Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	filter
PDPN	10630	broad.mit.edu	37	1	13936955	13936955	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:13936955C>T	uc001avd.2	+	3	552	c.503C>T	c.(502-504)GCG>GTG	p.A168V	PDPN_uc001avc.2_Missense_Mutation_p.A168V|PDPN_uc009vob.2_Missense_Mutation_p.A50V|PDPN_uc009voc.2_Missense_Mutation_p.A50V|PDPN_uc001ave.2_Missense_Mutation_p.A50V|PDPN_uc001avf.2_Missense_Mutation_p.A50V	NM_006474	NP_006465	Q86YL7	PDPN_HUMAN	lung type-I cell membrane-associated	92	Extracellular (Potential).				cell morphogenesis|lymphangiogenesis|regulation of cell shape	filopodium membrane|integral to plasma membrane|lamellipodium membrane|microvillus membrane|ruffle membrane				ovary(2)	2	Ovarian(185;0.249)	all_lung(284;2.29e-05)|Lung NSC(185;4.37e-05)|Renal(390;0.000147)|Breast(348;0.000162)|Colorectal(325;0.00058)|Ovarian(437;0.00965)|Hepatocellular(190;0.0245)|Myeloproliferative disorder(586;0.0255)	GBM - Glioblastoma multiforme(2;0.00182)	UCEC - Uterine corpus endometrioid carcinoma (279;0.00969)|Colorectal(212;4.48e-06)|COAD - Colon adenocarcinoma(227;0.000194)|BRCA - Breast invasive adenocarcinoma(304;0.000347)|Kidney(185;0.00087)|KIRC - Kidney renal clear cell carcinoma(229;0.0027)|STAD - Stomach adenocarcinoma(313;0.00802)|READ - Rectum adenocarcinoma(331;0.0678)		ACAGTCCACGCGCAAGAACAA	0.507													23	104	---	---	---	---	PASS
MST1P2	11209	broad.mit.edu	37	1	16974972	16974972	+	RNA	SNP	C	T	T	rs58464479	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:16974972C>T	uc010och.1	+	7		c.1432C>T			MST1P2_uc001azk.2_RNA|MST1P2_uc001azl.3_RNA|MST1P2_uc009vox.2_RNA|MST1P2_uc001azm.3_RNA	NR_027504				Homo sapiens cDNA FLJ43241 fis, clone HEART1000010, weakly  similar to Hepatocyte growth factor-like protein precursor.												0						GGACCAGAGCCTGGAAATGGT	0.637													6	32	---	---	---	---	PASS
SFRS4	6429	broad.mit.edu	37	1	29481370	29481370	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:29481370C>A	uc001bro.2	-	4	789	c.416G>T	c.(415-417)CGC>CTC	p.R139L	SFRS4_uc010ofy.1_Intron|SFRS4_uc009vtp.2_RNA	NM_005626	NP_005617	Q08170	SRSF4_HUMAN	splicing factor, arginine/serine-rich 4	139	RRM 2.				mRNA 3'-end processing|mRNA export from nucleus|nuclear mRNA splicing, via spliceosome|termination of RNA polymerase II transcription	nuclear speck	nucleotide binding|RNA binding				0		Colorectal(325;0.00161)|Breast(348;0.0364)|Myeloproliferative disorder(586;0.0393)|all_neural(195;0.0529)|Lung NSC(340;0.0654)|all_lung(284;0.074)|Ovarian(437;0.104)|Medulloblastoma(700;0.151)		Colorectal(126;1.01e-07)|COAD - Colon adenocarcinoma(152;6.21e-06)|STAD - Stomach adenocarcinoma(196;0.0196)|BRCA - Breast invasive adenocarcinoma(304;0.0531)|READ - Rectum adenocarcinoma(331;0.0649)|KIRC - Kidney renal clear cell carcinoma(1967;0.138)		TTCATTTTTGCGTCCCTTGTG	0.358													10	144	---	---	---	---	PASS
TNN	63923	broad.mit.edu	37	1	175046949	175046949	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:175046949G>A	uc001gkl.1	+	2	508	c.395G>A	c.(394-396)TGC>TAC	p.C132Y	TNN_uc010pmx.1_Missense_Mutation_p.C132Y	NM_022093	NP_071376	Q9UQP3	TENN_HUMAN	tenascin N precursor	132					cell growth|cell migration|signal transduction	extracellular space|proteinaceous extracellular matrix				large_intestine(5)|ovary(3)|central_nervous_system(1)	9		Breast(1374;0.000962)		KIRC - Kidney renal clear cell carcinoma(1967;0.00198)		CAGCGCTGCTGCCAGGGAGTC	0.463													10	36	---	---	---	---	PASS
CAMSAP1L1	23271	broad.mit.edu	37	1	200817766	200817766	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200817766G>A	uc001gvl.2	+	12	2172	c.1902G>A	c.(1900-1902)ATG>ATA	p.M634I	CAMSAP1L1_uc001gvk.2_Missense_Mutation_p.M623I|CAMSAP1L1_uc001gvm.2_Missense_Mutation_p.M607I	NM_203459	NP_982284	Q08AD1	CAMP2_HUMAN	calmodulin regulated spectrin-associated protein	634						cytoplasm|microtubule	protein binding			ovary(2)|large_intestine(1)|pancreas(1)	4						CTGAAACTATGGACGAAGATT	0.383													36	192	---	---	---	---	PASS
CAMSAP1L1	23271	broad.mit.edu	37	1	200817767	200817767	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:200817767G>T	uc001gvl.2	+	12	2173	c.1903G>T	c.(1903-1905)GAC>TAC	p.D635Y	CAMSAP1L1_uc001gvk.2_Missense_Mutation_p.D624Y|CAMSAP1L1_uc001gvm.2_Missense_Mutation_p.D608Y	NM_203459	NP_982284	Q08AD1	CAMP2_HUMAN	calmodulin regulated spectrin-associated protein	635						cytoplasm|microtubule	protein binding			ovary(2)|large_intestine(1)|pancreas(1)	4						TGAAACTATGGACGAAGATTC	0.388													37	192	---	---	---	---	PASS
GIGYF2	26058	broad.mit.edu	37	2	233677188	233677188	+	Silent	SNP	T	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:233677188T>C	uc002vti.3	+	20	2431	c.2094T>C	c.(2092-2094)GCT>GCC	p.A698A	GIGYF2_uc010zmj.1_Silent_p.A698A|GIGYF2_uc002vtg.2_Silent_p.A692A|GIGYF2_uc002vtj.3_Silent_p.A719A|GIGYF2_uc002vtk.3_Silent_p.A698A|GIGYF2_uc002vth.3_Silent_p.A692A|GIGYF2_uc010zmk.1_RNA|GIGYF2_uc010zml.1_Silent_p.A529A|GIGYF2_uc002vtq.3_Silent_p.A31A	NM_015575	NP_056390	Q6Y7W6	PERQ2_HUMAN	GRB10 interacting GYF protein 2 isoform b	698	Gln-rich.				cell death		protein binding			ovary(4)|central_nervous_system(3)	7		Breast(86;0.00279)|all_hematologic(139;0.00793)|Renal(207;0.0112)|Acute lymphoblastic leukemia(138;0.0182)|all_lung(227;0.0271)|Lung NSC(271;0.0839)		Epithelial(121;7.37e-16)|BRCA - Breast invasive adenocarcinoma(100;0.000472)|LUSC - Lung squamous cell carcinoma(224;0.00902)|Lung(119;0.0118)|GBM - Glioblastoma multiforme(43;0.0145)		AGCCAACAGCTTCACAGCCTA	0.378													18	76	---	---	---	---	PASS
