)GTG>TTG	p.V393L	P2RX2_uc001uki.1_Intron|P2RX2_uc001ukk.1_Missense_Mutation_p.V419L|P2RX2_uc001ukl.1_Missense_Mutation_p.V369L|P2RX2_uc001ukm.1_Missense_Mutation_p.V321L|P2RX2_uc001ukn.1_Missense_Mutation_p.V301L|P2RX2_uc009zyt.1_3'UTR|P2RX2_uc001uko.1_Intron	NM_170682	NP_733782	Q9UBL9	P2RX2_HUMAN	purinergic receptor P2X2 isoform A	393	Cytoplasmic (Potential).				positive regulation of calcium ion transport into cytosol|positive regulation of calcium-mediated signaling|protein homooligomerization	integral to membrane	ATP binding|extracellular ATP-gated cation channel activity|identical protein binding|purinergic nucleotide receptor activity				0	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.0767)		OV - Ovarian serous cystadenocarcinoma(86;2.32e-08)|Epithelial(86;8.62e-08)|all cancers(50;4.5e-06)		TAGCTGGCCTGTGACCCTTGC	0.592													4	21	---	---	---	---	PASS
IFT88	8100	broad.mit.edu	37	13	21165166	21165166	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:21165166C>A	uc001unh.2	+						IFT88_uc001uni.2_Intron|IFT88_uc001unj.2_Intron|IFT88_uc010tcq.1_Intron	NM_175605	NP_783195	Q13099	IFT88_HUMAN	intraflagellar transport 88 homolog isoform 1						cilium morphogenesis	centriole|intraflagellar transport particle B|microtubule basal body|microtubule-based flagellum	protein binding			ovary(1)	1		all_cancers(29;5.79e-25)|all_epithelial(30;2.57e-20)|all_lung(29;3.13e-16)|Lung SC(185;0.0262)|Ovarian(182;0.0825)|Hepatocellular(188;0.244)		all cancers(112;0.000667)|Epithelial(112;0.00119)|OV - Ovarian serous cystadenocarcinoma(117;0.0141)|Lung(94;0.0183)|LUSC - Lung squamous cell carcinoma(192;0.0528)		TCAGGTATCTCTATTGGATGC	0.299													7	77	---	---	---	---	PASS
SGCG	6445	broad.mit.edu	37	13	23853520	23853520	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:23853520G>C	uc001uom.2	+	5	563	c.408G>C	c.(406-408)CAG>CAC	p.Q136H	SGCG_uc009zzv.2_Missense_Mutation_p.Q136H|SGCG_uc009zzw.2_Missense_Mutation_p.Q136H	NM_000231	NP_000222	Q13326	SGCG_HUMAN	gamma sarcoglycan	136	Extracellular (Potential).				cytoskeleton organization|muscle organ development	cytoplasm|cytoskeleton|integral to membrane|sarcoglycan complex|sarcolemma					0		all_cancers(29;4.34e-23)|all_epithelial(30;4.4e-19)|all_lung(29;2.45e-18)|Lung SC(185;0.0228)|Breast(139;0.188)		all cancers(112;0.00255)|Epithelial(112;0.0129)|OV - Ovarian serous cystadenocarcinoma(117;0.0365)|Lung(94;0.205)		TAGAAGTCCAGAATCAACAGT	0.388													5	23	---	---	---	---	PASS
MIPEP	4285	broad.mit.edu	37	13	24443477	24443477	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:24443477G>T	uc001uox.3	-	7	997	c.897C>A	c.(895-897)TCC>TCA	p.S299S		NM_005932	NP_005923	Q99797	MIPEP_HUMAN	mitochondrial intermediate peptidase precursor	299					protein processing involved in protein targeting to mitochondrion|proteolysis	mitochondrial matrix	metal ion binding|metalloendopeptidase activity			central_nervous_system(1)	1		all_cancers(29;1.83e-22)|all_epithelial(30;8.75e-19)|all_lung(29;9.17e-18)|Lung SC(185;0.0225)|Breast(139;0.14)		all cancers(112;0.00389)|Epithelial(112;0.0266)|OV - Ovarian serous cystadenocarcinoma(117;0.0717)|Lung(94;0.207)|GBM - Glioblastoma multiforme(144;0.232)		GAGAAAACGTGGAATACCCCA	0.388													7	92	---	---	---	---	PASS
PARP4	143	broad.mit.edu	37	13	25027743	25027743	+	Missense_Mutation	SNP	C	A	A	rs150983352		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:25027743C>A	uc001upl.2	-	23	2914	c.2808G>T	c.(2806-2808)ATG>ATT	p.M936I	PARP4_uc010tdc.1_Missense_Mutation_p.M936I	NM_006437	NP_006428	Q9UKK3	PARP4_HUMAN	poly (ADP-ribose) polymerase family, member 4	936	VWFA.			M -> A (in Ref. 2; AAC62491 and 3; BAA11494).|M -> T (in Ref. 1; AAD47250).	cell death|DNA repair|inflammatory response|protein ADP-ribosylation|response to drug|transport	cytoplasm|nucleus|ribonucleoprotein complex|spindle microtubule	DNA binding|enzyme binding|NAD+ ADP-ribosyltransferase activity			ovary(3)|skin(1)	4		all_epithelial(30;7.67e-16)|Lung SC(185;0.0225)|Breast(139;0.052)		all cancers(112;0.000127)|Epithelial(112;0.000778)|Kidney(163;0.039)|OV - Ovarian serous cystadenocarcinoma(117;0.0578)|KIRC - Kidney renal clear cell carcinoma(186;0.135)|Lung(94;0.195)		ACTCTGCTGCCATGGTATTGC	0.478													4	57	---	---	---	---	PASS
GPR12	2835	broad.mit.edu	37	13	27333755	27333755	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:27333755G>A	uc010aal.2	-	2	432	c.210C>T	c.(208-210)TTC>TTT	p.F70F	GPR12_uc010tdl.1_Intron	NM_005288	NP_005279	P47775	GPR12_HUMAN	G protein-coupled receptor 12	70	Cytoplasmic (Potential).					integral to plasma membrane					0	Colorectal(5;5.77e-05)	Breast(139;0.198)		Epithelial(112;9.37e-07)|OV - Ovarian serous cystadenocarcinoma(117;1.16e-06)|all cancers(112;8.31e-06)|GBM - Glioblastoma multiforme(144;0.00121)|Lung(94;0.111)|LUSC - Lung squamous cell carcinoma(192;0.184)		TGGGGTTGTGGAAGATGATAA	0.532													13	33	---	---	---	---	PASS
FLT3	2322	broad.mit.edu	37	13	28599066	28599066	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:28599066C>A	uc001urw.2	-	18	2304	c.2222G>T	c.(2221-2223)AGA>ATA	p.R741I	FLT3_uc010aao.2_RNA|FLT3_uc010tdn.1_Missense_Mutation_p.R741I	NM_004119	NP_004110	P36888	FLT3_HUMAN	fms-related tyrosine kinase 3 precursor	741	Protein kinase.|Cytoplasmic (Potential).				positive regulation of cell proliferation	integral to plasma membrane	ATP binding|vascular endothelial growth factor receptor activity			haematopoietic_and_lymphoid_tissue(8536)|lung(7)|ovary(3)|stomach(1)|central_nervous_system(1)|skin(1)	8549	Acute lymphoblastic leukemia(6;0.04)	Lung SC(185;0.0156)|Ovarian(182;0.0392)	Colorectal(13;0.000157)|READ - Rectum adenocarcinoma(15;0.105)	OV - Ovarian serous cystadenocarcinoma(117;0.00154)|all cancers(112;0.00459)|GBM - Glioblastoma multiforme(144;0.00562)|Epithelial(112;0.0959)|Lung(94;0.212)	Sorafenib(DB00398)|Sunitinib(DB01268)	CTGAACTTCTCTTGAACCAGG	0.303			Mis|O		AML|ALL								9	155	---	---	---	---	PASS
FLT3	2322	broad.mit.edu	37	13	28624272	28624272	+	Silent	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:28624272T>C	uc001urw.2	-	6	784	c.702A>G	c.(700-702)AGA>AGG	p.R234R	FLT3_uc010aao.2_RNA|FLT3_uc010tdn.1_Silent_p.R234R	NM_004119	NP_004110	P36888	FLT3_HUMAN	fms-related tyrosine kinase 3 precursor	234	Extracellular (Potential).				positive regulation of cell proliferation	integral to plasma membrane	ATP binding|vascular endothelial growth factor receptor activity			haematopoietic_and_lymphoid_tissue(8536)|lung(7)|ovary(3)|stomach(1)|central_nervous_system(1)|skin(1)	8549	Acute lymphoblastic leukemia(6;0.04)	Lung SC(185;0.0156)|Ovarian(182;0.0392)	Colorectal(13;0.000157)|READ - Rectum adenocarcinoma(15;0.105)	OV - Ovarian serous cystadenocarcinoma(117;0.00154)|all cancers(112;0.00459)|GBM - Glioblastoma multiforme(144;0.00562)|Epithelial(112;0.0959)|Lung(94;0.212)	Sorafenib(DB00398)|Sunitinib(DB01268)	CCAGTTCATTTCTGGCACAGC	0.413			Mis|O		AML|ALL								16	68	---	---	---	---	PASS
EPSTI1	94240	broad.mit.edu	37	13	43528111	43528111	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:43528111C>A	uc001uyw.1	-	6	612	c.536G>T	c.(535-537)AGA>ATA	p.R179I	EPSTI1_uc001uyx.1_Missense_Mutation_p.R179I	NM_001002264	NP_001002264	Q96J88	ESIP1_HUMAN	epithelial stromal interaction 1 isoform 1	179	Potential.									ovary(1)	1		Lung NSC(96;3.6e-06)|Breast(139;0.00869)|Prostate(109;0.0181)|Lung SC(185;0.0262)|Hepatocellular(98;0.114)		GBM - Glioblastoma multiforme(144;0.000528)|BRCA - Breast invasive adenocarcinoma(63;0.0858)		AAATGCTTCTCTTCTAAGGTT	0.333													6	49	---	---	---	---	PASS
KPNA3	3839	broad.mit.edu	37	13	50306786	50306786	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:50306786G>T	uc001vdj.2	-	5	657	c.242C>A	c.(241-243)ACA>AAA	p.T81K		NM_002267	NP_002258	O00505	IMA3_HUMAN	karyopherin alpha 3	81	ARM 1; truncated.				interspecies interaction between organisms|NLS-bearing substrate import into nucleus|protein complex assembly	cytoplasm|nuclear pore	nuclear localization sequence binding|protein transporter activity				0		Lung NSC(96;2.46e-05)|Breast(56;9.7e-05)|Prostate(109;0.00174)|Hepatocellular(98;0.0207)|Myeloproliferative disorder(33;0.163)|Lung SC(185;0.187)|all_neural(104;0.19)		GBM - Glioblastoma multiforme(99;1.42e-09)		GTTATCACTTGTGGCATTCTG	0.338													6	128	---	---	---	---	PASS
PCDH20	64881	broad.mit.edu	37	13	61986230	61986230	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:61986230C>A	uc001vid.3	-	2	2366	c.2002G>T	c.(2002-2004)GCT>TCT	p.A668S	PCDH20_uc010thj.1_Missense_Mutation_p.A668S	NM_022843	NP_073754	Q8N6Y1	PCD20_HUMAN	protocadherin 20	641	Cadherin 5.|Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			ovary(4)|breast(1)|central_nervous_system(1)	6		Breast(118;0.195)|Prostate(109;0.229)		GBM - Glioblastoma multiforme(99;0.000118)		TTTCGTCCAGCGTCAGCATCT	0.448													6	50	---	---	---	---	PASS
TBC1D4	9882	broad.mit.edu	37	13	75923357	75923357	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:75923357A>T	uc001vjl.1	-	5	1704	c.1357T>A	c.(1357-1359)TGT>AGT	p.C453S	TBC1D4_uc010aer.2_Missense_Mutation_p.C453S|TBC1D4_uc010aes.2_Missense_Mutation_p.C453S	NM_014832	NP_055647	O60343	TBCD4_HUMAN	TBC1 domain family, member 4	453	PID 2.					cytoplasm	Rab GTPase activator activity			ovary(4)|central_nervous_system(1)|skin(1)	6		Prostate(6;0.014)|Breast(118;0.0982)		GBM - Glioblastoma multiforme(99;0.0116)		CAGGCCTCACACAGTTTAATC	0.473													6	39	---	---	---	---	PASS
CLN5	1203	broad.mit.edu	37	13	77570146	77570146	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:77570146G>T	uc001vkc.2	+	3	624	c.596G>T	c.(595-597)CGA>CTA	p.R199L		NM_006493	NP_006484	O75503	CLN5_HUMAN	ceroid-lipofuscinosis, neuronal 5	150					brain development|cell death|lysosomal lumen acidification|neuron maturation|protein catabolic process	endoplasmic reticulum|Golgi apparatus|integral to membrane|lysosomal membrane|perinuclear region of cytoplasm	protein binding			ovary(1)	1		Acute lymphoblastic leukemia(28;0.205)		GBM - Glioblastoma multiforme(99;0.0503)		CCCCATCTCCGACCTGAAATG	0.428													5	89	---	---	---	---	PASS
MYCBP2	23077	broad.mit.edu	37	13	77724879	77724879	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:77724879G>T	uc001vkf.2	-	48	7098	c.7007C>A	c.(7006-7008)ACA>AAA	p.T2336K	MYCBP2_uc010aev.2_Missense_Mutation_p.T1740K	NM_015057	NP_055872	O75592	MYCB2_HUMAN	MYC binding protein 2	2336	Filamin.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	ligase activity|protein binding|zinc ion binding			ovary(4)|breast(4)|skin(3)|lung(2)|pancreas(1)	14		Breast(118;0.212)|Acute lymphoblastic leukemia(28;0.22)		GBM - Glioblastoma multiforme(99;0.109)		CTTCATCATTGTTATGGCAAT	0.323													6	69	---	---	---	---	PASS
ITGBL1	9358	broad.mit.edu	37	13	102105224	102105224	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:102105224T>C	uc001vpb.2	+	1	259	c.40T>C	c.(40-42)TCC>CCC	p.S14P	ITGBL1_uc010agb.2_Missense_Mutation_p.S14P|ITGBL1_uc001vpc.3_5'UTR	NM_004791	NP_004782	O95965	ITGBL_HUMAN	integrin, beta-like 1 (with EGF-like repeat	14					cell-matrix adhesion|integrin-mediated signaling pathway	extracellular region|integrin complex	binding|receptor activity			ovary(1)|skin(1)	2	all_neural(89;0.0438)|Medulloblastoma(90;0.163)|Lung SC(71;0.184)					GCTGCTGGCGTCCTCCCTTCT	0.567													3	60	---	---	---	---	PASS
EFNB2	1948	broad.mit.edu	37	13	107165088	107165088	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:107165088C>A	uc001vqi.2	-	2	220	c.195G>T	c.(193-195)GTG>GTT	p.V65V		NM_004093	NP_004084	P52799	EFNB2_HUMAN	ephrin B2 precursor	65	Extracellular (Potential).				cell differentiation|cell-cell signaling|interspecies interaction between organisms|nervous system development	integral to plasma membrane	ephrin receptor binding			ovary(1)	1	Lung NSC(43;0.015)|all_neural(89;0.0741)|Lung SC(71;0.14)|Medulloblastoma(90;0.169)					TTTTAGAGTCCACTTTGGGGC	0.368													7	117	---	---	---	---	PASS
COL4A1	1282	broad.mit.edu	37	13	110818660	110818660	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:110818660G>T	uc001vqw.3	-						COL4A1_uc010agl.2_Intron	NM_001845	NP_001836	P02462	CO4A1_HUMAN	alpha 1 type IV collagen preproprotein						angiogenesis|axon guidance		extracellular matrix structural constituent|platelet-derived growth factor binding			ovary(3)|lung(1)|central_nervous_system(1)|pancreas(1)	6	all_cancers(4;9.8e-13)|all_epithelial(4;9.66e-08)|all_lung(23;3.75e-06)|Lung NSC(43;0.000274)|Colorectal(4;0.00178)|all_neural(89;0.00459)|Medulloblastoma(90;0.00596)|Lung SC(71;0.0604)	Breast(118;0.2)	BRCA - Breast invasive adenocarcinoma(86;0.11)|all cancers(43;0.145)			CCTAAAAGCAGAGGGAAAGCA	0.398													7	71	---	---	---	---	PASS
CARS2	79587	broad.mit.edu	37	13	111340110	111340110	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:111340110C>A	uc001vrd.2	-	5	569	c.529G>T	c.(529-531)GAA>TAA	p.E177*	CARS2_uc010tjm.1_RNA	NM_024537	NP_078813	Q9HA77	SYCM_HUMAN	cysteinyl-tRNA synthetase 2, mitochondrial	177					cysteinyl-tRNA aminoacylation	cytosol|mitochondrial matrix	ATP binding|cysteine-tRNA ligase activity|metal ion binding				0	all_lung(23;3.61e-05)|Lung NSC(43;0.00144)|Lung SC(71;0.0753)|all_neural(89;0.077)|Medulloblastoma(90;0.148)		BRCA - Breast invasive adenocarcinoma(86;0.163)		L-Cysteine(DB00151)	ATGATTCCTTCAATGAAAGAA	0.363													11	230	---	---	---	---	PASS
OR4K5	79317	broad.mit.edu	37	14	20389679	20389679	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20389679A>C	uc010tkw.1	+	1	914	c.914A>C	c.(913-915)TAC>TCC	p.Y305S		NM_001005483	NP_001005483	Q8NGD3	OR4K5_HUMAN	olfactory receptor, family 4, subfamily K,	305	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|skin(1)	2	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;2.95e-06)	GBM - Glioblastoma multiforme(265;0.00327)		GTGAACCATTACCTGAGGCCA	0.388													42	67	---	---	---	---	PASS
SUPT16H	11198	broad.mit.edu	37	14	21834657	21834657	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:21834657G>T	uc001wao.2	-	8	1326	c.987C>A	c.(985-987)GTC>GTA	p.V329V		NM_007192	NP_009123	Q9Y5B9	SP16H_HUMAN	chromatin-specific transcription elongation	329					DNA repair|DNA replication|nucleosome disassembly|positive regulation of transcription elongation, DNA-dependent|positive regulation of viral transcription|transcription elongation from RNA polymerase II promoter|viral reproduction	chromosome|nucleoplasm	GTP binding				0	all_cancers(95;0.00115)		Epithelial(56;1.62e-06)|all cancers(55;1.49e-05)	GBM - Glioblastoma multiforme(265;0.0159)		CCACGTCCATGACAGCGTTAT	0.348													9	220	---	---	---	---	PASS
RAB2B	84932	broad.mit.edu	37	14	21931912	21931912	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:21931912C>A	uc010tlt.1	-	6	478	c.377G>T	c.(376-378)CGC>CTC	p.R126L	RAB2B_uc010tls.1_Missense_Mutation_p.R80L|RAB2B_uc001wax.2_Missense_Mutation_p.R61L|RAB2B_uc010ain.2_Missense_Mutation_p.R17L	NM_032846	NP_116235	Q8WUD1	RAB2B_HUMAN	RAB2B protein isoform 1	126					protein transport|small GTPase mediated signal transduction|vesicle-mediated transport	endoplasmic reticulum membrane|Golgi membrane|plasma membrane	GTP binding			ovary(1)	1	all_cancers(95;0.000858)		Epithelial(56;1.53e-06)|all cancers(55;1.44e-05)	GBM - Glioblastoma multiforme(265;0.00391)		CACATCCCTGCGGGACTCTAG	0.408													49	66	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	14	22771929	22771929	+	Intron	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:22771929G>A	uc001wbw.2	+						uc010aja.1_Intron|uc010tmk.1_Intron|uc010tmo.1_Intron|uc001wco.2_Intron|uc010aje.1_Intron|uc001wcp.2_Intron|uc001wcr.1_Intron|uc001wcs.1_Intron|uc010ajf.1_Intron|uc010ajg.1_Intron|uc001wcx.3_Intron|uc001wdd.2_Intron|uc010ajj.1_Intron|uc001wde.1_Intron|uc001wdf.2_Intron|uc010ajk.1_Intron|uc001wdg.1_Intron|uc010ajl.1_Intron|uc001wdj.2_Intron|uc010ajo.1_Intron|uc010ajp.1_Intron|uc010ajq.1_5'UTR					SubName: Full=Alpha-chain C region; Flags: Fragment;																		GAACTGGACAGAAAAAAAAAA	0.413													4	9	---	---	---	---	PASS
HOMEZ	57594	broad.mit.edu	37	14	23746063	23746063	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:23746063C>A	uc001wja.2	-	2	522	c.374G>T	c.(373-375)CGA>CTA	p.R125L	HOMEZ_uc001wjb.2_Missense_Mutation_p.R127L	NM_020834	NP_065885	Q8IX15	HOMEZ_HUMAN	homeodomain leucine zipper protein	125						nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0	all_cancers(95;5.54e-06)			GBM - Glioblastoma multiforme(265;0.00643)		GTAGACTACTCGGGCTCGAGT	0.532													6	98	---	---	---	---	PASS
FOXG1	2290	broad.mit.edu	37	14	29237481	29237481	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:29237481G>A	uc001wqe.2	+	1	1195	c.996G>A	c.(994-996)TCG>TCA	p.S332S		NM_005249	NP_005240	P55316	FOXG1_HUMAN	forkhead box G1	332					axon midline choice point recognition|central nervous system neuron development|dorsal/ventral pattern formation|embryo development ending in birth or egg hatching|hindbrain development|inner ear morphogenesis|negative regulation of neuron differentiation|negative regulation of transcription, DNA-dependent|nonmotile primary cilium assembly|nose development|positive regulation of cell cycle|positive regulation of neuroblast proliferation|positive regulation of transcription from RNA polymerase II promoter|regulation of mitotic cell cycle|regulation of sequence-specific DNA binding transcription factor activity|tissue development	transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding			ovary(2)|lung(2)	4			LUAD - Lung adenocarcinoma(48;0.011)|Lung(238;0.0575)	GBM - Glioblastoma multiforme(265;0.00413)		GCACCACGTCGGCCTACCCCA	0.652													15	38	---	---	---	---	PASS
G2E3	55632	broad.mit.edu	37	14	31085736	31085736	+	Missense_Mutation	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31085736A>G	uc001wqk.2	+	15	2271	c.2117A>G	c.(2116-2118)CAT>CGT	p.H706R	G2E3_uc010tpf.1_Missense_Mutation_p.H660R|G2E3_uc001wql.1_Missense_Mutation_p.H218R	NM_017769	NP_060239	Q7L622	G2E3_HUMAN	G2/M-phase specific E3 ubiquitin ligase	706					apoptosis|multicellular organismal development|protein modification process	Golgi apparatus|nucleolus	acid-amino acid ligase activity|protein binding|zinc ion binding			ovary(2)|skin(1)	3						TACATTGGACATTAAAATGTT	0.313													31	59	---	---	---	---	PASS
HECTD1	25831	broad.mit.edu	37	14	31578712	31578712	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31578712C>A	uc001wrc.1	-	36	6860	c.6371G>T	c.(6370-6372)CGA>CTA	p.R2124L	HECTD1_uc001wra.1_Missense_Mutation_p.R250L|HECTD1_uc001wrb.1_Missense_Mutation_p.R250L	NM_015382	NP_056197	Q9ULT8	HECD1_HUMAN	HECT domain containing 1	2124					protein ubiquitination involved in ubiquitin-dependent protein catabolic process	intracellular	metal ion binding|protein binding|ubiquitin-protein ligase activity			ovary(3)|large_intestine(1)|lung(1)	5	Hepatocellular(127;0.0877)|Breast(36;0.176)		LUAD - Lung adenocarcinoma(48;0.00292)|Lung(238;0.0164)|BRCA - Breast invasive adenocarcinoma(188;0.111)|STAD - Stomach adenocarcinoma(7;0.173)	GBM - Glioblastoma multiforme(265;0.00617)		ACGACCAACTCGAAACTCTCC	0.473													5	57	---	---	---	---	PASS
ARHGAP5	394	broad.mit.edu	37	14	32560744	32560744	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:32560744G>T	uc001wrl.2	+	2	1108	c.869G>T	c.(868-870)TGG>TTG	p.W290L	ARHGAP5_uc001wrm.2_Missense_Mutation_p.W290L|ARHGAP5_uc001wrn.2_Missense_Mutation_p.W290L|ARHGAP5_uc001wro.2_Intron|ARHGAP5_uc001wrp.2_Intron	NM_001173	NP_001025226	Q13017	RHG05_HUMAN	Rho GTPase activating protein 5 isoform b	290	FF 1.				cell adhesion|Rho protein signal transduction	cytosol|membrane	GTP binding|GTPase activity|Rho GTPase activator activity|SH2 domain binding			ovary(4)|central_nervous_system(1)	5	Hepatocellular(127;0.0604)|Prostate(35;0.15)|Breast(36;0.186)		LUAD - Lung adenocarcinoma(48;0.00192)|Lung(238;0.00714)|BRCA - Breast invasive adenocarcinoma(188;0.0952)|STAD - Stomach adenocarcinoma(7;0.173)	GBM - Glioblastoma multiforme(265;0.00566)		CATGCAACTTGGAAAACTGTT	0.328													10	218	---	---	---	---	PASS
AKAP6	9472	broad.mit.edu	37	14	33015639	33015639	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:33015639C>A	uc001wrq.2	+	4	1950	c.1780C>A	c.(1780-1782)CCG>ACG	p.P594T	AKAP6_uc010aml.2_Missense_Mutation_p.P591T	NM_004274	NP_004265	Q13023	AKAP6_HUMAN	A-kinase anchor protein 6	594					protein targeting	calcium channel complex|nuclear membrane|sarcoplasmic reticulum	protein kinase A binding|receptor binding			breast(6)|ovary(5)|lung(4)|skin(3)|large_intestine(2)|pancreas(1)	21	Breast(36;0.0388)|Prostate(35;0.15)		LUAD - Lung adenocarcinoma(48;0.00107)|Lung(238;0.00677)|STAD - Stomach adenocarcinoma(7;0.116)	GBM - Glioblastoma multiforme(265;0.019)		CATCATGTCTCCGGTGCCACT	0.468													6	90	---	---	---	---	PASS
PNN	5411	broad.mit.edu	37	14	39647130	39647130	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:39647130C>A	uc001wuw.3	+							NM_002687	NP_002678	Q9H307	PININ_HUMAN	pinin, desmosome associated protein						cell adhesion|regulation of transcription, DNA-dependent|transcription, DNA-dependent	catalytic step 2 spliceosome|desmosome|intermediate filament|nuclear speck	DNA binding|protein binding|structural molecule activity			ovary(1)	1	Hepatocellular(127;0.213)		LUAD - Lung adenocarcinoma(48;0.000565)|Lung(238;0.000711)	GBM - Glioblastoma multiforme(112;0.0119)		GGTATTTATCCAAGTTTTGTT	0.308													8	187	---	---	---	---	PASS
CTAGE5	4253	broad.mit.edu	37	14	39818059	39818059	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:39818059G>T	uc001wvg.3	+	23	2462	c.2126G>T	c.(2125-2127)AGA>ATA	p.R709I	CTAGE5_uc001wuz.3_Missense_Mutation_p.R697I|CTAGE5_uc001wuy.3_Missense_Mutation_p.R629I|CTAGE5_uc001wvb.3_Missense_Mutation_p.R637I|CTAGE5_uc001wvc.3_Missense_Mutation_p.R611I|CTAGE5_uc001wva.3_Missense_Mutation_p.R680I|CTAGE5_uc001wvh.3_Missense_Mutation_p.R666I|CTAGE5_uc001wvf.3_Missense_Mutation_p.R634I|CTAGE5_uc001wvi.3_Missense_Mutation_p.R714I|CTAGE5_uc010amz.2_Missense_Mutation_p.R325I|CTAGE5_uc001wvj.3_Missense_Mutation_p.R680I	NM_005930	NP_005921	O15320	CTGE5_HUMAN	CTAGE family, member 5 isoform 1	709	Pro-rich.						enzyme activator activity|protein binding				0	Hepatocellular(127;0.213)		LUAD - Lung adenocarcinoma(48;0.000565)|Lung(238;0.000711)	GBM - Glioblastoma multiforme(112;0.0475)		GTGGATGCAAGAGGCCCATTC	0.527													10	186	---	---	---	---	PASS
FANCM	57697	broad.mit.edu	37	14	45645264	45645264	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:45645264C>A	uc001wwd.3	+	14	3406	c.3307C>A	c.(3307-3309)CAC>AAC	p.H1103N	FANCM_uc010anf.2_Missense_Mutation_p.H1077N|FANCM_uc001wwe.3_Missense_Mutation_p.H639N|FANCM_uc010ang.2_Missense_Mutation_p.H317N	NM_020937	NP_065988	Q8IYD8	FANCM_HUMAN	Fanconi anemia, complementation group M	1103					DNA repair	Fanconi anaemia nuclear complex	ATP binding|ATP-dependent helicase activity|chromatin binding|DNA binding|nuclease activity|protein binding			ovary(3)|lung(2)|breast(2)	7						TGTTCAAATACACAGAAGCCC	0.358								Involved_in_tolerance_or_repair_of_DNA_crosslinks	Fanconi_Anemia				5	58	---	---	---	---	PASS
MDGA2	161357	broad.mit.edu	37	14	47566206	47566206	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:47566206G>C	uc001wwj.3	-	6	1035	c.839C>G	c.(838-840)TCC>TGC	p.S280C	MDGA2_uc001wwi.3_Missense_Mutation_p.S51C|MDGA2_uc010ani.2_5'UTR	NM_001113498	NP_001106970	Q7Z553	MDGA2_HUMAN	MAM domain containing 1 isoform 1	280	Ig-like 3.				spinal cord motor neuron differentiation	anchored to membrane|plasma membrane				ovary(4)|large_intestine(1)|pancreas(1)	6						AGTCCCAAAGGACCTGACCCA	0.468													23	89	---	---	---	---	PASS
NIN	51199	broad.mit.edu	37	14	51224024	51224024	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:51224024G>T	uc001wym.2	-	18	3915	c.3724C>A	c.(3724-3726)CCT>ACT	p.P1242T	NIN_uc001wyi.2_Missense_Mutation_p.P1242T|NIN_uc001wyj.2_Intron|NIN_uc001wyk.2_Intron|NIN_uc010tqp.1_Missense_Mutation_p.P1248T|NIN_uc001wyo.2_Missense_Mutation_p.P1242T	NM_182946	NP_891991	Q8N4C6	NIN_HUMAN	ninein isoform 5	1242	Potential.				centrosome localization	centrosome|microtubule	calcium ion binding|GTP binding|protein binding			skin(3)|ovary(1)|kidney(1)|central_nervous_system(1)	6	all_epithelial(31;0.00244)|Breast(41;0.127)					GAAGCCTCAGGGATTCTCTCA	0.428			T	PDGFRB	MPD								8	211	---	---	---	---	PASS
TXNDC16	57544	broad.mit.edu	37	14	52936765	52936765	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52936765G>T	uc001wzs.2	-	16	2057	c.1608C>A	c.(1606-1608)ACC>ACA	p.T536T	TXNDC16_uc010tqu.1_Silent_p.T531T|TXNDC16_uc010aoe.2_RNA	NM_020784	NP_065835	Q9P2K2	TXD16_HUMAN	thioredoxin domain containing 16 isoform 1	536					cell redox homeostasis	extracellular region					0	Breast(41;0.0716)					CTGTTTTCATGGTTGGACTAA	0.299													8	172	---	---	---	---	PASS
TXNDC16	57544	broad.mit.edu	37	14	52981641	52981641	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52981641G>T	uc001wzs.2	-	8	1011	c.562C>A	c.(562-564)CAA>AAA	p.Q188K	TXNDC16_uc010tqu.1_Missense_Mutation_p.Q183K|TXNDC16_uc010aoe.2_RNA	NM_020784	NP_065835	Q9P2K2	TXD16_HUMAN	thioredoxin domain containing 16 isoform 1	188					cell redox homeostasis	extracellular region					0	Breast(41;0.0716)					AAGACAAATTGGTATGTAGTC	0.358													8	184	---	---	---	---	PASS
TXNDC16	57544	broad.mit.edu	37	14	52985907	52985907	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:52985907C>A	uc001wzs.2	-	7	946	c.497G>T	c.(496-498)AGA>ATA	p.R166I	TXNDC16_uc010tqu.1_Missense_Mutation_p.R161I|TXNDC16_uc010aoe.2_RNA	NM_020784	NP_065835	Q9P2K2	TXD16_HUMAN	thioredoxin domain containing 16 isoform 1	166					cell redox homeostasis	extracellular region					0	Breast(41;0.0716)					TCCAATGGCTCTTACATATGA	0.308													8	160	---	---	---	---	PASS
FERMT2	10979	broad.mit.edu	37	14	53417131	53417131	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:53417131G>T	uc001xad.2	-	2	211	c.156C>A	c.(154-156)CTC>CTA	p.L52L	FERMT2_uc001xac.2_Silent_p.L52L|FERMT2_uc001xae.2_Silent_p.L52L|FERMT2_uc001xaf.2_Silent_p.L52L	NM_006832	NP_006823	Q96AC1	FERM2_HUMAN	fermitin family homolog 2 isoform 1	52					actin cytoskeleton organization|cell adhesion|cell junction assembly|regulation of cell shape	cell cortex|cytosol|focal adhesion|stress fiber	binding				0	Breast(41;0.0342)					GCTACTCACCGAGTTTCTCCA	0.562													7	92	---	---	---	---	PASS
WDHD1	11169	broad.mit.edu	37	14	55458024	55458024	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:55458024G>T	uc001xbm.1	-	12	1326	c.1248C>A	c.(1246-1248)TCC>TCA	p.S416S	WDHD1_uc010aom.1_5'UTR|WDHD1_uc001xbn.1_Silent_p.S293S	NM_007086	NP_009017	O75717	WDHD1_HUMAN	WD repeat and HMG-box DNA binding protein 1	416						cytoplasm|nucleoplasm	DNA binding			skin(1)	1						ATGGCCTTTGGGATGTTACAA	0.438													6	84	---	---	---	---	PASS
C14orf101	54916	broad.mit.edu	37	14	57072380	57072380	+	Silent	SNP	C	A	A	rs141465683		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:57072380C>A	uc001xcm.2	+	5	737	c.615C>A	c.(613-615)CTC>CTA	p.L205L	C14orf101_uc001xcj.2_RNA|C14orf101_uc001xck.2_Silent_p.L205L|C14orf101_uc010aot.1_Silent_p.L205L|C14orf101_uc001xcl.1_RNA|C14orf101_uc001xcn.2_RNA|C14orf101_uc010trf.1_5'UTR	NM_017799	NP_060269	Q9NX78	CN101_HUMAN	hypothetical protein LOC54916	205	Helical; (Potential).					integral to membrane				breast(1)|central_nervous_system(1)	2				OV - Ovarian serous cystadenocarcinoma(311;0.226)		CTTGGATTCTCTTTCAACTTT	0.289													9	223	---	---	---	---	PASS
EXOC5	10640	broad.mit.edu	37	14	57686090	57686090	+	Silent	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:57686090A>T	uc001xct.2	-	14	1727	c.1476T>A	c.(1474-1476)ATT>ATA	p.I492I	EXOC5_uc001xcs.2_Silent_p.I171I|EXOC5_uc010trg.1_Silent_p.I437I|EXOC5_uc010trh.1_Silent_p.I427I	NM_006544	NP_006535	O00471	EXOC5_HUMAN	SEC10 protein	492					exocytosis|post-Golgi vesicle-mediated transport|protein transport|vesicle docking	cytoplasm				ovary(2)|breast(1)	3						AAAGATGAAAAATAGTATTGG	0.313													11	18	---	---	---	---	PASS
EXOC5	10640	broad.mit.edu	37	14	57698409	57698409	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:57698409C>A	uc001xct.2	-	11	1214	c.963G>T	c.(961-963)CTG>CTT	p.L321L	EXOC5_uc001xcs.2_5'UTR|EXOC5_uc010trg.1_Silent_p.L266L|EXOC5_uc010trh.1_Silent_p.L256L	NM_006544	NP_006535	O00471	EXOC5_HUMAN	SEC10 protein	321					exocytosis|post-Golgi vesicle-mediated transport|protein transport|vesicle docking	cytoplasm				ovary(2)|breast(1)	3						TAAACTCCATCAGCTTGCTGG	0.313													7	133	---	---	---	---	PASS
KCNH5	27133	broad.mit.edu	37	14	63175127	63175127	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:63175127C>A	uc001xfx.2	-	11	2117	c.2066G>T	c.(2065-2067)CGC>CTC	p.R689L	KCNH5_uc001xfy.2_3'UTR	NM_139318	NP_647479	Q8NCM2	KCNH5_HUMAN	potassium voltage-gated channel, subfamily H,	689	Cytoplasmic (Potential).				regulation of transcription, DNA-dependent	integral to membrane	calmodulin binding|two-component sensor activity|voltage-gated potassium channel activity			ovary(4)|skin(4)|central_nervous_system(1)	9				OV - Ovarian serous cystadenocarcinoma(108;0.00958)|BRCA - Breast invasive adenocarcinoma(234;0.168)		CTGCCGGAGGCGCTCCTCCTC	0.498													5	122	---	---	---	---	PASS
KCNH5	27133	broad.mit.edu	37	14	63483580	63483580	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:63483580C>A	uc001xfx.2	-	2	217	c.166G>T	c.(166-168)GCT>TCT	p.A56S	KCNH5_uc001xfy.2_Missense_Mutation_p.A56S|KCNH5_uc001xfz.1_5'UTR|KCNH5_uc001xga.2_5'UTR	NM_139318	NP_647479	Q8NCM2	KCNH5_HUMAN	potassium voltage-gated channel, subfamily H,	56	Cytoplasmic (Potential).|PAS.				regulation of transcription, DNA-dependent	integral to membrane	calmodulin binding|two-component sensor activity|voltage-gated potassium channel activity			ovary(4)|skin(4)|central_nervous_system(1)	9				OV - Ovarian serous cystadenocarcinoma(108;0.00958)|BRCA - Breast invasive adenocarcinoma(234;0.168)		ATGACGTCAGCTCGATGATAT	0.363													9	97	---	---	---	---	PASS
SGPP1	81537	broad.mit.edu	37	14	64165361	64165361	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64165361C>A	uc001xgj.2	-	2	794	c.700G>T	c.(700-702)GGA>TGA	p.G234*		NM_030791	NP_110418	Q9BX95	SGPP1_HUMAN	sphingosine-1-phosphate phosphatase 1	234	Helical; (Potential).					endoplasmic reticulum membrane|integral to membrane	dihydrosphingosine-1-phosphate phosphatase activity|sphingosine-1-phosphate phosphatase activity			central_nervous_system(1)	1				OV - Ovarian serous cystadenocarcinoma(108;0.0056)|all cancers(60;0.0141)|BRCA - Breast invasive adenocarcinoma(234;0.103)		AGAATCAGTCCATATATAAGA	0.284													7	107	---	---	---	---	PASS
SYNE2	23224	broad.mit.edu	37	14	64688335	64688335	+	Silent	SNP	G	T	T	rs75079588	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:64688335G>T	uc001xgm.2	+	111	20264	c.20034G>T	c.(20032-20034)GCG>GCT	p.A6678A	SYNE2_uc001xgl.2_Silent_p.A6701A|SYNE2_uc010apy.2_Silent_p.A3063A|SYNE2_uc001xgn.2_Silent_p.A1640A|SYNE2_uc001xgo.2_RNA|SYNE2_uc010aqa.2_Silent_p.A648A|SYNE2_uc001xgq.2_Silent_p.A1057A|SYNE2_uc001xgr.2_Silent_p.A461A|SYNE2_uc010tsi.1_Silent_p.A335A|SYNE2_uc001xgs.2_Silent_p.A349A|SYNE2_uc001xgt.2_Silent_p.A223A	NM_015180	NP_055995	Q8WXH0	SYNE2_HUMAN	spectrin repeat containing, nuclear envelope 2	6678	Cytoplasmic (Potential).				centrosome localization|cytoskeletal anchoring at nuclear membrane|nuclear migration along microfilament|positive regulation of cell migration	cytoskeleton|filopodium membrane|focal adhesion|integral to membrane|lamellipodium membrane|mitochondrial part|nuclear outer membrane|nucleoplasm|sarcoplasmic reticulum membrane|SUN-KASH complex|Z disc	actin binding|protein binding			ovary(8)|breast(4)|central_nervous_system(1)|pancreas(1)	14				all cancers(60;0.00153)|OV - Ovarian serous cystadenocarcinoma(108;0.00444)|BRCA - Breast invasive adenocarcinoma(234;0.0681)		TGTGGTTAGCGAGTGCCAAGA	0.547													7	121	---	---	---	---	PASS
SPTB	6710	broad.mit.edu	37	14	65246547	65246547	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:65246547C>A	uc001xht.2	-	20	4423	c.4369G>T	c.(4369-4371)GAG>TAG	p.E1457*	SPTB_uc001xhr.2_Nonsense_Mutation_p.E1457*|SPTB_uc001xhs.2_Nonsense_Mutation_p.E1457*|SPTB_uc001xhu.2_Nonsense_Mutation_p.E1457*|SPTB_uc010aqi.2_Nonsense_Mutation_p.E118*	NM_000347	NP_000338	P11277	SPTB1_HUMAN	spectrin beta isoform b	1457	Spectrin 12.				actin filament capping|axon guidance	cell surface|cytosol|intrinsic to internal side of plasma membrane|protein complex|spectrin|spectrin-associated cytoskeleton	actin filament binding|structural constituent of cytoskeleton			ovary(7)|skin(2)|lung(1)|central_nervous_system(1)	11		all_lung(585;4.15e-09)		all cancers(60;4.33e-34)|OV - Ovarian serous cystadenocarcinoma(108;8.32e-20)|BRCA - Breast invasive adenocarcinoma(234;0.0628)		AACCGCTTCTCGATGCTCAAG	0.562													5	110	---	---	---	---	PASS
MPP5	64398	broad.mit.edu	37	14	67787968	67787968	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:67787968C>A	uc001xjc.2	+	13	2198	c.1732C>A	c.(1732-1734)CGT>AGT	p.R578S	MPP5_uc001xjd.2_Missense_Mutation_p.R544S|ATP6V1D_uc001xje.2_Intron	NM_022474	NP_071919	Q8N3R9	MPP5_HUMAN	membrane protein, palmitoylated 5	578	Guanylate kinase-like.				tight junction assembly	cytoplasm|endomembrane system|tight junction	protein domain specific binding			ovary(1)	1				all cancers(60;0.000388)|OV - Ovarian serous cystadenocarcinoma(108;0.00762)|BRCA - Breast invasive adenocarcinoma(234;0.0106)		TTTAAGTCTTCGTACACAGGT	0.368													8	148	---	---	---	---	PASS
ATP6V1D	51382	broad.mit.edu	37	14	67805349	67805349	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:67805349G>T	uc001xjf.2	-	9	909	c.733C>A	c.(733-735)CTA>ATA	p.L245I	ATP6V1D_uc001xje.2_RNA	NM_015994	NP_057078	Q9Y5K8	VATD_HUMAN	H(+)-transporting two-sector ATPase	245					ATP hydrolysis coupled proton transport|cellular iron ion homeostasis|insulin receptor signaling pathway|transferrin transport	cytosol|proton-transporting two-sector ATPase complex, catalytic domain|vacuolar proton-transporting V-type ATPase complex	protein binding|proton-transporting ATPase activity, rotational mechanism			ovary(1)|lung(1)	2				all cancers(60;0.000739)|OV - Ovarian serous cystadenocarcinoma(108;0.00597)|BRCA - Breast invasive adenocarcinoma(234;0.00957)		TATTCAAATAGAAGATCCTCG	0.408													9	205	---	---	---	---	PASS
DCAF5	8816	broad.mit.edu	37	14	69585939	69585939	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:69585939C>A	uc001xkp.2	-	3	586	c.367G>T	c.(367-369)GAG>TAG	p.E123*	DCAF5_uc001xkq.2_Nonsense_Mutation_p.E123*|DCAF5_uc001xkr.3_Nonsense_Mutation_p.E123*|DCAF5_uc001xks.2_Nonsense_Mutation_p.E123*	NM_003861	NP_003852	Q96JK2	DCAF5_HUMAN	WD repeat domain 22	123	WD 2.					CUL4 RING ubiquitin ligase complex				ovary(1)|central_nervous_system(1)	2						ATAACTTGCTCATCATTGCCT	0.358													7	88	---	---	---	---	PASS
MED6	10001	broad.mit.edu	37	14	71063403	71063403	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:71063403C>A	uc001xmf.2	-	3	229	c.199G>T	c.(199-201)GAG>TAG	p.E67*	MED6_uc010tth.1_Nonsense_Mutation_p.E67*|MED6_uc010tti.1_Nonsense_Mutation_p.E67*|MED6_uc001xmg.1_Nonsense_Mutation_p.E67*|MED6_uc010ttj.1_Nonsense_Mutation_p.E67*	NM_005466	NP_005457	O75586	MED6_HUMAN	mediator of RNA polymerase II transcription,	67					positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	mediator complex	transcription coactivator activity				0				all cancers(60;0.00315)|BRCA - Breast invasive adenocarcinoma(234;0.00685)|OV - Ovarian serous cystadenocarcinoma(108;0.0352)		AGGATGTACTCGATTCCAACC	0.373													5	103	---	---	---	---	PASS
DCAF4	26094	broad.mit.edu	37	14	73412709	73412709	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:73412709G>T	uc001xng.2	+	7	872	c.652G>T	c.(652-654)GAA>TAA	p.E218*	DCAF4_uc001xnj.2_Nonsense_Mutation_p.E218*|DCAF4_uc010ttr.1_Nonsense_Mutation_p.E196*|DCAF4_uc001xnh.2_Nonsense_Mutation_p.E118*|DCAF4_uc010tts.1_Nonsense_Mutation_p.E157*|DCAF4_uc010ttt.1_Nonsense_Mutation_p.E3*|DCAF4_uc001xni.2_Nonsense_Mutation_p.E157*|DCAF4_uc001xnk.2_Nonsense_Mutation_p.E218*	NM_015604	NP_056419	Q8WV16	DCAF4_HUMAN	DDB1 and CUL4 associated factor 4 isoform 1	218						CUL4 RING ubiquitin ligase complex				ovary(1)|central_nervous_system(1)|skin(1)	3						GTTCATGCACGAAAACCTCTA	0.517													5	91	---	---	---	---	PASS
ZNF410	57862	broad.mit.edu	37	14	74364926	74364926	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:74364926C>A	uc001xoz.1	+	5	723	c.541C>A	c.(541-543)CGT>AGT	p.R181S	ZNF410_uc001xoy.1_RNA|ZNF410_uc010ary.1_RNA|ZNF410_uc010tuf.1_RNA|ZNF410_uc010tug.1_5'UTR|ZNF410_uc010tuh.1_Missense_Mutation_p.R108S|ZNF410_uc010tui.1_RNA|ZNF410_uc010arz.1_Missense_Mutation_p.R198S|ZNF410_uc001xpa.1_5'UTR|ZNF410_uc001xpb.1_Missense_Mutation_p.R181S|ZNF410_uc001xpc.1_Missense_Mutation_p.R128S|ZNF410_uc010tuj.1_5'UTR	NM_021188	NP_067011	Q86VK4	ZN410_HUMAN	zinc finger protein 410	181					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			skin(1)	1				BRCA - Breast invasive adenocarcinoma(234;0.00369)		TGCTGCTACTCGTGCACAACT	0.488													5	41	---	---	---	---	PASS
TMED10	10972	broad.mit.edu	37	14	75614415	75614415	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:75614415G>T	uc001xrm.1	-	3	430	c.363C>A	c.(361-363)CTC>CTA	p.L121L	TMED10_uc010ash.1_RNA|TMED10_uc010asg.1_RNA|TMED10_uc010tuz.1_5'UTR	NM_006827	NP_006818	P49755	TMEDA_HUMAN	transmembrane emp24 domain-containing protein 10	121	Lumenal (Potential).|GOLD.				protein transport|regulated secretory pathway|vesicle targeting, to, from or within Golgi	cis-Golgi network|ER-Golgi intermediate compartment|Golgi membrane|integral to membrane|melanosome|microsome|zymogen granule membrane	protein binding				0				BRCA - Breast invasive adenocarcinoma(234;0.0126)		CTAGGATCACGAGTTGGTCAG	0.493													9	202	---	---	---	---	PASS
TTLL5	23093	broad.mit.edu	37	14	76219245	76219245	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:76219245C>A	uc001xrx.2	+	18	1702	c.1497C>A	c.(1495-1497)CTC>CTA	p.L499L	TTLL5_uc010ask.1_Silent_p.L513L|TTLL5_uc001xrz.2_Silent_p.L61L|TTLL5_uc001xry.1_RNA	NM_015072	NP_055887	Q6EMB2	TTLL5_HUMAN	tubulin tyrosine ligase-like family, member 5	499					protein modification process|transcription, DNA-dependent	centrosome|cilium|microtubule basal body|nucleus	tubulin-tyrosine ligase activity			ovary(2)|central_nervous_system(1)	3				BRCA - Breast invasive adenocarcinoma(234;0.029)		GGTCCTACCTCGAGCATAAGA	0.368													10	203	---	---	---	---	PASS
TTLL5	23093	broad.mit.edu	37	14	76224173	76224173	+	Intron	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:76224173G>A	uc001xrx.2	+						TTLL5_uc010ask.1_Intron|TTLL5_uc001xrz.2_Splice_Site_p.R79_splice|TTLL5_uc001xry.1_Intron	NM_015072	NP_055887	Q6EMB2	TTLL5_HUMAN	tubulin tyrosine ligase-like family, member 5						protein modification process|transcription, DNA-dependent	centrosome|cilium|microtubule basal body|nucleus	tubulin-tyrosine ligase activity			ovary(2)|central_nervous_system(1)	3				BRCA - Breast invasive adenocarcinoma(234;0.029)		TGCTTCTGTAGGGGAAACCCA	0.393													17	73	---	---	---	---	PASS
KIAA1737	85457	broad.mit.edu	37	14	77572095	77572095	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77572095C>A	uc001xtd.2	+	2	223	c.44C>A	c.(43-45)TCT>TAT	p.S15Y	KIAA1737_uc001xtc.1_Translation_Start_Site	NM_033426	NP_219494	Q9C0C6	K1737_HUMAN	KIAA1737 protein	15											0			Kidney(204;0.164)	BRCA - Breast invasive adenocarcinoma(234;0.0284)		AGAAGACTCTCTGCCAAAGTA	0.488													8	116	---	---	---	---	PASS
VIPAR	63894	broad.mit.edu	37	14	77909006	77909006	+	Splice_Site	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:77909006C>A	uc001xtt.1	-	11	970	c.632_splice	c.e11-1	p.E211_splice	VIPAR_uc001xtu.1_Splice_Site_p.E211_splice|VIPAR_uc010tvj.1_Splice_Site_p.E162_splice|VIPAR_uc001xtv.1_Splice_Site_p.E211_splice	NM_022067	NP_071350	Q9H9C1	VIPAR_HUMAN	hypothetical protein LOC63894						endosome to lysosome transport|intracellular protein transport|regulation of transcription, DNA-dependent|transcription, DNA-dependent	early endosome|late endosome|recycling endosome	protein binding			central_nervous_system(1)	1						AAGAGGATCTCTGTCAGACAG	0.413													7	100	---	---	---	---	PASS
TSHR	7253	broad.mit.edu	37	14	81528491	81528491	+	Splice_Site	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:81528491G>T	uc001xvd.1	+	2	327	c.171_splice	c.e2-1	p.L57_splice	TSHR_uc001xvb.1_Splice_Site_p.L57_splice|TSHR_uc001xvc.2_Splice_Site_p.L57_splice|TSHR_uc010tvs.1_Splice_Site_p.L57_splice	NM_000369	NP_000360	P16473	TSHR_HUMAN	thyroid stimulating hormone receptor isoform 1						cell-cell signaling|positive regulation of cell proliferation	integral to plasma membrane	protein binding|thyroid-stimulating hormone receptor activity			thyroid(289)|ovary(5)|lung(3)|kidney(1)|skin(1)	299				BRCA - Breast invasive adenocarcinoma(234;0.0402)	Thyrotropin Alfa(DB00024)	TATTTTCACAGGAAGCTTATT	0.274			Mis		toxic thyroid adenoma	thyroid  adenoma	Hereditary nonautoimmune hyperthyroidism; subclinical hypothyroidism 						8	177	---	---	---	---	PASS
SPATA7	55812	broad.mit.edu	37	14	88897553	88897553	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:88897553C>A	uc001xwq.2	+	9	1217	c.1066C>A	c.(1066-1068)CGT>AGT	p.R356S	SPATA7_uc001xwr.2_Missense_Mutation_p.R324S|SPATA7_uc001xws.2_Missense_Mutation_p.R292S|SPATA7_uc001xwt.2_Missense_Mutation_p.R250S|SPATA7_uc001xwu.2_Missense_Mutation_p.R12S	NM_018418	NP_060888	Q9P0W8	SPAT7_HUMAN	spermatogenesis-associated protein 7 isoform a	356					response to stimulus|visual perception					ovary(1)	1						CCCTTCAACTCGTAAAATCTA	0.279													8	226	---	---	---	---	PASS
ZC3H14	79882	broad.mit.edu	37	14	89037427	89037427	+	Splice_Site	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:89037427G>C	uc001xww.2	+	4	420	c.195_splice	c.e4-1	p.W65_splice	ZC3H14_uc010twd.1_Splice_Site_p.W65_splice|ZC3H14_uc010twe.1_Splice_Site_p.W65_splice|ZC3H14_uc001xwx.2_Splice_Site_p.W65_splice|ZC3H14_uc010twf.1_Splice_Site|ZC3H14_uc001xwy.2_Splice_Site_p.W31_splice|ZC3H14_uc010twg.1_5'Flank	NM_024824	NP_079100	Q6PJT7	ZC3HE_HUMAN	zinc finger CCCH-type containing 14 isoform 1							cytoplasm|cytoplasm|nuclear speck	protein binding|RNA binding|zinc ion binding			ovary(2)|skin(1)	3						TTTTTCCTCAGGCTTCATGGT	0.274													15	139	---	---	---	---	PASS
ATXN3	4287	broad.mit.edu	37	14	92530748	92530748	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:92530748C>A	uc001yac.3	-	11	1071	c.1002G>T	c.(1000-1002)ATG>ATT	p.M334I	ATXN3_uc010aug.2_Missense_Mutation_p.M319I|ATXN3_uc001yad.3_Missense_Mutation_p.M279I|ATXN3_uc010auh.2_Missense_Mutation_p.M268I|ATXN3_uc001yae.3_Missense_Mutation_p.M236I	NM_004993	NP_004984	P54252	ATX3_HUMAN	ataxin 3 reference isoform	334	UIM 3.				cell death|nervous system development|nucleotide-excision repair|regulation of transcription, DNA-dependent|synaptic transmission|transcription, DNA-dependent	cytoplasm|nuclear matrix|nucleoplasm	cysteine-type peptidase activity|protein binding				0		all_cancers(154;0.0768)		COAD - Colon adenocarcinoma(157;0.224)		CTTCTTCACTCATAGCATCAC	0.318													10	253	---	---	---	---	PASS
ITPK1	3705	broad.mit.edu	37	14	93412760	93412760	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:93412760G>T	uc001ybg.2	-	10	1106	c.817C>A	c.(817-819)CTG>ATG	p.L273M	ITPK1_uc001ybe.2_Missense_Mutation_p.L273M|ITPK1_uc001ybf.2_Missense_Mutation_p.L154M|ITPK1_uc001ybh.2_Missense_Mutation_p.L273M	NM_014216	NP_055031	Q13572	ITPK1_HUMAN	inositol 1,3,4-triphosphate 5/6 kinase isoform	273	ATP-grasp.				blood coagulation|inositol trisphosphate metabolic process|signal transduction	cytosol	ATP binding|hydrolase activity|inositol tetrakisphosphate 1-kinase activity|inositol-1,3,4-trisphosphate 5/6-kinase activity|isomerase activity|ligase activity|magnesium ion binding				0		all_cancers(154;0.077)|all_epithelial(191;0.247)		Epithelial(152;0.124)|all cancers(159;0.169)		GACACGCCCAGTGCCTGCCGC	0.617													5	54	---	---	---	---	PASS
OTUB2	78990	broad.mit.edu	37	14	94510313	94510313	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:94510313G>T	uc001yci.2	+							NM_023112	NP_075601	Q96DC9	OTUB2_HUMAN	OTU domain, ubiquitin aldehyde binding 2						cellular amino acid metabolic process|protein K48-linked deubiquitination|protein K63-linked deubiquitination		omega peptidase activity|protein binding|ubiquitin-specific protease activity				0		all_cancers(154;0.12)		Epithelial(152;0.124)|all cancers(159;0.21)|COAD - Colon adenocarcinoma(157;0.215)		TTCCCCCTCTGTAGGTTCAAA	0.527													8	175	---	---	---	---	PASS
DICER1	23405	broad.mit.edu	37	14	95570029	95570029	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95570029C>A	uc001ydw.2	-	22	3886	c.3704G>T	c.(3703-3705)TGT>TTT	p.C1235F	DICER1_uc010avh.1_Missense_Mutation_p.C133F|DICER1_uc001ydv.2_Missense_Mutation_p.C1225F|DICER1_uc001ydx.2_Missense_Mutation_p.C1235F|DICER1_uc001ydy.1_Missense_Mutation_p.C87F	NM_030621	NP_085124	Q9UPY3	DICER_HUMAN	dicer1	1235					negative regulation of Schwann cell proliferation|negative regulation of transcription from RNA polymerase II promoter|nerve development|neuron projection morphogenesis|peripheral nervous system myelin formation|positive regulation of myelination|positive regulation of Schwann cell differentiation|pre-miRNA processing|production of siRNA involved in RNA interference|targeting of mRNA for destruction involved in RNA interference	cytosol|RNA-induced silencing complex	ATP binding|ATP-dependent helicase activity|double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity			skin(2)|ovary(1)|pancreas(1)|lung(1)	5		all_cancers(154;0.0621)|all_epithelial(191;0.223)		Epithelial(152;0.211)|COAD - Colon adenocarcinoma(157;0.215)		CAGGAGAGTACATTCATCGCT	0.428			Mis F|N			pleuropulmonary blastoma			DICER_1_syndrome_|Familial_Multinodular_Goiter_				6	99	---	---	---	---	PASS
DICER1	23405	broad.mit.edu	37	14	95582907	95582907	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:95582907G>T	uc001ydw.2	-	11	1817	c.1635C>A	c.(1633-1635)TCC>TCA	p.S545S	DICER1_uc001ydv.2_Silent_p.S535S|DICER1_uc001ydx.2_Silent_p.S545S	NM_030621	NP_085124	Q9UPY3	DICER_HUMAN	dicer1	545	Helicase C-terminal.|Required for interaction with PRKRA and TARBP2.				negative regulation of Schwann cell proliferation|negative regulation of transcription from RNA polymerase II promoter|nerve development|neuron projection morphogenesis|peripheral nervous system myelin formation|positive regulation of myelination|positive regulation of Schwann cell differentiation|pre-miRNA processing|production of siRNA involved in RNA interference|targeting of mRNA for destruction involved in RNA interference	cytosol|RNA-induced silencing complex	ATP binding|ATP-dependent helicase activity|double-stranded RNA binding|metal ion binding|protein binding|ribonuclease III activity			skin(2)|ovary(1)|pancreas(1)|lung(1)	5		all_cancers(154;0.0621)|all_epithelial(191;0.223)		Epithelial(152;0.211)|COAD - Colon adenocarcinoma(157;0.215)		ATTGAACATAGGATCGATATT	0.368			Mis F|N			pleuropulmonary blastoma			DICER_1_syndrome_|Familial_Multinodular_Goiter_				8	160	---	---	---	---	PASS
BDKRB1	623	broad.mit.edu	37	14	96730991	96730991	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:96730991G>T	uc001yfh.2	+	3	1180	c.972G>T	c.(970-972)TGG>TGT	p.W324C	BDKRB1_uc010avn.2_Intron	NM_000710	NP_000701	P46663	BKRB1_HUMAN	bradykinin receptor B1	324	Cytoplasmic (Potential).				elevation of cytosolic calcium ion concentration	endoplasmic reticulum|integral to plasma membrane	bradykinin receptor activity			ovary(3)	3		all_cancers(154;0.0677)|Melanoma(154;0.155)|all_epithelial(191;0.179)		COAD - Colon adenocarcinoma(157;0.208)|Epithelial(152;0.226)		CCAAGGTCTGGGAACTTTATA	0.443													8	254	---	---	---	---	PASS
WARS	7453	broad.mit.edu	37	14	100801207	100801207	+	3'UTR	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:100801207G>A	uc001yhf.1	-	10					WARS_uc001yhe.1_3'UTR|WARS_uc001yhg.1_3'UTR|WARS_uc001yhh.1_3'UTR|WARS_uc001yhi.1_3'UTR|WARS_uc001yhj.1_3'UTR|WARS_uc001yhk.1_3'UTR|WARS_uc001yhl.1_3'UTR	NM_173701	NP_776049	P23381	SYWC_HUMAN	tryptophanyl-tRNA synthetase isoform a						angiogenesis|negative regulation of cell proliferation|regulation of angiogenesis|tryptophanyl-tRNA aminoacylation	cytosol|soluble fraction	ATP binding|protein binding|tryptophan-tRNA ligase activity			breast(1)	1		all_cancers(154;0.00223)|all_lung(585;2.48e-06)|all_epithelial(191;0.000564)|Melanoma(154;0.152)			L-Tryptophan(DB00150)	TATGTAAAACGAGTGCTACTG	0.478													16	68	---	---	---	---	PASS
DYNC1H1	1778	broad.mit.edu	37	14	102442115	102442115	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:102442115A>C	uc001yks.2	+	2	487	c.323A>C	c.(322-324)CAT>CCT	p.H108P		NM_001376	NP_001367	Q14204	DYHC1_HUMAN	cytoplasmic dynein 1 heavy chain 1	108	Stem (By similarity).				cytoplasmic mRNA processing body assembly|G2/M transition of mitotic cell cycle|microtubule-based movement|mitotic spindle organization|stress granule assembly|transport	centrosome|cytoplasmic dynein complex|cytosol|Golgi apparatus|microtubule	ATP binding|ATPase activity, coupled|microtubule motor activity|protein binding			ovary(7)|central_nervous_system(2)|pancreas(1)	10						ATAGACATTCATTATGGGGTT	0.279													22	135	---	---	---	---	PASS
RCOR1	23186	broad.mit.edu	37	14	103177273	103177273	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103177273G>T	uc001ymb.2	+	7	772	c.772G>T	c.(772-774)GAG>TAG	p.E258*		NM_015156	NP_055971	Q9UKL0	RCOR1_HUMAN	REST corepressor 1	258	Potential.				blood coagulation|histone H4 deacetylation|interspecies interaction between organisms	transcriptional repressor complex	protein binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription|transcription regulatory region DNA binding			ovary(1)	1						GTCTTCCAGCGAGGATGAACT	0.333													6	146	---	---	---	---	PASS
RCOR1	23186	broad.mit.edu	37	14	103188542	103188542	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103188542G>T	uc001ymb.2	+	11	1199	c.1199G>T	c.(1198-1200)CGA>CTA	p.R400L		NM_015156	NP_055971	Q9UKL0	RCOR1_HUMAN	REST corepressor 1	400	SANT 2.				blood coagulation|histone H4 deacetylation|interspecies interaction between organisms	transcriptional repressor complex	protein binding|RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription|transcription regulatory region DNA binding			ovary(1)	1						AAATATGGCCGAGATTTTCAG	0.348													7	116	---	---	---	---	PASS
C14orf73	91828	broad.mit.edu	37	14	103574790	103574790	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:103574790G>T	uc001ymk.2	+	10	1988	c.1912G>T	c.(1912-1914)GAG>TAG	p.E638*		NM_001077594	NP_001071062	Q17RC7	EX3L4_HUMAN	hypothetical protein LOC91828	638											0		Melanoma(154;0.155)	Epithelial(46;0.221)			GATCCTGGGCGAGACCTACAA	0.607													5	95	---	---	---	---	PASS
AHNAK2	113146	broad.mit.edu	37	14	105418747	105418747	+	Missense_Mutation	SNP	C	A	A	rs75352715		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:105418747C>A	uc010axc.1	-	7	3161	c.3041G>T	c.(3040-3042)GGG>GTG	p.G1014V	AHNAK2_uc001ypx.2_Missense_Mutation_p.G914V	NM_138420	NP_612429	Q8IVF2	AHNK2_HUMAN	AHNAK nucleoprotein 2	1014						nucleus				ovary(1)	1		all_cancers(154;0.115)|Melanoma(154;0.155)|all_epithelial(191;0.183)	all cancers(16;0.000479)|OV - Ovarian serous cystadenocarcinoma(23;0.00659)|Epithelial(46;0.0151)|GBM - Glioblastoma multiforme(11;0.116)			GATGGACTTCCCTGGGGCCGA	0.602													11	178	---	---	---	---	PASS
ADAM6	8755	broad.mit.edu	37	14	107034915	107034915	+	RNA	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:107034915C>A	uc010tyt.1	-	154		c.7318G>T			uc001ysz.2_Missense_Mutation_p.W55C					Parts of antibodies, mostly variable regions.												0						TCTGGCGCACCCAGCCGATCC	0.567													5	9	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	15	22483060	22483060	+	IGR	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22483060C>A								OR4N3P (68675 upstream) : MIR1268 (30169 downstream)																							TATCCAGAAGCCTTGAAGGAG	0.537													9	92	---	---	---	---	PASS
PAR4	347745	broad.mit.edu	37	15	25453319	25453319	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25453319G>T	uc001yzk.1	+						PAR4_uc010ayo.1_Intron|SNORD115-20_uc001yzq.1_Intron|SNORD115-22_uc001yzr.1_5'Flank					Homo sapiens clone Rt-13I SNURF-SNRPN mRNA, downstream untranslated exons, alternatively spliced.												0						CCAACCTAGGGGAGAATTTTG	0.527													8	137	---	---	---	---	PASS
UBE3A	7337	broad.mit.edu	37	15	25599709	25599709	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25599709G>T	uc001zaq.2	-	8	2255	c.2255C>A	c.(2254-2256)CCA>CAA	p.P752Q	uc001zae.2_Intron|UBE3A_uc001zar.2_Missense_Mutation_p.P729Q|UBE3A_uc001zas.2_Missense_Mutation_p.P749Q|UBE3A_uc001zat.2_Missense_Mutation_p.P729Q	NM_000462	NP_000453	Q05086	UBE3A_HUMAN	ubiquitin protein ligase E3A isoform 2	752					brain development|interspecies interaction between organisms|protein K48-linked ubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus|proteasome complex	protein binding|ubiquitin-protein ligase activity			upper_aerodigestive_tract(1)|ovary(1)|breast(1)	3		all_cancers(20;3.47e-21)|Breast(32;0.00123)		all cancers(64;2.78e-08)|Epithelial(43;8.85e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0155)|Lung(196;0.0616)		AATTTCTTCTGGTCTGAATAA	0.353													8	142	---	---	---	---	PASS
ATP10A	57194	broad.mit.edu	37	15	25925402	25925402	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:25925402C>A	uc010ayu.2	-	20	3838	c.3732G>T	c.(3730-3732)GTG>GTT	p.V1244V		NM_024490	NP_077816	O60312	AT10A_HUMAN	ATPase, class V, type 10A	1244	Helical; (Potential).				ATP biosynthetic process|regulation of cell shape	integral to membrane|plasma membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			pancreas(2)|ovary(1)|breast(1)|liver(1)	5		all_cancers(20;5.16e-25)|all_lung(180;1.51e-14)|Acute lymphoblastic leukemia(1;2.53e-05)|all_hematologic(1;0.000267)|Breast(32;0.00125)		all cancers(64;9.48e-07)|Epithelial(43;1.69e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0252)|Lung(196;0.244)		AAATCAAAGCCACGGTGAAAA	0.468													8	49	---	---	---	---	PASS
GABRG3	2567	broad.mit.edu	37	15	27572070	27572070	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:27572070C>A	uc001zbg.1	+	4	551	c.385C>A	c.(385-387)CCA>ACA	p.P129T	GABRG3_uc001zbf.2_Missense_Mutation_p.P129T	NM_033223	NP_150092	Q99928	GBRG3_HUMAN	gamma-aminobutyric acid (GABA) A receptor, gamma	129	Extracellular (Probable).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity				0		all_lung(180;4.58e-12)|Breast(32;0.000625)|Colorectal(260;0.235)		all cancers(64;3.15e-07)|Epithelial(43;1.17e-06)|BRCA - Breast invasive adenocarcinoma(123;0.0261)		AATCTGGATCCCAGACACCAT	0.463													7	85	---	---	---	---	PASS
HERC2	8924	broad.mit.edu	37	15	28386674	28386674	+	Silent	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:28386674G>C	uc001zbj.2	-	78	12025	c.11919C>G	c.(11917-11919)GTC>GTG	p.V3973V		NM_004667	NP_004658	O95714	HERC2_HUMAN	hect domain and RLD 2	3973	RCC1 13.				DNA repair|intracellular protein transport|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus	guanyl-nucleotide exchange factor activity|heme binding|protein binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(4)|lung(4)|skin(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)	13		all_lung(180;1.3e-11)|Breast(32;0.000194)|Colorectal(260;0.227)		all cancers(64;3.93e-09)|Epithelial(43;9.99e-08)|BRCA - Breast invasive adenocarcinoma(123;0.0271)|GBM - Glioblastoma multiforme(186;0.0497)|Lung(196;0.199)		TGGGAACTTTGACTTTTGCGC	0.542													5	58	---	---	---	---	PASS
TRPM1	4308	broad.mit.edu	37	15	31354782	31354782	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:31354782G>T	uc001zfm.2	-	8	1151	c.1023C>A	c.(1021-1023)CTC>CTA	p.L341L	TRPM1_uc010azy.2_Silent_p.L248L|TRPM1_uc001zfl.2_RNA	NM_002420	NP_002411	Q7Z4N2	TRPM1_HUMAN	transient receptor potential cation channel,	341	Extracellular (Potential).				cellular response to light stimulus|visual perception	integral to plasma membrane	calcium channel activity|receptor activity			ovary(2)|pancreas(1)|skin(1)	4		all_lung(180;1.92e-11)		all cancers(64;3.52e-16)|Epithelial(43;1.65e-11)|GBM - Glioblastoma multiforme(186;3.57e-05)|BRCA - Breast invasive adenocarcinoma(123;0.00533)|COAD - Colon adenocarcinoma(236;0.0609)|Lung(196;0.199)		AGACACTTACGAGTTCTTTCT	0.348													5	89	---	---	---	---	PASS
RYR3	6263	broad.mit.edu	37	15	34147053	34147053	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34147053C>T	uc001zhi.2	+	98	14017	c.13947C>T	c.(13945-13947)ATC>ATT	p.I4649I	RYR3_uc010bar.2_Silent_p.I4644I	NM_001036	NP_001027	Q15413	RYR3_HUMAN	ryanodine receptor 3	4649					cellular calcium ion homeostasis	integral to membrane	calcium ion binding|receptor activity|ryanodine-sensitive calcium-release channel activity			ovary(5)|central_nervous_system(4)|lung(1)	10		all_lung(180;7.18e-09)		all cancers(64;8.95e-12)|GBM - Glioblastoma multiforme(186;0.00109)|BRCA - Breast invasive adenocarcinoma(123;0.0363)		TATTGGACATCGCAATGGGCT	0.453													19	88	---	---	---	---	PASS
EIF2AK4	440275	broad.mit.edu	37	15	40246108	40246108	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40246108C>A	uc001zkm.1	+	5	567	c.517C>A	c.(517-519)CGT>AGT	p.R173S	EIF2AK4_uc001zkl.2_Missense_Mutation_p.R173S|EIF2AK4_uc010bbj.1_5'Flank	NM_001013703	NP_001013725	Q9P2K8	E2AK4_HUMAN	eukaryotic translation initiation factor 2 alpha	173					translation	cytosolic ribosome	aminoacyl-tRNA ligase activity|ATP binding|eukaryotic translation initiation factor 2alpha kinase activity|protein homodimerization activity			lung(2)|stomach(1)|skin(1)	4		all_cancers(109;1.05e-19)|all_epithelial(112;4.38e-17)|Lung NSC(122;1.09e-12)|all_lung(180;3.56e-11)|Melanoma(134;0.0575)|Ovarian(310;0.0826)|Colorectal(260;0.119)		GBM - Glioblastoma multiforme(113;5.31e-07)|BRCA - Breast invasive adenocarcinoma(123;0.0616)		ATTTCAGCAACGTGAAATCCT	0.264													6	101	---	---	---	---	PASS
EIF2AK4	440275	broad.mit.edu	37	15	40247944	40247944	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40247944C>A	uc001zkm.1	+	6	768	c.718C>A	c.(718-720)CGG>AGG	p.R240R	EIF2AK4_uc001zkl.2_Silent_p.R240R|EIF2AK4_uc010bbj.1_5'UTR	NM_001013703	NP_001013725	Q9P2K8	E2AK4_HUMAN	eukaryotic translation initiation factor 2 alpha	240					translation	cytosolic ribosome	aminoacyl-tRNA ligase activity|ATP binding|eukaryotic translation initiation factor 2alpha kinase activity|protein homodimerization activity			lung(2)|stomach(1)|skin(1)	4		all_cancers(109;1.05e-19)|all_epithelial(112;4.38e-17)|Lung NSC(122;1.09e-12)|all_lung(180;3.56e-11)|Melanoma(134;0.0575)|Ovarian(310;0.0826)|Colorectal(260;0.119)		GBM - Glioblastoma multiforme(113;5.31e-07)|BRCA - Breast invasive adenocarcinoma(123;0.0616)		TGGTAAACATCGGGCAAACTC	0.453													5	92	---	---	---	---	PASS
NUSAP1	51203	broad.mit.edu	37	15	41668024	41668024	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41668024A>C	uc001zns.3	+	9	1351	c.1121A>C	c.(1120-1122)AAA>ACA	p.K374T	NUSAP1_uc001znq.3_Intron|NUSAP1_uc001znr.3_Missense_Mutation_p.K373T|NUSAP1_uc010bce.2_Intron|NUSAP1_uc001znt.3_Missense_Mutation_p.K359T|NUSAP1_uc001znv.3_Missense_Mutation_p.K372T|NUSAP1_uc001znu.3_Missense_Mutation_p.K373T|NUSAP1_uc010ucw.1_Intron|NUSAP1_uc001znw.3_Missense_Mutation_p.K178T	NM_016359	NP_057443	Q9BXS6	NUSAP_HUMAN	nucleolar and spindle associated protein 1	374	Interaction with microtubules (By similarity).				cytokinesis after mitosis|establishment of mitotic spindle localization|mitotic chromosome condensation|positive regulation of mitosis	chromosome|cytoplasm|nucleolus	DNA binding				0		all_cancers(109;5.07e-19)|all_epithelial(112;2.43e-16)|Lung NSC(122;1.81e-11)|all_lung(180;4.81e-10)|Melanoma(134;0.0179)|Colorectal(260;0.0946)|Ovarian(310;0.143)		OV - Ovarian serous cystadenocarcinoma(18;9.63e-17)|GBM - Glioblastoma multiforme(113;1.59e-06)|BRCA - Breast invasive adenocarcinoma(123;0.168)		GAACCACACAAAGGTATGTGG	0.393													8	47	---	---	---	---	PASS
RPAP1	26015	broad.mit.edu	37	15	41819710	41819710	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:41819710C>T	uc001zod.2	-	12	1646	c.1522G>A	c.(1522-1524)GAA>AAA	p.E508K		NM_015540	NP_056355	Q9BWH6	RPAP1_HUMAN	RNA polymerase II associated protein 1	508						nucleus	DNA binding|DNA-directed RNA polymerase activity			large_intestine(1)	1		all_cancers(109;6.59e-20)|all_epithelial(112;7.67e-17)|Lung NSC(122;5.34e-11)|all_lung(180;4.17e-10)|Melanoma(134;0.0179)|Ovarian(310;0.143)|Colorectal(260;0.173)		OV - Ovarian serous cystadenocarcinoma(18;2.84e-17)|GBM - Glioblastoma multiforme(113;1.68e-06)|Colorectal(105;0.0163)|BRCA - Breast invasive adenocarcinoma(123;0.117)		GGGCATTCTTCATCCTCGTCC	0.547													12	37	---	---	---	---	PASS
MGA	23269	broad.mit.edu	37	15	42003149	42003149	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42003149C>A	uc001zog.1	+	8	2777	c.2686C>A	c.(2686-2688)CGA>AGA	p.R896R	MGA_uc010ucy.1_Silent_p.R896R|MGA_uc010ucz.1_Silent_p.R896R	NM_001080541	NP_001074010	Q8IWI9	MGAP_HUMAN	MAX-interacting protein isoform 2	896						MLL1 complex	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(6)|kidney(3)|upper_aerodigestive_tract(1)|haematopoietic_and_lymphoid_tissue(1)|skin(1)	12		all_cancers(109;0.00356)|all_epithelial(112;0.0413)|all_lung(180;0.18)|Ovarian(310;0.238)		OV - Ovarian serous cystadenocarcinoma(18;1.41e-18)|GBM - Glioblastoma multiforme(113;2.15e-06)|COAD - Colon adenocarcinoma(120;0.031)|Lung(196;0.0721)|BRCA - Breast invasive adenocarcinoma(123;0.0964)|Colorectal(105;0.0998)|LUSC - Lung squamous cell carcinoma(244;0.235)		CCCTGTCTCTCGAAAGGCAAA	0.388													7	183	---	---	---	---	PASS