GBX2	2637	broad.mit.edu	37	2	237076138	237076138	+	Silent	SNP	G	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:237076138G>A	uc002vvw.1	-	1	515	c.477C>T	c.(475-477)GGC>GGT	p.G159G	GBX2_uc010zng.1_Silent_p.G149G	NM_001485	NP_001476	P52951	GBX2_HUMAN	gastrulation brain homeo box 2	159				LPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSA SPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFL AKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKG -> CRPHTLTTRSPACPQASAPAWRRAWRSPLRSWPRSPAA SPRRPSTRRRQRPASSRRSRCPAAVTSTRRRRCRLTRRTAK ASWPKRARCSPSPRPRRCRLRSSGLSEGKGKTSQRWKTTRS (in Ref. 1; AAC03241).		nucleus	sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity				0		Breast(86;0.00235)|Renal(207;0.00339)|all_hematologic(139;0.00357)|all_lung(227;0.0616)|Acute lymphoblastic leukemia(138;0.0775)|Ovarian(221;0.089)|Lung NSC(271;0.179)		Epithelial(121;4.5e-25)|OV - Ovarian serous cystadenocarcinoma(60;5.16e-11)|BRCA - Breast invasive adenocarcinoma(100;3.4e-05)|Lung(119;0.00195)|LUSC - Lung squamous cell carcinoma(224;0.00471)		CGAGCAGCGAGCCCTCTTTGG	0.746													4	10	---	---	---	---	PASS
IQSEC1	9922	broad.mit.edu	37	3	12949880	12949880	+	Silent	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:12949880G>T	uc003bxt.2	-	12	2775	c.2766C>A	c.(2764-2766)CTC>CTA	p.L922L	IQSEC1_uc003bxu.3_Silent_p.L800L|IQSEC1_uc011auw.1_Silent_p.L908L	NM_014869	NP_055684	Q6DN90	IQEC1_HUMAN	IQ motif and Sec7 domain 1 isoform b	922					regulation of ARF protein signal transduction	cytoplasm|nucleus	ARF guanyl-nucleotide exchange factor activity			ovary(1)	1						GGGAGCTGCTGAGGGCGCTGC	0.637													3	33	---	---	---	---	PASS
KAT2B	8850	broad.mit.edu	37	3	20153265	20153265	+	Silent	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:20153265C>T	uc003cbq.2	+	6	1475	c.1029C>T	c.(1027-1029)CTC>CTT	p.L343L		NM_003884	NP_003875	Q92831	KAT2B_HUMAN	K(lysine) acetyltransferase 2B	343					cell cycle arrest|cellular response to insulin stimulus|chromatin remodeling|histone H3 acetylation|interspecies interaction between organisms|N-terminal peptidyl-lysine acetylation|negative regulation of cell proliferation|transcription initiation from RNA polymerase I promoter	Ada2/Gcn5/Ada3 transcription activator complex|chromatin remodeling complex|PCAF complex	cyclin-dependent protein kinase inhibitor activity|histone acetyltransferase activity|histone deacetylase binding|protein kinase binding|transcription coactivator activity|transcription factor binding			ovary(1)|central_nervous_system(1)|pancreas(1)	3						CTCTAATCCTCACTCATTTCC	0.423													19	52	---	---	---	---	PASS
PTPRG	5793	broad.mit.edu	37	3	62109908	62109908	+	Intron	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:62109908C>T	uc003dlb.2	+						PTPRG_uc003dlc.2_Intron|ID2B_uc011bfh.1_RNA	NM_002841	NP_002832	P23470	PTPRG_HUMAN	protein tyrosine phosphatase, receptor type, G						transmembrane receptor protein tyrosine kinase signaling pathway	integral to plasma membrane	identical protein binding|transmembrane receptor protein tyrosine phosphatase activity			ovary(5)|lung(2)	7				BRCA - Breast invasive adenocarcinoma(55;0.000376)|KIRC - Kidney renal clear cell carcinoma(10;0.0499)|Kidney(10;0.065)		TGTCATTTGACATTAACTCCG	0.473													11	22	---	---	---	---	PASS
KBTBD8	84541	broad.mit.edu	37	3	67054477	67054477	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:67054477G>T	uc003dmy.2	+	3	1139	c.1086G>T	c.(1084-1086)ATG>ATT	p.M362I	KBTBD8_uc011bfv.1_Intron	NM_032505	NP_115894	Q8NFY9	KBTB8_HUMAN	T-cell activation kelch repeat protein	362	Kelch 1.									ovary(2)|large_intestine(1)|breast(1)	4		Lung NSC(201;0.0765)		BRCA - Breast invasive adenocarcinoma(55;6.02e-06)|KIRC - Kidney renal clear cell carcinoma(39;0.105)|Kidney(39;0.125)		ATTTCTGGATGTATGATCATT	0.433													26	75	---	---	---	---	PASS
RPL22L1	200916	broad.mit.edu	37	3	170584196	170584196	+	Silent	SNP	A	G	G			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:170584196A>G	uc003fhc.3	-	4	431	c.342T>C	c.(340-342)GAT>GAC	p.D114D	RPL22L1_uc003fhb.3_RNA	NM_001099645	NP_001093115	Q6P5R6	RL22L_HUMAN	ribosomal protein L22-like 1	114					translation	ribosome	structural constituent of ribosome				0	all_cancers(22;1.96e-19)|all_lung(20;1.59e-15)|Lung NSC(18;7.08e-15)|Ovarian(172;0.00197)|Breast(254;0.137)		LUSC - Lung squamous cell carcinoma(14;1.1e-14)|Lung(28;2.99e-14)			ATTCATCTTCATCTTGACTAA	0.393													8	17	---	---	---	---	PASS