PLA2G4E	123745	broad.mit.edu	37	15	42302381	42302381	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:42302381C>A	uc001zow.1	-	1	65	c.65G>T	c.(64-66)AGC>ATC	p.S22I		NM_001080490	NP_001073959	Q3MJ16	PA24E_HUMAN	phospholipase A2, group 4E	Error:Variant_position_missing_in_Q3MJ16_after_alignment					phospholipid catabolic process	cytosol|lysosomal membrane	metal ion binding|phospholipase A2 activity				0		all_cancers(109;8.09e-13)|all_epithelial(112;2.03e-11)|Lung NSC(122;2.17e-07)|all_lung(180;8.79e-07)|Melanoma(134;0.0273)		OV - Ovarian serous cystadenocarcinoma(18;7.61e-18)|GBM - Glioblastoma multiforme(94;3.07e-06)		CTCCGGTACGCTGGGAGCCTG	0.592													5	28	---	---	---	---	PASS
TMEM62	80021	broad.mit.edu	37	15	43441294	43441294	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43441294C>A	uc001zqr.2	+	7	1090	c.811C>A	c.(811-813)CGT>AGT	p.R271S	TMEM62_uc010bda.2_Missense_Mutation_p.R141S	NM_024956	NP_079232	Q0P6H9	TMM62_HUMAN	transmembrane protein 62	271						integral to membrane				ovary(1)|breast(1)	2		all_cancers(109;1.16e-10)|all_epithelial(112;2.01e-09)|Lung NSC(122;8.91e-07)|all_lung(180;8.8e-06)|Melanoma(134;0.0728)		GBM - Glioblastoma multiforme(94;4.23e-07)		TTTGCACACTCGTCACTTCCA	0.408													5	99	---	---	---	---	PASS
CCNDBP1	23582	broad.mit.edu	37	15	43483668	43483668	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43483668G>T	uc001zqv.2	+	8	886	c.655G>T	c.(655-657)GAG>TAG	p.E219*	CCNDBP1_uc001zqu.2_Nonsense_Mutation_p.E91*|CCNDBP1_uc010bdc.2_Nonsense_Mutation_p.E219*|CCNDBP1_uc010bdb.2_Nonsense_Mutation_p.E91*|CCNDBP1_uc010udl.1_Nonsense_Mutation_p.E58*|CCNDBP1_uc001zqw.2_RNA|CCNDBP1_uc001zqx.2_Nonsense_Mutation_p.E91*|CCNDBP1_uc010bdd.2_Nonsense_Mutation_p.E91*|CCNDBP1_uc001zqy.2_Nonsense_Mutation_p.E91*	NM_012142	NP_036274	O95273	CCDB1_HUMAN	cyclin D-type binding-protein 1 isoform 1	219	Interaction with TCF3.				cell cycle	cytoplasm|nucleus	protein binding			ovary(1)|kidney(1)	2		all_cancers(109;3.31e-14)|all_epithelial(112;1.26e-12)|Lung NSC(122;2.46e-08)|all_lung(180;2.75e-07)|Melanoma(134;0.0476)|Colorectal(260;0.215)		GBM - Glioblastoma multiforme(94;8.42e-07)		CCACAATCATGAGGATGATGT	0.468													7	90	---	---	---	---	PASS
TP53BP1	7158	broad.mit.edu	37	15	43712600	43712600	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:43712600G>T	uc001zrs.2	-	21	4717	c.4569C>A	c.(4567-4569)TAC>TAA	p.Y1523*	TP53BP1_uc010udp.1_Nonsense_Mutation_p.Y1523*|TP53BP1_uc001zrq.3_Nonsense_Mutation_p.Y1528*|TP53BP1_uc001zrr.3_Nonsense_Mutation_p.Y1528*|TP53BP1_uc010udq.1_Nonsense_Mutation_p.Y1528*	NM_005657	NP_005648	Q12888	TP53B_HUMAN	tumor protein p53 binding protein 1 isoform 3	1523	Interaction with dimethylated histone H4.			Y->A: Increases affinity for histone H4 that has been dimethylated at 'Lys-20'. No effect on recruitment to double strand breaks.|Y->S: Decreases affinity for histone H4 that has been dimethylated at 'Lys-20'.	double-strand break repair via homologous recombination|positive regulation of transcription from RNA polymerase II promoter	condensed chromosome kinetochore|cytoplasm|nucleoplasm	p53 binding|RNA polymerase II activating transcription factor binding|RNA polymerase II transcription cofactor activity			ovary(2)|skin(2)|large_intestine(1)|pancreas(1)|kidney(1)	7		all_cancers(109;6.94e-11)|all_epithelial(112;2.69e-09)|Lung NSC(122;7.86e-07)|all_lung(180;7.84e-06)|Melanoma(134;0.0728)		GBM - Glioblastoma multiforme(94;1.59e-06)		CATCACATTCGTACCCATCAT	0.478								Direct_reversal_of_damage|Other_conserved_DNA_damage_response_genes					8	202	---	---	---	---	PASS
SPG11	80208	broad.mit.edu	37	15	44951474	44951474	+	Missense_Mutation	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:44951474A>G	uc001ztx.2	-	3	501	c.470T>C	c.(469-471)CTG>CCG	p.L157P	SPG11_uc010ueh.1_Missense_Mutation_p.L157P|SPG11_uc010uei.1_Missense_Mutation_p.L157P|SPG11_uc001zua.1_Missense_Mutation_p.L157P	NM_025137	NP_079413	Q96JI7	SPTCS_HUMAN	spatacsin isoform 1	157	Extracellular (Potential).				cell death	cytosol|integral to membrane|nucleus	protein binding			ovary(4)|skin(1)	5		all_cancers(109;1.29e-14)|all_epithelial(112;1.26e-12)|Lung NSC(122;1.34e-07)|all_lung(180;1.21e-06)|Melanoma(134;0.0122)		all cancers(107;2.93e-22)|GBM - Glioblastoma multiforme(94;1.55e-06)|COAD - Colon adenocarcinoma(120;0.0432)|Colorectal(105;0.0484)|Lung(196;0.104)|LUSC - Lung squamous cell carcinoma(244;0.214)		GTGAAATGACAGGATTCTCAA	0.308													6	59	---	---	---	---	PASS
SLC28A2	9153	broad.mit.edu	37	15	45556214	45556214	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45556214C>A	uc001zva.2	+	6	647	c.582C>A	c.(580-582)CAC>CAA	p.H194Q		NM_004212	NP_004203	O43868	S28A2_HUMAN	solute carrier family 28 (sodium-coupled	194					nucleobase, nucleoside and nucleotide metabolic process	integral to plasma membrane|membrane fraction	nucleoside binding|nucleoside:sodium symporter activity|purine nucleoside transmembrane transporter activity			ovary(4)	4		all_cancers(109;8.53e-07)|all_epithelial(112;1.39e-05)|Lung NSC(122;8.3e-05)|all_lung(180;0.000547)|Melanoma(134;0.0417)		all cancers(107;3.77e-16)|GBM - Glioblastoma multiforme(94;2.71e-06)		CCAAACACCACAGCGCAGTGA	0.483													6	95	---	---	---	---	PASS
USP8	9101	broad.mit.edu	37	15	50769081	50769081	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:50769081G>T	uc001zym.3	+	10	1385	c.885G>T	c.(883-885)TTG>TTT	p.L295F	USP8_uc001zyk.1_5'UTR|USP8_uc001zyl.3_Missense_Mutation_p.L295F|USP8_uc001zyn.3_Missense_Mutation_p.L295F|USP8_uc010ufh.1_Missense_Mutation_p.L218F|USP8_uc010bev.1_Intron	NM_001128611	NP_001122083	P40818	UBP8_HUMAN	ubiquitin specific peptidase 8	295	Rhodanese.				cell cycle|cell proliferation|endosome organization|protein K48-linked deubiquitination|protein K63-linked deubiquitination|ubiquitin-dependent protein catabolic process	cytosol|early endosome|extrinsic to plasma membrane|nucleus	cysteine-type endopeptidase activity|SH3 domain binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			lung(1)|central_nervous_system(1)	2				all cancers(107;0.000225)|GBM - Glioblastoma multiforme(94;0.000771)		ATGAGCCTTTGGTTTTAGAGG	0.413													7	89	---	---	---	---	PASS
CYP19A1	1588	broad.mit.edu	37	15	51535107	51535107	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:51535107C>A	uc001zyz.3	-	3	254	c.3G>T	c.(1-3)ATG>ATT	p.M1I	CYP19A1_uc001zza.3_Missense_Mutation_p.M1I|CYP19A1_uc001zzb.2_Missense_Mutation_p.M1I|CYP19A1_uc001zzd.2_Missense_Mutation_p.M1I|CYP19A1_uc010bey.1_Missense_Mutation_p.M1I|CYP19A1_uc001zze.1_RNA	NM_031226	NP_112503	P11511	CP19A_HUMAN	cytochrome P450, family 19	1					estrogen biosynthetic process|xenobiotic metabolic process	endoplasmic reticulum membrane|membrane fraction	aromatase activity|electron carrier activity|heme binding|oxygen binding|steroid hydroxylase activity			skin(3)	3				all cancers(107;0.000372)|GBM - Glioblastoma multiforme(94;0.0128)	Aminoglutethimide(DB00357)|Anastrozole(DB01217)|Conjugated Estrogens(DB00286)|Danazol(DB01406)|Diethylstilbestrol(DB00255)|Exemestane(DB00990)|Letrozole(DB01006)|Testolactone(DB00894)|Testosterone(DB00624)	TTTCCAAAACCATCTTGTGTT	0.473													7	128	---	---	---	---	PASS
RAB27A	5873	broad.mit.edu	37	15	55516101	55516101	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:55516101G>T	uc002aco.2	-	6	686	c.453C>A	c.(451-453)CTC>CTA	p.L151L	RAB27A_uc002acr.2_Silent_p.L151L|RAB27A_uc002acp.2_Silent_p.L151L|RAB27A_uc002acq.2_Silent_p.L151L	NM_183234	NP_899057	P51159	RB27A_HUMAN	Ras-related protein Rab-27A	151					small GTPase mediated signal transduction	dendrite|exocytic vesicle|late endosome|lysosome|melanosome	GTP binding|GTPase activity			ovary(1)	1				all cancers(107;0.0273)|GBM - Glioblastoma multiforme(80;0.0993)		ATTTCTCTGCGAGTGCTATGG	0.388													9	204	---	---	---	---	PASS
TCF12	6938	broad.mit.edu	37	15	57458628	57458628	+	Silent	SNP	C	A	A	rs147522860		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:57458628C>A	uc002aec.2	+	6	638	c.354C>A	c.(352-354)TCC>TCA	p.S118S	TCF12_uc010ugm.1_Silent_p.S170S|TCF12_uc010ugn.1_Silent_p.S114S|TCF12_uc002aea.2_Silent_p.S118S|TCF12_uc010bfs.2_Intron|TCF12_uc002aeb.2_Silent_p.S118S|TCF12_uc002aed.2_Silent_p.S118S	NM_207038	NP_996921	Q99081	HTF4_HUMAN	transcription factor 12 isoform b	118					immune response|muscle organ development|regulation of transcription from RNA polymerase II promoter	nucleus	DNA binding|protein binding|sequence-specific DNA binding transcription factor activity			central_nervous_system(5)|ovary(2)|lung(1)	8		Colorectal(260;0.0907)		all cancers(107;0.000313)|GBM - Glioblastoma multiforme(80;0.00878)|STAD - Stomach adenocarcinoma(283;0.239)		GCTCATTTTCCCTGTACAGCA	0.308			T	TEC	extraskeletal myxoid chondrosarcoma								9	238	---	---	---	---	PASS
CGNL1	84952	broad.mit.edu	37	15	57730260	57730260	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:57730260C>A	uc002aeg.2	+	2	139	c.63C>A	c.(61-63)CTC>CTA	p.L21L	CGNL1_uc010bfw.2_Silent_p.L21L	NM_032866	NP_116255	Q0VF96	CGNL1_HUMAN	cingulin-like 1	21	Head.					myosin complex|tight junction	motor activity			skin(6)|ovary(4)|central_nervous_system(1)	11				all cancers(107;0.121)|GBM - Glioblastoma multiforme(80;0.186)		ATCTGAGACTCGCAAGTGATG	0.493													6	112	---	---	---	---	PASS
VPS13C	54832	broad.mit.edu	37	15	62241690	62241690	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:62241690C>A	uc002agz.2	-	42	4785	c.4711G>T	c.(4711-4713)GAG>TAG	p.E1571*	VPS13C_uc002aha.2_Nonsense_Mutation_p.E1528*|VPS13C_uc002ahb.1_Nonsense_Mutation_p.E1571*|VPS13C_uc002ahc.1_Nonsense_Mutation_p.E1528*	NM_020821	NP_065872	Q709C8	VP13C_HUMAN	vacuolar protein sorting 13C protein isoform 2A	1571					protein localization					ovary(2)	2						GGTTTCAGCTCGGATTCCTTC	0.368													6	118	---	---	---	---	PASS
TLN2	83660	broad.mit.edu	37	15	63031711	63031711	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63031711C>T	uc002alb.3	+	28	3852	c.3852C>T	c.(3850-3852)CTC>CTT	p.L1284L	TLN2_uc002alc.3_5'Flank	NM_015059	NP_055874	Q9Y4G6	TLN2_HUMAN	talin 2	1284					cell adhesion|cell-cell junction assembly|cytoskeletal anchoring at plasma membrane	actin cytoskeleton|cytoplasm|focal adhesion|ruffle|synapse	actin binding|insulin receptor binding|structural constituent of cytoskeleton			ovary(5)|upper_aerodigestive_tract(2)|lung(2)|breast(2)	11						ATGAATTCCTCGATGCTGGCA	0.547													15	44	---	---	---	---	PASS
TLN2	83660	broad.mit.edu	37	15	63069108	63069108	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63069108A>T	uc002alb.3	+	40	5513	c.5513A>T	c.(5512-5514)AAG>ATG	p.K1838M	TLN2_uc002alc.3_Missense_Mutation_p.K231M|TLN2_uc002ald.2_Missense_Mutation_p.K231M	NM_015059	NP_055874	Q9Y4G6	TLN2_HUMAN	talin 2	1838					cell adhesion|cell-cell junction assembly|cytoskeletal anchoring at plasma membrane	actin cytoskeleton|cytoplasm|focal adhesion|ruffle|synapse	actin binding|insulin receptor binding|structural constituent of cytoskeleton			ovary(5)|upper_aerodigestive_tract(2)|lung(2)|breast(2)	11						GCCATGAGCAAGGTGGGCATG	0.572													10	28	---	---	---	---	PASS
HERC1	8925	broad.mit.edu	37	15	63958160	63958160	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:63958160G>T	uc002amp.2	-	42	8661	c.8513C>A	c.(8512-8514)CCA>CAA	p.P2838Q		NM_003922	NP_003913	Q15751	HERC1_HUMAN	hect domain and RCC1-like domain 1	2838					protein modification process|transport	cytosol|Golgi apparatus|membrane	acid-amino acid ligase activity|ARF guanyl-nucleotide exchange factor activity			ovary(6)|breast(6)|lung(5)|central_nervous_system(2)	19						ATCAGCTGATGGTATGTCTCC	0.468													9	154	---	---	---	---	PASS
IGDCC4	57722	broad.mit.edu	37	15	65677303	65677303	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65677303C>A	uc002aou.1	-	19	3541	c.3331G>T	c.(3331-3333)GAC>TAC	p.D1111Y	IGDCC4_uc002aot.1_Missense_Mutation_p.D699Y	NM_020962	NP_066013	Q8TDY8	IGDC4_HUMAN	immunoglobulin superfamily, DCC subclass, member	1111	Cytoplasmic (Potential).					integral to membrane|plasma membrane				ovary(1)|pancreas(1)|skin(1)	3						TTTATGGCGTCGTACACCAGA	0.632											OREG0023195	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	6	104	---	---	---	---	PASS
IGDCC4	57722	broad.mit.edu	37	15	65687505	65687505	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65687505G>T	uc002aou.1	-	8	1713	c.1503C>A	c.(1501-1503)TTC>TTA	p.F501L	IGDCC4_uc002aot.1_Missense_Mutation_p.F89L	NM_020962	NP_066013	Q8TDY8	IGDC4_HUMAN	immunoglobulin superfamily, DCC subclass, member	501	Extracellular (Potential).|Fibronectin type-III 1.					integral to membrane|plasma membrane				ovary(1)|pancreas(1)|skin(1)	3						CCACCACGTAGAACTCATAAT	0.562													5	25	---	---	---	---	PASS
RAB11A	8766	broad.mit.edu	37	15	66172017	66172017	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:66172017G>T	uc002apk.2	+	4	567	c.439G>T	c.(439-441)GGT>TGT	p.G147C	RAB11A_uc010ujk.1_Nonsense_Mutation_p.E147*	NM_004663	NP_004654	P62491	RB11A_HUMAN	Ras-related protein Rab-11A	147					cell cycle|cytokinesis|neuron projection development|plasma membrane to endosome transport|protein localization in plasma membrane|small GTPase mediated signal transduction|vesicle-mediated transport	cleavage furrow|plasma membrane|recycling endosome membrane|trans-Golgi network	GTP binding|GTPase activity|syntaxin binding				0						AGAAAAGAATGGTTTGTCATT	0.348													8	151	---	---	---	---	PASS
SPESP1	246777	broad.mit.edu	37	15	69238055	69238055	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:69238055C>A	uc002arn.1	+	2	310	c.182C>A	c.(181-183)CCA>CAA	p.P61Q	NOX5_uc002arp.1_Intron|NOX5_uc002arq.1_Intron|NOX5_uc010bid.1_Intron|NOX5_uc002aro.2_Intron	NM_145658	NP_663633	Q6UW49	SPESP_HUMAN	sperm equatorial segment protein 1 precursor	61					multicellular organismal development	acrosomal vesicle					0						TCTAACTCTCCAAAACATGTT	0.373													7	127	---	---	---	---	PASS
NOX5	79400	broad.mit.edu	37	15	69331338	69331338	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:69331338C>A	uc002ars.1	+						NOX5_uc002arp.1_Intron|NOX5_uc002arq.1_Intron|NOX5_uc010bid.1_Intron|NOX5_uc002arr.1_Intron|NOX5_uc010bie.1_Intron|NOX5_uc010bif.1_Intron	NM_024505	NP_078781	Q96PH1	NOX5_HUMAN	NADPH oxidase, EF-hand calcium binding domain 5						angiogenesis|angiogenesis|cytokine secretion|cytokinesis|electron transport chain|endothelial cell proliferation|induction of apoptosis|positive regulation of reactive oxygen species metabolic process|regulation of fusion of sperm to egg plasma membrane|regulation of proton transport|superoxide anion generation	endoplasmic reticulum|endoplasmic reticulum|integral to membrane	calcium ion binding|electron carrier activity|flavin adenine dinucleotide binding|heme binding|hydrogen ion channel activity|NADP binding|superoxide-generating NADPH oxidase activity			breast(1)|pancreas(1)	2						AGGTAATGGCCACCTCCtcca	0.284													8	100	---	---	---	---	PASS
HCN4	10021	broad.mit.edu	37	15	73617653	73617653	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:73617653C>A	uc002avp.2	-	5	2717	c.1723G>T	c.(1723-1725)GAG>TAG	p.E575*		NM_005477	NP_005468	Q9Y3Q4	HCN4_HUMAN	hyperpolarization activated cyclic	575	Cytoplasmic (Potential).				blood circulation|muscle contraction	integral to membrane	cAMP binding|protein binding|sodium channel activity|voltage-gated potassium channel activity			ovary(5)|liver(1)	6				COAD - Colon adenocarcinoma(1;0.142)		CGCAGGGGCTCGCTTAGCTCG	0.677													4	13	---	---	---	---	PASS
SIN3A	25942	broad.mit.edu	37	15	75676637	75676637	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:75676637C>A	uc002bai.2	-	17	3422	c.3163G>T	c.(3163-3165)GAG>TAG	p.E1055*	SIN3A_uc002baj.2_Nonsense_Mutation_p.E1055*|SIN3A_uc010uml.1_Nonsense_Mutation_p.E1055*	NM_015477	NP_056292	Q96ST3	SIN3A_HUMAN	transcriptional co-repressor Sin3A	1055					blood coagulation|cellular lipid metabolic process|negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleolus|Sin3 complex	protein binding			skin(3)|ovary(1)|lung(1)	5						ATTAGCTGCTCAGCTTTCCGC	0.483													8	170	---	---	---	---	PASS
CIB2	10518	broad.mit.edu	37	15	78403567	78403567	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:78403567G>T	uc002bdb.1	-	3	459	c.138C>A	c.(136-138)TAC>TAA	p.Y46*	CIB2_uc002bdc.1_Nonsense_Mutation_p.Y3*|CIB2_uc010ums.1_Nonsense_Mutation_p.Y46*	NM_006383	NP_006374	O75838	CIB2_HUMAN	DNA-dependent protein kinase catalytic	46							calcium ion binding				0						GGCTCTTCCTGTAGTCCATTG	0.592													5	57	---	---	---	---	PASS
KIAA1024	23251	broad.mit.edu	37	15	79760690	79760690	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:79760690C>A	uc002bew.1	+	4	2790	c.2715C>A	c.(2713-2715)CTC>CTA	p.L905L	KIAA1024_uc010unk.1_3'UTR	NM_015206	NP_056021	Q9UPX6	K1024_HUMAN	hypothetical protein LOC23251	905	Helical; (Potential).					integral to membrane				pancreas(2)|ovary(1)|central_nervous_system(1)	4						CCGTCATCCTCGTTATTGTCG	0.453													4	35	---	---	---	---	PASS
FAH	2184	broad.mit.edu	37	15	80454614	80454614	+	Silent	SNP	C	A	A	rs147946196	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:80454614C>A	uc002bfj.2	+	6	473	c.391C>A	c.(391-393)CGG>AGG	p.R131R	FAH_uc002bfk.1_Silent_p.R131R|FAH_uc002bfm.1_Silent_p.R131R|FAH_uc002bfn.1_Silent_p.R61R|FAH_uc010unl.1_Nonsense_Mutation_p.S152*|FAH_uc002bfl.1_Silent_p.R131R	NM_000137	NP_000128	P16930	FAAA_HUMAN	fumarylacetoacetase	131					L-phenylalanine catabolic process|tyrosine catabolic process	cytosol	fumarylacetoacetase activity|metal ion binding				0						CTATTCCTCTCGGCAGCATGC	0.488									Tyrosinemia_type_1				5	91	---	---	---	---	PASS
HOMER2	9455	broad.mit.edu	37	15	83561518	83561518	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:83561518C>A	uc002bjg.2	-	2	267	c.81G>T	c.(79-81)GCG>GCT	p.A27A	HOMER2_uc002bjh.2_Silent_p.A27A|HOMER2_uc002bjj.2_Silent_p.A27A|HOMER2_uc002bji.2_Silent_p.A27A	NM_199330	NP_955362	Q9NSB8	HOME2_HUMAN	homer 2 isoform 2	27	WH1.				metabotropic glutamate receptor signaling pathway	cell junction|cytoplasm|postsynaptic density|postsynaptic membrane					0						CCTGCTTGCTCGCAGGCATCC	0.542													6	95	---	---	---	---	PASS
ADAMTSL3	57188	broad.mit.edu	37	15	84373180	84373180	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:84373180G>T	uc002bjz.3	+	3	333	c.109G>T	c.(109-111)GAG>TAG	p.E37*	ADAMTSL3_uc002bjy.1_Nonsense_Mutation_p.E37*|ADAMTSL3_uc010bmt.1_Nonsense_Mutation_p.E37*|ADAMTSL3_uc010bmu.1_Nonsense_Mutation_p.E37*	NM_207517	NP_997400	P82987	ATL3_HUMAN	ADAMTS-like 3 precursor	37						proteinaceous extracellular matrix	metallopeptidase activity|zinc ion binding			ovary(6)|central_nervous_system(5)|lung(5)|large_intestine(4)|breast(3)|skin(2)|kidney(1)|pancreas(1)	27			BRCA - Breast invasive adenocarcinoma(143;0.211)			TTTCCTTCCCGAGTTTGCACT	0.463													10	214	---	---	---	---	PASS
DET1	55070	broad.mit.edu	37	15	89056198	89056198	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:89056198C>T	uc002bmr.2	-	5	1789	c.1637G>A	c.(1636-1638)CGA>CAA	p.R546Q	DET1_uc002bmp.3_RNA|DET1_uc010bnk.2_RNA|DET1_uc002bmq.2_Missense_Mutation_p.R557Q	NM_001144074	NP_001137546	Q7L5Y6	DET1_HUMAN	de-etiolated 1 isoform 2	546						nucleus				lung(1)|pancreas(1)	2	Lung NSC(78;0.105)|all_lung(78;0.182)		BRCA - Breast invasive adenocarcinoma(143;0.188)			GCAGCAGTGTCGCATATGGAA	0.493													8	31	---	---	---	---	PASS
POLG	5428	broad.mit.edu	37	15	89870503	89870503	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:89870503C>A	uc002bns.3	-	7	1610	c.1328G>T	c.(1327-1329)CGT>CTT	p.R443L	POLG_uc002bnr.3_Missense_Mutation_p.R443L	NM_002693	NP_002684	P54098	DPOG1_HUMAN	DNA-directed DNA polymerase gamma	443					base-excision repair, gap-filling|cell death|DNA-dependent DNA replication	mitochondrial nucleoid	DNA binding|DNA-directed DNA polymerase activity|protease binding			ovary(1)|lung(1)	2	Lung NSC(78;0.0472)|all_lung(78;0.089)		STAD - Stomach adenocarcinoma(125;0.165)			TGCCAGGTAACGCTCCCAGTT	0.587								DNA_polymerases_(catalytic_subunits)					7	27	---	---	---	---	PASS
IQGAP1	8826	broad.mit.edu	37	15	90977012	90977012	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:90977012G>T	uc002bpl.1	+	5	553	c.452G>T	c.(451-453)TGT>TTT	p.C151F		NM_003870	NP_003861	P46940	IQGA1_HUMAN	IQ motif containing GTPase activating protein 1	151	CH.				energy reserve metabolic process|regulation of insulin secretion|small GTPase mediated signal transduction	actin filament|cytoplasm|midbody|nucleus|plasma membrane	calmodulin binding|GTPase inhibitor activity|protein phosphatase binding|Ras GTPase activator activity			ovary(2)|lung(2)|central_nervous_system(2)|pancreas(1)|skin(1)	8	Melanoma(11;0.00551)|Lung NSC(78;0.0237)|all_lung(78;0.0488)		BRCA - Breast invasive adenocarcinoma(143;0.0745)|KIRC - Kidney renal clear cell carcinoma(17;0.138)|Kidney(142;0.194)			TGTATCTACTGTATCCATGCA	0.328													8	188	---	---	---	---	PASS
CRTC3	64784	broad.mit.edu	37	15	91162997	91162997	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91162997C>A	uc002bpp.2	+	9	830	c.724C>A	c.(724-726)CGA>AGA	p.R242R	CRTC3_uc002bpo.2_Silent_p.R242R	NM_022769	NP_073606	Q6UUV7	CRTC3_HUMAN	transducer of regulated CREB protein 3 isoform	242					interspecies interaction between organisms|regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus			CRTC3/MAML2(26)	salivary_gland(26)|ovary(1)	27	Melanoma(11;0.00551)|Lung NSC(78;0.0931)|all_lung(78;0.163)		BRCA - Breast invasive adenocarcinoma(143;0.0745)			AGGACGCCCTCGATCCTGTGA	0.438			T	MAML2	salivary gland mucoepidermoid								5	87	---	---	---	---	PASS
SV2B	9899	broad.mit.edu	37	15	91795651	91795651	+	Silent	SNP	C	A	A	rs148980578	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:91795651C>A	uc002bqv.2	+	3	1076	c.685C>A	c.(685-687)CGG>AGG	p.R229R	SV2B_uc002bqt.2_Silent_p.R229R|SV2B_uc010uqv.1_Silent_p.R78R|SV2B_uc002bqu.3_RNA	NM_014848	NP_055663	Q7L1I2	SV2B_HUMAN	synaptic vesicle protein 2B homolog	229	Cytoplasmic (Potential).				neurotransmitter transport	acrosomal vesicle|cell junction|integral to membrane|synaptic vesicle membrane	transmembrane transporter activity	p.R229R(1)		ovary(3)|central_nervous_system(2)|skin(2)|upper_aerodigestive_tract(1)	8	Lung NSC(78;0.0987)|all_lung(78;0.172)		BRCA - Breast invasive adenocarcinoma(143;0.0895)			ATTCTTGTCTCGGGAGAAGCG	0.483													5	84	---	---	---	---	PASS
ARRDC4	91947	broad.mit.edu	37	15	98511308	98511308	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:98511308C>A	uc010bom.2	+	4	746	c.587C>A	c.(586-588)TCG>TAG	p.S196*	ARRDC4_uc002bui.3_Nonsense_Mutation_p.S109*	NM_183376	NP_899232	Q8NCT1	ARRD4_HUMAN	arrestin domain containing 4	196					signal transduction						0	Melanoma(26;0.00539)|Lung NSC(78;0.0125)|all_lung(78;0.0222)		OV - Ovarian serous cystadenocarcinoma(32;0.0417)			GGTCCAGTCTCGCTGAGTGCC	0.333													5	131	---	---	---	---	PASS
TARSL2	123283	broad.mit.edu	37	15	102241364	102241364	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:102241364G>T	uc002bxm.2	-	10	1300	c.1245C>A	c.(1243-1245)CAC>CAA	p.H415Q	TARSL2_uc002bxl.2_5'UTR|TARSL2_uc010usi.1_RNA	NM_152334	NP_689547	A2RTX5	SYTC2_HUMAN	threonyl-tRNA synthetase-like 2	415					threonyl-tRNA aminoacylation	cytoplasm	ATP binding|threonine-tRNA ligase activity			ovary(2)	2	Lung NSC(78;0.000991)|all_lung(78;0.00128)|Melanoma(26;0.00505)		OV - Ovarian serous cystadenocarcinoma(32;0.000268)|LUSC - Lung squamous cell carcinoma(107;0.187)|Lung(145;0.23)			GACTCAAATCGTGGAAAAAGA	0.318													5	78	---	---	---	---	PASS
SRRM2	23524	broad.mit.edu	37	16	2817786	2817786	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:2817786G>T	uc002crk.2	+	11	7806	c.7257G>T	c.(7255-7257)ATG>ATT	p.M2419I	SRRM2_uc002crj.1_Missense_Mutation_p.M2323I|SRRM2_uc002crl.1_Missense_Mutation_p.M2419I|SRRM2_uc010bsu.1_Missense_Mutation_p.M2323I	NM_016333	NP_057417	Q9UQ35	SRRM2_HUMAN	splicing coactivator subunit SRm300	2419	Ser-rich.					Cajal body|catalytic step 2 spliceosome|nuclear speck	C2H2 zinc finger domain binding|protein N-terminus binding|RNA binding			ovary(1)|pancreas(1)|central_nervous_system(1)|skin(1)	4						AATCTAGGATGACCTCTGAAC	0.597													5	18	---	---	---	---	PASS
ZNF174	7727	broad.mit.edu	37	16	3452089	3452089	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3452089G>T	uc002cvc.2	+	1	900	c.85G>T	c.(85-87)GAG>TAG	p.E29*	ZNF434_uc002cux.3_5'Flank|ZNF434_uc010uwx.1_5'Flank|ZNF434_uc002cuy.3_5'Flank|ZNF434_uc002cuz.2_5'Flank|ZNF434_uc010uwy.1_5'Flank|ZNF434_uc010uxa.1_5'Flank|ZNF174_uc002cva.2_Nonsense_Mutation_p.E29*|ZNF174_uc002cvb.2_Nonsense_Mutation_p.E29*	NM_003450	NP_003441	Q15697	ZN174_HUMAN	zinc finger protein 174 isoform a	29					negative regulation of transcription from RNA polymerase II promoter|viral reproduction	actin cytoskeleton|cytoplasm|nucleus	protein homodimerization activity|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|zinc ion binding				0						CAAACTAGAAGAGAAACGGGG	0.488													8	157	---	---	---	---	PASS
CREBBP	1387	broad.mit.edu	37	16	3843455	3843455	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:3843455G>C	uc002cvv.2	-	4	1352	c.1148C>G	c.(1147-1149)CCG>CGG	p.P383R	CREBBP_uc002cvw.2_Missense_Mutation_p.P383R	NM_004380	NP_004371	Q92793	CBP_HUMAN	CREB binding protein isoform a	383	TAZ-type 1.|Interaction with SRCAP.				cellular lipid metabolic process|homeostatic process|interspecies interaction between organisms|N-terminal peptidyl-lysine acetylation|protein complex assembly|response to hypoxia	cytoplasm|nuclear body	histone acetyltransferase activity|MyoD binding|p53 binding|sequence-specific DNA binding transcription factor activity|signal transducer activity|transcription coactivator activity|zinc ion binding			haematopoietic_and_lymphoid_tissue(97)|ovary(14)|lung(6)|skin(6)|breast(2)|NS(1)|pancreas(1)	127		Ovarian(90;0.0266)		OV - Ovarian serous cystadenocarcinoma(1;3.54e-05)		TCGACAATGCGGGAGCGAGCA	0.498			T|N|F|Mis|O	MLL|MORF|RUNXBP2	ALL|AML|DLBCL|B-NHL 		Rubinstein-Taybi syndrome		Rubinstein-Taybi_syndrome				24	69	---	---	---	---	PASS
GRIN2A	2903	broad.mit.edu	37	16	9857519	9857519	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:9857519G>T	uc002czo.3	-	13	4430	c.3882C>A	c.(3880-3882)AAC>AAA	p.N1294K	GRIN2A_uc010uym.1_Missense_Mutation_p.N1294K|GRIN2A_uc010uyn.1_Intron|GRIN2A_uc002czr.3_Intron	NM_001134407	NP_001127879	Q12879	NMDE1_HUMAN	N-methyl-D-aspartate receptor subunit 2A isoform	1294	Cytoplasmic (Potential).				response to ethanol	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|outer membrane-bounded periplasmic space|postsynaptic membrane	N-methyl-D-aspartate selective glutamate receptor activity|zinc ion binding			skin(32)|NS(5)|ovary(4)|large_intestine(1)|lung(1)|breast(1)|kidney(1)	45					Felbamate(DB00949)|Glycine(DB00145)|L-Glutamic Acid(DB00142)|Loperamide(DB00836)|Memantine(DB01043)	TGTCGACAATGTTATCGTAGG	0.527													5	79	---	---	---	---	PASS
EMP2	2013	broad.mit.edu	37	16	10631855	10631855	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:10631855G>A	uc002czx.2	-	4	440	c.246C>T	c.(244-246)TTC>TTT	p.F82F		NM_001424	NP_001415	P54851	EMP2_HUMAN	epithelial membrane protein 2	82	Helical; (Potential).				cell proliferation	integral to membrane					0						GCTGGAGCACGAAGATGAAGA	0.557													10	85	---	---	---	---	PASS
ZC3H7A	29066	broad.mit.edu	37	16	11859381	11859381	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:11859381G>T	uc002dbk.2	-	13	1881	c.1683C>A	c.(1681-1683)CTC>CTA	p.L561L	ZC3H7A_uc002dbj.2_RNA|ZC3H7A_uc002dbl.2_Silent_p.L561L|ZC3H7A_uc002dbm.1_Silent_p.L471L	NM_014153	NP_054872	Q8IWR0	Z3H7A_HUMAN	zinc finger CCCH-type containing 7A	561						nucleus	nucleic acid binding|zinc ion binding			ovary(2)|pancreas(1)|skin(1)	4						GATGCTCCTGGAGAAGTTTGA	0.443													7	122	---	---	---	---	PASS
GDE1	51573	broad.mit.edu	37	16	19522230	19522230	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19522230C>A	uc002dgh.2	-	3	638	c.474G>T	c.(472-474)AGG>AGT	p.R158S	GDE1_uc002dgi.2_Missense_Mutation_p.R48S	NM_016641	NP_057725	Q9NZC3	GDE1_HUMAN	glycerophosphodiester phosphodiesterase 1	158	Lumenal (Potential).|GDPD.				glycerol metabolic process|lipid metabolic process	cytoplasm|integral to membrane	glycerophosphodiester phosphodiesterase activity|glycerophosphoinositol glycerophosphodiesterase activity|metal ion binding			ovary(2)|central_nervous_system(1)	3						CAACAGCTTCCCTTAGGGTAG	0.383													8	184	---	---	---	---	PASS
CP110	9738	broad.mit.edu	37	16	19548085	19548085	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:19548085C>A	uc002dgl.3	+	4	1341	c.1094C>A	c.(1093-1095)CCT>CAT	p.P365H	CP110_uc002dgk.3_Missense_Mutation_p.P365H			O43303	CP110_HUMAN	RecName: Full=Centrosomal protein of 110 kDa;          Short=Cep110;	365	Interaction with CEP76.				centriole replication|G2/M transition of mitotic cell cycle|regulation of cytokinesis	centriole|cytosol	protein binding				0						GCCAAATTACCTAGTCCAGAG	0.368													5	34	---	---	---	---	PASS
GPR139	124274	broad.mit.edu	37	16	20043299	20043299	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20043299C>A	uc002dgu.1	-	2	982	c.820G>T	c.(820-822)GCC>TCC	p.A274S	GPR139_uc010vaw.1_Missense_Mutation_p.A181S	NM_001002911	NP_001002911	Q6DWJ6	GP139_HUMAN	G protein-coupled receptor 139	274	Helical; Name=7; (Potential).					integral to membrane|plasma membrane				ovary(2)	2						TTCAGAAGGGCTAGCATGTTG	0.552													7	53	---	---	---	---	PASS
ACSM1	116285	broad.mit.edu	37	16	20693762	20693762	+	Missense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20693762T>A	uc002dhm.1	-	3	495	c.427A>T	c.(427-429)ATC>TTC	p.I143F	ACSM1_uc002dhn.1_RNA|ACSM1_uc010bwg.1_Missense_Mutation_p.I143F	NM_052956	NP_443188	Q08AH1	ACSM1_HUMAN	acyl-CoA synthetase medium-chain family member	143					benzoate metabolic process|butyrate metabolic process|energy derivation by oxidation of organic compounds|fatty acid oxidation|xenobiotic metabolic process	mitochondrial matrix	acyl-CoA ligase activity|ATP binding|butyrate-CoA ligase activity|GTP binding|metal ion binding			central_nervous_system(1)|skin(1)	2						TTCAACAGGATGGTCGCAGGA	0.473													8	41	---	---	---	---	PASS
ERI2	112479	broad.mit.edu	37	16	20800840	20800840	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20800840C>A	uc002dhs.2	-	10	898	c.855G>T	c.(853-855)ATG>ATT	p.M285I	ACSM3_uc002dhr.2_Intron|ACSM3_uc010vba.1_Intron	NM_080663	NP_542394	A8K979	ERI2_HUMAN	exoribonuclease 2 isoform 2	Error:Variant_position_missing_in_A8K979_after_alignment						intracellular	exonuclease activity|nucleic acid binding|zinc ion binding			large_intestine(1)	1						cctgtttactcatattgggct	0.045													8	122	---	---	---	---	PASS
LOC81691	81691	broad.mit.edu	37	16	20857539	20857539	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20857539C>A	uc002dhv.2	+						ERI2_uc002dht.3_Intron|LOC81691_uc002dhx.2_Intron|LOC81691_uc002dhw.2_Intron|LOC81691_uc002dhy.3_Intron	NM_030941	NP_112203	Q96IC2	REXON_HUMAN	exonuclease NEF-sp isoform 1							nucleolus	exonuclease activity|nucleotide binding|RNA binding			ovary(1)|kidney(1)	2						GGCTTTGATCCCAGACTCTGA	0.542													8	137	---	---	---	---	PASS