SLIT2	9353	broad.mit.edu	37	4	20620767	20620767	+	3'UTR	SNP	A	G	G			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:20620767A>G	uc003gpr.1	+	37					SLIT2_uc003gps.1_3'UTR	NM_004787	NP_004778	O94813	SLIT2_HUMAN	slit homolog 2 precursor						apoptosis involved in luteolysis|axon extension involved in axon guidance|branching morphogenesis of a tube|cell migration involved in sprouting angiogenesis|cellular response to heparin|cellular response to hormone stimulus|chemorepulsion involved in postnatal olfactory bulb interneuron migration|corticospinal neuron axon guidance through spinal cord|induction of negative chemotaxis|motor axon guidance|negative regulation of actin filament polymerization|negative regulation of cell growth|negative regulation of cellular response to growth factor stimulus|negative regulation of chemokine-mediated signaling pathway|negative regulation of endothelial cell migration|negative regulation of lamellipodium assembly|negative regulation of mononuclear cell migration|negative regulation of neutrophil chemotaxis|negative regulation of protein phosphorylation|negative regulation of retinal ganglion cell axon guidance|negative regulation of small GTPase mediated signal transduction|negative regulation of smooth muscle cell chemotaxis|negative regulation of vascular permeability|positive regulation of apoptosis|positive regulation of axonogenesis|response to cortisol stimulus|retinal ganglion cell axon guidance|Roundabout signaling pathway|ureteric bud development	cell surface|cytoplasm|extracellular space|plasma membrane	calcium ion binding|GTPase inhibitor activity|heparin binding|laminin-1 binding|protein homodimerization activity|proteoglycan binding|Roundabout binding			central_nervous_system(4)|skin(4)|ovary(3)	11						TTATGAGAATAAAGACTTTTT	0.303													5	11	---	---	---	---	PASS
FRAS1	80144	broad.mit.edu	37	4	79369243	79369243	+	Missense_Mutation	SNP	T	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:79369243T>C	uc003hlb.2	+	44	6487	c.6047T>C	c.(6046-6048)CTG>CCG	p.L2016P		NM_025074	NP_079350	Q86XX4	FRAS1_HUMAN	Fraser syndrome 1	2015	CSPG 8.|Extracellular (Potential).				cell communication	integral to membrane|plasma membrane	metal ion binding			large_intestine(5)	5						TCTGAGCCTCTGGAGAATGGG	0.468													14	33	---	---	---	---	PASS
ELF2	1998	broad.mit.edu	37	4	139983329	139983329	+	Intron	SNP	T	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:139983329T>C	uc003ihp.1	-						ELF2_uc003ihm.1_Intron|ELF2_uc003ihn.1_Intron|ELF2_uc003iho.1_Intron|ELF2_uc011chc.1_5'UTR	NM_201999	NP_973728	Q15723	ELF2_HUMAN	E74-like factor 2 (ets domain transcription						negative regulation of transcription, DNA-dependent|positive regulation of transcription, DNA-dependent|regulation of transcription from RNA polymerase II promoter	cytoplasm	protein binding|sequence-specific DNA binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|sequence-specific DNA binding transcription factor activity			ovary(1)|skin(1)	2	all_hematologic(180;0.162)					TTGTTTCTACttttttttttt	0.109													2	3	---	---	---	---	PASS
TERT	7015	broad.mit.edu	37	5	1282650	1282650	+	Missense_Mutation	SNP	C	G	G			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:1282650C>G	uc003jcb.1	-	3	1721	c.1663G>C	c.(1663-1665)GAG>CAG	p.E555Q	TERT_uc003jbz.1_5'UTR|TERT_uc003jca.1_Missense_Mutation_p.E555Q|TERT_uc003jcc.1_Missense_Mutation_p.E555Q|TERT_uc003jcd.1_RNA|TERT_uc003jce.1_RNA	NM_198253	NP_937983	O14746	TERT_HUMAN	telomerase reverse transcriptase isoform 1	555					anti-apoptosis|DNA strand elongation|replicative senescence|telomere formation via telomerase|telomere maintenance via telomerase	cytoplasm|nucleolus|PML body|telomerase holoenzyme complex	protein homodimerization activity|telomeric DNA binding|telomeric RNA binding|telomeric template RNA reverse transcriptase activity			lung(7)|ovary(2)|central_nervous_system(2)|skin(1)	12	all_cancers(3;3.17e-16)|Lung NSC(6;8.55e-15)|all_lung(6;7.2e-14)|all_epithelial(6;1.87e-10)		Epithelial(17;0.00105)|all cancers(22;0.00178)|OV - Ovarian serous cystadenocarcinoma(19;0.00239)|Lung(60;0.185)			CTGAGCAGCTCGACGACGTAC	0.527									TERT_Mutation-Associated_Haematological_Disorders|Congenital_Dyskeratosis|Pulmonary_Fibrosis_Idiopathic				12	86	---	---	---	---	PASS
ANKH	56172	broad.mit.edu	37	5	14711323	14711323	+	Nonsense_Mutation	SNP	T	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:14711323T>A	uc003jfm.3	-	12	1793	c.1462A>T	c.(1462-1464)AGA>TGA	p.R488*	ANKH_uc003jfl.3_Nonsense_Mutation_p.R201*	NM_054027	NP_473368	Q9HCJ1	ANKH_HUMAN	progressive ankylosis protein	488	Cytoplasmic (Potential).				locomotory behavior|regulation of bone mineralization|skeletal system development	integral to plasma membrane|outer membrane	inorganic diphosphate transmembrane transporter activity|inorganic phosphate transmembrane transporter activity			upper_aerodigestive_tract(1)	1						TTCTCCTCTCTCATTTCCACG	0.527													62	238	---	---	---	---	PASS
POC5	134359	broad.mit.edu	37	5	74981284	74981284	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:74981284C>A	uc003keh.3	-	10	1352	c.1155G>T	c.(1153-1155)AAG>AAT	p.K385N	POC5_uc010izu.2_Missense_Mutation_p.K268N|POC5_uc003keg.3_Missense_Mutation_p.K360N	NM_001099271	NP_001092741	Q8NA72	POC5_HUMAN	proteome of centriole 5 isoform 1	385					cell cycle	centriole				lung(1)	1						CATACTCTTCCTTTTTATTAT	0.388													34	162	---	---	---	---	PASS
PCDHA5	56143	broad.mit.edu	37	5	140201665	140201665	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:140201665G>A	uc003lhl.2	+	1	305	c.305G>A	c.(304-306)AGC>AAC	p.S102N	PCDHA1_uc003lha.2_Intron|PCDHA1_uc003lhb.2_Intron|PCDHA2_uc003lhd.2_Intron|PCDHA3_uc003lhf.2_Intron|PCDHA4_uc003lhi.2_Intron|PCDHA4_uc003lhh.1_Intron|PCDHA5_uc003lhk.1_Missense_Mutation_p.S102N|PCDHA5_uc003lhj.1_Missense_Mutation_p.S102N	NM_018908	NP_061731	Q9Y5H7	PCDA5_HUMAN	protocadherin alpha 5 isoform 1 precursor	102	Extracellular (Potential).|Cadherin 1.				homophilic cell adhesion|nervous system development	integral to plasma membrane	calcium ion binding|protein binding			ovary(1)|breast(1)|skin(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			GCGGAGTGCAGCATCCACCTG	0.582													28	157	---	---	---	---	PASS
MUC21	394263	broad.mit.edu	37	6	30954884	30954884	+	Missense_Mutation	SNP	G	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:30954884G>C	uc003nsh.2	+	2	1183	c.932G>C	c.(931-933)GGG>GCG	p.G311A	MUC21_uc003nsi.1_RNA	NM_001010909	NP_001010909	Q5SSG8	MUC21_HUMAN	mucin 21 precursor	311	Ser-rich.|28 X 15 AA approximate tandem repeats.|19.|Extracellular (Potential).					integral to membrane|plasma membrane				ovary(1)|skin(1)	2						ACCTCCAGTGGGGCCAACACA	0.607													41	181	---	---	---	---	PASS
VPS41	27072	broad.mit.edu	37	7	38857441	38857441	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:38857441C>A	uc003tgy.2	-	7	452	c.426G>T	c.(424-426)AAG>AAT	p.K142N	VPS41_uc003tgz.2_Missense_Mutation_p.K117N|VPS41_uc010kxn.2_Missense_Mutation_p.K142N	NM_014396	NP_055211	P49754	VPS41_HUMAN	vacuolar protein sorting 41 isoform 1	142					Golgi vesicle transport|intracellular protein transport|vesicle-mediated transport	cytosol|Golgi-associated vesicle|HOPS complex|membrane fraction	zinc ion binding			skin(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)	4						TCACAAACTGCTTGCAACTGG	0.443													21	136	---	---	---	---	PASS
TRRAP	8295	broad.mit.edu	37	7	98601971	98601971	+	Missense_Mutation	SNP	G	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:98601971G>C	uc003upp.2	+	67	10635	c.10426G>C	c.(10426-10428)GCT>CCT	p.A3476P	TRRAP_uc011kis.1_Missense_Mutation_p.A3447P|TRRAP_uc003upr.2_Missense_Mutation_p.A3182P	NM_003496	NP_003487	Q9Y4A5	TRRAP_HUMAN	transformation/transcription domain-associated	3476					histone deubiquitination|histone H2A acetylation|histone H4 acetylation|regulation of transcription, DNA-dependent|transcription, DNA-dependent	NuA4 histone acetyltransferase complex|PCAF complex|STAGA complex|transcription factor TFTC complex	phosphotransferase activity, alcohol group as acceptor|protein binding|transcription cofactor activity			ovary(9)|large_intestine(8)|central_nervous_system(6)|skin(6)|stomach(5)|upper_aerodigestive_tract(1)|lung(1)|liver(1)	37	all_cancers(62;6.96e-09)|all_epithelial(64;4.86e-09)|Lung NSC(181;0.01)|all_lung(186;0.016)|Esophageal squamous(72;0.0274)		STAD - Stomach adenocarcinoma(171;0.215)			GGCACAGACAGCTGAAGTGGA	0.488													27	189	---	---	---	---	PASS
DNAJC2	27000	broad.mit.edu	37	7	102960089	102960089	+	Silent	SNP	T	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:102960089T>A	uc003vbo.2	-	12	1460	c.1209A>T	c.(1207-1209)ACA>ACT	p.T403T	PMPCB_uc011kll.1_Intron|DNAJC2_uc003vbn.2_Silent_p.T28T|DNAJC2_uc010lix.2_Intron|DNAJC2_uc003vbp.2_Silent_p.T28T	NM_014377	NP_055192	Q99543	DNJC2_HUMAN	DnaJ (Hsp40) homolog, subfamily C, member 2	403					'de novo' cotranslational protein folding|chromatin modification|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytosol|nuclear membrane	chromatin binding|DNA binding|histone binding|Hsp70 protein binding|ubiquitin binding			kidney(1)	1						CTACTTCTTTTGTGCATGATG	0.358													23	139	---	---	---	---	PASS
KEL	3792	broad.mit.edu	37	7	142655413	142655413	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:142655413G>A	uc003wcb.2	-	5	713	c.503C>T	c.(502-504)CCC>CTC	p.P168L		NM_000420	NP_000411	P23276	KELL_HUMAN	Kell blood group, metallo-endopeptidase	168	Extracellular (Potential).				proteolysis|vasoconstriction	integral to membrane|plasma membrane	metal ion binding|metalloendopeptidase activity|protein binding			ovary(3)|central_nervous_system(1)	4	Melanoma(164;0.059)					TTGTCTGAGGGGACCAGTCCC	0.473													29	157	---	---	---	---	PASS
DPP6	1804	broad.mit.edu	37	7	154172047	154172047	+	Missense_Mutation	SNP	A	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:154172047A>C	uc003wlk.2	+	3	511	c.382A>C	c.(382-384)AAG>CAG	p.K128Q	DPP6_uc003wli.2_Missense_Mutation_p.K64Q|DPP6_uc003wlj.2_Missense_Mutation_p.K128Q|DPP6_uc010lqh.1_Missense_Mutation_p.K66Q|DPP6_uc003wlm.2_Missense_Mutation_p.K66Q|DPP6_uc011kvq.1_Missense_Mutation_p.K66Q	NM_130797	NP_570629	P42658	DPP6_HUMAN	dipeptidyl-peptidase 6 isoform 1	128	Extracellular (Potential).				cell death|proteolysis	integral to membrane	dipeptidyl-peptidase activity|serine-type peptidase activity			pancreas(3)|breast(1)	4	all_neural(206;0.181)	all_hematologic(28;0.0044)|all_lung(21;0.0176)|Lung NSC(21;0.0204)	OV - Ovarian serous cystadenocarcinoma(82;0.0562)			TCTGTCTCAAAAGAAGAAGGT	0.378													11	97	---	---	---	---	PASS