DNAH3	55567	broad.mit.edu	37	16	20975912	20975912	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:20975912C>A	uc010vbe.1	-	53	9294	c.9294G>T	c.(9292-9294)GCG>GCT	p.A3098A	DNAH3_uc010vbd.1_Silent_p.A533A	NM_017539	NP_060009	Q8TD57	DYH3_HUMAN	dynein, axonemal, heavy chain 3	3098	AAA 5 (By similarity).				ciliary or flagellar motility|microtubule-based movement	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|microtubule motor activity			ovary(10)|skin(3)|large_intestine(2)|central_nervous_system(2)|upper_aerodigestive_tract(1)	18				GBM - Glioblastoma multiforme(48;0.207)		CCAGTTTATTCGCCTTCTCCA	0.468													6	103	---	---	---	---	PASS
IGSF6	10261	broad.mit.edu	37	16	21654427	21654427	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:21654427G>T	uc002djg.1	-	5	687	c.634C>A	c.(634-636)CAT>AAT	p.H212N	uc002diq.3_Intron|METTL9_uc002dje.2_Intron|METTL9_uc002djf.2_Intron	NM_005849	NP_005840	O95976	IGSF6_HUMAN	immunoglobulin superfamily, member 6 precursor	212	Cytoplasmic (Potential).				cell surface receptor linked signaling pathway|immune response	integral to plasma membrane	transmembrane receptor activity				0				GBM - Glioblastoma multiforme(48;0.066)		TGTCTCTTATGGTATAGTTCT	0.318													7	118	---	---	---	---	PASS
PRKCB	5579	broad.mit.edu	37	16	24192229	24192229	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:24192229C>A	uc002dmd.2	+	13	1710	c.1513C>A	c.(1513-1515)CCA>ACA	p.P505T	PRKCB_uc002dme.2_Missense_Mutation_p.P505T	NM_212535	NP_997700	P05771	KPCB_HUMAN	protein kinase C, beta isoform 1	505	Protein kinase.				apoptosis|B cell activation|B cell receptor signaling pathway|intracellular signal transduction|lipoprotein transport|platelet activation|positive regulation of I-kappaB kinase/NF-kappaB cascade|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|synaptic transmission|transcription, DNA-dependent	cytosol|nucleus|plasma membrane	androgen receptor binding|ATP binding|chromatin binding|histone binding|histone kinase activity (H3-T6 specific)|ligand-dependent nuclear receptor transcription coactivator activity|protein kinase C activity|protein kinase C binding|zinc ion binding			ovary(3)|central_nervous_system(3)|lung(2)|large_intestine(1)	9					Vitamin E(DB00163)	CTGTGGCACTCCAGACTACAT	0.547													5	53	---	---	---	---	PASS
AQP8	343	broad.mit.edu	37	16	25228513	25228513	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:25228513C>A	uc002doc.2	+							NM_001169	NP_001160	O94778	AQP8_HUMAN	aquaporin 8						cellular response to cAMP	integral to plasma membrane	water channel activity			upper_aerodigestive_tract(1)|breast(1)|pancreas(1)	3				GBM - Glioblastoma multiforme(48;0.044)		TTTTTCCCTACGGCAGATAGC	0.577													6	165	---	---	---	---	PASS
EIF3CL	728689	broad.mit.edu	37	16	28734566	28734566	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:28734566C>A	uc010byj.2	+	9	947	c.858C>A	c.(856-858)TCC>TCA	p.S286S	uc010vct.1_Intron|EIF3CL_uc010byi.2_Silent_p.S286S|EIF3CL_uc002dqs.3_Silent_p.S286S|EIF3C_uc002dqt.3_Silent_p.S286S|EIF3CL_uc010vcy.1_Silent_p.S276S|EIF3C_uc002dqu.3_Silent_p.S286S|EIF3CL_uc002dqv.3_Silent_p.S32S	NM_001099661	NP_001093131	B5ME19	B5ME19_HUMAN	eukaryotic translation initiation factor 3,	286						eukaryotic translation initiation factor 3 complex	translation initiation factor activity				0						ACAGGAAATCCAAGCGCCTGG	0.567													11	333	---	---	---	---	PASS
KIF22	3835	broad.mit.edu	37	16	29810339	29810339	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:29810339G>T	uc002dts.3	+	5	617	c.593G>T	c.(592-594)CGA>CTA	p.R198L	uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|KIF22_uc010vdv.1_Missense_Mutation_p.R130L|KIF22_uc010vdw.1_Missense_Mutation_p.R130L|KIF22_uc010bzf.2_Missense_Mutation_p.R130L	NM_007317	NP_015556	Q14807	KIF22_HUMAN	kinesin family member 22	198	Kinesin-motor.				blood coagulation|DNA repair|microtubule-based movement|mitosis	cytosol|kinetochore|microtubule|nucleus	ATP binding|DNA binding|microtubule motor activity|protein binding				0						CTGGTAATCCGAGAAGACTGC	0.537													6	103	---	---	---	---	PASS
HIRIP3	8479	broad.mit.edu	37	16	30006065	30006065	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30006065C>A	uc002dve.2	-	4	862	c.401G>T	c.(400-402)CGA>CTA	p.R134L	uc002dtf.2_Intron|BOLA2_uc010bzb.1_Intron|INO80E_uc002dvg.1_5'Flank|INO80E_uc002dvh.1_5'Flank|INO80E_uc002dvi.1_5'Flank|INO80E_uc002dvj.1_5'Flank|INO80E_uc002dvk.1_5'Flank|HIRIP3_uc002dvf.2_Intron	NM_003609	NP_003600	Q9BW71	HIRP3_HUMAN	HIRA interacting protein 3	134	Glu-rich.				chromatin assembly or disassembly	nucleus	protein binding			central_nervous_system(1)	1						CTTTGAGGCTCGCCTTGGATT	0.597													6	108	---	---	---	---	PASS
C16orf93	90835	broad.mit.edu	37	16	30770363	30770363	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30770363C>G	uc002dzm.2	-	8	1118	c.787G>C	c.(787-789)GAG>CAG	p.E263Q	C16orf93_uc002dzn.2_Missense_Mutation_p.E328Q|C16orf93_uc002dzo.2_Missense_Mutation_p.E226Q	NM_001014979	NP_001014979	A1A4V9	CP093_HUMAN	hypothetical protein LOC90835	263											0						GCCACTGTCTCTAGTTCCTCT	0.562													19	119	---	---	---	---	PASS
C16orf93	90835	broad.mit.edu	37	16	30771025	30771025	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30771025C>G	uc002dzm.2	-	5	821	c.490G>C	c.(490-492)GAG>CAG	p.E164Q	C16orf93_uc002dzn.2_Missense_Mutation_p.E164Q|C16orf93_uc002dzo.2_Missense_Mutation_p.E127Q|RNF40_uc002dzq.2_5'Flank|RNF40_uc010caa.2_5'Flank|RNF40_uc010cab.2_5'Flank|RNF40_uc010vfa.1_5'Flank|RNF40_uc002dzr.2_5'Flank|RNF40_uc010vfb.1_5'Flank	NM_001014979	NP_001014979	A1A4V9	CP093_HUMAN	hypothetical protein LOC90835	164											0						TAGCACTCCTCCACGTTGCCC	0.502													4	27	---	---	---	---	PASS
SETD1A	9739	broad.mit.edu	37	16	30991034	30991034	+	Silent	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:30991034G>C	uc002ead.1	+	14	4613	c.3927G>C	c.(3925-3927)ACG>ACC	p.T1309T		NM_014712	NP_055527	O15047	SET1A_HUMAN	SET domain containing 1A	1309					regulation of transcription, DNA-dependent|transcription, DNA-dependent	chromosome|nuclear speck|Set1C/COMPASS complex	histone-lysine N-methyltransferase activity|nucleotide binding|protein binding|RNA binding			ovary(2)|skin(1)	3						TCAAGCCCACGCCCCCTGCGC	0.706													3	18	---	---	---	---	PASS
DNAJA2	10294	broad.mit.edu	37	16	46991042	46991042	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:46991042G>T	uc002eeo.2	-	9	1280	c.1138C>A	c.(1138-1140)CGA>AGA	p.R380R	DNAJA2_uc002eep.2_Silent_p.R297R	NM_005880	NP_005871	O60884	DNJA2_HUMAN	DnaJ subfamily A member 2	380					positive regulation of cell proliferation|protein folding|response to heat	membrane	ATP binding|heat shock protein binding|metal ion binding|unfolded protein binding			lung(1)	1		all_cancers(37;0.00125)|all_lung(18;0.00338)|all_epithelial(9;0.00358)|Lung NSC(13;0.0309)|Breast(268;0.116)				CCTGAGCCTCGAGTGCTATCA	0.463													9	227	---	---	---	---	PASS
LONP2	83752	broad.mit.edu	37	16	48290549	48290549	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:48290549C>G	uc002efi.1	+	3	586	c.497C>G	c.(496-498)CCT>CGT	p.P166R	LONP2_uc010vgm.1_Intron|LONP2_uc002efj.1_Intron	NM_031490	NP_113678	Q86WA8	LONP2_HUMAN	peroxisomal LON protease-like	166	Lon.				misfolded or incompletely synthesized protein catabolic process|protein targeting to peroxisome|signal peptide processing	nucleoid|peroxisomal matrix	ATP binding|ATP-dependent peptidase activity|enzyme binding|sequence-specific DNA binding|serine-type endopeptidase activity				0						ATGTCTGTCCCTGCAGTTGCT	0.353													9	82	---	---	---	---	PASS
RPGRIP1L	23322	broad.mit.edu	37	16	53675399	53675399	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:53675399C>A	uc002ehp.2	-						RPGRIP1L_uc002eho.3_Intron|RPGRIP1L_uc010vgy.1_Intron|RPGRIP1L_uc010cbx.2_Intron|RPGRIP1L_uc010vgz.1_Intron	NM_015272	NP_056087	Q68CZ1	FTM_HUMAN	RPGRIP1-like isoform a						negative regulation of G-protein coupled receptor protein signaling pathway	cell-cell junction|centrosome|cilium axoneme|microtubule basal body	thromboxane A2 receptor binding			ovary(1)	1		all_cancers(37;0.0973)				TGTCAAATTACAATAATTTTA	0.279													12	48	---	---	---	---	PASS
AARS	16	broad.mit.edu	37	16	70302256	70302256	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70302256C>A	uc002eyn.1	-	8	1099	c.989G>T	c.(988-990)CGA>CTA	p.R330L	AARS_uc010vlu.1_Missense_Mutation_p.R160L	NM_001605	NP_001596	P49588	SYAC_HUMAN	alanyl-tRNA synthetase	330					alanyl-tRNA aminoacylation|tRNA processing	cytosol|soluble fraction	alanine-tRNA ligase activity|ATP binding|metal ion binding|tRNA binding			pancreas(1)	1		Ovarian(137;0.0365)		BRCA - Breast invasive adenocarcinoma(221;0.161)	L-Alanine(DB00160)	TCGGACAGCTCGGCGGAGAAT	0.507													4	40	---	---	---	---	PASS
ZFP1	162239	broad.mit.edu	37	16	75203869	75203869	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:75203869G>C	uc002fdo.2	+	4	1025	c.861G>C	c.(859-861)CAG>CAC	p.Q287H	ZFP1_uc002fdp.2_Missense_Mutation_p.Q232H|ZFP1_uc010cgt.2_Missense_Mutation_p.Q254H|ZFP1_uc010cgs.2_Missense_Mutation_p.Q232H|ZFP1_uc002fdq.2_Missense_Mutation_p.Q287H	NM_153688	NP_710155	Q6P2D0	ZFP1_HUMAN	zinc finger protein 1 homolog	287	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			upper_aerodigestive_tract(1)|ovary(1)	2						CCACACACCAGAGAATTCATA	0.433													5	30	---	---	---	---	PASS
C16orf7	9605	broad.mit.edu	37	16	89785517	89785517	+	Intron	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:89785517C>G	uc002fom.1	-						C16orf7_uc002fol.1_5'UTR|ZNF276_uc010ciq.2_5'Flank|ZNF276_uc002fop.2_5'Flank|ZNF276_uc002foq.3_5'Flank|ZNF276_uc010cir.2_5'Flank|ZNF276_uc002for.3_5'Flank|ZNF276_uc010cis.2_5'Flank|ZNF276_uc002fos.3_5'Flank|ZNF276_uc002fot.3_5'Flank	NM_004913	NP_004904	Q9Y2B5	CP007_HUMAN	chromosome 16 open reading frame 7						ATP synthesis coupled proton transport		GTPase activator activity|transporter activity				0		Lung NSC(15;2.19e-05)|all_lung(18;3.07e-05)|all_hematologic(23;0.0256)		BRCA - Breast invasive adenocarcinoma(80;0.0273)		CCTCCTGTGTCCAGGAAAGAG	0.517													11	31	---	---	---	---	PASS
PRPF8	10594	broad.mit.edu	37	17	1582704	1582704	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1582704C>G	uc002fte.2	-	10	1404	c.1290G>C	c.(1288-1290)TGG>TGC	p.W430C		NM_006445	NP_006436	Q6P2Q9	PRP8_HUMAN	U5 snRNP-specific protein	430						catalytic step 2 spliceosome|nuclear speck|U5 snRNP	protein binding|RNA binding			lung(4)|ovary(2)	6				UCEC - Uterine corpus endometrioid carcinoma (25;0.0855)		GCTCCCGATACCTGGAAAAAT	0.502													18	56	---	---	---	---	PASS
PRPF8	10594	broad.mit.edu	37	17	1584337	1584337	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:1584337C>A	uc002fte.2	-	7	992	c.878G>T	c.(877-879)TGG>TTG	p.W293L		NM_006445	NP_006436	Q6P2Q9	PRP8_HUMAN	U5 snRNP-specific protein	293						catalytic step 2 spliceosome|nuclear speck|U5 snRNP	protein binding|RNA binding			lung(4)|ovary(2)	6				UCEC - Uterine corpus endometrioid carcinoma (25;0.0855)		GAATTCATTCCAGTCTTCATC	0.279													8	114	---	---	---	---	PASS
SMG6	23293	broad.mit.edu	37	17	2203024	2203024	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:2203024G>T	uc002fub.1	-	2	1078	c.1023C>A	c.(1021-1023)AAC>AAA	p.N341K	SMG6_uc002fud.1_Missense_Mutation_p.N310K	NM_017575	NP_060045	Q86US8	EST1A_HUMAN	Smg-6 homolog, nonsense mediated mRNA decay	341	Interaction with telomeric DNA.				mRNA export from nucleus|nuclear-transcribed mRNA catabolic process, nonsense-mediated decay|regulation of dephosphorylation|telomere maintenance	chromosome, telomeric region|cytosol|nucleolus|telomerase holoenzyme complex	endoribonuclease activity|metal ion binding|protein binding|telomeric DNA binding			central_nervous_system(2)|lung(1)|kidney(1)	4						CTTTAGCACTGTTTTTCTGCT	0.473													6	85	---	---	---	---	PASS
SPATA22	84690	broad.mit.edu	37	17	3352120	3352120	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3352120G>A	uc002fvm.2	-	6	890	c.653C>T	c.(652-654)CCA>CTA	p.P218L	SPATA22_uc010vrg.1_Missense_Mutation_p.P202L|SPATA22_uc010vrf.1_Missense_Mutation_p.P218L|SPATA22_uc002fvn.2_Missense_Mutation_p.P218L|SPATA22_uc002fvo.2_Missense_Mutation_p.P218L|SPATA22_uc002fvp.2_Missense_Mutation_p.P218L|SPATA22_uc010ckf.2_Missense_Mutation_p.P175L	NM_032598	NP_115987	Q8NHS9	SPT22_HUMAN	spermatogenesis associated 22	218											0						GTTGTCTTCTGGAATATCATC	0.308													30	66	---	---	---	---	PASS
C17orf85	55421	broad.mit.edu	37	17	3716427	3716427	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3716427G>T	uc010ckl.1	-	13	1797	c.1774C>A	c.(1774-1776)CGC>AGC	p.R592S	C17orf85_uc002fwr.2_Missense_Mutation_p.R302S|C17orf85_uc002fwq.2_Missense_Mutation_p.R312S	NM_001114118	NP_001107590	Q53F19	CQ085_HUMAN	ELG protein isoform a	592							nucleotide binding			skin(1)	1				UCEC - Uterine corpus endometrioid carcinoma (3;0.0725)		TTCTTTTGGCGAGACTGCTCT	0.537													6	90	---	---	---	---	PASS
ZZEF1	23140	broad.mit.edu	37	17	3916904	3916904	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:3916904G>T	uc002fxe.2	-	52	8482	c.8418C>A	c.(8416-8418)TTC>TTA	p.F2806L	ZZEF1_uc002fxg.1_Missense_Mutation_p.F127L	NM_015113	NP_055928	O43149	ZZEF1_HUMAN	zinc finger, ZZ type with EF hand domain 1	2806							calcium ion binding|zinc ion binding			ovary(2)|central_nervous_system(1)|pancreas(1)	4						TCAAAATCTCGAATCCTGGCC	0.403													7	188	---	---	---	---	PASS
MINK1	50488	broad.mit.edu	37	17	4798448	4798448	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:4798448C>A	uc010vsl.1	+	25	3192	c.2996C>A	c.(2995-2997)CCC>CAC	p.P999H	MINK1_uc010vsk.1_Missense_Mutation_p.P970H|MINK1_uc010vsm.1_Missense_Mutation_p.P979H|MINK1_uc010vsn.1_Missense_Mutation_p.P962H|MINK1_uc010vso.1_Missense_Mutation_p.P907H|MINK1_uc010vsp.1_Missense_Mutation_p.P460H	NM_153827	NP_722549	Q8N4C8	MINK1_HUMAN	misshapen-like kinase 1 isoform 3	999	Mediates interaction with RAP2A.				JNK cascade	cytoplasm	ATP binding|protein binding|protein serine/threonine kinase activity|small GTPase regulator activity			central_nervous_system(2)|stomach(1)|large_intestine(1)|lung(1)|skin(1)	6						AACGTGAATCCCACCAACACC	0.602													9	258	---	---	---	---	PASS
ENO3	2027	broad.mit.edu	37	17	4858862	4858862	+	Silent	SNP	C	A	A	rs35119507	byFrequency	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:4858862C>A	uc002gab.3	+	8	922	c.828C>A	c.(826-828)CTC>CTA	p.L276L	ENO3_uc010vsr.1_Silent_p.L183L|ENO3_uc002gac.3_Silent_p.L276L|ENO3_uc010vss.1_Silent_p.L233L|ENO3_uc010vst.1_Silent_p.L112L	NM_053013	NP_443739	P13929	ENOB_HUMAN	enolase 3	276					gluconeogenesis|glycolysis	phosphopyruvate hydratase complex	magnesium ion binding|phosphopyruvate hydratase activity			ovary(1)	1						GGGAGAAGCTCGGAGAGCTGT	0.522													6	140	---	---	---	---	PASS
ZNF594	84622	broad.mit.edu	37	17	5085768	5085768	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:5085768G>T	uc010cla.1	-	2	1940	c.1784C>A	c.(1783-1785)CCA>CAA	p.P595Q		NM_032530	NP_115919	Q96JF6	ZN594_HUMAN	zinc finger protein 594	595					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|skin(1)	3						GCATTCATATGGTTTCTCTCT	0.423													8	174	---	---	---	---	PASS
SLC2A4	6517	broad.mit.edu	37	17	7187914	7187914	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7187914G>A	uc002gfp.2	+	7	1038	c.838G>A	c.(838-840)GGC>AGC	p.G280S	SLC2A4_uc002gfo.2_Missense_Mutation_p.G280S|SLC2A4_uc010cmd.2_RNA	NM_001042	NP_001033	P14672	GTR4_HUMAN	glucose transporter 4	280	Cytoplasmic (Potential).				carbohydrate metabolic process|glucose homeostasis|glucose import	external side of plasma membrane|integral to plasma membrane|perinuclear region of cytoplasm	D-glucose transmembrane transporter activity|protein binding				0						CCAGCTCCTGGGCAGCCGTAC	0.632													12	18	---	---	---	---	PASS
NEURL4	84461	broad.mit.edu	37	17	7221432	7221432	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7221432C>A	uc002gga.1	-	25	4019	c.4012G>T	c.(4012-4014)GAG>TAG	p.E1338*	GPS2_uc002gfv.1_5'Flank|GPS2_uc002gfw.1_5'Flank|GPS2_uc002gfx.1_5'Flank|NEURL4_uc002gfy.1_RNA|GPS2_uc002gfz.1_5'UTR|NEURL4_uc002ggb.1_Nonsense_Mutation_p.E1336*	NM_032442	NP_115818	Q96JN8	NEUL4_HUMAN	neuralized homolog 4 isoform 1	1338							protein binding			upper_aerodigestive_tract(1)|ovary(1)	2						GCATGGTACTCGCAGCTCTTT	0.592													5	74	---	---	---	---	PASS
ACAP1	9744	broad.mit.edu	37	17	7247076	7247076	+	Intron	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7247076T>A	uc002ggd.2	+							NM_014716	NP_055531	Q15027	ACAP1_HUMAN	centaurin beta1						intracellular signal transduction|lipid metabolic process|protein transport|regulation of ARF GTPase activity		ARF GTPase activator activity|phospholipase C activity|protein binding|zinc ion binding			breast(2)|large_intestine(1)	3						GTTTGTGAGTTGTGGCGGGGG	0.547													69	95	---	---	---	---	PASS
MPDU1	9526	broad.mit.edu	37	17	7487219	7487219	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7487219C>A	uc002ghw.2	+	1	255	c.39C>A	c.(37-39)CTC>CTA	p.L13L	MPDU1_uc010vub.1_5'UTR|MPDU1_uc002ghx.2_Silent_p.L13L|MPDU1_uc010vuc.1_Silent_p.L13L	NM_004870	NP_004861	O75352	MPU1_HUMAN	mannose-P-dolichol utilization defect 1	13					dolichol-linked oligosaccharide biosynthetic process|protein folding	endoplasmic reticulum membrane|integral to membrane|mitochondrion	protein binding			central_nervous_system(1)	1						AACGGCTGCTCGTGCCGATTC	0.542													7	147	---	---	---	---	PASS
TP53	7157	broad.mit.edu	37	17	7577090	7577090	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:7577090C>G	uc002gim.2	-	8	1042	c.848G>C	c.(847-849)CGC>CCC	p.R283P	TP53_uc002gig.1_Intron|TP53_uc002gih.2_Missense_Mutation_p.R283P|TP53_uc010cne.1_5'Flank|TP53_uc010cnf.1_Missense_Mutation_p.R151P|TP53_uc010cng.1_Missense_Mutation_p.R151P|TP53_uc002gii.1_Missense_Mutation_p.R151P|TP53_uc010cnh.1_Missense_Mutation_p.R283P|TP53_uc010cni.1_Missense_Mutation_p.R283P|TP53_uc002gij.2_Missense_Mutation_p.R283P	NM_001126112	NP_001119584	P04637	P53_HUMAN	tumor protein p53 isoform a	283	|Interaction with E4F1.|Interaction with HIPK1 (By similarity).|Interaction with AXIN1 (By similarity).		R -> C (in LFS; germline mutation and in sporadic cancers; somatic mutation).|R -> G (in sporadic cancers; somatic mutation).|R -> S (in a sporadic cancer; somatic mutation).|R -> L (in sporadic cancers; somatic mutation).|R -> P (in sporadic cancers; somatic mutation).|R -> H (in a brain tumor with no family history; germline mutation and in sporadic cancers; somatic mutation).		activation of caspase activity by cytochrome c|base-excision repair|blood coagulation|cell cycle arrest|cell differentiation|cell proliferation|cellular protein localization|cellular response to drug|cellular response to glucose starvation|cellular response to hypoxia|cellular response to ionizing radiation|cellular response to UV|determination of adult lifespan|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator|ER overload response|interspecies interaction between organisms|negative regulation of apoptosis|negative regulation of cell growth|negative regulation of cell proliferation|negative regulation of helicase activity|negative regulation of transcription from RNA polymerase II promoter|negative regulation of transcription from RNA polymerase II promoter|nucleotide-excision repair|oxidative stress-induced premature senescence|positive regulation of histone deacetylation|positive regulation of neuron apoptosis|positive regulation of peptidyl-tyrosine phosphorylation|positive regulation of reactive oxygen species metabolic process|positive regulation of thymocyte apoptosis|positive regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|protein localization|protein tetramerization|Ras protein signal transduction|regulation of mitochondrial membrane permeability|replicative senescence|response to antibiotic|response to gamma radiation|response to X-ray	cytoplasm|cytosol|endoplasmic reticulum|insoluble fraction|mitochondrion|nuclear chromatin|nuclear matrix|nucleolus|nucleus|PML body|protein complex|replication fork	ATP binding|chaperone binding|chromatin binding|copper ion binding|damaged DNA binding|DNA strand annealing activity|histone acetyltransferase binding|p53 binding|protease binding|protein binding|protein heterodimerization activity|protein kinase binding|protein N-terminus binding|protein phosphatase 2A binding|RNA polymerase II transcription factor binding|sequence-specific DNA binding transcription factor activity|transcription regulatory region DNA binding|transcription regulatory region DNA binding|transcription repressor activity|ubiquitin protein ligase binding|zinc ion binding	p.R283P(23)|p.R283C(18)|p.R283H(12)|p.0?(7)|p.R283L(4)|p.R283R(4)|p.R283fs*62(4)|p.R283G(2)|p.R283fs*63(2)|p.?(2)|p.R283fs*16(2)|p.A276_R283delACPGRDRR(1)|p.R283del(1)|p.R283S(1)|p.R283fs*22(1)|p.R282_E287delRRTEEE(1)|p.T284_G293del10(1)|p.G279fs*59(1)|p.S269fs*21(1)|p.C275_R283delCACPGRDRR(1)|p.L265_K305del41(1)|p.T284fs*57(1)|p.R283fs*56(1)|p.R283_T284>T(1)|p.V272_K292del21(1)|p.R283fs*59(1)|p.C275fs*20(1)		large_intestine(4656)|breast(2429)|upper_aerodigestive_tract(2212)|lung(2028)|ovary(1592)|oesophagus(1462)|haematopoietic_and_lymphoid_tissue(1228)|stomach(1136)|urinary_tract(1114)|central_nervous_system(1085)|liver(805)|skin(694)|pancreas(375)|biliary_tract(247)|soft_tissue(209)|prostate(194)|endometrium(150)|bone(102)|vulva(79)|kidney(79)|cervix(68)|thyroid(54)|salivary_gland(43)|adrenal_gland(37)|peritoneum(33)|eye(24)|thymus(21)|genital_tract(16)|autonomic_ganglia(16)|small_intestine(14)|testis(11)|penis(10)|vagina(6)|meninges(5)|pituitary(4)|pleura(3)|gastrointestinal_tract_(site_indeterminate)(1)|NS(1)|Fallopian tube(1)|placenta(1)	22245		all_cancers(10;1.01e-06)|Myeloproliferative disorder(207;0.0122)|Prostate(122;0.081)		GBM - Glioblastoma multiforme(2;1.59e-06)|READ - Rectum adenocarcinoma(115;0.174)		TTCCTCTGTGCGCCGGTCTCT	0.562		111	Mis|N|F		breast|colorectal|lung|sarcoma|adrenocortical|glioma|multiple other tumour types	breast|sarcoma|adrenocortical carcinoma|glioma|multiple other tumour types		Other_conserved_DNA_damage_response_genes	Hereditary_Adrenocortical_Cancer|Endometrial_Cancer_Familial_Clustering_of|Hereditary_Breast-Ovarian_Cancer_non-BRCA1/2|Li-Fraumeni_syndrome|Osteosarcoma_Familial_Clustering_of	HNSCC(1;<9.43e-08)|TCGA GBM(1;<1E-08)|TSP Lung(2;<1E-08)|TCGA Ovarian(1;<1.89e-07)|Multiple Myeloma(5;0.019)			10	10	---	---	---	---	PASS
WDR16	146845	broad.mit.edu	37	17	9480093	9480093	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:9480093C>A	uc002gly.2	+						STX8_uc002glx.2_5'Flank|WDR16_uc002glz.2_Intron|WDR16_uc010coc.2_Intron	NM_145054	NP_659491	Q8N1V2	WDR16_HUMAN	WD40-repeat protein upregulated in HCC isoform							cytoplasm|intracellular membrane-bounded organelle	protein binding			skin(2)|ovary(1)|central_nervous_system(1)	4						GTGAGGCCTCCAGCATCTTTG	0.547											OREG0024167	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	5	35	---	---	---	---	PASS
MYH1	4619	broad.mit.edu	37	17	10399845	10399845	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10399845C>A	uc002gmo.2	-	34	4772	c.4678G>T	c.(4678-4680)GGA>TGA	p.G1560*	uc002gml.1_Intron	NM_005963	NP_005954	P12882	MYH1_HUMAN	myosin, heavy chain 1, skeletal muscle, adult	1560	Potential.					muscle myosin complex|myofibril|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity			ovary(10)|skin(6)|breast(3)|upper_aerodigestive_tract(1)|kidney(1)	21						AGGATCTTTCCCTCTTCATGT	0.383													52	77	---	---	---	---	PASS
MYH2	4620	broad.mit.edu	37	17	10429093	10429093	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:10429093C>G	uc010coi.2	-	31	4416	c.4288G>C	c.(4288-4290)GAG>CAG	p.E1430Q	uc002gml.1_Intron|MYH2_uc002gmp.3_Missense_Mutation_p.E1430Q|MYH2_uc010coj.2_Intron	NM_001100112	NP_001093582	Q9UKX2	MYH2_HUMAN	myosin heavy chain IIa	1430	Potential.				muscle filament sliding	muscle myosin complex|myosin filament|sarcomere	actin binding|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(5)|pancreas(4)|skin(3)|lung(1)|kidney(1)	14						TCCTCGACCTCATTCTGCAGC	0.537													6	71	---	---	---	---	PASS
DNAH9	1770	broad.mit.edu	37	17	11835352	11835352	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:11835352C>A	uc002gne.2	+	64	12195	c.12127C>A	c.(12127-12129)CGG>AGG	p.R4043R	DNAH9_uc010coo.2_Silent_p.R3261R|DNAH9_uc002gnf.2_Silent_p.R355R	NM_001372	NP_001363	Q9NYC9	DYH9_HUMAN	dynein, axonemal, heavy chain 9 isoform 2	4043	AAA 6 (By similarity).				cell projection organization|cellular component movement|microtubule-based movement|spermatogenesis	axonemal dynein complex|cilium axoneme|cytoplasm|microtubule	ATP binding|ATPase activity|microtubule motor activity			skin(10)|ovary(4)|breast(3)|central_nervous_system(2)|pancreas(1)	20		Breast(5;0.0122)|all_epithelial(5;0.131)		Colorectal(4;6.88e-05)|COAD - Colon adenocarcinoma(4;0.000813)|READ - Rectum adenocarcinoma(10;0.157)		GATGTGTTCTCGGGAGACGGA	0.493													7	223	---	---	---	---	PASS
NCOR1	9611	broad.mit.edu	37	17	16029511	16029511	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:16029511G>T	uc002gpo.2	-	15	1759	c.1519C>A	c.(1519-1521)CGA>AGA	p.R507R	NCOR1_uc002gpn.2_Silent_p.R507R|NCOR1_uc002gpp.1_Silent_p.R398R|NCOR1_uc002gpr.2_Silent_p.R398R|NCOR1_uc002gps.1_Silent_p.R516R|NCOR1_uc010coz.1_Silent_p.R323R|NCOR1_uc010cpb.1_Silent_p.R517R|NCOR1_uc010cpa.1_Silent_p.R508R	NM_006311	NP_006302	O75376	NCOR1_HUMAN	nuclear receptor co-repressor 1	507	Potential.				cellular lipid metabolic process|chromatin modification|negative regulation of JNK cascade|regulation of glycolysis by negative regulation of transcription from an RNA polymerase II promoter|regulation of lipid transport by negative regulation of transcription from an RNA polymerase II promoter|spindle assembly|transcription from RNA polymerase II promoter	nuclear chromatin|spindle microtubule|transcriptional repressor complex	histone deacetylase binding|transcription corepressor activity|transcription regulatory region DNA binding			upper_aerodigestive_tract(2)|ovary(1)|central_nervous_system(1)|kidney(1)	5				UCEC - Uterine corpus endometrioid carcinoma (92;0.101)		tGCGAGGGTCGAGCAATTTGC	0.179													5	105	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	17	19091408	19091408	+	IGR	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:19091408G>C								GRAPL (29260 upstream) : EPN2 (49282 downstream)																							cgaaaaccacgaggaagagag	0.065													6	189	---	---	---	---	PASS
TMEM97	27346	broad.mit.edu	37	17	26652619	26652619	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26652619G>T	uc002hat.2	+	2	362	c.217G>T	c.(217-219)GAG>TAG	p.E73*		NM_014573	NP_055388	Q5BJF2	TMM97_HUMAN	transmembrane protein 97	73	Helical; (Potential).				cholesterol homeostasis|regulation of cell growth	integral to membrane|lysosome|nuclear membrane|plasma membrane|rough endoplasmic reticulum	protein binding				0	all_lung(13;0.000238)|Lung NSC(42;0.000789)			UCEC - Uterine corpus endometrioid carcinoma (53;0.153)		TCTGTTTTGCGAGCTTGTGTT	0.448													6	96	---	---	---	---	PASS
SPAG5	10615	broad.mit.edu	37	17	26906801	26906801	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:26906801C>A	uc002hbq.2	-	17	2944	c.2852G>T	c.(2851-2853)CGA>CTA	p.R951L	ALDOC_uc002hbp.2_5'Flank|ALDOC_uc010cro.2_5'Flank	NM_006461	NP_006452	Q96R06	SPAG5_HUMAN	sperm associated antigen 5	951					cell division|mitosis|phosphatidylinositol-mediated signaling|spindle organization	condensed chromosome kinetochore|cytoplasm|spindle pole	protein binding			central_nervous_system(1)	1	Lung NSC(42;0.00431)					TGATGCTACTCGGGTGAAAGC	0.502													7	101	---	---	---	---	PASS
PHF12	57649	broad.mit.edu	37	17	27233933	27233933	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27233933G>T	uc002hdg.1	-	14	3151	c.2621C>A	c.(2620-2622)TCG>TAG	p.S874*	PHF12_uc010wbb.1_Nonsense_Mutation_p.S856*	NM_001033561	NP_001028733	Q96QT6	PHF12_HUMAN	PHD finger protein 12 isoform 1	874					negative regulation of transcription, DNA-dependent|transcription, DNA-dependent	transcriptional repressor complex	protein binding|zinc ion binding			ovary(1)	1	all_cancers(5;1.95e-14)|all_epithelial(6;5e-18)|Lung NSC(42;0.01)		Epithelial(11;1.64e-05)|all cancers(11;7.47e-05)|BRCA - Breast invasive adenocarcinoma(11;9.79e-05)			GGTCTTCTCCGAGAAGTCACA	0.507													5	87	---	---	---	---	PASS
TAOK1	57551	broad.mit.edu	37	17	27829707	27829707	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:27829707G>T	uc002hdz.1	+	13	1498	c.1304G>T	c.(1303-1305)CGA>CTA	p.R435L	TAOK1_uc010wbe.1_Missense_Mutation_p.R435L|TAOK1_uc010wbf.1_Missense_Mutation_p.R435L|TAOK1_uc002heb.1_Missense_Mutation_p.R261L	NM_020791	NP_065842	Q7L7X3	TAOK1_HUMAN	TAO kinase 1	435					mitotic prometaphase	cytosol|intracellular membrane-bounded organelle	ATP binding|protein serine/threonine kinase activity			upper_aerodigestive_tract(1)|lung(1)|central_nervous_system(1)|skin(1)	4			Colorectal(6;0.198)			TATCGTAATCGAGAACACTTT	0.398													6	71	---	---	---	---	PASS
CPD	1362	broad.mit.edu	37	17	28749923	28749923	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:28749923G>T	uc002hfb.1	+	5	1554	c.1539G>T	c.(1537-1539)TTG>TTT	p.L513F	CPD_uc010wbo.1_Missense_Mutation_p.L266F|CPD_uc010wbp.1_RNA	NM_001304	NP_001295	O75976	CBPD_HUMAN	carboxypeptidase D precursor	513	Extracellular (Potential).|Carboxypeptidase-like 2.				proteolysis	integral to membrane	metallocarboxypeptidase activity|serine-type carboxypeptidase activity|zinc ion binding			liver(1)|skin(1)	2						AAATCTTCTTGAGAAGGTTTG	0.393													7	102	---	---	---	---	PASS
PSMD11	5717	broad.mit.edu	37	17	30791091	30791091	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30791091G>T	uc010cta.1	+	4	383	c.343G>T	c.(343-345)GAA>TAA	p.E115*	PSMD11_uc010wbz.1_Nonsense_Mutation_p.E115*|PSMD11_uc002hhm.2_Nonsense_Mutation_p.E115*	NM_002815	NP_002806	O00231	PSD11_HUMAN	proteasome 26S non-ATPase subunit 11	115					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	proteasome complex	protein binding			ovary(1)	1		Breast(31;0.159)|Ovarian(249;0.182)	BRCA - Breast invasive adenocarcinoma(9;0.109)			AGAGTGCATCGAATGGGCCAA	0.438													6	88	---	---	---	---	PASS
LIG3	3980	broad.mit.edu	37	17	33319587	33319587	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:33319587C>A	uc002hik.1	+	8	1439	c.1331C>A	c.(1330-1332)TCG>TAG	p.S444*	LIG3_uc002hij.2_Nonsense_Mutation_p.S444*|LIG3_uc010cth.1_Nonsense_Mutation_p.S453*	NM_013975	NP_039269	P49916	DNLI3_HUMAN	ligase III, DNA, ATP-dependent isoform alpha	444					base-excision repair|cell division|DNA ligation involved in DNA repair|DNA replication|reciprocal meiotic recombination|spermatogenesis	nucleoplasm	ATP binding|DNA binding|DNA ligase (ATP) activity|protein binding|zinc ion binding			skin(3)|lung(2)|ovary(2)|large_intestine(1)|pancreas(1)	9		Ovarian(249;0.17)			Bleomycin(DB00290)	TTCAAAGCCTCGCGCAACCTG	0.587								Other_BER_factors					5	71	---	---	---	---	PASS