WNK2	65268	broad.mit.edu	37	9	96002217	96002217	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:96002217G>T	uc004ati.1	+	6	1501	c.1501G>T	c.(1501-1503)GAC>TAC	p.D501Y	WNK2_uc011lud.1_Missense_Mutation_p.D501Y|WNK2_uc004atj.2_Missense_Mutation_p.D501Y|WNK2_uc004atk.2_Missense_Mutation_p.D138Y|WNK2_uc010mrc.1_Missense_Mutation_p.D501Y|WNK2_uc010mrd.1_Missense_Mutation_p.D138Y	NM_006648	NP_006639	Q9Y3S1	WNK2_HUMAN	WNK lysine deficient protein kinase 2	501					intracellular protein kinase cascade		ATP binding|protein binding|protein serine/threonine kinase activity			lung(4)|stomach(3)|ovary(2)|large_intestine(1)|central_nervous_system(1)|breast(1)	12						GTTCACCTTCGACCTGGAGAA	0.582													3	10	---	---	---	---	PASS
ANO3	63982	broad.mit.edu	37	11	26563538	26563538	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:26563538G>T	uc001mqt.3	+	11	1222	c.1077G>T	c.(1075-1077)CAG>CAT	p.Q359H	ANO3_uc010rdr.1_Missense_Mutation_p.Q343H|ANO3_uc010rds.1_Missense_Mutation_p.Q198H|ANO3_uc010rdt.1_Missense_Mutation_p.Q213H	NM_031418	NP_113606	Q9BYT9	ANO3_HUMAN	transmembrane protein 16C	359	Cytoplasmic (Potential).					chloride channel complex	chloride channel activity			ovary(2)|central_nervous_system(1)|pancreas(1)	4						ATGGACCTCAGAATAACAGAC	0.398													22	59	---	---	---	---	PASS
DPP3	10072	broad.mit.edu	37	11	66255471	66255471	+	Silent	SNP	T	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:66255471T>A	uc001oig.1	+	6	722	c.660T>A	c.(658-660)CTT>CTA	p.L220L	DPP3_uc001oif.1_Silent_p.L220L|DPP3_uc010rpe.1_Silent_p.L209L	NM_005700	NP_005691	Q9NY33	DPP3_HUMAN	dipeptidyl peptidase III	220					proteolysis	cytoplasm	aminopeptidase activity|dipeptidyl-peptidase activity|metal ion binding|metallopeptidase activity			ovary(1)|skin(1)	2						CTTCTGTGCTTGGCTCAGGTG	0.483													6	49	---	---	---	---	PASS
RSF1	51773	broad.mit.edu	37	11	77378304	77378304	+	Silent	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:77378304C>T	uc001oyn.2	-	16	4104	c.3984G>A	c.(3982-3984)AGG>AGA	p.R1328R	RSF1_uc001oym.2_Silent_p.R1076R	NM_016578	NP_057662	Q96T23	RSF1_HUMAN	remodeling and spacing factor 1	1328					CenH3-containing nucleosome assembly at centromere|negative regulation of DNA binding|negative regulation of transcription, DNA-dependent|nucleosome positioning|positive regulation of transcription, DNA-dependent|positive regulation of viral transcription|transcription initiation, DNA-dependent	RSF complex	histone binding|protein binding|zinc ion binding			ovary(2)|central_nervous_system(2)	4	all_cancers(14;1.54e-17)|all_epithelial(13;4.06e-20)|Ovarian(111;0.152)		Epithelial(5;3e-50)|all cancers(3;6.37e-47)|BRCA - Breast invasive adenocarcinoma(5;9.82e-31)			AGGGCAGGACCCTAGGCTGGC	0.537													27	136	---	---	---	---	PASS
SYTL2	54843	broad.mit.edu	37	11	85416035	85416035	+	Missense_Mutation	SNP	A	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:85416035A>C	uc010rth.1	-	14	2416	c.2140T>G	c.(2140-2142)TTG>GTG	p.L714V	SYTL2_uc010rtg.1_Missense_Mutation_p.L715V|SYTL2_uc010rti.1_Missense_Mutation_p.L690V|SYTL2_uc010rtj.1_Missense_Mutation_p.L682V|SYTL2_uc001pav.2_Missense_Mutation_p.L156V|SYTL2_uc010rte.1_Missense_Mutation_p.L116V|SYTL2_uc001pax.2_Missense_Mutation_p.L156V|SYTL2_uc001paz.2_Missense_Mutation_p.L35V|SYTL2_uc001pba.2_Missense_Mutation_p.L99V|SYTL2_uc001pay.2_Missense_Mutation_p.L145V|SYTL2_uc001paw.2_Missense_Mutation_p.L116V|SYTL2_uc009yvj.2_RNA|SYTL2_uc001pbd.2_Missense_Mutation_p.L1012V|SYTL2_uc001pbb.2_Missense_Mutation_p.L1052V|SYTL2_uc001pbc.2_Missense_Mutation_p.L1036V|SYTL2_uc010rtf.1_Missense_Mutation_p.L532V	NM_001162951	NP_001156423	Q9HCH5	SYTL2_HUMAN	synaptotagmin-like 2 isoform g	714	C2 1.				intracellular protein transport|vesicle docking involved in exocytosis	exocytic vesicle|extrinsic to plasma membrane|melanosome|membrane fraction	neurexin binding|phosphatidylinositol-4,5-bisphosphate binding|phosphatidylserine binding|Rab GTPase binding			ovary(2)|large_intestine(1)	3		Acute lymphoblastic leukemia(157;4.19e-06)|all_hematologic(158;0.0033)		KIRC - Kidney renal clear cell carcinoma(183;0.202)|Kidney(183;0.237)		GACAGGTTCAATTTCTGTGTC	0.343													23	104	---	---	---	---	PASS
NOX4	50507	broad.mit.edu	37	11	89135577	89135577	+	Missense_Mutation	SNP	A	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:89135577A>T	uc001pct.2	-	9	1002	c.763T>A	c.(763-765)TTT>ATT	p.F255I	NOX4_uc009yvr.2_Missense_Mutation_p.F230I|NOX4_uc001pcu.2_Missense_Mutation_p.F181I|NOX4_uc001pcw.2_Intron|NOX4_uc001pcx.2_Intron|NOX4_uc001pcv.2_Missense_Mutation_p.F255I|NOX4_uc009yvo.2_Intron|NOX4_uc010rtu.1_Missense_Mutation_p.F89I|NOX4_uc009yvp.2_Intron|NOX4_uc010rtv.1_Missense_Mutation_p.F231I|NOX4_uc009yvq.2_Missense_Mutation_p.F231I|NOX4_uc009yvs.1_RNA	NM_016931	NP_058627	Q9NPH5	NOX4_HUMAN	NADPH oxidase 4 isoform a	255	Extracellular (Potential).|Ferric oxidoreductase.|Mediates interaction with TLR4.				cell aging|cell morphogenesis|inflammatory response|negative regulation of cell proliferation|superoxide anion generation	endoplasmic reticulum membrane|focal adhesion|integral to membrane|nucleus	electron carrier activity|flavin adenine dinucleotide binding|heme binding|NAD(P)H oxidase activity|nucleotide binding|oxygen sensor activity			ovary(1)|central_nervous_system(1)	2		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.011)				GGTTTTGAAAATCCTTCAGGG	0.423													59	196	---	---	---	---	PASS
PZP	5858	broad.mit.edu	37	12	9321469	9321469	+	Silent	SNP	A	G	G			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:9321469A>G	uc001qvl.2	-	17	2132	c.2103T>C	c.(2101-2103)TAT>TAC	p.Y701Y	PZP_uc009zgl.2_Silent_p.Y570Y|PZP_uc010sgo.1_5'Flank|PZP_uc009zgm.1_Silent_p.Y33Y	NM_002864	NP_002855			pregnancy-zone protein precursor											ovary(3)|upper_aerodigestive_tract(1)|large_intestine(1)	5						TTTTACCTCCATAGTATCCTT	0.333													27	114	---	---	---	---	PASS
NT5DC3	51559	broad.mit.edu	37	12	104186991	104186991	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:104186991C>A	uc010swe.1	-	9	1011	c.970G>T	c.(970-972)GTG>TTG	p.V324L		NM_001031701	NP_001026871	Q86UY8	NT5D3_HUMAN	5'-nucleotidase domain containing 3	324							hydrolase activity|metal ion binding			ovary(2)|skin(1)	3						ACAATGACCACATCGAACAGG	0.423													74	301	---	---	---	---	PASS
TRAFD1	10906	broad.mit.edu	37	12	112580008	112580008	+	Silent	SNP	A	G	G			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:112580008A>G	uc001ttp.2	+	6	845	c.759A>G	c.(757-759)CAA>CAG	p.Q253Q	TRAFD1_uc001tto.2_Silent_p.Q253Q|TRAFD1_uc010syj.1_RNA	NM_006700	NP_006691	O14545	TRAD1_HUMAN	TRAF-type zinc finger domain containing 1	253					negative regulation of innate immune response	intracellular	protein binding|zinc ion binding				0						ATGAAGGCCAAGCCTCCAGTG	0.557													15	126	---	---	---	---	PASS
OR4K15	81127	broad.mit.edu	37	14	20444219	20444219	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:20444219C>T	uc010tkx.1	+	1	542	c.542C>T	c.(541-543)ACC>ATC	p.T181I		NM_001005486	NP_001005486	Q8NH41	OR4KF_HUMAN	olfactory receptor, family 4, subfamily K,	181	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)	1	all_cancers(95;0.00108)		Epithelial(56;9.96e-07)|all cancers(55;3.58e-06)	GBM - Glioblastoma multiforme(265;0.00327)		ATCCATACTACCAGCCAGTTG	0.448													64	167	---	---	---	---	PASS
SPG21	51324	broad.mit.edu	37	15	65255989	65255989	+	Missense_Mutation	SNP	C	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:65255989C>A	uc002aod.2	-	9	992	c.899G>T	c.(898-900)AGC>ATC	p.S300I	SPG21_uc002aoe.2_Missense_Mutation_p.S300I|SPG21_uc010bhb.2_Missense_Mutation_p.S273I|SPG21_uc010bhc.2_Missense_Mutation_p.S146I	NM_001127889	NP_001121361	Q9NZD8	SPG21_HUMAN	spastic paraplegia 21 isoform a	300					cell death	cytosol|endosome membrane|trans-Golgi network transport vesicle	CD4 receptor binding				0						GATGCCAAGGCTGCCTTTCTG	0.517													28	143	---	---	---	---	PASS
HN1L	90861	broad.mit.edu	37	16	1749049	1749049	+	3'UTR	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:1749049G>T	uc002cmg.2	+	5					HN1L_uc010uvi.1_3'UTR|HN1L_uc010brt.2_RNA|HN1L_uc010bru.2_3'UTR|HN1L_uc010uvj.1_3'UTR|HN1L_uc010uvk.1_3'UTR	NM_144570	NP_653171	Q9H910	HN1L_HUMAN	hematological and neurological expressed 1-like							cytoplasm|nucleus				upper_aerodigestive_tract(1)	1						AAGAGATAGGGTAGCCATGTT	0.537													9	37	---	---	---	---	PASS
MYH11	4629	broad.mit.edu	37	16	15833980	15833980	+	Silent	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:15833980C>T	uc002ddy.2	-	23	3032	c.2925G>A	c.(2923-2925)ACG>ACA	p.T975T	MYH11_uc002ddv.2_Silent_p.T982T|MYH11_uc002ddw.2_Silent_p.T975T|MYH11_uc002ddx.2_Silent_p.T982T|MYH11_uc010bvg.2_Silent_p.T807T	NM_002474	NP_002465	P35749	MYH11_HUMAN	smooth muscle myosin heavy chain 11 isoform	975	Potential.				axon guidance|cardiac muscle fiber development|elastic fiber assembly|skeletal muscle myosin thick filament assembly|smooth muscle contraction	cytosol|melanosome|muscle myosin complex|myosin filament	actin binding|ATP binding|calmodulin binding|motor activity|structural constituent of muscle			ovary(6)|skin(3)|lung(2)|breast(2)|upper_aerodigestive_tract(1)|pancreas(1)	15						TGGCCTCAGCCGTGACCTTCT	0.433			T	CBFB	AML								11	292	---	---	---	---	PASS
Unknown	0	broad.mit.edu	37	16	70268158	70268158	+	RNA	SNP	A	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70268158A>C	uc010cfp.1	-	3		c.257T>G								Homo sapiens cDNA, FLJ98908.																		TTCTTCATTAAAACAGCTACT	0.333													4	19	---	---	---	---	PASS
KIAA1609	57707	broad.mit.edu	37	16	84516270	84516270	+	Silent	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:84516270C>T	uc002fib.2	-	6	1112	c.1005G>A	c.(1003-1005)GTG>GTA	p.V335V	KIAA1609_uc010vod.1_Silent_p.V308V|KIAA1609_uc002fic.2_RNA	NM_020947	NP_065998	Q6P9B6	K1609_HUMAN	hypothetical protein LOC57707	335	TLD.						protein binding			ovary(2)	2						TGTGTGTGTACACAGCCATGC	0.562													9	57	---	---	---	---	PASS
C17orf75	64149	broad.mit.edu	37	17	30666861	30666861	+	Silent	SNP	C	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:30666861C>A	uc002hhg.2	-	3	349	c.318G>T	c.(316-318)GGG>GGT	p.G106G		NM_022344	NP_071739	Q9HAS0	NJMU_HUMAN	hypothetical protein LOC64149	106					spermatogenesis					ovary(1)	1		Breast(31;0.116)|Ovarian(249;0.182)	BRCA - Breast invasive adenocarcinoma(9;0.239)			CATTACCCAGCCCTTCAAAGA	0.443													34	175	---	---	---	---	PASS
ZNF407	55628	broad.mit.edu	37	18	72346684	72346684	+	Missense_Mutation	SNP	G	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:72346684G>A	uc002llw.2	+	1	3766	c.3709G>A	c.(3709-3711)GCA>ACA	p.A1237T	ZNF407_uc010xfc.1_Missense_Mutation_p.A1237T|ZNF407_uc010dqu.1_Missense_Mutation_p.A1237T|ZNF407_uc002llu.2_Missense_Mutation_p.A1236T	NM_017757	NP_060227	Q9C0G0	ZN407_HUMAN	zinc finger protein 407 isoform 1	1237					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)	2		Esophageal squamous(42;0.131)|Prostate(75;0.173)		BRCA - Breast invasive adenocarcinoma(31;0.184)		AGGAGGAAACGCAGGAGACGG	0.537													11	47	---	---	---	---	PASS