PIGW	284098	broad.mit.edu	37	17	34893028	34893028	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:34893028G>T	uc002hmy.1	+	2	121	c.78G>T	c.(76-78)TTG>TTT	p.L26F	MYO19_uc002hmw.2_5'Flank|MYO19_uc010cuu.2_5'Flank|MYO19_uc010wcy.1_5'Flank|MYO19_uc010wcz.1_5'Flank|MYO19_uc010wda.1_5'Flank|MYO19_uc002hmx.2_5'Flank|PIGW_uc002hmz.1_Missense_Mutation_p.L26F	NM_178517	NP_848612	Q7Z7B1	PIGW_HUMAN	phosphatidylinositol glycan, class W	26	Helical; (Potential).				C-terminal protein lipidation|preassembly of GPI anchor in ER membrane	endoplasmic reticulum membrane|integral to membrane	O-acyltransferase activity				0		Breast(25;0.00957)|Ovarian(249;0.17)	Kidney(155;0.104)	UCEC - Uterine corpus endometrioid carcinoma (308;0.0182)		CCCAGGGATTGTGCTTTCCTG	0.433													6	78	---	---	---	---	PASS
GGNBP2	79893	broad.mit.edu	37	17	34934591	34934591	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:34934591C>A	uc002hnb.2	+	7	1069	c.820C>A	c.(820-822)CGT>AGT	p.R274S	GGNBP2_uc002hna.2_Missense_Mutation_p.R274S|GGNBP2_uc002hnc.1_Missense_Mutation_p.R103S	NM_024835	NP_079111	Q9H3C7	GGNB2_HUMAN	zinc finger protein 403	274					cell differentiation|multicellular organismal development|spermatogenesis	cytoplasmic membrane-bounded vesicle				ovary(2)	2		Breast(25;0.00957)|Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0193)		TCTTTTGGGTCGTGCTGAGCC	0.438													5	116	---	---	---	---	PASS
MRPL45	84311	broad.mit.edu	37	17	36462506	36462506	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:36462506G>A	uc002hpy.2	+	4	521	c.369G>A	c.(367-369)CGG>CGA	p.R123R		NM_032351	NP_115727	Q9BRJ2	RM45_HUMAN	mitochondrial ribosomal protein L45 precursor	123					intracellular protein transport|translation	mitochondrial inner membrane presequence translocase complex|ribosome	P-P-bond-hydrolysis-driven protein transmembrane transporter activity|structural constituent of ribosome				0	Breast(7;2.97e-12)	Breast(25;0.0101)|Ovarian(249;0.15)				ACAGAATCCGGAGGATAAAAG	0.358													12	81	---	---	---	---	PASS
GPR179	440435	broad.mit.edu	37	17	36487046	36487046	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:36487046C>A	uc002hpz.2	-	11	2427	c.2406G>T	c.(2404-2406)GAG>GAT	p.E802D		NM_001004334	NP_001004334	Q6PRD1	GP179_HUMAN	GPR158-like 1 precursor	802	Cytoplasmic (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)	3	Breast(7;2.97e-12)	Breast(25;0.0101)|Ovarian(249;0.15)				ACTCCCGGCTCTCTGTTCGAG	0.667													4	12	---	---	---	---	PASS
MED1	5469	broad.mit.edu	37	17	37571341	37571341	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:37571341G>T	uc002hrv.3	-	16	1649	c.1437C>A	c.(1435-1437)CTC>CTA	p.L479L	MED1_uc010wee.1_Silent_p.L307L|MED1_uc002hru.2_Silent_p.L479L	NM_004774	NP_004765	Q15648	MED1_HUMAN	mediator complex subunit 1	479	Interaction with ESR1.|Interaction with THRA.|Interaction with the Mediator complex and THRA.				androgen biosynthetic process|androgen receptor signaling pathway|cellular lipid metabolic process|fat cell differentiation|positive regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|transcription initiation from RNA polymerase II promoter	mediator complex	DNA binding|estrogen receptor binding|ligand-dependent nuclear receptor binding|ligand-dependent nuclear receptor transcription coactivator activity|peroxisome proliferator activated receptor binding|receptor activity|retinoic acid receptor binding|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			lung(2)|ovary(2)|breast(1)|skin(1)|kidney(1)|pancreas(1)	8		Ovarian(249;1.78e-06)|Lung SC(565;0.0262)	Lung(15;0.0178)|LUAD - Lung adenocarcinoma(14;0.146)	UCEC - Uterine corpus endometrioid carcinoma (308;6.64e-05)|BRCA - Breast invasive adenocarcinoma(366;0.00136)|READ - Rectum adenocarcinoma(1115;0.0649)		GCCCTTTGTAGAGTTTACAGC	0.408										HNSCC(31;0.082)			11	308	---	---	---	---	PASS
MED24	9862	broad.mit.edu	37	17	38191412	38191412	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38191412T>C	uc002htt.2	-	6	830	c.517A>G	c.(517-519)AAG>GAG	p.K173E	MED24_uc010wes.1_Missense_Mutation_p.K14E|MED24_uc010wet.1_RNA|MED24_uc002hts.2_Missense_Mutation_p.K198E|MED24_uc002htu.2_Missense_Mutation_p.K160E|MED24_uc010cwn.2_Missense_Mutation_p.K160E|MED24_uc010weu.1_Missense_Mutation_p.K83E|MED24_uc010wev.1_Missense_Mutation_p.K123E|MED24_uc010wew.1_Missense_Mutation_p.K102E|MED24_uc010wex.1_Intron|MED24_uc010wez.1_5'Flank|MED24_uc010wfa.1_Missense_Mutation_p.K123E|MED24_uc010wfb.1_Missense_Mutation_p.K185E|MED24_uc010wfc.1_Missense_Mutation_p.K110E	NM_014815	NP_055630	O75448	MED24_HUMAN	mediator complex subunit 24 isoform 1	173					androgen receptor signaling pathway|positive regulation of transcription, DNA-dependent|transcription initiation from RNA polymerase II promoter	mediator complex	ligand-dependent nuclear receptor transcription coactivator activity|receptor activity|RNA polymerase II transcription cofactor activity|thyroid hormone receptor binding|vitamin D receptor binding			ovary(1)	1	Colorectal(19;0.000442)					GCCCGGTTCTTGGTGCTGCTG	0.642											OREG0024387	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	43	61	---	---	---	---	PASS
CCR7	1236	broad.mit.edu	37	17	38711930	38711930	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:38711930G>T	uc002huw.2	-	3	264	c.201C>A	c.(199-201)ATC>ATA	p.I67I		NM_001838	NP_001829	P32248	CCR7_HUMAN	chemokine (C-C motif) receptor 7 precursor	67	Helical; Name=1; (Potential).				cell maturation|immunological synapse formation|inflammatory response|interleukin-12 secretion|lymphocyte migration into lymph node|positive regulation of dendritic cell antigen processing and presentation|positive regulation of glycoprotein biosynthetic process|positive regulation of humoral immune response|positive regulation of hypersensitivity|positive regulation of interleukin-12 production|positive regulation of neutrophil chemotaxis|regulation of interferon-gamma production|regulation of interleukin-1 beta secretion|T cell costimulation	integral to membrane|intracellular	C-C chemokine receptor activity|chemokine (C-C motif) ligand 19 binding|chemokine (C-C motif) ligand 21 binding			breast(1)	1		Breast(137;0.000496)				CGAAACAAATGATGGAGTACA	0.493													8	52	---	---	---	---	PASS
CNTNAP1	8506	broad.mit.edu	37	17	40843900	40843900	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40843900G>T	uc002iay.2	+	16	2637	c.2421G>T	c.(2419-2421)CTG>CTT	p.L807L	CNTNAP1_uc010wgs.1_RNA	NM_003632	NP_003623	P78357	CNTP1_HUMAN	contactin associated protein 1 precursor	807	Extracellular (Potential).				axon guidance|cell adhesion	paranode region of axon	receptor activity|receptor binding|SH3 domain binding|SH3/SH2 adaptor activity			ovary(3)|breast(3)|upper_aerodigestive_tract(1)|lung(1)	8		Breast(137;0.000143)		BRCA - Breast invasive adenocarcinoma(366;0.143)		ACCACAGCCTGGATGTCTCCT	0.577													10	130	---	---	---	---	PASS
CNTD1	124817	broad.mit.edu	37	17	40955684	40955684	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40955684G>T	uc002ibm.3	+	2	448	c.216G>T	c.(214-216)GTG>GTT	p.V72V	CNTD1_uc010wha.1_5'UTR	NM_173478	NP_775749	Q8N815	CNTD1_HUMAN	cyclin N-terminal domain containing 1	72	Cyclin N-terminal.									central_nervous_system(1)	1		Breast(137;0.00104)		BRCA - Breast invasive adenocarcinoma(366;0.0749)		AGAAATCTGTGAGCTACCAGG	0.423													8	179	---	---	---	---	PASS
BECN1	8678	broad.mit.edu	37	17	40963737	40963737	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:40963737C>A	uc002ibo.3	-	11	1255	c.1120G>T	c.(1120-1122)GAC>TAC	p.D374Y	BECN1_uc010whb.1_Missense_Mutation_p.D287Y|BECN1_uc010whc.1_Intron|BECN1_uc002ibn.2_Missense_Mutation_p.D374Y	NM_003766	NP_003757	Q14457	BECN1_HUMAN	beclin 1	374					anti-apoptosis|cell cycle|cellular defense response|cytokinesis|response to virus	membrane	protein binding			ovary(1)	1		Breast(137;0.00104)		BRCA - Breast invasive adenocarcinoma(366;0.0745)		TGCACACAGTCCAGGAAAGCC	0.488													15	85	---	---	---	---	PASS
GPATCH8	23131	broad.mit.edu	37	17	42478509	42478509	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42478509G>T	uc002igw.1	-	8	1000	c.936C>A	c.(934-936)CTC>CTA	p.L312L	GPATCH8_uc002igv.1_Silent_p.L234L|GPATCH8_uc010wiz.1_Silent_p.L234L	NM_001002909	NP_001002909	Q9UKJ3	GPTC8_HUMAN	G patch domain containing 8	312						intracellular	nucleic acid binding|zinc ion binding			ovary(2)|kidney(1)|skin(1)	4		Prostate(33;0.0181)		BRCA - Breast invasive adenocarcinoma(366;0.206)		CTATTGATTCGAGTTTGACAG	0.463											OREG0024461	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	8	244	---	---	---	---	PASS
DBF4B	80174	broad.mit.edu	37	17	42786663	42786663	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:42786663C>A	uc002ihf.2	+						DBF4B_uc002ihd.1_Intron|DBF4B_uc010wjb.1_Intron|DBF4B_uc002ihe.2_Intron|DBF4B_uc010wjc.1_Intron|DBF4B_uc002ihg.2_Intron	NM_145663	NP_663696	Q8NFT6	DBF4B_HUMAN	DBF4 homolog B isoform 1						cell cycle	nucleus	nucleic acid binding|zinc ion binding				0		Prostate(33;0.0322)				CTGTTATGTCCTTTCTCAGGA	0.572													9	188	---	---	---	---	PASS
CA10	56934	broad.mit.edu	37	17	50008415	50008415	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:50008415C>A	uc002itw.3	-	3	1200	c.214G>T	c.(214-216)GAG>TAG	p.E72*	CA10_uc002itv.3_Nonsense_Mutation_p.E78*|CA10_uc002itx.3_Nonsense_Mutation_p.E72*|CA10_uc002ity.3_Nonsense_Mutation_p.E72*|CA10_uc002itz.2_Nonsense_Mutation_p.E72*	NM_020178	NP_064563	Q9NS85	CAH10_HUMAN	carbonic anhydrase X	72					brain development					ovary(1)|skin(1)	2			BRCA - Breast invasive adenocarcinoma(22;4.74e-06)			TGACTGGTCTCTATGTTGACT	0.468													9	160	---	---	---	---	PASS
DGKE	8526	broad.mit.edu	37	17	54912188	54912188	+	Nonsense_Mutation	SNP	C	A	A	rs148605410		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:54912188C>A	uc002iur.2	+	2	212	c.32C>A	c.(31-33)TCG>TAG	p.S11*	DGKE_uc002ius.1_Nonsense_Mutation_p.S11*|C17orf67_uc002iuq.2_5'Flank	NM_003647	NP_003638	P52429	DGKE_HUMAN	diacylglycerol kinase epsilon	11					activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|intracellular signal transduction|phospholipid biosynthetic process|platelet activation	integral to membrane|plasma membrane	ATP binding|diacylglycerol kinase activity|metal ion binding|protein binding			breast(2)	2	Breast(9;3.59e-07)					GCGCCGGGCTCGCCCTCCGAG	0.647													6	139	---	---	---	---	PASS
PPM1E	22843	broad.mit.edu	37	17	57050227	57050227	+	Missense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57050227G>A	uc002iwx.2	+	6	1278	c.1151G>A	c.(1150-1152)TGC>TAC	p.C384Y	PPM1E_uc010ddd.2_Missense_Mutation_p.C147Y	NM_014906	NP_055721	Q8WY54	PPM1E_HUMAN	protein phosphatase 1E	393	PP2C-like.				protein dephosphorylation	cytoplasm|nucleolus|protein serine/threonine phosphatase complex	metal ion binding|protein serine/threonine phosphatase activity			breast(3)|lung(1)|skin(1)	5	Medulloblastoma(34;0.127)|all_neural(34;0.237)		BRCA - Breast invasive adenocarcinoma(1;5.76e-11)			CTTGGAGGTTGCGTAGTCTGG	0.403													23	97	---	---	---	---	PASS
CLTC	1213	broad.mit.edu	37	17	57728613	57728613	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57728613C>A	uc002ixq.1	+	5	1174	c.731C>A	c.(730-732)CCA>CAA	p.P244Q	CLTC_uc002ixp.2_Missense_Mutation_p.P244Q|CLTC_uc002ixr.1_Missense_Mutation_p.P248Q	NM_004859	NP_004850	Q00610	CLH1_HUMAN	clathrin heavy chain 1	244	Globular terminal domain.				axon guidance|epidermal growth factor receptor signaling pathway|intracellular protein transport|mitosis|negative regulation of epidermal growth factor receptor signaling pathway|nerve growth factor receptor signaling pathway|post-Golgi vesicle-mediated transport|receptor internalization|transferrin transport	clathrin coat of coated pit|clathrin coat of trans-Golgi network vesicle|cytosol|melanosome|spindle	protein binding|structural molecule activity		CLTC/ALK(44)|CLTC/TFE3(2)	haematopoietic_and_lymphoid_tissue(33)|soft_tissue(11)|kidney(2)|ovary(1)|breast(1)	48	all_neural(34;0.0878)|Medulloblastoma(34;0.0922)					CAGCCCTTTCCAAAGAAGGCA	0.259			T	ALK|TFE3	ALCL|renal 								8	203	---	---	---	---	PASS
CLTC	1213	broad.mit.edu	37	17	57762524	57762524	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:57762524C>A	uc002ixq.1	+	29	4985	c.4542C>A	c.(4540-4542)CTC>CTA	p.L1514L	CLTC_uc002ixp.2_Silent_p.L1514L|CLTC_uc002ixr.1_Silent_p.L1518L	NM_004859	NP_004850	Q00610	CLH1_HUMAN	clathrin heavy chain 1	1514	Heavy chain arm.|Proximal segment.|Involved in binding clathrin light chain (By similarity).				axon guidance|epidermal growth factor receptor signaling pathway|intracellular protein transport|mitosis|negative regulation of epidermal growth factor receptor signaling pathway|nerve growth factor receptor signaling pathway|post-Golgi vesicle-mediated transport|receptor internalization|transferrin transport	clathrin coat of coated pit|clathrin coat of trans-Golgi network vesicle|cytosol|melanosome|spindle	protein binding|structural molecule activity		CLTC/ALK(44)|CLTC/TFE3(2)	haematopoietic_and_lymphoid_tissue(33)|soft_tissue(11)|kidney(2)|ovary(1)|breast(1)	48	all_neural(34;0.0878)|Medulloblastoma(34;0.0922)					CTGCTTATCTCTTCAAAGGCA	0.423			T	ALK|TFE3	ALCL|renal 								9	116	---	---	---	---	PASS
DDX42	11325	broad.mit.edu	37	17	61889361	61889361	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:61889361C>G	uc002jbu.2	+	15	1725	c.1468C>G	c.(1468-1470)CGG>GGG	p.R490G	DDX42_uc002jbv.2_Missense_Mutation_p.R490G|DDX42_uc002jbw.1_Missense_Mutation_p.R226G|DDX42_uc002jbx.2_Missense_Mutation_p.R226G|DDX42_uc002jby.2_Missense_Mutation_p.R36G	NM_007372	NP_031398	Q86XP3	DDX42_HUMAN	DEAD box polypeptide 42 protein	490	Helicase C-terminal.				protein localization|regulation of anti-apoptosis	Cajal body|cytoplasm|nuclear speck	ATP binding|ATP-dependent helicase activity|protein binding|RNA binding			ovary(2)|skin(2)|large_intestine(1)	5						CTGGCTTACCCGGCGTCTGGT	0.433													5	199	---	---	---	---	PASS
PRKAR1A	5573	broad.mit.edu	37	17	66521111	66521111	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:66521111C>A	uc002jhg.2	+						PRKAR1A_uc002jhh.2_Intron|PRKAR1A_uc002jhi.2_Intron|PRKAR1A_uc002jhj.2_Intron|PRKAR1A_uc002jhk.2_Intron|PRKAR1A_uc002jhl.2_Intron|PRKAR1A_uc002jhm.2_Intron	NM_212471	NP_997636	P10644	KAP0_HUMAN	cAMP-dependent protein kinase, regulatory						activation of phospholipase C activity|activation of protein kinase A activity|blood coagulation|cellular response to glucagon stimulus|energy reserve metabolic process|intracellular signal transduction|nerve growth factor receptor signaling pathway|regulation of insulin secretion|regulation of transcription from RNA polymerase II promoter|transmembrane transport|water transport	cAMP-dependent protein kinase complex|cytosol	cAMP binding|cAMP-dependent protein kinase regulator activity|protein binding			adrenal_gland(4)|lung(3)|thyroid(2)|soft_tissue(2)|breast(1)	12	Breast(10;1.64e-13)					TAAGATTTACCAATATCAAAA	0.338			T|Mis|N|F|S	RET	papillary thyroid	myxoma|endocrine|papillary thyroid			Carney_Complex|Primary_Pigmented_Nodular_Adrenocortical_Disease_Familial|Cardiac_Myxomas_Familial_Clustering_of				8	142	---	---	---	---	PASS
ABCA10	10349	broad.mit.edu	37	17	67150376	67150376	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:67150376C>A	uc010dfa.1	-	32	4665	c.3786G>T	c.(3784-3786)GTG>GTT	p.V1262V	ABCA10_uc010wqs.1_Silent_p.V254V|ABCA10_uc010wqt.1_RNA	NM_080282	NP_525021	Q8WWZ4	ABCAA_HUMAN	ATP-binding cassette, sub-family A, member 10	1262	ABC transporter 2.				transport	integral to membrane	ATP binding|ATPase activity			ovary(2)|central_nervous_system(1)|skin(1)	4	Breast(10;6.95e-12)					TGTCACATACCACTCCTGCAG	0.323													9	74	---	---	---	---	PASS
LRRC45	201255	broad.mit.edu	37	17	79983065	79983065	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:79983065C>A	uc002kde.2	+						STRA13_uc002kdc.2_5'Flank|STRA13_uc002kdd.2_5'Flank	NM_144999	NP_659436	Q96CN5	LRC45_HUMAN	leucine rich repeat containing 45							centrosome				pancreas(1)	1	all_neural(118;0.0878)|Ovarian(332;0.12)|all_lung(278;0.246)		BRCA - Breast invasive adenocarcinoma(99;0.0114)|OV - Ovarian serous cystadenocarcinoma(97;0.0191)			GTGAGGCCTCCCAGGCGCCCT	0.652													3	2	---	---	---	---	PASS
USP14	9097	broad.mit.edu	37	18	210396	210396	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:210396C>A	uc002kkf.1	+	15	1452	c.1236C>A	c.(1234-1236)TCC>TCA	p.S412S	USP14_uc002kkg.1_Silent_p.S377S|USP14_uc010wyr.1_Silent_p.S401S	NM_005151	NP_005142	P54578	UBP14_HUMAN	ubiquitin specific protease 14 isoform a	412					regulation of chemotaxis|regulation of proteasomal protein catabolic process|ubiquitin-dependent protein catabolic process	cell surface|cytoplasmic membrane-bounded vesicle|plasma membrane|proteasome complex	cysteine-type endopeptidase activity|endopeptidase inhibitor activity|proteasome binding|tRNA guanylyltransferase activity|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			ovary(2)	2		all_cancers(4;0.0896)|Myeloproliferative disorder(11;0.0412)				ATATTGGCTCCAATAATTGTG	0.348													7	110	---	---	---	---	PASS
COLEC12	81035	broad.mit.edu	37	18	333036	333036	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:333036G>C	uc002kkm.2	-	7	2139	c.1924C>G	c.(1924-1926)CTT>GTT	p.L642V		NM_130386	NP_569057	Q5KU26	COL12_HUMAN	collectin sub-family member 12	642	Extracellular (Potential).|C-type lectin.				carbohydrate mediated signaling|innate immune response|phagocytosis, recognition|protein homooligomerization	collagen|integral to membrane	galactose binding|low-density lipoprotein particle binding|metal ion binding|pattern recognition receptor activity|scavenger receptor activity			ovary(1)|pancreas(1)	2		all_cancers(4;0.0442)|Myeloproliferative disorder(11;0.0426)				ATGAAAACAAGATGTGAAGAC	0.378													21	77	---	---	---	---	PASS
CLUL1	27098	broad.mit.edu	37	18	627165	627165	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:627165C>A	uc002kkp.2	+	5	637	c.492C>A	c.(490-492)CTC>CTA	p.L164L	CLUL1_uc010wys.1_Silent_p.L216L|CLUL1_uc002kkq.2_Silent_p.L164L	NM_014410	NP_055225	Q15846	CLUL1_HUMAN	clusterin-like 1 (retinal) precursor	164					cell death	extracellular region				ovary(2)	2						AAAAAGATCTCCCCATCAGTG	0.393													7	99	---	---	---	---	PASS
NDC80	10403	broad.mit.edu	37	18	2587934	2587934	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:2587934C>A	uc002kli.2	+							NM_006101	NP_006092	O14777	NDC80_HUMAN	kinetochore associated 2						attachment of spindle microtubules to kinetochore|cell division|establishment of mitotic spindle orientation|mitotic prometaphase|mitotic sister chromatid segregation|mitotic spindle organization|phosphatidylinositol-mediated signaling	condensed nuclear chromosome outer kinetochore|cytosol|Ndc80 complex	protein binding			ovary(1)	1						TAAGTGTTCTCGTTCTTAGGG	0.388													4	38	---	---	---	---	PASS
MYOM1	8736	broad.mit.edu	37	18	3086126	3086126	+	Silent	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3086126A>G	uc002klp.2	-	30	4495	c.4161T>C	c.(4159-4161)ACT>ACC	p.T1387T	MYOM1_uc002klq.2_Silent_p.T1291T	NM_003803	NP_003794	P52179	MYOM1_HUMAN	myomesin 1 isoform a	1387	Ig-like C2-type 4.					striated muscle myosin thick filament	structural constituent of muscle			ovary(3)|central_nervous_system(1)|pancreas(1)	5						ACACAATATGAGTCTCCTTCT	0.358													13	89	---	---	---	---	PASS
MYOM1	8736	broad.mit.edu	37	18	3142053	3142053	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:3142053C>A	uc002klp.2	-	14	2243	c.1909G>T	c.(1909-1911)GTG>TTG	p.V637L	MYOM1_uc002klq.2_Missense_Mutation_p.V637L	NM_003803	NP_003794	P52179	MYOM1_HUMAN	myomesin 1 isoform a	637						striated muscle myosin thick filament	structural constituent of muscle			ovary(3)|central_nervous_system(1)|pancreas(1)	5						GGGCCAGGCACAATACCCTCT	0.557													5	47	---	---	---	---	PASS
L3MBTL4	91133	broad.mit.edu	37	18	6237993	6237993	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:6237993C>A	uc002kmz.3	-	10	914	c.754G>T	c.(754-756)GAG>TAG	p.E252*	L3MBTL4_uc010dkt.2_Nonsense_Mutation_p.E252*|L3MBTL4_uc002kmy.3_Nonsense_Mutation_p.E90*	NM_173464	NP_775735	Q8NA19	LMBL4_HUMAN	l(3)mbt-like 4	252	MBT 2.				chromatin modification	nucleus	sequence-specific DNA binding transcription factor activity|zinc ion binding			skin(2)|pancreas(1)	3		Colorectal(10;0.0249)				CTTCCATTCTCCTGACACCAA	0.443													7	102	---	---	---	---	PASS
PTPRM	5797	broad.mit.edu	37	18	8370999	8370999	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:8370999G>C	uc002knn.3	+	22	3630	c.3127G>C	c.(3127-3129)GAA>CAA	p.E1043Q	PTPRM_uc010dkv.2_Missense_Mutation_p.E1056Q|PTPRM_uc010wzl.1_Missense_Mutation_p.E830Q	NM_002845	NP_002836	P28827	PTPRM_HUMAN	protein tyrosine phosphatase, receptor type, M	1043	Tyrosine-protein phosphatase 1.|Cytoplasmic (Potential).				homophilic cell adhesion|negative regulation of angiogenesis|negative regulation of endothelial cell migration|negative regulation of endothelial cell proliferation|response to drug|retina layer formation|retinal ganglion cell axon guidance	cell-cell adherens junction|integral to plasma membrane|lamellipodium|perinuclear region of cytoplasm	cadherin binding|transmembrane receptor protein tyrosine phosphatase activity			lung(3)|ovary(2)|central_nervous_system(1)	6		Colorectal(10;0.234)				ATTTGCTGTTGAAAAGGTAAG	0.353													9	66	---	---	---	---	PASS
NDUFV2	4729	broad.mit.edu	37	18	9126889	9126889	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:9126889C>A	uc002knu.2	+	7	707	c.640C>A	c.(640-642)CCA>ACA	p.P214T		NM_021074	NP_066552	P19404	NDUV2_HUMAN	NADH dehydrogenase ubiquinone flavoprotein 2	214					cardiac muscle tissue development|mitochondrial electron transport, NADH to ubiquinone|nervous system development|transport	mitochondrial respiratory chain complex I	2 iron, 2 sulfur cluster binding|electron carrier activity|metal ion binding|NAD binding|NADH dehydrogenase (ubiquinone) activity			ovary(1)	1					NADH(DB00157)	TGGCAAAATCCCAAAACCAGG	0.299													10	335	---	---	---	---	PASS
VAPA	9218	broad.mit.edu	37	18	9954179	9954179	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:9954179G>T	uc002kok.2	+	6	1020	c.721G>T	c.(721-723)GGA>TGA	p.G241*	VAPA_uc002koj.2_Nonsense_Mutation_p.G286*	NM_194434	NP_919415	Q9P0L0	VAPA_HUMAN	vesicle-associated membrane protein-associated	241	Helical; Anchor for type IV membrane protein; (Potential).				cell death|cellular membrane fusion|neuron projection development|positive regulation of I-kappaB kinase/NF-kappaB cascade|protein localization in endoplasmic reticulum|sphingolipid metabolic process	endoplasmic reticulum membrane|integral to membrane|plasma membrane|vesicle	protein heterodimerization activity|signal transducer activity|structural molecule activity				0						CATTTTCATTGGATTCTTTCT	0.378													11	189	---	---	---	---	PASS
RNMT	8731	broad.mit.edu	37	18	13731773	13731773	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:13731773C>A	uc002ksk.1	+	2	324	c.257C>A	c.(256-258)CCT>CAT	p.P86H	RNMT_uc002ksl.1_Missense_Mutation_p.P86H|RNMT_uc002ksm.1_Missense_Mutation_p.P86H|RNMT_uc010dlk.2_Missense_Mutation_p.P86H|RNMT_uc010xae.1_Intron	NM_003799	NP_003790	O43148	MCES_HUMAN	RNA (guanine-7-) methyltransferase	86					mRNA capping|transcription from RNA polymerase II promoter|viral reproduction	nucleoplasm	mRNA (guanine-N7-)-methyltransferase activity|RNA binding				0						AAACTTGATCCTGAAATTGTC	0.363													7	100	---	---	---	---	PASS
LAMA3	3909	broad.mit.edu	37	18	21328024	21328024	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21328024C>A	uc002kuq.2	+	3	651	c.565C>A	c.(565-567)CAT>AAT	p.H189N	LAMA3_uc010dlv.1_Missense_Mutation_p.H189N|LAMA3_uc002kur.2_Missense_Mutation_p.H189N	NM_198129	NP_937762	Q16787	LAMA3_HUMAN	laminin alpha 3 subunit isoform 1	189	Laminin N-terminal.				cell adhesion|epidermis development|hemidesmosome assembly|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	receptor binding|structural molecule activity			ovary(8)|skin(2)|central_nervous_system(1)	11	all_cancers(21;7.81e-05)|all_epithelial(16;4.45e-07)|Lung NSC(20;0.00156)|all_lung(20;0.00508)|Colorectal(14;0.0202)|Ovarian(20;0.17)				Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)	ATATTTTGCTCGTAAGTAATC	0.323													5	81	---	---	---	---	PASS
LAMA3	3909	broad.mit.edu	37	18	21508596	21508596	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21508596G>T	uc002kuq.2	+	64	8389	c.8303G>T	c.(8302-8304)CGA>CTA	p.R2768L	LAMA3_uc002kur.2_Missense_Mutation_p.R2712L|LAMA3_uc002kus.3_Missense_Mutation_p.R1159L|LAMA3_uc002kut.3_Missense_Mutation_p.R1103L	NM_198129	NP_937762	Q16787	LAMA3_HUMAN	laminin alpha 3 subunit isoform 1	2768	Laminin G-like 3.				cell adhesion|epidermis development|hemidesmosome assembly|regulation of cell adhesion|regulation of cell migration|regulation of embryonic development	laminin-1 complex	receptor binding|structural molecule activity			ovary(8)|skin(2)|central_nervous_system(1)	11	all_cancers(21;7.81e-05)|all_epithelial(16;4.45e-07)|Lung NSC(20;0.00156)|all_lung(20;0.00508)|Colorectal(14;0.0202)|Ovarian(20;0.17)				Alteplase(DB00009)|Anistreplase(DB00029)|Reteplase(DB00015)|Tenecteplase(DB00031)	CAGCTTGTGCGATCTGCCTCA	0.418													5	103	---	---	---	---	PASS
OSBPL1A	114876	broad.mit.edu	37	18	21751363	21751363	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:21751363G>T	uc002kve.2	-						OSBPL1A_uc002kvd.2_Intron|OSBPL1A_uc010xbc.1_Intron	NM_080597	NP_542164	Q9BXW6	OSBL1_HUMAN	oxysterol-binding protein-like 1A isoform B						cholesterol metabolic process|lipid transport|vesicle-mediated transport		phospholipid binding			ovary(4)	4	all_cancers(21;0.000396)|all_epithelial(16;4.36e-06)|Lung NSC(20;0.00171)|all_lung(20;0.0055)|Colorectal(14;0.0505)|Ovarian(20;0.17)					ATTTAAAAGAGAAATTTTACC	0.264													7	107	---	---	---	---	PASS
IMPACT	55364	broad.mit.edu	37	18	22007948	22007948	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:22007948C>A	uc002kvh.3	+	2	214	c.102C>A	c.(100-102)GCC>GCA	p.A34A	IMPACT_uc002kvg.3_Silent_p.A16A	NM_018439	NP_060909	Q9P2X3	IMPCT_HUMAN	Impact homolog	34	RWD.										0	all_cancers(21;0.00018)|all_epithelial(16;1.5e-06)|Lung NSC(20;0.0027)|all_lung(20;0.0085)|Colorectal(14;0.0361)|Ovarian(20;0.0991)					ATGACTGTGCCAAAATATTTT	0.388													8	156	---	---	---	---	PASS
TAF4B	6875	broad.mit.edu	37	18	23873404	23873404	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:23873404C>A	uc002kvu.3	+	9	2230	c.1741C>A	c.(1741-1743)CAA>AAA	p.Q581K	TAF4B_uc002kvs.3_RNA|TAF4B_uc002kvt.3_Missense_Mutation_p.Q586K	NM_005640	NP_005631	Q92750	TAF4B_HUMAN	TAF4b RNA polymerase II, TATA box binding	581					transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|viral reproduction	cytoplasm|nucleolus|transcription factor TFIID complex	DNA binding|NF-kappaB binding|sequence-specific DNA binding transcription factor activity			lung(1)|central_nervous_system(1)|skin(1)	3	all_cancers(21;0.00151)|Lung NSC(5;0.000401)|all_lung(6;0.00115)|Ovarian(20;0.124)		Epithelial(2;9.57e-07)|all cancers(3;5.15e-06)|OV - Ovarian serous cystadenocarcinoma(3;1.96e-05)|LUSC - Lung squamous cell carcinoma(2;0.00594)|Lung(2;0.0267)			CATTCTAAAGCAAATTACTCT	0.308													10	79	---	---	---	---	PASS
DSC1	1823	broad.mit.edu	37	18	28710517	28710517	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:28710517G>T	uc002kwn.2	-	16	2907	c.2645C>A	c.(2644-2646)CCC>CAC	p.P882H	DSC1_uc002kwm.2_3'UTR|uc002kwo.1_5'Flank	NM_024421	NP_077739	Q08554	DSC1_HUMAN	desmocollin 1 isoform Dsc1a preproprotein	882	Cytoplasmic (Potential).				homophilic cell adhesion	desmosome|gap junction|integral to membrane|membrane fraction	calcium ion binding			ovary(3)|skin(1)	4			OV - Ovarian serous cystadenocarcinoma(10;0.00778)			CCTAAATTTGGGTTCCAGGTG	0.418													7	135	---	---	---	---	PASS
INO80C	125476	broad.mit.edu	37	18	33048590	33048590	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:33048590C>A	uc002kyy.3	-	5	681	c.564G>T	c.(562-564)ACG>ACT	p.T188T	INO80C_uc002kyw.1_Intron|INO80C_uc002kyx.3_Silent_p.T133T|INO80C_uc010dmt.2_Silent_p.T224T	NM_194281	NP_919257	Q6PI98	IN80C_HUMAN	Ies6-similar protein isoform 2	188					DNA recombination|DNA repair|regulation of transcription, DNA-dependent|transcription, DNA-dependent	Ino80 complex|MLL1 complex					0						GAACGATGCTCGTGGCCTTCC	0.522													6	137	---	---	---	---	PASS
SLC14A2	8170	broad.mit.edu	37	18	43207095	43207095	+	Silent	SNP	C	A	A	rs147874580		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:43207095C>A	uc010dnj.2	+	5	825	c.504C>A	c.(502-504)CTC>CTA	p.L168L	SLC14A2_uc002lbb.2_Silent_p.L168L|SLC14A2_uc002lbe.2_Silent_p.L168L	NM_007163	NP_009094	Q15849	UT2_HUMAN	solute carrier family 14 (urea transporter),	168	Helical; (Potential).					apical plasma membrane|integral to membrane|membrane fraction	protein binding|urea transmembrane transporter activity			upper_aerodigestive_tract(1)|ovary(1)|central_nervous_system(1)|skin(1)	4						TAACAGCTCTCGCCTTGGGCC	0.517													5	49	---	---	---	---	PASS
KIAA1632	57724	broad.mit.edu	37	18	43459008	43459008	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:43459008C>A	uc002lbm.2	-	33	5939	c.5839G>T	c.(5839-5841)GCC>TCC	p.A1947S	KIAA1632_uc010xcq.1_Missense_Mutation_p.A501S|KIAA1632_uc010xcr.1_RNA|KIAA1632_uc010xcs.1_RNA|KIAA1632_uc002lbn.2_Missense_Mutation_p.A822S	NM_020964	NP_066015	Q9HCE0	EPG5_HUMAN	hypothetical protein LOC57724	1947					autophagy						0						GGGTCTTGGGCCAAACAGGTC	0.418													5	71	---	---	---	---	PASS
C18orf25	147339	broad.mit.edu	37	18	43796094	43796094	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:43796094G>T	uc002lbw.2	+	2	627	c.248G>T	c.(247-249)CGA>CTA	p.R83L	C18orf25_uc002lbx.2_Missense_Mutation_p.R83L	NM_145055	NP_659492	Q96B23	CR025_HUMAN	ARKadia-like 1 isoform a	83										central_nervous_system(2)	2						ACAACTGGCCGAGTTTATGAG	0.468													5	106	---	---	---	---	PASS
DCC	1630	broad.mit.edu	37	18	50961579	50961579	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:50961579G>T	uc002lfe.1	+	22	3816	c.3229G>T	c.(3229-3231)GAG>TAG	p.E1077*	DCC_uc010dpf.1_Nonsense_Mutation_p.E712*	NM_005215	NP_005206	P43146	DCC_HUMAN	netrin receptor DCC precursor	1077	Extracellular (Potential).				apoptosis|induction of apoptosis|negative regulation of collateral sprouting|negative regulation of dendrite development	cytosol|integral to membrane				skin(8)|ovary(6)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	17		all_cancers(7;0.11)|all_epithelial(6;0.00126)		Colorectal(16;0.0251)|COAD - Colon adenocarcinoma(17;0.0942)		CACCCTAAATGGTAAGTATAT	0.353													9	231	---	---	---	---	PASS
C18orf26	284254	broad.mit.edu	37	18	52265134	52265134	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:52265134C>A	uc002lfq.1	+	3	437	c.391C>A	c.(391-393)CTT>ATT	p.L131I	C18orf26_uc002lfp.1_Missense_Mutation_p.L79I	NM_173629	NP_775900	Q8N1N2	CR026_HUMAN	hypothetical protein LOC284254	131	Helical; (Potential).					integral to membrane					0				Colorectal(16;0.0193)|READ - Rectum adenocarcinoma(59;0.178)		AATTGGAGTACTTATAATATG	0.418													6	84	---	---	---	---	PASS
ATP8B1	5205	broad.mit.edu	37	18	55362765	55362765	+	Splice_Site	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:55362765C>A	uc002lgw.2	-	8	699	c.699_splice	c.e8-1	p.G233_splice	uc002lgv.1_Intron	NM_005603	NP_005594	O43520	AT8B1_HUMAN	ATPase, class I, type 8B, member 1						ATP biosynthetic process|bile acid and bile salt transport|negative regulation of transcription, DNA-dependent	apical plasma membrane|integral to plasma membrane|membrane fraction	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			breast(5)|ovary(2)|central_nervous_system(2)|lung(1)	10		Colorectal(73;0.229)				ATTGGTTTCTCTAAAGGAATG	0.338									Byler_disease				6	65	---	---	---	---	PASS
MC4R	4160	broad.mit.edu	37	18	58039353	58039353	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:58039353G>T	uc002lie.1	-	1	649	c.230C>A	c.(229-231)TCA>TAA	p.S77*		NM_005912	NP_005903	P32245	MC4R_HUMAN	melanocortin 4 receptor	77	Cytoplasmic (Potential).				feeding behavior|G-protein signaling, coupled to cAMP nucleotide second messenger|positive regulation of bone resorption|positive regulation of cAMP biosynthetic process	integral to membrane|plasma membrane	melanocyte-stimulating hormone receptor activity|neuropeptide binding|ubiquitin protein ligase binding			lung(1)	1		Colorectal(73;0.0946)				GTACATGGGTGAATGCAGATT	0.428													6	44	---	---	---	---	PASS
CDH20	28316	broad.mit.edu	37	18	59217418	59217418	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:59217418G>C	uc010dps.1	+	10	1868	c.1856G>C	c.(1855-1857)CGG>CCG	p.R619P	CDH20_uc002lif.2_Missense_Mutation_p.R613P	NM_031891	NP_114097	Q9HBT6	CAD20_HUMAN	cadherin 20, type 2 preproprotein	619	Extracellular (Potential).				homophilic cell adhesion	integral to membrane|plasma membrane	calcium ion binding			breast(3)|ovary(1)|pancreas(1)	5		Colorectal(73;0.186)				AGTTTGAGCCGGGGCGCCCTC	0.587													4	55	---	---	---	---	PASS
DSEL	92126	broad.mit.edu	37	18	65179108	65179108	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:65179108C>A	uc002lke.1	-	2	3992	c.2768G>T	c.(2767-2769)AGT>ATT	p.S923I		NM_032160	NP_115536	Q8IZU8	DSEL_HUMAN	dermatan sulfate epimerase-like	913						integral to membrane	isomerase activity|sulfotransferase activity			ovary(3)|upper_aerodigestive_tract(1)|large_intestine(1)|central_nervous_system(1)	6		Esophageal squamous(42;0.129)				AAAATGCCCACTGCGGATATC	0.428													5	42	---	---	---	---	PASS
FBXO15	201456	broad.mit.edu	37	18	71740764	71740764	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:71740764G>T	uc002lle.2	-	10	1573	c.1237C>A	c.(1237-1239)CTT>ATT	p.L413I	FBXO15_uc002lld.2_RNA|FBXO15_uc002llf.2_Missense_Mutation_p.L489I	NM_152676	NP_689889	Q8NCQ5	FBX15_HUMAN	F-box protein 15 isoform 1	413										ovary(2)|pancreas(1)	3		Esophageal squamous(42;0.103)|Prostate(75;0.173)		BRCA - Breast invasive adenocarcinoma(31;0.143)		TTGACAATAAGGTATTCTTCG	0.433													7	118	---	---	---	---	PASS
ZNF236	7776	broad.mit.edu	37	18	74622034	74622034	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:74622034G>T	uc002lmi.2	+	15	2754	c.2556G>T	c.(2554-2556)GTG>GTT	p.V852V	ZNF236_uc002lmj.2_RNA	NM_007345	NP_031371	Q9UL36	ZN236_HUMAN	zinc finger protein 236	852					cellular response to glucose stimulus	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)	4		Prostate(75;0.0405)|Esophageal squamous(42;0.129)|Melanoma(33;0.132)		OV - Ovarian serous cystadenocarcinoma(15;4.36e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0686)		ATGGGTTTGTGGCTCCACAGG	0.512													10	31	---	---	---	---	PASS
PALM	5064	broad.mit.edu	37	19	734187	734187	+	Silent	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:734187G>A	uc002lpm.1	+	6	629	c.435G>A	c.(433-435)ACG>ACA	p.T145T	PALM_uc010xft.1_Silent_p.T145T|PALM_uc002lpn.1_Silent_p.T145T|PALM_uc010xfu.1_Silent_p.T10T	NM_002579	NP_002570	O75781	PALM_HUMAN	paralemmin isoform 1	145					cellular component movement|negative regulation of adenylate cyclase activity|negative regulation of dopamine receptor signaling pathway|positive regulation of filopodium assembly|regulation of cell shape	cytoplasmic membrane-bounded vesicle|filopodium membrane|integral to plasma membrane					0		all_epithelial(18;2.19e-21)|Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;3.55e-06)|all_lung(49;5.41e-06)|Breast(49;4.08e-05)|Hepatocellular(1079;0.137)|Renal(1328;0.228)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)|Lung(535;0.201)		CGGTGGGCACGCCCAAAGGTA	0.632													11	36	---	---	---	---	PASS
MED16	10025	broad.mit.edu	37	19	873444	873444	+	Intron	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:873444C>G	uc002lqd.1	-						MED16_uc010drw.1_Intron|MED16_uc002lqe.2_Intron|MED16_uc002lqf.2_Intron	NM_005481	NP_005472	Q9Y2X0	MED16_HUMAN	mediator complex subunit 16						androgen receptor signaling pathway|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	receptor activity|thyroid hormone receptor binding|thyroid hormone receptor coactivator activity|vitamin D receptor binding				0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;6.59e-06)|all_lung(49;9.97e-06)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		GAGAGCATGGCGCACCTGGTT	0.667													4	18	---	---	---	---	PASS
MED16	10025	broad.mit.edu	37	19	873446	873446	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:873446C>A	uc002lqd.1	-						MED16_uc010drw.1_Intron|MED16_uc002lqe.2_Intron|MED16_uc002lqf.2_Intron	NM_005481	NP_005472	Q9Y2X0	MED16_HUMAN	mediator complex subunit 16						androgen receptor signaling pathway|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	mediator complex	receptor activity|thyroid hormone receptor binding|thyroid hormone receptor coactivator activity|vitamin D receptor binding				0		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;6.59e-06)|all_lung(49;9.97e-06)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		GAGCATGGCGCACCTGGTTGG	0.657													4	20	---	---	---	---	PASS
DOT1L	84444	broad.mit.edu	37	19	2185887	2185887	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2185887C>A	uc002lvb.3	+	3	195	c.159C>A	c.(157-159)CTC>CTA	p.L53L		NM_032482	NP_115871	Q8TEK3	DOT1L_HUMAN	DOT1-like, histone H3 methyltransferase	53						nucleus	DNA binding|histone-lysine N-methyltransferase activity|protein binding			pancreas(2)|upper_aerodigestive_tract(1)|lung(1)	4		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		ATCTCAAGCTCGCTATGGAGA	0.438													8	339	---	---	---	---	PASS
C19orf35	374872	broad.mit.edu	37	19	2276431	2276431	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:2276431G>C	uc002lvn.2	-	4	770	c.670C>G	c.(670-672)CTG>GTG	p.L224V	SPPL2B_uc010dsw.1_Intron	NM_198532	NP_940934	Q6ZS72	CS035_HUMAN	hypothetical protein LOC374872	224										pancreas(1)	1				UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		TGTGGAGACAGGGAGGCCTGC	0.721													3	17	---	---	---	---	PASS
GTF2F1	2962	broad.mit.edu	37	19	6392877	6392877	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:6392877C>A	uc002meq.2	-	2	335	c.50G>T	c.(49-51)CGA>CTA	p.R17L	GTF2F1_uc010xjc.1_5'Flank	NM_002096	NP_002087	P35269	T2FA_HUMAN	general transcription factor IIF, polypeptide 1,	17					mRNA capping|nuclear mRNA splicing, via spliceosome|positive regulation of transcription, DNA-dependent|positive regulation of viral transcription|response to virus|transcription elongation from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter|viral reproduction	cell junction|transcription factor TFIIF complex	catalytic activity|DNA binding|phosphatase activator activity|transcription coactivator activity|transcription factor binding				0						CTTAGGAACTCGAACGACGTA	0.582											OREG0025199	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	5	120	---	---	---	---	PASS
CD209	30835	broad.mit.edu	37	19	7812213	7812213	+	Silent	SNP	G	T	T	rs147713865		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7812213G>T	uc002mht.2	-	2	152	c.85C>A	c.(85-87)CGA>AGA	p.R29R	CD209_uc010xju.1_Silent_p.R29R|CD209_uc010dvp.2_Silent_p.R29R|CD209_uc002mhr.2_Silent_p.R29R|CD209_uc002mhs.2_Silent_p.R29R|CD209_uc002mhu.2_Silent_p.R29R|CD209_uc010dvq.2_Silent_p.R29R|CD209_uc002mhq.2_Silent_p.R29R|CD209_uc002mhv.2_Silent_p.R29R|CD209_uc002mhx.2_Intron|CD209_uc002mhw.2_Intron|CD209_uc010dvr.2_Silent_p.R29R	NM_021155	NP_066978	Q9NNX6	CD209_HUMAN	CD209 molecule isoform 1	29	Cytoplasmic (Probable).				cell-cell recognition|endocytosis|heterophilic cell-cell adhesion|innate immune response|intracellular signal transduction|intracellular virion transport|leukocyte cell-cell adhesion|peptide antigen transport|viral genome replication|virion attachment to host cell surface receptor	cytoplasm|extracellular region|integral to membrane|plasma membrane	mannose binding|metal ion binding|peptide antigen binding|receptor activity|virion binding			skin(1)	1						TTGTATCCTCGAGTCTGTCGG	0.383													10	237	---	---	---	---	PASS
HNRNPM	4670	broad.mit.edu	37	19	8550698	8550698	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:8550698C>A	uc010dwe.2	+	14	1466	c.1386C>A	c.(1384-1386)CTC>CTA	p.L462L	HNRNPM_uc010xke.1_Silent_p.L408L|HNRNPM_uc010dwd.2_Silent_p.L423L|HNRNPM_uc002mka.2_Silent_p.L327L|HNRNPM_uc002mkb.1_5'Flank	NM_005968	NP_005959	P52272	HNRPM_HUMAN	heterogeneous nuclear ribonucleoprotein M	462	27 X 6 AA repeats of [GEVSTPAN]-[ILMV]- [DE]-[RH]-[MLVI]-[GAV].|9.				alternative nuclear mRNA splicing, via spliceosome	catalytic step 2 spliceosome|integral to plasma membrane|nuclear matrix|nucleolus|paraspeckles	nucleotide binding|protein domain specific binding|RNA binding				0						CGCTGGGCCTCGACCACATGG	0.687													4	37	---	---	---	---	PASS
COL5A3	50509	broad.mit.edu	37	19	10091477	10091477	+	Intron	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:10091477C>G	uc002mmq.1	-							NM_015719	NP_056534	P25940	CO5A3_HUMAN	collagen, type V, alpha 3 preproprotein						collagen fibril organization|skin development	collagen type V	collagen binding|extracellular matrix structural constituent			ovary(7)|lung(1)|central_nervous_system(1)|skin(1)	10			Epithelial(33;7.11e-05)			CCACCCATCCCATACCTTGGG	0.572													3	9	---	---	---	---	PASS
DOCK6	57572	broad.mit.edu	37	19	11332606	11332606	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:11332606C>T	uc002mqs.3	-	28	3512	c.3471G>A	c.(3469-3471)GTG>GTA	p.V1157V	DOCK6_uc010xlq.1_Silent_p.V496V	NM_020812	NP_065863	Q96HP0	DOCK6_HUMAN	dedicator of cytokinesis 6	1157					blood coagulation	cytosol	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(2)|skin(1)	3						CACGAGCCTTCACAGTGGCCT	0.592													8	40	---	---	---	---	PASS
ZNF442	79973	broad.mit.edu	37	19	12461930	12461930	+	Nonsense_Mutation	SNP	G	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12461930G>A	uc002mtr.1	-	6	1080	c.469C>T	c.(469-471)CAA>TAA	p.Q157*	ZNF442_uc010xmk.1_Nonsense_Mutation_p.Q88*	NM_030824	NP_110451	Q9H7R0	ZN442_HUMAN	zinc finger protein 442	157					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			large_intestine(2)|breast(1)|kidney(1)	4						GTCCCACATTGTTTATGTGTA	0.403													20	87	---	---	---	---	PASS
DHPS	1725	broad.mit.edu	37	19	12790661	12790661	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12790661C>A	uc002muh.1	-	3	545	c.448G>T	c.(448-450)GAG>TAG	p.E150*	DHPS_uc002muf.1_Nonsense_Mutation_p.E27*|DHPS_uc002mug.1_Nonsense_Mutation_p.E108*|DHPS_uc002mui.1_Nonsense_Mutation_p.E150*|DHPS_uc002muj.1_Nonsense_Mutation_p.E150*|DHPS_uc002muk.1_RNA|DHPS_uc010xmn.1_RNA	NM_001930	NP_001921	P49366	DHYS_HUMAN	deoxyhypusine synthase isoform a	150					peptidyl-lysine modification to hypusine|positive regulation of cell proliferation|post-translational protein modification|spermidine catabolic process to deoxyhypusine, using deoxyhypusine synthase|translation	cytosol	deoxyhypusine synthase activity|protein binding			central_nervous_system(1)	1					Sulfadoxine(DB01299)	AGGCTAAACTCGCCCAAGTAT	0.607													4	46	---	---	---	---	PASS
HAUS8	93323	broad.mit.edu	37	19	17163697	17163697	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17163697C>A	uc002nfe.2	-	10	978	c.867G>T	c.(865-867)CAG>CAT	p.Q289H	HAUS8_uc002nff.2_Missense_Mutation_p.Q288H|HAUS8_uc002nfg.1_Missense_Mutation_p.Q228H|HAUS8_uc002nfh.1_Missense_Mutation_p.Q289H	NM_033417	NP_219485	Q9BT25	HAUS8_HUMAN	sarcoma antigen NY-SAR-48 isoform a	289					cell division|centrosome organization|mitosis|spindle assembly	centrosome|HAUS complex|microtubule|spindle pole					0						AGTCCAGCACCTGCACATTTT	0.537											OREG0025339	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	22	83	---	---	---	---	PASS
USHBP1	83878	broad.mit.edu	37	19	17373367	17373367	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:17373367C>T	uc002nfs.1	-	4	749	c.636G>A	c.(634-636)CAG>CAA	p.Q212Q	USHBP1_uc002nft.1_RNA|USHBP1_uc010xpk.1_Silent_p.Q148Q|USHBP1_uc010eam.1_Silent_p.Q140Q	NM_031941	NP_114147	Q8N6Y0	USBP1_HUMAN	Usher syndrome 1C binding protein 1	212	Potential.						PDZ domain binding			ovary(1)	1						TCACCTCTTTCTGCAGCGTCT	0.582													10	19	---	---	---	---	PASS
MEF2B	100271849	broad.mit.edu	37	19	19257870	19257870	+	Silent	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:19257870T>A	uc002nlm.2	-	5	630	c.516A>T	c.(514-516)CCA>CCT	p.P172P	MEF2B_uc002nln.2_Silent_p.P219P|MEF2B_uc002nll.2_Silent_p.P172P|LOC729991-MEF2B_uc010xqo.1_Silent_p.P172P|LOC729991-MEF2B_uc010xqp.1_Silent_p.P172P|LOC729991-MEF2B_uc002nlo.2_Silent_p.P172P|LOC729991-MEF2B_uc002nlp.2_Silent_p.P172P|MEF2B_uc002nlk.2_Silent_p.P175P	NM_001145785	NP_001139257			myocyte enhancer factor 2B isoform a											skin(1)	1			OV - Ovarian serous cystadenocarcinoma(5;0.00011)|Epithelial(12;0.00412)			TGGGGGCTGCTGGTCGGAAGG	0.672													5	15	---	---	---	---	PASS
ZNF676	163223	broad.mit.edu	37	19	22363137	22363137	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22363137G>T	uc002nqs.1	-	3	1700	c.1382C>A	c.(1381-1383)TCC>TAC	p.S461Y		NM_001001411	NP_001001411	Q8N7Q3	ZN676_HUMAN	zinc finger protein 676	461	C2H2-type 11.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0		Lung NSC(12;0.0207)|all_lung(12;0.0214)|all_epithelial(12;0.114)				AAAGCTTGAGGACCAGGTGAA	0.418													24	81	---	---	---	---	PASS
ZNF99	7652	broad.mit.edu	37	19	22940353	22940353	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:22940353C>T	uc010xrh.1	-	5	2085	c.2085G>A	c.(2083-2085)AAG>AAA	p.K695K		NM_001080409	NP_001073878			zinc finger protein 99											ovary(1)|skin(1)	2		Lung NSC(12;0.0207)|all_lung(12;0.0214)|all_epithelial(12;0.102)				TATAGGGTTTCTTTCCAGTAT	0.348													6	34	---	---	---	---	PASS
DPY19L3	147991	broad.mit.edu	37	19	32927415	32927415	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:32927415G>T	uc002ntg.2	+	5	568	c.392G>T	c.(391-393)CGA>CTA	p.R131L	DPY19L3_uc002nth.1_Missense_Mutation_p.R131L|DPY19L3_uc002nti.1_5'Flank	NM_207325	NP_997208	Q6ZPD9	D19L3_HUMAN	dpy-19-like 3	131						integral to membrane				ovary(4)	4	Esophageal squamous(110;0.162)					CTCCTTCAGCGAATGAATATT	0.289													7	126	---	---	---	---	PASS
ANKRD27	84079	broad.mit.edu	37	19	33135333	33135333	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33135333C>A	uc002ntn.1	-	5	579	c.423G>T	c.(421-423)GTG>GTT	p.V141V	ANKRD27_uc002nto.1_Silent_p.V141V	NM_032139	NP_115515	Q96NW4	ANR27_HUMAN	ankyrin repeat domain 27 (VPS9 domain)	141					early endosome to late endosome transport	early endosome|lysosome	GTPase activator activity|guanyl-nucleotide exchange factor activity			ovary(2)|skin(2)|pancreas(1)	5	Esophageal squamous(110;0.137)					AGAACTCTCTCACATCTTCAA	0.502													8	203	---	---	---	---	PASS
CCDC123	84902	broad.mit.edu	37	19	33424363	33424363	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:33424363G>T	uc002nty.2	-	8	969	c.880C>A	c.(880-882)CAG>AAG	p.Q294K	CCDC123_uc002ntx.2_Missense_Mutation_p.Q47K|CCDC123_uc010edg.2_RNA|CCDC123_uc002ntz.1_Missense_Mutation_p.Q294K|CCDC123_uc002nua.2_Missense_Mutation_p.Q294K	NM_032816	NP_116205	Q96ST8	CEP89_HUMAN	coiled-coil domain containing 123	294	Potential.					centrosome|spindle pole					0	Esophageal squamous(110;0.137)					CCACCTTCCTGTGACGACGCC	0.378													6	109	---	---	---	---	PASS
MAP4K1	11184	broad.mit.edu	37	19	39090569	39090569	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:39090569G>T	uc002oix.1	-	22	1773	c.1665C>A	c.(1663-1665)CTC>CTA	p.L555L	MAP4K1_uc002oiw.1_Silent_p.L142L|MAP4K1_uc002oiy.1_Silent_p.L555L|MAP4K1_uc010xug.1_Intron	NM_007181	NP_009112	Q92918	M4K1_HUMAN	mitogen-activated protein kinase kinase kinase	555	CNH.				activation of JUN kinase activity|peptidyl-serine phosphorylation		ATP binding|MAP kinase kinase kinase kinase activity|protein binding|small GTPase regulator activity			skin(4)|lung(3)|ovary(1)	8	all_cancers(60;6.42e-06)|Ovarian(47;0.103)		Lung(45;0.000751)|LUSC - Lung squamous cell carcinoma(53;0.00272)			CCAGACCTGAGAGAGACATGA	0.498													6	62	---	---	---	---	PASS
SPTBN4	57731	broad.mit.edu	37	19	41076417	41076417	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41076417C>A	uc002ony.2	+	33	7188	c.7102C>A	c.(7102-7104)CGG>AGG	p.R2368R	SPTBN4_uc002onz.2_Silent_p.R2368R|SPTBN4_uc010egx.2_Silent_p.R1111R	NM_020971	NP_066022	Q9H254	SPTN4_HUMAN	spectrin, beta, non-erythrocytic 4 isoform	2368					actin filament capping|axon guidance|cytoskeletal anchoring at plasma membrane|vesicle-mediated transport	cytosol|nuclear matrix|PML body|spectrin	actin binding|ankyrin binding|structural constituent of cytoskeleton			ovary(3)|central_nervous_system(1)|skin(1)	5			Lung(22;0.000114)|LUSC - Lung squamous cell carcinoma(20;0.000384)			GCGGACACCTcggccggaccg	0.433													3	5	---	---	---	---	PASS
SNRPA	6626	broad.mit.edu	37	19	41257326	41257326	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:41257326G>T	uc002ooz.2	+	1	548	c.13G>T	c.(13-15)GAG>TAG	p.E5*	C19orf54_uc002oou.1_5'Flank|C19orf54_uc002oow.1_5'Flank|C19orf54_uc002oox.1_5'Flank|C19orf54_uc002ooy.1_5'Flank|C19orf54_uc010xvs.1_5'Flank	NM_004596	NP_004587	P09012	SNRPA_HUMAN	small nuclear ribonucleoprotein polypeptide A	5						nucleoplasm|spliceosomal complex	nucleotide binding|protein binding|RNA binding			skin(2)|ovary(1)|central_nervous_system(1)	4			LUSC - Lung squamous cell carcinoma(20;0.000219)|Lung(22;0.000959)			GGCAGTTCCCGAGACCCGCCC	0.493													6	133	---	---	---	---	PASS
GSK3A	2931	broad.mit.edu	37	19	42740862	42740862	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42740862C>A	uc002otb.1	-	4	681	c.562G>T	c.(562-564)GAG>TAG	p.E188*	GSK3A_uc002ota.1_Nonsense_Mutation_p.E106*|GSK3A_uc002otc.2_RNA	NM_019884	NP_063937	P49840	GSK3A_HUMAN	glycogen synthase kinase 3 alpha	188	Protein kinase.				insulin receptor signaling pathway|negative regulation of glucose import|negative regulation of insulin receptor signaling pathway|negative regulation of transferase activity|nerve growth factor receptor signaling pathway|phosphatidylinositol-mediated signaling|positive regulation of protein catabolic process	beta-catenin destruction complex|cytosol	ATP binding|protein kinase A catalytic subunit binding|protein serine/threonine kinase activity|tau-protein kinase activity			ovary(2)|lung(2)	4		Prostate(69;0.00682)				AGGTAAAGCTCGTCTTTCTGC	0.562													5	47	---	---	---	---	PASS
CIC	23152	broad.mit.edu	37	19	42795796	42795796	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:42795796C>G	uc002otf.1	+	11	2825	c.2785C>G	c.(2785-2787)CCT>GCT	p.P929A		NM_015125	NP_055940	Q96RK0	CIC_HUMAN	capicua homolog	929	Pro-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|protein binding			ovary(4)|breast(4)|lung(1)|central_nervous_system(1)|skin(1)	11		Prostate(69;0.00682)				TCTGGCCGCCCCTAGCATGTC	0.677			T	DUX4	soft tissue sarcoma								5	55	---	---	---	---	PASS
PSG11	5680	broad.mit.edu	37	19	43523145	43523145	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:43523145C>A	uc002ovm.1	-	3	593	c.486G>T	c.(484-486)ATG>ATT	p.M162I	PSG11_uc002ouw.2_Missense_Mutation_p.M168I|PSG10_uc002ouv.1_Intron|PSG6_uc002ovh.1_Intron|PSG6_uc002ovi.2_Intron|PSG6_uc010xwk.1_Intron|PSG11_uc002ovk.1_Missense_Mutation_p.M168I|PSG11_uc002ovn.1_Missense_Mutation_p.M168I|PSG11_uc002ovo.1_Missense_Mutation_p.M40I|PSG11_uc002ovp.1_Missense_Mutation_p.M40I	NM_002785	NP_002776	Q9UQ72	PSG11_HUMAN	pregnancy specific beta-1-glycoprotein 11	162	Ig-like C2-type 1.				female pregnancy	extracellular region					0		Prostate(69;0.00682)				TCACAGTCTCCATGGCCTCCC	0.527													7	126	---	---	---	---	PASS
CADM4	199731	broad.mit.edu	37	19	44131919	44131919	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44131919C>A	uc002oxc.1	-	2	137	c.88G>T	c.(88-90)GAG>TAG	p.E30*		NM_145296	NP_660339	Q8NFZ8	CADM4_HUMAN	cell adhesion molecule 4 precursor	30	Ig-like V-type.|Extracellular (Potential).				cell adhesion	integral to membrane					0		Prostate(69;0.0199)				GTCACGTTCTCTGTCTGTACT	0.522													14	72	---	---	---	---	PASS
ZNF180	7733	broad.mit.edu	37	19	44982160	44982160	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:44982160G>T	uc002ozf.3	-	5	820	c.538C>A	c.(538-540)CAA>AAA	p.Q180K	ZNF180_uc002ozh.3_5'UTR|ZNF180_uc002ozi.3_Missense_Mutation_p.Q153K|ZNF180_uc002ozg.3_Missense_Mutation_p.Q179K|ZNF180_uc010ejm.2_Missense_Mutation_p.Q155K	NM_013256	NP_037388	Q9UJW8	ZN180_HUMAN	zinc finger protein 180	180					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2		Prostate(69;0.0435)				GCTTTCCTTTGAGTGAATGCC	0.408													8	111	---	---	---	---	PASS
OPA3	80207	broad.mit.edu	37	19	46087920	46087920	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:46087920C>A	uc002pck.3	-	1	203	c.103G>T	c.(103-105)GAG>TAG	p.E35*	OPA3_uc002pcj.3_Nonsense_Mutation_p.E35*|OPA3_uc010xxk.1_Intron	NM_025136	NP_079412	Q9H6K4	OPA3_HUMAN	OPA3 protein isoform b	35					response to stimulus|visual perception	mitochondrion					0		Ovarian(192;0.051)|all_neural(266;0.112)		OV - Ovarian serous cystadenocarcinoma(262;0.00778)|GBM - Glioblastoma multiforme(486;0.0976)|Epithelial(262;0.242)		TTGAAGAACTCGCTTCGGCGG	0.587													7	65	---	---	---	---	PASS
KLK3	354	broad.mit.edu	37	19	51361743	51361743	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:51361743G>T	uc002pts.1	+	4	563	c.522G>T	c.(520-522)GTG>GTT	p.V174V	KLK3_uc010ycj.1_Silent_p.V133V|KLK3_uc002ptr.1_Silent_p.V131V|KLK3_uc010eof.1_RNA	NM_001030047	NP_001025218	P07288	KLK3_HUMAN	prostate specific antigen isoform 3	174	Peptidase S1.				negative regulation of angiogenesis|proteolysis	extracellular region	serine-type endopeptidase activity			upper_aerodigestive_tract(1)|ovary(1)|kidney(1)	3		all_neural(266;0.057)		OV - Ovarian serous cystadenocarcinoma(262;0.00763)|GBM - Glioblastoma multiforme(134;0.0144)		TTCAGTGTGTGGACCTCCATG	0.488													7	64	---	---	---	---	PASS
KLK7	5650	broad.mit.edu	37	19	51480838	51480838	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:51480838C>T	uc002puo.2	-	6	818	c.716G>A	c.(715-717)TGC>TAC	p.C239Y	KLK7_uc002pup.2_Missense_Mutation_p.C239Y|KLK7_uc010yco.1_Missense_Mutation_p.C113Y|KLK7_uc010eok.2_Missense_Mutation_p.C167Y	NM_139277	NP_644806	P49862	KLK7_HUMAN	stratum corneum chymotryptic enzyme	239	Peptidase S1.				epidermis development|proteolysis	extracellular region	serine-type endopeptidase activity				0		all_neural(266;0.026)		OV - Ovarian serous cystadenocarcinoma(262;0.00382)|GBM - Glioblastoma multiforme(134;0.00895)		GGTGAACTTGCACACTTGAGT	0.463													6	55	---	---	---	---	PASS
FPR3	2359	broad.mit.edu	37	19	52327252	52327252	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52327252C>T	uc002pxt.1	+	2	435	c.251C>T	c.(250-252)TCA>TTA	p.S84L		NM_002030	NP_002021	P25089	FPR3_HUMAN	formyl peptide receptor-like 2	84	Extracellular (Potential).				cellular component movement|chemotaxis	integral to membrane|plasma membrane	N-formyl peptide receptor activity			lung(4)|breast(1)|skin(1)	6						CGAATGGTCTCAGTCGCCATG	0.468													6	50	---	---	---	---	PASS
FPR3	2359	broad.mit.edu	37	19	52327257	52327257	+	Missense_Mutation	SNP	G	T	T	rs143250626	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52327257G>T	uc002pxt.1	+	2	440	c.256G>T	c.(256-258)GCC>TCC	p.A86S		NM_002030	NP_002021	P25089	FPR3_HUMAN	formyl peptide receptor-like 2	86	Extracellular (Potential).				cellular component movement|chemotaxis	integral to membrane|plasma membrane	N-formyl peptide receptor activity			lung(4)|breast(1)|skin(1)	6						GGTCTCAGTCGCCATGAGAGA	0.453													16	36	---	---	---	---	PASS
ZNF577	84765	broad.mit.edu	37	19	52376052	52376052	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:52376052G>T	uc010yde.1	-	7	1582	c.1191C>A	c.(1189-1191)TCC>TCA	p.S397S	ZNF577_uc010ydd.1_Intron|ZNF577_uc002pxx.3_Silent_p.S338S|ZNF577_uc002pxv.2_Silent_p.S390S|ZNF577_uc002pxw.2_Silent_p.S331S	NM_032679	NP_116068	Q9BSK1	ZN577_HUMAN	zinc finger protein 577 isoform a	397					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		all_neural(266;0.0602)		GBM - Glioblastoma multiforme(134;0.00161)|OV - Ovarian serous cystadenocarcinoma(262;0.019)		TCATGTATAAGGAGGTATGAC	0.438													8	120	---	---	---	---	PASS
KIR2DL1	3802	broad.mit.edu	37	19	55285042	55285042	+	Nonsense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:55285042C>T	uc002qhb.1	+	3	366	c.328C>T	c.(328-330)CAG>TAG	p.Q110*	KIR2DS4_uc010yfj.1_Intron|KIR2DS4_uc010yfk.1_Intron|KIR2DL3_uc010erw.1_Intron|KIR2DL1_uc002qgz.1_Intron|KIR2DL3_uc002qha.1_Intron|KIR3DP1_uc010yfi.1_Intron|KIR2DL1_uc010erz.1_Nonsense_Mutation_p.Q110*	NM_014218	NP_055033	P43626	KI2L1_HUMAN	killer cell immunoglobulin-like receptor, two	110	Extracellular (Potential).				immune response|natural killer cell inhibitory signaling pathway	integral to plasma membrane	protein binding|receptor activity				0				GBM - Glioblastoma multiforme(193;0.0192)		CTCCCCCTATCAGGTGTCAGC	0.527													41	56	---	---	---	---	PASS
ZNF264	9422	broad.mit.edu	37	19	57723831	57723831	+	Nonsense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:57723831G>T	uc002qob.2	+	4	1779	c.1366G>T	c.(1366-1368)GAG>TAG	p.E456*		NM_003417	NP_003408	O43296	ZN264_HUMAN	zinc finger protein 264	456	C2H2-type 10.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2		Colorectal(82;5.46e-05)|all_neural(62;0.0218)|Ovarian(87;0.0822)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0135)		AAAGCCTTTCGAGTGCAAAGA	0.517													5	32	---	---	---	---	PASS
ZNF551	90233	broad.mit.edu	37	19	58198327	58198327	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58198327C>A	uc002qpw.3	+	3	859	c.636C>A	c.(634-636)TAC>TAA	p.Y212*	ZNF551_uc002qpv.3_Nonsense_Mutation_p.Y155*|ZNF776_uc002qpx.2_Intron	NM_138347	NP_612356	Q7Z340	ZN551_HUMAN	zinc finger protein 551	228					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)	1		Colorectal(82;0.000256)|all_neural(62;0.0577)|Breast(46;0.147)|Ovarian(87;0.156)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0257)		GGGGTGAATACAGAAAAGCTT	0.443													8	51	---	---	---	---	PASS
PSMF1	9491	broad.mit.edu	37	20	1108149	1108149	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:1108149C>A	uc002wel.3	+	4	531	c.363C>A	c.(361-363)CAC>CAA	p.H121Q	PSMF1_uc010zpo.1_Missense_Mutation_p.H33Q|PSMF1_uc002wem.3_Missense_Mutation_p.H121Q|PSMF1_uc010zpp.1_Missense_Mutation_p.H121Q|PSMF1_uc002wen.3_Missense_Mutation_p.H121Q	NM_178578	NP_848693	Q92530	PSMF1_HUMAN	proteasome inhibitor subunit 1	121					anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest|G1/S transition of mitotic cell cycle|M/G1 transition of mitotic cell cycle|mRNA metabolic process|negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle|regulation of apoptosis|regulation of cellular amino acid metabolic process|S phase of mitotic cell cycle|viral reproduction	proteasome core complex	endopeptidase inhibitor activity|protein binding				0						GTGACTTCCACAGGTACTTCT	0.428													7	123	---	---	---	---	PASS
IDH3B	3420	broad.mit.edu	37	20	2640344	2640344	+	Splice_Site	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:2640344C>T	uc002wgp.2	-	10	1019	c.1010_splice	c.e10+1	p.N337_splice	IDH3B_uc002wgq.2_Splice_Site_p.N337_splice|IDH3B_uc002wgr.2_Splice_Site_p.N185_splice	NM_006899	NP_008830	O43837	IDH3B_HUMAN	isocitrate dehydrogenase 3, beta subunit isoform						isocitrate metabolic process|tricarboxylic acid cycle	mitochondrial matrix	electron carrier activity|isocitrate dehydrogenase (NAD+) activity|magnesium ion binding|NAD binding				0					NADH(DB00157)	CCATGACCTACTTAAGATGCC	0.592													20	94	---	---	---	---	PASS
VPS16	64601	broad.mit.edu	37	20	2840410	2840410	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:2840410C>A	uc002whe.2	+	2	147	c.99C>A	c.(97-99)CTC>CTA	p.L33L	VPS16_uc002whf.2_Silent_p.L33L|VPS16_uc002whd.2_RNA|VPS16_uc002whg.2_5'Flank	NM_022575	NP_072097	Q9H269	VPS16_HUMAN	vacuolar protein sorting 16 isoform 1	33					intracellular protein transport	early endosome|HOPS complex|late endosome membrane|lysosomal membrane|recycling endosome				ovary(2)|pancreas(1)|skin(1)	4						AGGAGGAACTCAGGGATTGCC	0.562													7	98	---	---	---	---	PASS
RIN2	54453	broad.mit.edu	37	20	19956212	19956212	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:19956212G>T	uc002wro.1	+	7	1579	c.1543G>T	c.(1543-1545)GTC>TTC	p.V515F	RIN2_uc010gcu.1_Intron|RIN2_uc010gcv.1_Missense_Mutation_p.V309F	NM_018993	NP_061866	Q8WYP3	RIN2_HUMAN	Ras and Rab interactor 2	515					endocytosis|small GTPase mediated signal transduction	cytoplasm	GTPase activator activity|Rab guanyl-nucleotide exchange factor activity			lung(4)|ovary(1)	5						GAAGCGGATGGTCCGCAGGAT	0.592													13	50	---	---	---	---	PASS
CRNKL1	51340	broad.mit.edu	37	20	20017981	20017981	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:20017981G>T	uc002wrs.2	-	14	2397	c.2365C>A	c.(2365-2367)CAG>AAG	p.Q789K		NM_016652	NP_057736	Q9BZJ0	CRNL1_HUMAN	crooked neck-like 1 protein	789	HAT 16.				spliceosome assembly	catalytic step 2 spliceosome|cytoplasm|nuclear speck	RNA binding			ovary(2)|large_intestine(1)	3						TCATCAGTCTGGACCTTTCTT	0.438													8	151	---	---	---	---	PASS
TMEM90B	79953	broad.mit.edu	37	20	24523790	24523790	+	Silent	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:24523790T>C	uc002wtw.1	+	2	690	c.57T>C	c.(55-57)GCT>GCC	p.A19A		NM_024893	NP_079169	Q9H7V2	SYNG1_HUMAN	transmembrane protein 90B	19	Cytoplasmic (Potential).				response to biotic stimulus	early endosome membrane|integral to membrane|plasma membrane					0						TCAGTGATGCTGGCAAGAGGA	0.537													11	48	---	---	---	---	PASS
ZNF337	26152	broad.mit.edu	37	20	25657102	25657102	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:25657102G>T	uc002wva.2	-	4	1344	c.822C>A	c.(820-822)ACC>ACA	p.T274T	uc002wuz.2_RNA|ZNF337_uc010ztg.1_Silent_p.T242T|ZNF337_uc002wvb.2_Silent_p.T274T|ZNF337_uc002wvc.2_Silent_p.T274T	NM_015655	NP_056470	Q9Y3M9	ZN337_HUMAN	zinc finger protein 337	274	C2H2-type 4.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						ATGACTTACTGGTATAGCCTC	0.517													7	116	---	---	---	---	PASS