SALL3	27164	broad.mit.edu	37	18	76753526	76753526	+	Nonsense_Mutation	SNP	G	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:76753526G>A	uc002lmt.2	+	2	1535	c.1535G>A	c.(1534-1536)TGG>TAG	p.W512*	SALL3_uc010dra.2_Nonsense_Mutation_p.W119*	NM_171999	NP_741996	Q9BXA9	SALL3_HUMAN	sal-like 3	512					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(2)|large_intestine(1)|central_nervous_system(1)	4		Esophageal squamous(42;0.129)|Melanoma(33;0.16)|Prostate(75;0.167)		OV - Ovarian serous cystadenocarcinoma(15;4.69e-06)|BRCA - Breast invasive adenocarcinoma(31;0.0256)		GTGACCACCTGGCTGGACAGC	0.697													3	17	---	---	---	---	PASS
WDR18	57418	broad.mit.edu	37	19	990274	990274	+	Silent	SNP	T	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:990274T>A	uc002lqm.1	+	4	533	c.507T>A	c.(505-507)TCT>TCA	p.S169S	WDR18_uc002lqn.1_RNA|WDR18_uc010drx.1_Silent_p.S132S|WDR18_uc010dry.1_Silent_p.S169S	NM_024100	NP_077005	Q9BV38	WDR18_HUMAN	WD repeat domain 18	169										skin(1)	1		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.04e-05)|all_lung(49;1.53e-05)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		ACGTCTGGTCTCACCACGCGC	0.721													4	18	---	---	---	---	PASS
TSHZ3	57616	broad.mit.edu	37	19	31768041	31768041	+	Silent	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:31768041C>T	uc002nsy.3	-	2	2723	c.2658G>A	c.(2656-2658)ACG>ACA	p.T886T		NM_020856	NP_065907	Q63HK5	TSH3_HUMAN	zinc finger protein 537	886					negative regulation of transcription, DNA-dependent|regulation of respiratory gaseous exchange by neurological system process	growth cone|nucleus	chromatin binding|protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(4)|skin(2)|pancreas(1)|lung(1)	8	Esophageal squamous(110;0.226)					TCTGGGCGGGCGTCGACTCCT	0.612													5	27	---	---	---	---	PASS
PRKD2	25865	broad.mit.edu	37	19	47181735	47181735	+	Silent	SNP	G	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:47181735G>A	uc002pfh.2	-	17	2598	c.2256C>T	c.(2254-2256)AAC>AAT	p.N752N	PRKD2_uc002pfd.2_Silent_p.N126N|PRKD2_uc010eks.2_Silent_p.N155N|PRKD2_uc010ekt.2_Silent_p.N19N|PRKD2_uc002pfe.2_Silent_p.N272N|PRKD2_uc002pff.2_Silent_p.N272N|PRKD2_uc002pfg.2_Silent_p.N595N|PRKD2_uc002pfi.2_Silent_p.N752N|PRKD2_uc002pfj.2_Silent_p.N752N|PRKD2_uc010xye.1_Silent_p.N752N|PRKD2_uc002pfk.2_Silent_p.N595N	NM_001079881	NP_001073350	Q9BZL6	KPCD2_HUMAN	protein kinase D2 isoform A	752	Protein kinase.				cell death|intracellular signal transduction|positive regulation of transcription from RNA polymerase II promoter|protein autophosphorylation|T cell receptor signaling pathway	cytoplasm|membrane|nucleus	ATP binding|metal ion binding|protein kinase C activity			ovary(2)|central_nervous_system(2)|stomach(1)|large_intestine(1)|lung(1)	7		Ovarian(192;0.0129)|all_neural(266;0.0459)|Breast(70;0.212)		OV - Ovarian serous cystadenocarcinoma(262;0.000189)|all cancers(93;0.000545)|Epithelial(262;0.0219)|GBM - Glioblastoma multiforme(486;0.0353)		CCTCATCCTCGTTGAAAGGGA	0.617													16	60	---	---	---	---	PASS
ZNF701	55762	broad.mit.edu	37	19	53087030	53087030	+	3'UTR	SNP	T	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:53087030T>C	uc002pzs.1	+	4					ZNF701_uc010ydn.1_3'UTR	NM_018260	NP_060730	Q9NV72	ZN701_HUMAN	zinc finger protein 701						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0				OV - Ovarian serous cystadenocarcinoma(262;0.0105)|GBM - Glioblastoma multiforme(134;0.0402)		ATCCATGGTATAGGGAAACTT	0.398													7	45	---	---	---	---	PASS
ZNF274	10782	broad.mit.edu	37	19	58723904	58723904	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:58723904C>T	uc002qrq.1	+	10	1816	c.1357C>T	c.(1357-1359)CGT>TGT	p.R453C	ZNF274_uc002qrr.1_Missense_Mutation_p.R421C|ZNF274_uc002qrs.1_Missense_Mutation_p.R348C|ZNF274_uc010eum.1_Missense_Mutation_p.R212C	NM_133502	NP_598009	Q96GC6	ZN274_HUMAN	zinc finger protein 274 isoform c	453					viral reproduction	centrosome|nucleolus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(1)	1		Colorectal(82;5.46e-05)|all_neural(62;0.0182)|Ovarian(87;0.0443)|Breast(46;0.0889)|Renal(1328;0.157)		UCEC - Uterine corpus endometrioid carcinoma (67;0.168)|GBM - Glioblastoma multiforme(193;0.0168)|Lung(386;0.215)		ATTGCGCAAACGTGACTCACA	0.423													18	119	---	---	---	---	PASS
TRMT6	51605	broad.mit.edu	37	20	5924213	5924213	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:5924213C>T	uc002wmh.1	-	6	781	c.659G>A	c.(658-660)CGA>CAA	p.R220Q	TRMT6_uc010zra.1_Missense_Mutation_p.R50Q|TRMT6_uc010gbn.1_Missense_Mutation_p.R50Q|TRMT6_uc010gbo.1_RNA	NM_015939	NP_057023	Q9UJA5	TRM6_HUMAN	tRNA methyltransferase 6	220					regulation of translational initiation|tRNA processing	nucleus	protein binding|translation initiation factor activity			pancreas(1)	1						ACCTCCCATTCGTTCCATCAT	0.428													59	263	---	---	---	---	PASS