TPX2	22974	broad.mit.edu	37	20	30385255	30385255	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:30385255C>A	uc002wwp.1	+	16	2580	c.1882C>A	c.(1882-1884)CGT>AGT	p.R628S	TPX2_uc010gdv.1_Missense_Mutation_p.R664S	NM_012112	NP_036244	Q9ULW0	TPX2_HUMAN	TPX2, microtubule-associated protein homolog	628					activation of protein kinase activity|apoptosis|cell division|cell proliferation|mitosis|regulation of mitotic spindle organization	cytoplasm|microtubule|nucleus|spindle pole	ATP binding|GTP binding|protein kinase binding			large_intestine(1)|ovary(1)	2			Epithelial(4;0.000771)|Colorectal(19;0.00306)|all cancers(5;0.004)|COAD - Colon adenocarcinoma(19;0.0347)|OV - Ovarian serous cystadenocarcinoma(3;0.0656)			TTTCAAGGCTCGTCCAAACAC	0.448													6	174	---	---	---	---	PASS
EDEM2	55741	broad.mit.edu	37	20	33703284	33703284	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33703284G>T	uc002xbo.2	-	11	1789	c.1689C>A	c.(1687-1689)TTC>TTA	p.F563L	EDEM2_uc010zus.1_Missense_Mutation_p.F342L|EDEM2_uc002xbq.2_Missense_Mutation_p.F526L|EDEM2_uc010zut.1_Missense_Mutation_p.F522L|EDEM2_uc002xbp.2_Missense_Mutation_p.F411L|EDEM2_uc002xbn.2_Missense_Mutation_p.F411L|EDEM2_uc002xbr.2_RNA|EDEM2_uc010zuu.1_Missense_Mutation_p.F287L	NM_018217	NP_060687	Q9BV94	EDEM2_HUMAN	ER degradation enhancer, mannosidase alpha-like	563					post-translational protein modification|protein folding|protein N-linked glycosylation via asparagine|response to unfolded protein	endoplasmic reticulum lumen|endoplasmic reticulum membrane|extracellular region	calcium ion binding|mannosyl-oligosaccharide 1,2-alpha-mannosidase activity|misfolded protein binding				0			BRCA - Breast invasive adenocarcinoma(18;0.00936)			ACTTGGAGGTGAAGGGCTGAC	0.448													8	123	---	---	---	---	PASS
UQCC	55245	broad.mit.edu	37	20	33999756	33999756	+	Missense_Mutation	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:33999756A>G	uc002xcd.2	-	1	78	c.11T>C	c.(10-12)CTG>CCG	p.L4P	UQCC_uc010zuz.1_5'UTR|UQCC_uc010zva.1_Missense_Mutation_p.L4P|UQCC_uc002xce.2_Missense_Mutation_p.L4P|UQCC_uc002xcg.2_5'UTR|UQCC_uc010gfb.2_Missense_Mutation_p.L4P|UQCC_uc010zvb.1_Missense_Mutation_p.L4P|UQCC_uc002xcf.2_5'UTR|GDF5_uc010gfc.1_Intron|UQCC_uc010gfd.1_5'UTR	NM_018244	NP_060714	Q9NVA1	UQCC_HUMAN	basic FGF-repressed Zic binding protein isoform	4						cytoplasmic membrane-bounded vesicle				breast(1)	1			BRCA - Breast invasive adenocarcinoma(18;0.00252)			GACTCGCACCAGCAACGCCAT	0.542													16	63	---	---	---	---	PASS
PLCG1	5335	broad.mit.edu	37	20	39788562	39788562	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:39788562G>T	uc002xjp.1	+	3	544	c.423G>T	c.(421-423)ATG>ATT	p.M141I	PLCG1_uc002xjo.1_Missense_Mutation_p.M141I	NM_182811	NP_877963	P19174	PLCG1_HUMAN	phospholipase C, gamma 1 isoform b	141	PH 1.				activation of phospholipase C activity|axon guidance|blood coagulation|cellular response to epidermal growth factor stimulus|epidermal growth factor receptor signaling pathway|fibroblast growth factor receptor signaling pathway|interspecies interaction between organisms|intracellular signal transduction|leukocyte migration|nerve growth factor receptor signaling pathway|phospholipid catabolic process|positive regulation of angiogenesis|positive regulation of blood vessel endothelial cell migration|positive regulation of epithelial cell migration|T cell receptor signaling pathway	cytosol|lamellipodium|plasma membrane|ruffle	calcium ion binding|phosphatidylinositol phospholipase C activity|protein binding|receptor signaling protein activity			lung(3)|breast(3)|skin(2)	8		Myeloproliferative disorder(115;0.00878)				CTTGGCTGATGGAGGATACAT	0.547													6	59	---	---	---	---	PASS
PTPRT	11122	broad.mit.edu	37	20	40733286	40733286	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:40733286C>A	uc002xkg.2	-	25	3647	c.3463G>T	c.(3463-3465)GAG>TAG	p.E1155*	PTPRT_uc010ggj.2_Nonsense_Mutation_p.E1174*|PTPRT_uc010ggi.2_Nonsense_Mutation_p.E358*	NM_007050	NP_008981	O14522	PTPRT_HUMAN	protein tyrosine phosphatase, receptor type, T	1155	Cytoplasmic (Potential).				homophilic cell adhesion|transmembrane receptor protein tyrosine kinase signaling pathway	cell surface|integral to membrane|plasma membrane	alpha-catenin binding|beta-catenin binding|cadherin binding|delta-catenin binding|gamma-catenin binding|protein tyrosine phosphatase activity|receptor activity			skin(8)|ovary(7)|lung(5)	20		Myeloproliferative disorder(115;0.00452)|Lung NSC(126;0.0573)|all_lung(126;0.0783)				GAACGGAACTCACACACAGGG	0.512													6	75	---	---	---	---	PASS
MMP9	4318	broad.mit.edu	37	20	44641162	44641162	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:44641162G>T	uc002xqz.2	+	8	1290	c.1271G>T	c.(1270-1272)CGC>CTC	p.R424L		NM_004994	NP_004985	P14780	MMP9_HUMAN	matrix metalloproteinase 9 preproprotein	424					collagen catabolic process|macrophage differentiation|positive regulation of keratinocyte migration|proteolysis	extracellular space|proteinaceous extracellular matrix	collagen binding|metalloendopeptidase activity|zinc ion binding			ovary(1)|pancreas(1)	2		Myeloproliferative disorder(115;0.0122)			Glucosamine(DB01296)|Marimastat(DB00786)|Minocycline(DB01017)|Simvastatin(DB00641)	CCTATGTACCGCTTCACTGAG	0.617													12	37	---	---	---	---	PASS
NCOA3	8202	broad.mit.edu	37	20	46268381	46268381	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:46268381C>A	uc002xtk.2	+	15	2973	c.2768C>A	c.(2767-2769)CCA>CAA	p.P923Q	NCOA3_uc010ght.1_Missense_Mutation_p.P918Q|NCOA3_uc002xtl.2_Missense_Mutation_p.P923Q|NCOA3_uc002xtm.2_Missense_Mutation_p.P923Q|NCOA3_uc002xtn.2_Missense_Mutation_p.P923Q|NCOA3_uc010zyc.1_Missense_Mutation_p.P718Q	NM_181659	NP_858045	Q9Y6Q9	NCOA3_HUMAN	nuclear receptor coactivator 3 isoform a	923					androgen receptor signaling pathway|cellular lipid metabolic process|positive regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	nucleoplasm	androgen receptor binding|histone acetyltransferase activity|ligand-dependent nuclear receptor binding|protein N-terminus binding|signal transducer activity|thyroid hormone receptor binding			ovary(3)|lung(1)|skin(1)	5						TGGGGCTTACCAAACTCAAAG	0.468													9	129	---	---	---	---	PASS
STAU1	6780	broad.mit.edu	37	20	47782640	47782640	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:47782640C>A	uc002xud.2	-	3	510	c.99G>T	c.(97-99)ATG>ATT	p.M33I	STAU1_uc002xua.2_Intron|STAU1_uc002xub.2_Intron|STAU1_uc002xuc.2_Intron|STAU1_uc002xue.2_Intron|STAU1_uc002xuf.2_Intron|STAU1_uc002xug.2_Missense_Mutation_p.M33I	NM_017453	NP_059347	O95793	STAU1_HUMAN	staufen isoform b	33						microtubule associated complex|rough endoplasmic reticulum|stress granule	double-stranded RNA binding			ovary(4)|kidney(1)	5			BRCA - Breast invasive adenocarcinoma(12;0.000644)|Colorectal(8;0.198)			AAGGAATACTCATCAAAGGCT	0.463													7	116	---	---	---	---	PASS
BCAS1	8537	broad.mit.edu	37	20	52645048	52645048	+	Missense_Mutation	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:52645048C>G	uc002xws.2	-	4	944	c.606G>C	c.(604-606)AAG>AAC	p.K202N	BCAS1_uc010zzb.1_Missense_Mutation_p.K105N|BCAS1_uc010gim.2_Missense_Mutation_p.K105N|BCAS1_uc002xwt.2_Missense_Mutation_p.K202N|BCAS1_uc010gil.1_Missense_Mutation_p.K202N|BCAS1_uc010zzc.1_Missense_Mutation_p.K105N	NM_003657	NP_003648	O75363	BCAS1_HUMAN	breast carcinoma amplified sequence 1	202						cytoplasm	protein binding			ovary(2)|central_nervous_system(1)	3	Breast(2;9.53e-15)|Lung NSC(4;5.57e-06)|all_lung(4;1.44e-05)		STAD - Stomach adenocarcinoma(23;0.116)|Colorectal(105;0.198)			TTTCCTGTCCCTTGTCCAGCT	0.552													36	99	---	---	---	---	PASS
DIDO1	11083	broad.mit.edu	37	20	61511697	61511697	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:61511697C>T	uc002ydr.1	-	16	5875	c.5611G>A	c.(5611-5613)GAA>AAA	p.E1871K	DIDO1_uc002yds.1_Missense_Mutation_p.E1871K	NM_033081	NP_149072	Q9BTC0	DIDO1_HUMAN	death inducer-obliterator 1 isoform c	1871	Pro-rich.				apoptosis|transcription, DNA-dependent	cytoplasm|nucleus	zinc ion binding			ovary(3)|skin(3)	6	Breast(26;5.68e-08)					TCTGTCCCTTCAAACTGGGCG	0.622													5	25	---	---	---	---	PASS
TMPRSS15	5651	broad.mit.edu	37	21	19716354	19716354	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:19716354C>A	uc002ykw.2	-	11	1226	c.1195G>T	c.(1195-1197)GGA>TGA	p.G399*		NM_002772	NP_002763	P98073	ENTK_HUMAN	enterokinase precursor	399	Extracellular (Potential).|MAM.				proteolysis	brush border|integral to membrane	scavenger receptor activity|serine-type endopeptidase activity			ovary(5)|upper_aerodigestive_tract(1)|breast(1)|skin(1)	8						CCTCCTGGTCCAGTTGGGGTA	0.403													13	53	---	---	---	---	PASS
RNF160	26046	broad.mit.edu	37	21	30304965	30304965	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:30304965G>T	uc002ymr.2	-	28	5048	c.5035C>A	c.(5035-5037)CGA>AGA	p.R1679R		NM_015565	NP_056380	O94822	LTN1_HUMAN	zinc finger protein 294	1633							ligase activity|zinc ion binding				0						ATTACCTCTCGAGTAGTAGCT	0.338													7	118	---	---	---	---	PASS
TIAM1	7074	broad.mit.edu	37	21	32617825	32617825	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:32617825C>A	uc002yow.1	-	7	2035	c.1563G>T	c.(1561-1563)CTG>CTT	p.L521L	TIAM1_uc011adk.1_Silent_p.L521L|TIAM1_uc011adl.1_Silent_p.L521L|TIAM1_uc002yox.1_Silent_p.L129L	NM_003253	NP_003244	Q13009	TIAM1_HUMAN	T-cell lymphoma invasion and metastasis 1	521	PH 1.				apoptosis|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|regulation of Rho protein signal transduction|small GTPase mediated signal transduction	cell-cell junction|cytosol	receptor signaling protein activity|Rho guanyl-nucleotide exchange factor activity			lung(3)|breast(3)|ovary(2)|large_intestine(2)	10						AGGCATCACCCAGGGAATTGC	0.532													6	24	---	---	---	---	PASS
SFRS15	57466	broad.mit.edu	37	21	33068523	33068523	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:33068523C>A	uc002ypd.2	-	9	1397	c.971G>T	c.(970-972)GGA>GTA	p.G324V	SFRS15_uc002ype.2_Missense_Mutation_p.G324V|SFRS15_uc010glu.2_Missense_Mutation_p.G309V|SFRS15_uc002ypf.1_5'UTR	NM_020706	NP_065757	O95104	SFR15_HUMAN	splicing factor, arginine/serine-rich 15 isoform	324						nucleus	nucleotide binding|RNA binding				0						CATGCCATCTCCAGGAAAGCC	0.423													7	106	---	---	---	---	PASS
GCFC1	94104	broad.mit.edu	37	21	34132155	34132155	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:34132155A>C	uc002yqn.2	-	6	1316	c.1126T>G	c.(1126-1128)TTC>GTC	p.F376V	GCFC1_uc002yqo.2_RNA|GCFC1_uc002yqp.2_Missense_Mutation_p.F376V|GCFC1_uc002yqr.2_Missense_Mutation_p.F376V	NM_016631	NP_057715	Q9Y5B6	GCFC1_HUMAN	GC-rich sequence DNA-binding factor candidate	376						cytosol|nucleus	DNA binding|sequence-specific DNA binding transcription factor activity			ovary(2)	2						GGAGTTTTGAAAGGGACTGTA	0.413													13	70	---	---	---	---	PASS
CHAF1B	8208	broad.mit.edu	37	21	37775112	37775112	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:37775112G>T	uc002yvj.2	+	8	858	c.720G>T	c.(718-720)CTG>CTT	p.L240L		NM_005441	NP_005432	Q13112	CAF1B_HUMAN	chromatin assembly factor 1 subunit B	240	WD 5.				cell cycle|DNA repair|DNA replication|DNA replication-dependent nucleosome assembly|protein complex assembly|regulation of transcription, DNA-dependent|transcription, DNA-dependent	CAF-1 complex|cytoplasm	chromatin binding|histone binding|unfolded protein binding			ovary(1)|skin(1)	2						TCCGTAGACTGAGTTTCACTC	0.438													10	186	---	---	---	---	PASS
PCP4	5121	broad.mit.edu	37	21	41301006	41301006	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:41301006C>A	uc002yyp.2	+	3	240	c.159C>A	c.(157-159)TTC>TTA	p.F53L		NM_006198	NP_006189	P48539	PCP4_HUMAN	Purkinje cell protein 4	53	IQ.				central nervous system development	cytosol|nucleus				large_intestine(1)	1		Prostate(19;2.65e-06)|all_epithelial(19;0.138)				TCAGAAAATTCCAGAAGAAGA	0.448													5	31	---	---	---	---	PASS
PDXK	8566	broad.mit.edu	37	21	45161591	45161591	+	Silent	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr21:45161591C>G	uc002zdm.3	+	3	384	c.186C>G	c.(184-186)CTC>CTG	p.L62L	PDXK_uc010gpj.2_Silent_p.L62L|PDXK_uc002zdn.3_Silent_p.L62L|PDXK_uc002zdq.3_5'UTR	NM_003681	NP_003672	O00764	PDXK_HUMAN	pyridoxal kinase	62					cell proliferation|pyridoxal 5'-phosphate salvage	cytosol	ATP binding|lithium ion binding|magnesium ion binding|potassium ion binding|protein homodimerization activity|pyridoxal kinase activity|pyridoxal phosphate binding|sodium ion binding|zinc ion binding				0				Colorectal(79;0.109)|READ - Rectum adenocarcinoma(84;0.161)|STAD - Stomach adenocarcinoma(101;0.18)	Pyridoxal(DB00147)|Pyridoxine(DB00165)	CAGATGAGCTCCAGGAGTTGT	0.587													6	37	---	---	---	---	PASS
MICAL3	57553	broad.mit.edu	37	22	18300884	18300884	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:18300884C>A	uc002zng.3	-	26	4896	c.4543G>T	c.(4543-4545)GAG>TAG	p.E1515*	MICAL3_uc011agl.1_Nonsense_Mutation_p.E1431*|MICAL3_uc010gre.1_5'Flank	NM_015241	NP_056056	Q7RTP6	MICA3_HUMAN	microtubule associated monoxygenase, calponin	1515						cytoplasm|cytoskeleton	monooxygenase activity|zinc ion binding				0		all_epithelial(15;0.198)		Lung(27;0.0427)		TCCACGCTCTCCACAAACGAC	0.632													7	14	---	---	---	---	PASS
MICAL3	57553	broad.mit.edu	37	22	18300885	18300885	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:18300885C>A	uc002zng.3	-	26	4895	c.4542G>T	c.(4540-4542)GTG>GTT	p.V1514V	MICAL3_uc011agl.1_Silent_p.V1430V|MICAL3_uc010gre.1_5'Flank	NM_015241	NP_056056	Q7RTP6	MICA3_HUMAN	microtubule associated monoxygenase, calponin	1514						cytoplasm|cytoskeleton	monooxygenase activity|zinc ion binding				0		all_epithelial(15;0.198)		Lung(27;0.0427)		CCACGCTCTCCACAAACGACT	0.632													7	14	---	---	---	---	PASS
SLC25A1	6576	broad.mit.edu	37	22	19164622	19164622	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:19164622G>T	uc002zoz.2	-						SLC25A1_uc002zoy.2_Intron|SLC25A1_uc002zpa.2_Intron	NM_005984	NP_005975	P53007	TXTP_HUMAN	solute carrier family 25 (mitochondrial carrier;						gluconeogenesis|long-chain fatty-acyl-CoA biosynthetic process|mitochondrial citrate transport|triglyceride biosynthetic process	integral to membrane|mitochondrial inner membrane	citrate transmembrane transporter activity|protein binding				0	Colorectal(54;0.0993)	all_lung(157;9.94e-09)		Lung(27;0.124)		CAGGAAGGTCGAGTGGCTCAC	0.602													4	26	---	---	---	---	PASS
CRKL	1399	broad.mit.edu	37	22	21288203	21288203	+	Silent	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:21288203C>T	uc002ztf.2	+	2	957	c.448C>T	c.(448-450)CTA>TTA	p.L150L	CRKL_uc002ztg.1_RNA	NM_005207	NP_005198	P46109	CRKL_HUMAN	v-crk sarcoma virus CT10 oncogene homolog	150	SH3 1.				JNK cascade|Ras protein signal transduction	cytosol	protein tyrosine kinase activity|SH3/SH2 adaptor activity|signal transducer activity				0	all_cancers(11;1.16e-25)|all_epithelial(7;3.37e-24)|Lung NSC(8;7.25e-16)|all_lung(8;1.37e-14)|Melanoma(16;0.000465)|Ovarian(15;0.00167)|Colorectal(54;0.0332)|all_neural(72;0.142)	Lung SC(17;0.0262)	LUSC - Lung squamous cell carcinoma(15;0.000204)|Lung(15;0.00494)|Epithelial(17;0.176)			GGGTGAGATCCTAGTGATAAT	0.483													14	51	---	---	---	---	PASS
LOC96610	96610	broad.mit.edu	37	22	22782344	22782344	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:22782344C>A	uc011aim.1	+											Parts of antibodies, mostly variable regions.												0						CTGACTATTACTGTATGATTT	0.468													8	156	---	---	---	---	PASS
LOC96610	96610	broad.mit.edu	37	22	23247189	23247189	+	RNA	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:23247189C>A	uc011aim.1	+	373		c.15992C>A			uc002zws.2_Intron					Parts of antibodies, mostly variable regions.												0						GCGGAGGGACCAAGCTGACCG	0.542													6	79	---	---	---	---	PASS
ADRBK2	157	broad.mit.edu	37	22	26117245	26117245	+	Intron	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:26117245G>T	uc003abx.3	+						ADRBK2_uc003aby.3_Intron	NM_005160	NP_005151	P35626	ARBK2_HUMAN	beta-adrenergic receptor kinase 2								ATP binding|beta-adrenergic receptor kinase activity|signal transducer activity			lung(3)|ovary(2)|stomach(1)|central_nervous_system(1)	7					Adenosine triphosphate(DB00171)	CTGTTTTTATGGTTAGCAAAA	0.274													7	125	---	---	---	---	PASS
MTMR3	8897	broad.mit.edu	37	22	30416160	30416160	+	Missense_Mutation	SNP	A	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:30416160A>G	uc003agv.3	+	17	2840	c.2512A>G	c.(2512-2514)AGA>GGA	p.R838G	MTMR3_uc003agu.3_Missense_Mutation_p.R838G|MTMR3_uc003agw.3_Missense_Mutation_p.R838G	NM_021090	NP_066576	Q13615	MTMR3_HUMAN	myotubularin-related protein 3 isoform c	838					phosphatidylinositol dephosphorylation	cytoplasm|membrane|membrane fraction|nucleus	metal ion binding|phosphatidylinositol-3-phosphatase activity|protein serine/threonine phosphatase activity|protein tyrosine phosphatase activity			breast(3)|ovary(1)|skin(1)	5			OV - Ovarian serous cystadenocarcinoma(5;0.00204)|Epithelial(10;0.06)|all cancers(5;0.107)			TTTTGAGACCAGAGGACCAAA	0.463													17	74	---	---	---	---	PASS
GAL3ST1	9514	broad.mit.edu	37	22	30953382	30953382	+	5'UTR	SNP	C	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:30953382C>G	uc003aig.1	-	3					GAL3ST1_uc003aih.1_5'UTR|GAL3ST1_uc003aii.1_5'UTR|GAL3ST1_uc010gvz.1_5'UTR	NM_004861	NP_004852	Q99999	G3ST1_HUMAN	galactose-3-O-sulfotransferase 1						protein N-linked glycosylation	Golgi membrane|integral to plasma membrane|membrane fraction	galactosylceramide sulfotransferase activity				0						GGCAGCATCTCAGACACCTGC	0.632													3	33	---	---	---	---	PASS
EIF4ENIF1	56478	broad.mit.edu	37	22	31838065	31838065	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:31838065C>A	uc003akz.1	-	17	2410	c.2246G>T	c.(2245-2247)CGA>CTA	p.R749L	EIF4ENIF1_uc003akx.1_Missense_Mutation_p.R404L|EIF4ENIF1_uc003aky.1_Missense_Mutation_p.R429L|EIF4ENIF1_uc003ala.1_Missense_Mutation_p.R749L|EIF4ENIF1_uc003alb.1_Missense_Mutation_p.R575L|EIF4ENIF1_uc003akw.1_Missense_Mutation_p.R239L	NM_019843	NP_062817	Q9NRA8	4ET_HUMAN	eukaryotic translation initiation factor 4E	749						nucleus	protein binding|protein transporter activity			ovary(1)	1						AGAAGAGTCTCGATCGGCACT	0.483													7	115	---	---	---	---	PASS
HMGXB4	10042	broad.mit.edu	37	22	35660936	35660936	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:35660936G>T	uc003anl.2	+	5	729	c.555G>T	c.(553-555)CGG>CGT	p.R185R	HMGXB4_uc011amh.1_Silent_p.R76R|HMGXB4_uc003ank.2_Silent_p.R76R	NM_001003681	NP_001003681	Q9UGU5	HMGX4_HUMAN	high-mobility group protein 2-like 1	185					endosome to lysosome transport|negative regulation of Wnt receptor signaling pathway|Wnt receptor signaling pathway	NURF complex	DNA binding			breast(1)|skin(1)	2						TGACCCTTCGGGAGCCTGATG	0.463													8	131	---	---	---	---	PASS
MYH9	4627	broad.mit.edu	37	22	36696899	36696899	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:36696899G>T	uc003apg.2	-	22	3067	c.2836C>A	c.(2836-2838)CAG>AAG	p.Q946K	MYH9_uc003aph.1_Missense_Mutation_p.Q810K	NM_002473	NP_002464	P35579	MYH9_HUMAN	myosin, heavy polypeptide 9, non-muscle	946	Potential.				actin cytoskeleton reorganization|actin filament-based movement|angiogenesis|axon guidance|blood vessel endothelial cell migration|cytokinesis|integrin-mediated signaling pathway|leukocyte migration|membrane protein ectodomain proteolysis|monocyte differentiation|platelet formation|protein transport|regulation of cell shape	actomyosin contractile ring|cleavage furrow|cytosol|myosin complex|nucleus|ruffle|stress fiber|uropod	actin filament binding|actin-dependent ATPase activity|ADP binding|ATP binding|calmodulin binding|microfilament motor activity|protein anchor|protein homodimerization activity			breast(3)|ovary(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|lung(1)|skin(1)|kidney(1)|pancreas(1)	11						GCAGGAACCTGGATGTTCTGC	0.642			T	ALK	ALCL		Deafness|autosomal dominant 17|Epstein syndrome|Fechtner syndrome|May-Hegglin anomaly|Sebastian syndrome		Hereditary_Macrothrombocytopenia_MYH9-associated				5	31	---	---	---	---	PASS
NCF4	4689	broad.mit.edu	37	22	37260122	37260122	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:37260122C>A	uc003apy.3	+	2	252	c.68C>A	c.(67-69)TCG>TAG	p.S23*	NCF4_uc003apz.3_Nonsense_Mutation_p.S23*	NM_000631	NP_000622	Q15080	NCF4_HUMAN	neutrophil cytosolic factor 4 isoform 1	23	PX.				cell communication|immune response|oxidation-reduction process	cytosol|NADPH oxidase complex	phosphatidylinositol binding|protein dimerization activity			ovary(1)	1						GTTGCCATCTCGGCCAACATT	0.522													5	136	---	---	---	---	PASS
PHF5A	84844	broad.mit.edu	37	22	41856492	41856492	+	Intron	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41856492C>A	uc003bab.2	-							NM_032758	NP_116147	Q7RTV0	PHF5A_HUMAN	PHD-finger 5A						nuclear mRNA splicing, via spliceosome|positive regulation of transcription, DNA-dependent	nuclear speck|U12-type spliceosomal complex|U2 snRNP	DNA binding|sequence-specific DNA binding transcription factor activity				0						AGCCATCTCTCTGGAAAACAG	0.353													6	53	---	---	---	---	PASS
ZBED4	9889	broad.mit.edu	37	22	50278129	50278129	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50278129G>C	uc003bix.2	+	2	1289	c.819G>C	c.(817-819)AAG>AAC	p.K273N		NM_014838	NP_055653	O75132	ZBED4_HUMAN	zinc finger, BED-type containing 4	273						cytoplasm|nucleus	DNA binding|metal ion binding|protein dimerization activity			ovary(2)	2		all_cancers(38;8.58e-10)|all_epithelial(38;1.15e-08)|all_lung(38;0.000109)|Lung NSC(38;0.0018)|Breast(42;0.00191)|Ovarian(80;0.0164)|Lung SC(80;0.164)		UCEC - Uterine corpus endometrioid carcinoma (28;0.168)|BRCA - Breast invasive adenocarcinoma(115;0.2)|LUAD - Lung adenocarcinoma(64;0.247)		TAGCGGAGAAGAGCCTTCCAC	0.572													4	81	---	---	---	---	PASS
SAPS2	9701	broad.mit.edu	37	22	50845250	50845250	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:50845250C>A	uc003blb.1	+	5	782	c.360C>A	c.(358-360)CTC>CTA	p.L120L	SAPS2_uc003bky.1_Silent_p.L120L|SAPS2_uc003bkz.1_Silent_p.L120L|SAPS2_uc003blc.2_Silent_p.L120L|SAPS2_uc003bla.1_Silent_p.L120L	NM_014678	NP_055493	O75170	PP6R2_HUMAN	SAPS domain family, member 2	120						cytoplasm|intracellular membrane-bounded organelle	protein binding				0		all_cancers(38;5.78e-13)|all_epithelial(38;1.71e-11)|all_lung(38;3.89e-05)|Breast(42;0.000523)|Lung NSC(38;0.000992)|Ovarian(80;0.0221)|Hepatocellular(38;0.0691)|Lung SC(80;0.113)		BRCA - Breast invasive adenocarcinoma(115;0.222)		ATCCTCTGCTCGCCAGTTTTT	0.557													7	260	---	---	---	---	PASS
CA5B	11238	broad.mit.edu	37	X	15768283	15768283	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:15768283G>T	uc004cxe.2	+	2	254	c.137G>T	c.(136-138)CGA>CTA	p.R46L		NM_007220	NP_009151	Q9Y2D0	CAH5B_HUMAN	carbonic anhydrase VB, mitochondrial precursor	46					one-carbon metabolic process	mitochondrion	carbonate dehydratase activity|zinc ion binding				0	Hepatocellular(33;0.183)					ACCCGGAACCGAGCCTGTGAG	0.358													5	51	---	---	---	---	PASS
CDKL5	6792	broad.mit.edu	37	X	18616696	18616696	+	Missense_Mutation	SNP	A	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:18616696A>C	uc004cym.2	+	11	1193	c.940A>C	c.(940-942)AAA>CAA	p.K314Q	CDKL5_uc004cyn.2_Missense_Mutation_p.K314Q	NM_003159	NP_003150	O76039	CDKL5_HUMAN	cyclin-dependent kinase-like 5	314					neuron migration|positive regulation of axon extension|positive regulation of dendrite morphogenesis|positive regulation of Rac GTPase activity|protein autophosphorylation	dendrite cytoplasm|dendritic growth cone|nucleus	ATP binding|cyclin-dependent protein kinase activity|Rac GTPase binding			ovary(2)|large_intestine(1)|stomach(1)|central_nervous_system(1)|skin(1)	6	Hepatocellular(33;0.183)					AGCAAAAAGAAAACCTTACCA	0.423													8	35	---	---	---	---	PASS
PHEX	5251	broad.mit.edu	37	X	22095759	22095759	+	Missense_Mutation	SNP	C	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:22095759C>T	uc004dah.2	+	5	805	c.602C>T	c.(601-603)TCT>TTT	p.S201F	PHEX_uc011mjr.1_Missense_Mutation_p.S201F|PHEX_uc011mjs.1_Missense_Mutation_p.S104F	NM_000444	NP_000435	P78562	PHEX_HUMAN	phosphate-regulating neutral endopeptidase	201	Extracellular (Potential).				biomineral tissue development|cell-cell signaling|protein modification process|proteolysis|skeletal system development	integral to plasma membrane	aminopeptidase activity|metalloendopeptidase activity|zinc ion binding			ovary(2)|lung(1)	3						TACAGCAATTCTGTGTTCATC	0.443													23	50	---	---	---	---	PASS
APOO	79135	broad.mit.edu	37	X	23858459	23858459	+	Nonstop_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:23858459C>A	uc004dax.2	-	8	828	c.597G>T	c.(595-597)TAG>TAT	p.*199Y	APOO_uc004daw.2_RNA|APOO_uc004day.3_RNA	NM_024122	NP_077027	Q9BUR5	APOO_HUMAN	apolipoprotein O precursor	199					lipid transport	high-density lipoprotein particle|integral to membrane|low-density lipoprotein particle|very-low-density lipoprotein particle					0						ATGGAGTTTTCTACTTAGTTC	0.343													7	110	---	---	---	---	PASS
FAM48B1	100130302	broad.mit.edu	37	X	24381386	24381386	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:24381386C>A	uc011mjx.1	+	1	509	c.509C>A	c.(508-510)ACG>AAG	p.T170K		NM_001136234	NP_001129706			hypothetical protein LOC100130302											kidney(1)	1						CTACGTCCAACGATGCAGACT	0.468													5	83	---	---	---	---	PASS
CXorf21	80231	broad.mit.edu	37	X	30577741	30577741	+	Silent	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:30577741G>C	uc004dcg.1	-	3	1008	c.732C>G	c.(730-732)CTC>CTG	p.L244L		NM_025159	NP_079435	Q9HAI6	CX021_HUMAN	hypothetical protein LOC80231	244										ovary(1)	1						TTGTCATGATGAGTTCAGACG	0.428													6	20	---	---	---	---	PASS
CXorf21	80231	broad.mit.edu	37	X	30577970	30577970	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:30577970G>C	uc004dcg.1	-	3	779	c.503C>G	c.(502-504)TCC>TGC	p.S168C		NM_025159	NP_079435	Q9HAI6	CX021_HUMAN	hypothetical protein LOC80231	168										ovary(1)	1						AGTAGAAATGGAATCCTCCAT	0.428													6	14	---	---	---	---	PASS
CXorf21	80231	broad.mit.edu	37	X	30578451	30578451	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:30578451T>C	uc004dcg.1	-	3	298	c.22A>G	c.(22-24)AGT>GGT	p.S8G		NM_025159	NP_079435	Q9HAI6	CX021_HUMAN	hypothetical protein LOC80231	8										ovary(1)	1						TCAAGTCCACTGAGATACCCT	0.408													12	10	---	---	---	---	PASS
WNK3	65267	broad.mit.edu	37	X	54275131	54275131	+	Missense_Mutation	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:54275131T>A	uc004dtd.1	-	17	4089	c.3650A>T	c.(3649-3651)CAT>CTT	p.H1217L	WNK3_uc004dtc.1_Missense_Mutation_p.H1217L	NM_001002838	NP_001002838	Q9BYP7	WNK3_HUMAN	WNK lysine deficient protein kinase 3 isoform 2	1217					intracellular protein kinase cascade|positive regulation of establishment of protein localization in plasma membrane|positive regulation of peptidyl-threonine phosphorylation|positive regulation of rubidium ion transmembrane transporter activity|positive regulation of rubidium ion transport|positive regulation of sodium ion transmembrane transporter activity|positive regulation of sodium ion transport|protein autophosphorylation	adherens junction|tight junction	ATP binding|protein binding|protein serine/threonine kinase activity|rubidium ion transmembrane transporter activity|sodium ion transmembrane transporter activity			lung(4)|ovary(3)|kidney(2)|central_nervous_system(2)	11						GATACTTACATGTAAACACAA	0.368													6	9	---	---	---	---	PASS
VSIG4	11326	broad.mit.edu	37	X	65252402	65252402	+	Missense_Mutation	SNP	G	T	T	rs150666044		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:65252402G>T	uc004dwh.2	-	3	729	c.602C>A	c.(601-603)GCG>GAG	p.A201E	VSIG4_uc004dwi.2_Intron|VSIG4_uc010nkq.1_Missense_Mutation_p.A201E|VSIG4_uc004dwj.2_Missense_Mutation_p.A201E|VSIG4_uc011moy.1_Intron|VSIG4_uc004dwk.2_Missense_Mutation_p.A201E|VSIG4_uc004dwl.2_Missense_Mutation_p.A97E	NM_007268	NP_009199	Q9Y279	VSIG4_HUMAN	V-set and immunoglobulin domain containing 4	201	Ig-like 2.|Extracellular (Potential).				complement activation, alternative pathway	integral to membrane	protein binding				0						GGCTATCACCGCAGGCTTGAA	0.502													12	14	---	---	---	---	PASS
ABCB7	22	broad.mit.edu	37	X	74282203	74282203	+	Missense_Mutation	SNP	T	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:74282203T>C	uc004eca.2	-	14	1920	c.1895A>G	c.(1894-1896)TAT>TGT	p.Y632C	ABCB7_uc004ebz.2_Missense_Mutation_p.Y633C|ABCB7_uc011mqn.1_Missense_Mutation_p.Y606C|ABCB7_uc010nls.2_Missense_Mutation_p.Y593C|ABCB7_uc010nlt.2_Missense_Mutation_p.Y592C	NM_004299	NP_004290	O75027	ABCB7_HUMAN	ATP-binding cassette, sub-family B, member 7	632	ABC transporter.				cellular iron ion homeostasis	integral to membrane|mitochondrial inner membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances|heme transporter activity			ovary(1)	1						AGCTTCATCATAGAGTATGAC	0.353													19	23	---	---	---	---	PASS
ATP7A	538	broad.mit.edu	37	X	77301961	77301961	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:77301961C>A	uc004ecx.3	+	23	4557	c.4397C>A	c.(4396-4398)TCA>TAA	p.S1466*		NM_000052	NP_000043	Q04656	ATP7A_HUMAN	ATPase, Cu++ transporting, alpha polypeptide	1466	Cytoplasmic (Potential).				ATP biosynthetic process|blood vessel development|blood vessel remodeling|cartilage development|cellular copper ion homeostasis|cerebellar Purkinje cell differentiation|collagen fibril organization|copper ion import|detoxification of copper ion|dopamine metabolic process|elastic fiber assembly|elastin biosynthetic process|epinephrine metabolic process|hair follicle morphogenesis|locomotory behavior|lung alveolus development|negative regulation of metalloenzyme activity|neuroprotection|peptidyl-lysine modification|pigmentation|positive regulation of metalloenzyme activity|positive regulation of oxidoreductase activity|pyramidal neuron development|regulation of oxidative phosphorylation|removal of superoxide radicals|serotonin metabolic process|skin development|T-helper cell differentiation|tryptophan metabolic process	basolateral plasma membrane|cytosol|endoplasmic reticulum|endoplasmic reticulum|integral to membrane|late endosome|neuron projection|neuronal cell body|perinuclear region of cytoplasm|trans-Golgi network|trans-Golgi network transport vesicle	ATP binding|copper-dependent protein binding|copper-exporting ATPase activity|superoxide dismutase copper chaperone activity				0						TCTATAAACTCACTACTGTCT	0.443													7	100	---	---	---	---	PASS
BRWD3	254065	broad.mit.edu	37	X	79975108	79975108	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:79975108G>T	uc004edt.2	-	18	2187	c.1924C>A	c.(1924-1926)CAA>AAA	p.Q642K	BRWD3_uc010nmi.1_RNA|BRWD3_uc004edo.2_Missense_Mutation_p.Q238K|BRWD3_uc004edp.2_Missense_Mutation_p.Q471K|BRWD3_uc004edq.2_Missense_Mutation_p.Q238K|BRWD3_uc010nmj.1_Missense_Mutation_p.Q238K|BRWD3_uc004edr.2_Missense_Mutation_p.Q312K|BRWD3_uc004eds.2_Missense_Mutation_p.Q238K|BRWD3_uc004edu.2_Missense_Mutation_p.Q312K|BRWD3_uc004edv.2_Missense_Mutation_p.Q238K|BRWD3_uc004edw.2_Missense_Mutation_p.Q238K|BRWD3_uc004edx.2_Missense_Mutation_p.Q238K|BRWD3_uc004edy.2_Missense_Mutation_p.Q238K|BRWD3_uc004edz.2_Missense_Mutation_p.Q312K|BRWD3_uc004eea.2_Missense_Mutation_p.Q312K|BRWD3_uc004eeb.2_Missense_Mutation_p.Q238K	NM_153252	NP_694984	Q6RI45	BRWD3_HUMAN	bromodomain and WD repeat domain containing 3	642										ovary(4)	4						CTCTCATCTTGGTCATTGGTT	0.383													7	74	---	---	---	---	PASS
KLHL4	56062	broad.mit.edu	37	X	86773049	86773049	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:86773049G>T	uc004efb.2	+	1	335	c.153G>T	c.(151-153)AGG>AGT	p.R51S	KLHL4_uc004efa.2_Missense_Mutation_p.R51S	NM_019117	NP_061990	Q9C0H6	KLHL4_HUMAN	kelch-like 4 isoform 1	51						cytoplasm|microtubule cytoskeleton|nucleolus	actin binding			ovary(2)|lung(1)|breast(1)|central_nervous_system(1)	5						TTCAGGGCAGGTTGAAGAGCC	0.547													5	19	---	---	---	---	PASS
RAB40AL	282808	broad.mit.edu	37	X	102192998	102192998	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:102192998G>T	uc004ejs.2	+	1	799	c.752G>T	c.(751-753)AGG>ATG	p.R251M		NM_001031834	NP_001027004	P0C0E4	RB40L_HUMAN	RAB40A, member RAS oncogene family-like	251					protein transport|small GTPase mediated signal transduction	mitochondrion|plasma membrane	GTP binding			ovary(2)	2						ACTCACAAAAGGAGCAGCCTC	0.527													6	45	---	---	---	---	PASS
FAM199X	139231	broad.mit.edu	37	X	103432970	103432970	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:103432970C>A	uc004elw.2	+	5	1145	c.979C>A	c.(979-981)CGG>AGG	p.R327R	FAM199X_uc004elx.2_Intron	NM_207318	NP_997201	Q6PEV8	F199X_HUMAN	hypothetical protein LOC139231	327										ovary(1)	1						TGCAGCAGAGCGGATTCGGGA	0.403													5	66	---	---	---	---	PASS
NRK	203447	broad.mit.edu	37	X	105183976	105183976	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:105183976G>T	uc004emd.2	+	23	4213	c.3910G>T	c.(3910-3912)GCC>TCC	p.A1304S	NRK_uc010npc.1_Missense_Mutation_p.A972S	NM_198465	NP_940867	Q7Z2Y5	NRK_HUMAN	Nik related kinase	1304	CNH.						ATP binding|protein serine/threonine kinase activity|small GTPase regulator activity			breast(7)|ovary(3)|lung(2)|large_intestine(1)|central_nervous_system(1)	14						GACAGAGGAAGCCTGCAAAGC	0.388										HNSCC(51;0.14)			4	13	---	---	---	---	PASS
MORC4	79710	broad.mit.edu	37	X	106228456	106228456	+	Nonsense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:106228456C>A	uc004emu.3	-	5	787	c.544G>T	c.(544-546)GAG>TAG	p.E182*	MORC4_uc004emp.3_Intron|MORC4_uc004emv.3_Nonsense_Mutation_p.E182*|MORC4_uc004emw.3_Intron	NM_024657	NP_078933	Q8TE76	MORC4_HUMAN	zinc finger, CW type with coiled-coil domain 2	182							ATP binding|zinc ion binding			ovary(1)	1						AATGAATCCTCGGTAATAATC	0.373													5	108	---	---	---	---	PASS
MID2	11043	broad.mit.edu	37	X	107160757	107160757	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107160757G>T	uc004enl.2	+	7	1796	c.1223G>T	c.(1222-1224)CGA>CTA	p.R408L	MID2_uc004enk.2_Missense_Mutation_p.R408L	NM_012216	NP_036348	Q9UJV3	TRIM1_HUMAN	midline 2 isoform 1	408	Fibronectin type-III.					centrosome|microtubule	ligase activity|zinc ion binding			ovary(1)	1						CCATCTATCCGAGAAGAACTC	0.443													6	105	---	---	---	---	PASS
IRS4	8471	broad.mit.edu	37	X	107979494	107979494	+	Silent	SNP	T	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:107979494T>A	uc004eoc.2	-	1	114	c.81A>T	c.(79-81)GCA>GCT	p.A27A		NM_003604	NP_003595	O14654	IRS4_HUMAN	insulin receptor substrate 4	27	Poly-Ala.					plasma membrane	insulin receptor binding|SH3/SH2 adaptor activity|signal transducer activity			ovary(4)|large_intestine(2)|lung(1)|breast(1)|skin(1)|pancreas(1)	10						TCACCACTGCTGCTAGAGCTG	0.617													9	10	---	---	---	---	PASS
CUL4B	8450	broad.mit.edu	37	X	119664005	119664005	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:119664005G>T	uc004esw.2	-	21	3035	c.2598C>A	c.(2596-2598)CAC>CAA	p.H866Q	CUL4B_uc010nqq.2_Missense_Mutation_p.H567Q|CUL4B_uc004esv.2_Missense_Mutation_p.H848Q	NM_003588	NP_003579	Q13620	CUL4B_HUMAN	cullin 4B isoform 1	866					cell cycle|DNA repair|ubiquitin-dependent protein catabolic process	Cul4B-RING ubiquitin ligase complex|nucleus	protein binding|ubiquitin protein ligase binding			lung(1)|central_nervous_system(1)|pancreas(1)	3						CAAGGAGATTGTGGCTAAGTG	0.353													6	109	---	---	---	---	PASS
THOC2	57187	broad.mit.edu	37	X	122765633	122765633	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:122765633C>A	uc004etu.2	-	22	2419	c.2387G>T	c.(2386-2388)CGA>CTA	p.R796L	THOC2_uc011muh.1_Missense_Mutation_p.R721L	NM_001081550	NP_001075019	Q8NI27	THOC2_HUMAN	THO complex 2	796					intronless viral mRNA export from host nucleus|mRNA processing|RNA splicing	THO complex part of transcription export complex	protein binding|RNA binding			ovary(3)	3						TGAAGGCACTCGCTTTATATA	0.368													6	118	---	---	---	---	PASS
ACTRT1	139741	broad.mit.edu	37	X	127185050	127185050	+	3'UTR	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:127185050G>T	uc004eum.2	-	1						NM_138289	NP_612146	Q8TDG2	ACTT1_HUMAN	actin-related protein T1							cytoplasm|cytoskeleton				ovary(2)|central_nervous_system(2)|skin(1)	5						TCTGCTCAAGGATCTTTAAAA	0.443													36	68	---	---	---	---	PASS
OCRL	4952	broad.mit.edu	37	X	128710040	128710040	+	Splice_Site	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:128710040G>T	uc004euq.2	+	17	2044	c.1879_splice	c.e17+1	p.N627_splice	OCRL_uc004eur.2_Splice_Site_p.N627_splice	NM_000276	NP_000267	Q01968	OCRL_HUMAN	phosphatidylinositol polyphosphate 5-phosphatase						regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	clathrin-coated vesicle|cytosol|early endosome|Golgi stack|Golgi-associated vesicle	GTPase activator activity|phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity|protein binding			lung(2)|ovary(1)|kidney(1)	4						TTGGAGCCAAGTGAGTTTTCC	0.458													5	55	---	---	---	---	PASS
ARHGAP36	158763	broad.mit.edu	37	X	130217734	130217734	+	Missense_Mutation	SNP	A	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:130217734A>T	uc004evz.2	+	4	691	c.346A>T	c.(346-348)AGC>TGC	p.S116C	ARHGAP36_uc004ewa.2_Missense_Mutation_p.S104C|ARHGAP36_uc004ewb.2_Missense_Mutation_p.S85C|ARHGAP36_uc004ewc.2_5'UTR	NM_144967	NP_659404	Q6ZRI8	RHG36_HUMAN	hypothetical protein LOC158763 precursor	116					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity			ovary(3)	3						ATTTGGCATTAGCCTGGAAGA	0.557													39	54	---	---	---	---	PASS
GPC4	2239	broad.mit.edu	37	X	132458415	132458415	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:132458415G>T	uc004exc.1	-	3	681	c.469C>A	c.(469-471)CTG>ATG	p.L157M	GPC4_uc011mvg.1_Missense_Mutation_p.L87M	NM_001448	NP_001439	O75487	GPC4_HUMAN	glypican 4 precursor	157					anatomical structure morphogenesis|cell proliferation	anchored to membrane|external side of plasma membrane|extracellular space|insoluble fraction|integral to plasma membrane|proteinaceous extracellular matrix	heparan sulfate proteoglycan binding				0	Acute lymphoblastic leukemia(192;0.000127)					ATTTCTTCCAGGTTCACATTT	0.438													7	79	---	---	---	---	PASS
CD40LG	959	broad.mit.edu	37	X	135741406	135741406	+	Silent	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:135741406C>A	uc004faa.2	+	5	690	c.618C>A	c.(616-618)CTC>CTA	p.L206L	CD40LG_uc010nsd.2_Silent_p.L185L	NM_000074	NP_000065	P29965	CD40L_HUMAN	CD40 ligand	206	Extracellular (Potential).				anti-apoptosis|B cell proliferation|inflammatory response|isotype switching|leukocyte cell-cell adhesion|platelet activation|positive regulation of endothelial cell apoptosis|positive regulation of interleukin-12 production	extracellular space|integral to plasma membrane|soluble fraction	CD40 receptor binding|cytokine activity|tumor necrosis factor receptor binding			skin(1)	1	Acute lymphoblastic leukemia(192;0.000127)				Atorvastatin(DB01076)	GAATCTTACTCAGAGCTGCAA	0.498									Immune_Deficiency_with_Hyper-IgM				7	89	---	---	---	---	PASS
CDR1	1038	broad.mit.edu	37	X	139866047	139866047	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:139866047C>A	uc004fbg.1	-	1	677	c.485G>T	c.(484-486)AGA>ATA	p.R162I	uc004fbf.1_RNA	NM_004065	NP_004056	P51861	CDR1_HUMAN	cerebellar degeneration-related protein 1,	162	4.|6 X 6 AA approximate repeats.										0	Acute lymphoblastic leukemia(192;7.65e-05)	Lung SC(4;0.051)				CAATCCAAGTCTTCCGGATAA	0.448													27	56	---	---	---	---	PASS
MAGEC1	9947	broad.mit.edu	37	X	140993421	140993421	+	Missense_Mutation	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:140993421G>C	uc004fbt.2	+	4	517	c.231G>C	c.(229-231)CAG>CAC	p.Q77H	MAGEC1_uc010nsl.1_Intron	NM_005462	NP_005453	O60732	MAGC1_HUMAN	melanoma antigen family C, 1	77							protein binding			ovary(1)|kidney(1)|central_nervous_system(1)|skin(1)	4	Acute lymphoblastic leukemia(192;6.56e-05)					AGGACTCCCAGTCTCCTCTCC	0.592										HNSCC(15;0.026)			14	27	---	---	---	---	PASS
FMR1	2332	broad.mit.edu	37	X	147011672	147011672	+	Missense_Mutation	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:147011672G>T	uc010nst.2	+	7	728	c.539G>T	c.(538-540)CGA>CTA	p.R180L	FMR1_uc011mwz.1_Missense_Mutation_p.R180L|FMR1_uc004fcj.2_Missense_Mutation_p.R180L|FMR1_uc004fck.3_Missense_Mutation_p.R180L|FMR1_uc004fcl.3_Missense_Mutation_p.R41L|FMR1_uc011mxa.1_5'UTR	NM_002024	NP_002015	Q06787	FMR1_HUMAN	fragile X mental retardation 1	180					mRNA transport|negative regulation of translational initiation	cytoplasm|mRNA cap binding complex|nucleolus|nucleoplasm|soluble fraction	mRNA binding|protein binding			ovary(2)|pancreas(1)	3	Acute lymphoblastic leukemia(192;6.56e-05)					ACCTCAAAGCGAGCACATATG	0.373									Fragile_X_syndrome				5	57	---	---	---	---	PASS
AFF2	2334	broad.mit.edu	37	X	147967502	147967502	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:147967502C>A	uc004fcp.2	+	8	1825	c.1346C>A	c.(1345-1347)ACT>AAT	p.T449N	AFF2_uc004fco.2_Missense_Mutation_p.T410N|AFF2_uc004fcq.2_Missense_Mutation_p.T439N|AFF2_uc004fcr.2_Missense_Mutation_p.T410N|AFF2_uc011mxb.1_Missense_Mutation_p.T414N|AFF2_uc004fcs.2_Missense_Mutation_p.T416N|AFF2_uc011mxc.1_Missense_Mutation_p.T90N	NM_002025	NP_002016	P51816	AFF2_HUMAN	fragile X mental retardation 2	449					brain development|mRNA processing|regulation of RNA splicing|RNA splicing	nuclear speck	G-quadruplex RNA binding|protein binding			ovary(3)|pancreas(2)	5	Acute lymphoblastic leukemia(192;6.56e-05)					TGCACTGCCACTGAGCTCTAC	0.502													6	74	---	---	---	---	PASS
AFF2	2334	broad.mit.edu	37	X	148037297	148037297	+	Silent	SNP	G	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:148037297G>T	uc004fcp.2	+	11	2201	c.1722G>T	c.(1720-1722)ACG>ACT	p.T574T	AFF2_uc004fcq.2_Silent_p.T564T|AFF2_uc004fcr.2_Silent_p.T535T|AFF2_uc011mxb.1_Silent_p.T539T|AFF2_uc004fcs.2_Silent_p.T541T|AFF2_uc011mxc.1_Silent_p.T215T	NM_002025	NP_002016	P51816	AFF2_HUMAN	fragile X mental retardation 2	574					brain development|mRNA processing|regulation of RNA splicing|RNA splicing	nuclear speck	G-quadruplex RNA binding|protein binding			ovary(3)|pancreas(2)	5	Acute lymphoblastic leukemia(192;6.56e-05)					AAGTGAAGACGAATGCCAGTC	0.473													5	89	---	---	---	---	PASS
TMEM185A	84548	broad.mit.edu	37	X	148690401	148690401	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:148690401C>A	uc011mxq.1	-	4	647	c.336G>T	c.(334-336)TGG>TGT	p.W112C	HSFX2_uc004fdl.2_Intron|HSFX1_uc004fdm.2_Intron|TMEM185A_uc011mxp.1_Missense_Mutation_p.W53C|TMEM185A_uc004fdo.2_Intron|TMEM185A_uc004fdp.3_Missense_Mutation_p.W29C	NM_032508	NP_115897	Q8NFB2	T185A_HUMAN	transmembrane protein 185A	112	Helical; (Potential).					integral to membrane				ovary(1)	1	Acute lymphoblastic leukemia(192;6.56e-05)|Colorectal(9;0.0662)					AGACCAGGAGCCAGAAATGGC	0.483													16	29	---	---	---	---	PASS
CNGA2	1260	broad.mit.edu	37	X	150911689	150911689	+	Silent	SNP	G	C	C			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:150911689G>C	uc004fey.1	+	7	938	c.714G>C	c.(712-714)GTG>GTC	p.V238V		NM_005140	NP_005131	Q16280	CNGA2_HUMAN	cyclic nucleotide gated channel alpha 2	238	Helical; Name=H3; (Potential).				response to stimulus|sensory perception of smell	intracellular cyclic nucleotide activated cation channel complex	cAMP binding|intracellular cAMP activated cation channel activity			breast(3)	3	Acute lymphoblastic leukemia(192;6.56e-05)					ATTTTGCTGTGGACATCCACA	0.517													3	42	---	---	---	---	PASS
USP9Y	8287	broad.mit.edu	37	Y	14959215	14959215	+	Missense_Mutation	SNP	C	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrY:14959215C>A	uc004fst.1	+	42	7972	c.7027C>A	c.(7027-7029)CAA>AAA	p.Q2343K	USP9Y_uc010nwu.1_RNA	NM_004654	NP_004645	O00507	USP9Y_HUMAN	ubiquitin specific protease 9, Y-linked	2343					BMP signaling pathway|protein deubiquitination|spermatogenesis|transforming growth factor beta receptor signaling pathway|ubiquitin-dependent protein catabolic process	cytoplasm	co-SMAD binding|ubiquitin thiolesterase activity|ubiquitin-specific protease activity				0						TCTACTTTTCCAAATTTTACT	0.333													6	74	---	---	---	---	PASS
CACHD1	57685	broad.mit.edu	37	1	65141677	65141679	+	Intron	DEL	TAA	-	-	rs71742501		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:65141677_65141679delTAA	uc001dbo.1	+						CACHD1_uc001dbp.1_Intron|CACHD1_uc001dbq.1_Intron|CACHD1_uc010opa.1_Intron	NM_020925	NP_065976	Q5VU97	CAHD1_HUMAN	cache domain containing 1						calcium ion transport	integral to membrane				ovary(2)	2						GTAAaataattaataataataat	0.305													7	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	1	97144991	97144991	+	IGR	DEL	C	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:97144991delC								None (None upstream) : PTBP2 (42184 downstream)																							TGTACATCTGCCTATATTCCT	0.428													16	7	---	---	---	---	
PDE4DIP	9659	broad.mit.edu	37	1	144851694	144851695	+	3'UTR	INS	-	AG	AG			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:144851694_144851695insAG	uc001elw.3	-	44					NBPF10_uc009wir.2_Intron|NBPF9_uc010oye.1_Intron|NBPF9_uc010oyf.1_Intron|NBPF9_uc010oyg.1_Intron|PDE4DIP_uc001elk.1_Intron|PDE4DIP_uc001ell.1_Intron|PDE4DIP_uc001elm.3_Intron|PDE4DIP_uc001eln.3_Intron|PDE4DIP_uc001elo.2_Intron|PDE4DIP_uc001elx.3_3'UTR|PDE4DIP_uc001elv.3_3'UTR	NM_014644	NP_055459	Q5VU43	MYOME_HUMAN	phosphodiesterase 4D interacting protein isoform						cellular protein complex assembly	centrosome|Golgi apparatus|myofibril|nucleus	enzyme binding			ovary(4)|haematopoietic_and_lymphoid_tissue(1)	5				Colorectal(2;0.0829)|COAD - Colon adenocarcinoma(2;0.126)		AGAATTTCAACAGAGTTGGTCT	0.455			T	PDGFRB	MPD								4	2	---	---	---	---	
RAB3GAP2	25782	broad.mit.edu	37	1	220332835	220332836	+	Intron	INS	-	A	A	rs139131833	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:220332835_220332836insA	uc010puk.1	-						RAB3GAP2_uc001hmf.2_Intron|RAB3GAP2_uc001hmg.2_Intron|RAB3GAP2_uc001hmh.2_Intron	NM_012414	NP_036546	Q9H2M9	RBGPR_HUMAN	rab3 GTPase-activating protein, non-catalytic						intracellular protein transport	cytoplasm|soluble fraction	GTPase activator activity|protein heterodimerization activity			central_nervous_system(1)	1				GBM - Glioblastoma multiforme(131;0.0443)		GCACAAATAATAAAAAGTAACC	0.277													9	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	3	40418599	40418600	+	IGR	INS	-	G	G			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:40418599_40418600insG								EIF1B (64686 upstream) : ENTPD3 (10073 downstream)																							aggggaggggagggagggagga	0.000													2	4	---	---	---	---	
CHIC2	26511	broad.mit.edu	37	4	54876121	54876122	+	3'UTR	INS	-	A	A	rs145864126	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:54876121_54876122insA	uc003haj.1	-	6					PDGFRA_uc003haa.2_Intron	NM_012110	NP_036242	Q9UKJ5	CHIC2_HUMAN	cysteine-rich hydrophobic domain 2							plasma membrane	protein binding			central_nervous_system(1)	1	all_cancers(7;0.0193)|all_neural(26;0.0209)|Lung NSC(11;0.0281)|Glioma(25;0.08)		LUSC - Lung squamous cell carcinoma(32;0.00216)			TGCGGTTATTTaaaaaaaaaac	0.317			T	ETV6	AML								4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	5	37086022	37086022	+	IGR	DEL	A	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:37086022delA								NIPBL (20102 upstream) : C5orf42 (20308 downstream)																							AATTAATAGGAAAAAAAAaaa	0.204													4	2	---	---	---	---	
CHD1	1105	broad.mit.edu	37	5	98204056	98204056	+	Intron	DEL	G	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:98204056delG	uc003knf.2	-						CHD1_uc010jbn.2_Intron	NM_001270	NP_001261	O14646	CHD1_HUMAN	chromodomain helicase DNA binding protein 1						regulation of transcription from RNA polymerase II promoter|transcription, DNA-dependent	cytoplasm|nucleus	ATP binding|ATP-dependent DNA helicase activity|DNA binding|methylated histone residue binding			lung(2)|ovary(1)|breast(1)|pancreas(1)	5		all_cancers(142;5.36e-08)|all_epithelial(76;6.97e-11)|Lung NSC(167;0.000693)|Prostate(80;0.000986)|all_lung(232;0.00119)|Ovarian(225;0.024)|Colorectal(57;0.117)		COAD - Colon adenocarcinoma(37;0.0717)	Epirubicin(DB00445)	aaaaaaaaaaGACACCCTTCA	0.129													3	3	---	---	---	---	
RHAG	6005	broad.mit.edu	37	6	49604650	49604650	+	5'Flank	DEL	A	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:49604650delA	uc003ozk.3	-						RHAG_uc010jzl.2_5'Flank|RHAG_uc010jzm.2_5'Flank	NM_000324	NP_000315	Q02094	RHAG_HUMAN	Rh-associated glycoprotein						carbon dioxide transport|cellular ion homeostasis	integral to plasma membrane	ammonia transmembrane transporter activity|ammonium transmembrane transporter activity|ankyrin binding			breast(1)|skin(1)	2	Lung NSC(77;0.0255)					ACATCACAAGAAAAAAAAAAT	0.403													4	2	---	---	---	---	
ADCYAP1R1	117	broad.mit.edu	37	7	31144657	31144657	+	Intron	DEL	G	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:31144657delG	uc003tca.1	+						ADCYAP1R1_uc003tcb.1_Intron|ADCYAP1R1_uc003tcc.1_Intron|ADCYAP1R1_uc003tcd.1_Intron|ADCYAP1R1_uc003tce.1_Intron|uc003tcg.2_5'Flank	NM_001118	NP_001109	P41586	PACR_HUMAN	adenylate cyclase activating polypeptide 1						activation of adenylate cyclase activity|cell differentiation|nerve growth factor receptor signaling pathway|spermatogenesis	integral to plasma membrane	vasoactive intestinal polypeptide receptor activity			ovary(1)	1						ACTGAGAGGAGGGGCTGGTCA	0.597													9	4	---	---	---	---	
ADCK2	90956	broad.mit.edu	37	7	140370352	140370352	+	5'Flank	DEL	C	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:140370352delC	uc003vvy.1	+						ADCK2_uc003vvz.2_5'Flank	NM_052853	NP_443085	Q7Z695	ADCK2_HUMAN	aarF domain containing kinase 2							integral to membrane	ATP binding|protein serine/threonine kinase activity				0	Melanoma(164;0.00956)					TGGTCACCCTCCCCCGCATTC	0.537													4	2	---	---	---	---	
EPB49	2039	broad.mit.edu	37	8	21931142	21931142	+	Intron	DEL	A	-	-	rs143269534		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:21931142delA	uc011kyt.1	+						EPB49_uc010ltl.2_Intron|EPB49_uc011kys.1_Intron|EPB49_uc010ltn.2_Intron|EPB49_uc011kyu.1_Intron|EPB49_uc011kyv.1_Intron|EPB49_uc010ltq.2_Intron	NM_001114136	NP_001107608	Q08495	DEMA_HUMAN	erythrocyte membrane protein band 4.9 isoform 1						actin filament bundle assembly|actin filament capping	actin cytoskeleton|nucleus	actin binding			central_nervous_system(1)	1				Colorectal(74;9.05e-05)|READ - Rectum adenocarcinoma(5;0.0276)|COAD - Colon adenocarcinoma(73;0.0631)		accctgtctcaaaaaaaaaaa	0.119													4	5	---	---	---	---	
CNTLN	54875	broad.mit.edu	37	9	17466939	17466939	+	Intron	DEL	G	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:17466939delG	uc003zmz.2	+						CNTLN_uc003zmy.2_Intron|CNTLN_uc010mio.2_Intron	NM_017738	NP_060208	Q9NXG0	CNTLN_HUMAN	centlein isoform 1							centriole|membrane	two-component sensor activity			pancreas(1)	1				GBM - Glioblastoma multiforme(50;6.14e-10)		TAGGCAGATAGGCAGTAGCCT	0.353													18	9	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	40479758	40479758	+	IGR	DEL	A	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:40479758delA								FAM74A1 (572518 upstream) : FAM75A3 (220533 downstream)																							CATTAAATTGAAAAAAAAAAA	0.413													4	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	43840028	43840029	+	Intron	DEL	TT	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:43840028_43840029delTT	uc004acz.1	+											Homo sapiens cDNA FLJ30083 fis, clone BGGI12001097, weakly similar to Homo sapiens contactin associated protein (Caspr) mRNA.																		TGGGGGCATCTTTTTTTTTTTT	0.436													6	3	---	---	---	---	
KIAA1274	27143	broad.mit.edu	37	10	72245966	72245967	+	Intron	DEL	TT	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:72245966_72245967delTT	uc001jrd.3	+							NM_014431	NP_055246	Q9ULE6	PALD_HUMAN	KIAA1274											ovary(2)|central_nervous_system(1)	3						AGTCAATATCTTTTTTTTTTTT	0.431													6	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	11	48967951	48967951	+	IGR	DEL	A	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:48967951delA								OR4A47 (456679 upstream) : FOLH1 (200237 downstream)																							AGGAGCTCCTAAAAAAAATGC	0.398													12	7	---	---	---	---	
KBTBD3	143879	broad.mit.edu	37	11	105929470	105929470	+	Intron	DEL	T	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:105929470delT	uc001pja.2	-						KBTBD3_uc001pjb.2_Intron|KBTBD3_uc009yxm.2_Intron	NM_198439	NP_940841	Q8NAB2	KBTB3_HUMAN	BTB and kelch domain containing 3											ovary(1)|central_nervous_system(1)	2		Melanoma(852;0.000878)|Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.0017)|Breast(348;0.0321)		BRCA - Breast invasive adenocarcinoma(274;5.43e-05)|Epithelial(105;0.00418)|all cancers(92;0.0299)		TTTGTTTTTGTTTTTTTTTTT	0.144													4	2	---	---	---	---	
CD9	928	broad.mit.edu	37	12	6341859	6341859	+	Frame_Shift_Del	DEL	C	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:6341859delC	uc001qnp.1	+	4	681	c.237delC	c.(235-237)TGCfs	p.C79fs	CD9_uc010seu.1_Frame_Shift_Del_p.C79fs|CD9_uc010sev.1_Frame_Shift_Del_p.C79fs|CD9_uc001qnq.1_Frame_Shift_Del_p.C79fs	NM_001769	NP_001760	P21926	CD9_HUMAN	CD9 antigen	79	Cytoplasmic (Potential).			C->A: Loss of palmitoylation; when associated with A-9; A-78; A-87; A-218 and A-219.	cell adhesion|cellular component movement|fusion of sperm to egg plasma membrane|paranodal junction assembly|platelet activation|platelet degranulation	integral to plasma membrane|platelet alpha granule membrane				ovary(1)	1						TGGGCTGCTGCGGGGCTGTGC	0.622													4	2	---	---	---	---	
PA2G4	5036	broad.mit.edu	37	12	56505493	56505494	+	Intron	INS	-	AT	AT	rs143474707	by1000genomes	TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:56505493_56505494insAT	uc001sjm.2	+						PA2G4_uc009zol.2_Intron|PA2G4_uc009zom.2_Intron	NM_006191	NP_006182	Q9UQ80	PA2G4_HUMAN	ErbB3-binding protein 1						cell cycle arrest|cell proliferation|negative regulation of transcription, DNA-dependent|regulation of translation|rRNA processing	cytoplasm|nucleolus|ribonucleoprotein complex	DNA binding|RNA binding|sequence-specific DNA binding transcription factor activity|ubiquitin protein ligase binding				0			OV - Ovarian serous cystadenocarcinoma(18;0.0739)			tggattttaaaatatatataTA	0.035													5	4	---	---	---	---	
DUSP6	1848	broad.mit.edu	37	12	89743425	89743427	+	Intron	DEL	ATA	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:89743425_89743427delATA	uc001tay.2	-						DUSP6_uc001taz.2_Intron	NM_001946	NP_001937	Q16828	DUS6_HUMAN	dual specificity phosphatase 6 isoform a						dorsal/ventral pattern formation|inactivation of MAPK activity|innate immune response|MyD88-dependent toll-like receptor signaling pathway|MyD88-independent toll-like receptor signaling pathway|negative regulation of ERK1 and ERK2 cascade|nerve growth factor receptor signaling pathway|positive regulation of apoptosis|regulation of endodermal cell fate specification|regulation of fibroblast growth factor receptor signaling pathway|regulation of heart growth|response to nitrosative stress|stress-activated MAPK cascade|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 3 signaling pathway|toll-like receptor 4 signaling pathway	cytosol|nucleoplasm	MAP kinase tyrosine/serine/threonine phosphatase activity|protein tyrosine phosphatase activity				0						ACTTGAAAACATAATAATAATAA	0.379													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	14	20086237	20086237	+	IGR	DEL	T	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20086237delT								P704P (65965 upstream) : OR4Q3 (129350 downstream)																							GGTGTGTGTGTGGGGGGGTAT	0.388													3	3	---	---	---	---	
SDCCAG1	9147	broad.mit.edu	37	14	50050222	50050223	+	Intron	INS	-	A	A			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:50050222_50050223insA	uc010anj.1	-						RPS29_uc001wwl.2_Intron	NM_004713	NP_004704	O60524	NEMF_HUMAN	serologically defined colon cancer antigen 1							cytoplasm|nucleus					0	all_epithelial(31;0.000822)|Breast(41;0.0117)	all_lung(585;1.02e-05)		OV - Ovarian serous cystadenocarcinoma(311;5.99e-34)		gactcagtctcaaaaaaaaaaa	0.109													4	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	14	99596010	99596011	+	IGR	DEL	TC	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:99596010_99596011delTC								C14orf177 (411913 upstream) : BCL11B (39616 downstream)																							TCTATCTGTGTCACTCTCCCTC	0.500													4	2	---	---	---	---	
EML1	2009	broad.mit.edu	37	14	100332058	100332059	+	Intron	INS	-	A	A	rs112436887		TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:100332058_100332059insA	uc001ygs.2	+						EML1_uc010avt.1_Intron|EML1_uc010tww.1_Intron|EML1_uc001ygq.2_Intron|EML1_uc001ygr.2_Intron	NM_004434	NP_004425	O00423	EMAL1_HUMAN	echinoderm microtubule associated protein like 1							cytoplasm|microtubule|microtubule associated complex	calcium ion binding|protein binding			large_intestine(2)|pancreas(1)|ovary(1)|skin(1)	5		Melanoma(154;0.0879)|all_epithelial(191;0.216)				TATTACTTTTTAAAATGACATT	0.342													4	2	---	---	---	---	
TUBGCP5	114791	broad.mit.edu	37	15	22833557	22833557	+	Frame_Shift_Del	DEL	G	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22833557delG	uc001yur.3	+	1	163	c.33delG	c.(31-33)TTGfs	p.L11fs	TUBGCP5_uc001yuq.2_Frame_Shift_Del_p.L11fs	NM_052903	NP_443135	Q96RT8	GCP5_HUMAN	tubulin, gamma complex associated protein 5	11					G2/M transition of mitotic cell cycle|microtubule nucleation	centrosome|cytosol|gamma-tubulin ring complex|microtubule|spindle pole	microtubule binding			skin(1)	1		all_cancers(20;2.26e-25)|all_epithelial(15;2.1e-22)|Lung NSC(15;3.36e-17)|all_lung(15;1.04e-16)|Breast(32;0.000776)|Colorectal(260;0.0488)		all cancers(64;2.86e-06)|Epithelial(43;2.63e-05)|BRCA - Breast invasive adenocarcinoma(123;0.000949)		GGAGTCGGTTGGACGCGCAGC	0.701													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	45902861	45902861	+	IGR	DEL	A	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:45902861delA								PLDN (953 upstream) : SQRDL (20485 downstream)																							Ctattttattaaaaaaaaaaa	0.338													4	2	---	---	---	---	
SLCO3A1	28232	broad.mit.edu	37	15	92647823	92647823	+	Intron	DEL	G	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:92647823delG	uc002bqx.2	+						SLCO3A1_uc002bqy.2_Intron|SLCO3A1_uc010boc.1_Intron|SLCO3A1_uc002bqz.1_Intron	NM_013272	NP_037404	Q9UIG8	SO3A1_HUMAN	solute carrier organic anion transporter family,						sodium-independent organic anion transport	integral to membrane|plasma membrane	sodium-independent organic anion transmembrane transporter activity			skin(1)	1	Lung NSC(78;0.0158)|all_lung(78;0.0255)		BRCA - Breast invasive adenocarcinoma(143;0.0841)			GGATTGGGATGGGGGTGATGA	0.592													4	2	---	---	---	---	
ATP2C2	9914	broad.mit.edu	37	16	84456439	84456440	+	Intron	INS	-	T	T			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84456439_84456440insT	uc002fhx.2	+						ATP2C2_uc010chj.2_Intron|ATP2C2_uc002fhy.2_Intron|ATP2C2_uc002fhz.2_Intron	NM_014861	NP_055676	O75185	AT2C2_HUMAN	ATPase, Ca++ transporting, type 2C, member 2						ATP biosynthetic process	Golgi membrane|integral to membrane	ATP binding|calcium-transporting ATPase activity|metal ion binding|protein binding			breast(1)|central_nervous_system(1)	2						TAAACATTTAAttttttttttt	0.178													2	4	---	---	---	---	
AXIN2	8313	broad.mit.edu	37	17	63550397	63550398	+	Intron	DEL	TC	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:63550397_63550398delTC	uc002jfi.2	-						AXIN2_uc010den.1_Intron|AXIN2_uc002jfh.2_Intron	NM_004655	NP_004646	Q9Y2T1	AXIN2_HUMAN	axin 2						cellular protein localization|cellular response to organic cyclic compound|dorsal/ventral axis specification|intramembranous ossification|maintenance of DNA repeat elements|mRNA stabilization|negative regulation of canonical Wnt receptor signaling pathway|negative regulation of catenin import into nucleus|negative regulation of cell proliferation|negative regulation of osteoblast differentiation|odontogenesis|positive regulation of cell death|positive regulation of epithelial to mesenchymal transition|positive regulation of protein phosphorylation|regulation of centromeric sister chromatid cohesion|regulation of mismatch repair|Wnt receptor signaling pathway involved in somitogenesis	Axin-APC-beta-catenin-GSK3B complex|cell cortex|centrosome|cytoplasmic membrane-bounded vesicle|cytoplasmic microtubule|nucleus|plasma membrane|postsynaptic density	armadillo repeat domain binding|beta-catenin binding|GTPase activator activity|protein kinase binding|signal transducer activity|ubiquitin protein ligase binding			central_nervous_system(1)|skin(1)	2						cACGTTCCCTTCTCAAAACAAT	0.366									Oligodontia_Ectodermal_Dysplasia_and_Colorectal_Polyp_syndrome				4	2	---	---	---	---	
AFG3L2	10939	broad.mit.edu	37	18	12337643	12337645	+	Intron	DEL	CAG	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:12337643_12337645delCAG	uc002kqz.1	-							NM_006796	NP_006787	Q9Y4W6	AFG32_HUMAN	AFG3 ATPase family gene 3-like 2						cell death|protein catabolic process|proteolysis	integral to membrane	ATP binding|metalloendopeptidase activity|nucleoside-triphosphatase activity|unfolded protein binding|zinc ion binding				0					Adenosine triphosphate(DB00171)	TCTGTGTAGCcagcagcagcagc	0.384													9	4	---	---	---	---	
NFIC	4782	broad.mit.edu	37	19	3462956	3462958	+	3'UTR	DEL	AGA	-	-			TCGA-85-6561-01A-11D-1817-08	TCGA-85-6561-10A-01D-1817-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:3462956_3462958delAGA	uc010xhi.1	+	11					NFIC_uc002lxo.2_3'UTR|NFIC_uc010xhh.1_3'UTR|NFIC_uc002lxp.2_3'UTR|NFIC_uc010xhj.1_3'UTR	NM_205843	NP_995315	P08651	NFIC_HUMAN	nuclear factor I/C isoform 2						DNA replication|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription from RNA polymerase II promoter|transcription from RNA polymerase II promoter	nucleus	DNA binding|sequence-specific DNA binding transcription factor activity				0		Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;7.8e-05)|Epithelial(107;2.94e-108)|BRCA - Breast invasive adenocarcinoma(158;0.00154)|STAD - Stomach adenocarcinoma(1328;0.191)		aaacaaaggcagaagaagaagaa	0.404													4	2	---	---	---	---	