ZNF337	26152	broad.mit.edu	37	20	25656758	25656758	+	Missense_Mutation	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:25656758C>T	uc002wva.2	-	4	1688	c.1166G>A	c.(1165-1167)GGA>GAA	p.G389E	uc002wuz.2_RNA|ZNF337_uc010ztg.1_Missense_Mutation_p.G357E|ZNF337_uc002wvb.2_Missense_Mutation_p.G389E|ZNF337_uc002wvc.2_Missense_Mutation_p.G389E	NM_015655	NP_056470	Q9Y3M9	ZN337_HUMAN	zinc finger protein 337	389	C2H2-type 8.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						GAGGAGACTTCCTTTCACGCT	0.488													31	104	---	---	---	---	PASS
C20orf4	25980	broad.mit.edu	37	20	34843594	34843594	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr20:34843594G>T	uc002xfc.1	+	4	1175	c.1082G>T	c.(1081-1083)TGG>TTG	p.W361L	C20orf4_uc002xfd.1_Intron|C20orf4_uc002xfe.1_Missense_Mutation_p.W361L	NM_015511	NP_056326	Q9Y312	CT004_HUMAN	hypothetical protein LOC25980	361											0	Breast(12;0.0162)	Myeloproliferative disorder(115;0.0393)				AAGTTCCGGTGGGACTTTGCT	0.582													27	142	---	---	---	---	PASS
RANGAP1	5905	broad.mit.edu	37	22	41677122	41677122	+	5'UTR	SNP	C	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:41677122C>A	uc003azs.2	-	1					RANGAP1_uc003azt.2_Intron|RANGAP1_uc003azu.2_Intron|RANGAP1_uc011aoz.1_5'Flank	NM_002883	NP_002874	P46060	RAGP1_HUMAN	Ran GTPase activating protein 1						mitotic prometaphase|signal transduction	condensed chromosome kinetochore|cytosol|nuclear membrane|nuclear pore|soluble fraction|spindle pole	protein binding|Ran GTPase activator activity				0						AAAAAGGAGTCTCCTGGGGCC	0.562													3	29	---	---	---	---	PASS
SHANK3	85358	broad.mit.edu	37	22	51160606	51160606	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr22:51160606G>T	uc003bne.1	+	22	4393	c.4393G>T	c.(4393-4395)GCC>TCC	p.A1465S	SHANK3_uc003bnf.1_Missense_Mutation_p.A912S|SHANK3_uc010hbg.1_Missense_Mutation_p.A647S	NM_001080420	NP_001073889	F2Z3L0	F2Z3L0_HUMAN	SH3 and multiple ankyrin repeat domains 3	1465										central_nervous_system(1)	1		all_cancers(38;3.75e-11)|all_epithelial(38;1.82e-09)|Breast(42;0.000448)|all_lung(38;0.000665)|Lung NSC(38;0.0104)|Ovarian(80;0.104)|Lung SC(80;0.162)|Hepatocellular(38;0.178)		BRCA - Breast invasive adenocarcinoma(115;0.22)		GCAGCACCACGCCGCCTCTGC	0.711													3	14	---	---	---	---	PASS
ASMT	438	broad.mit.edu	37	X	1748789	1748789	+	Silent	SNP	C	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1748789C>T	uc004cqd.2	+	6	664	c.519C>T	c.(517-519)ACC>ACT	p.T173T	ASMT_uc010ncy.2_Silent_p.T173T|ASMT_uc004cqe.2_Silent_p.T173T	NM_004043	NP_004034	P46597	HIOM_HUMAN	acetylserotonin O-methyltransferase	173					melatonin biosynthetic process|translation	cytosol	acetylserotonin O-methyltransferase activity|S-methyltransferase activity			skin(1)	1		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)				GCGTGCTGACCGCCTTTGACC	0.557													36	181	---	---	---	---	PASS
MXRA5	25878	broad.mit.edu	37	X	3228209	3228209	+	Missense_Mutation	SNP	G	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:3228209G>T	uc004crg.3	-	7	8192	c.8035C>A	c.(8035-8037)CTG>ATG	p.L2679M		NM_015419	NP_056234	Q9NR99	MXRA5_HUMAN	adlican precursor	2679	Ig-like C2-type 11.					extracellular region				ovary(5)|lung(1)|central_nervous_system(1)|skin(1)	8		all_lung(23;0.00031)|Lung NSC(23;0.000946)				GGGCCCTCCAGATGCATGCCA	0.612													17	42	---	---	---	---	PASS
PTCHD1	139411	broad.mit.edu	37	X	23410647	23410647	+	Splice_Site	SNP	G	C	C			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:23410647G>C	uc004dal.3	+	3	1021	c.1013_splice	c.e3-1	p.G338_splice		NM_173495	NP_775766	Q96NR3	PTHD1_HUMAN	patched domain containing 1						cognition|smoothened signaling pathway	integral to membrane|plasma membrane	hedgehog receptor activity			ovary(4)|kidney(1)|skin(1)	6						TGCCCTCTTAGGTCATGGATT	0.403													20	36	---	---	---	---	PASS
EIF4G3	8672	broad.mit.edu	37	1	21488461	21488462	+	Intron	INS	-	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:21488461_21488462insA	uc001bef.2	-						EIF4G3_uc001bed.2_Intron|EIF4G3_uc001bee.2_Intron|EIF4G3_uc001beh.2_Intron	NM_003760	NP_003751	O43432	IF4G3_HUMAN	eukaryotic translation initiation factor 4						interspecies interaction between organisms|regulation of translational initiation|RNA metabolic process	eukaryotic translation initiation factor 4F complex	protein binding|RNA cap binding|translation initiation factor activity			skin(1)	1		all_lung(284;2.61e-06)|Lung NSC(340;2.81e-06)|Colorectal(325;3.46e-05)|Renal(390;9.67e-05)|Breast(348;0.00149)|Ovarian(437;0.00338)|Myeloproliferative disorder(586;0.0256)		UCEC - Uterine corpus endometrioid carcinoma (279;0.023)|COAD - Colon adenocarcinoma(152;5.42e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000327)|GBM - Glioblastoma multiforme(114;0.000696)|Kidney(64;0.0018)|STAD - Stomach adenocarcinoma(196;0.00644)|KIRC - Kidney renal clear cell carcinoma(64;0.0185)|READ - Rectum adenocarcinoma(331;0.124)|Lung(427;0.191)		aactctgtctcaaaaaaaaaaa	0.168													4	2	---	---	---	---	
ZNF684	127396	broad.mit.edu	37	1	40995229	40995230	+	5'Flank	DEL	AG	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:40995229_40995230delAG	uc001cft.1	+							NM_152373	NP_689586	Q5T5D7	ZN684_HUMAN	zinc finger protein 684						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0	Ovarian(52;0.00769)|all_hematologic(146;0.0501)|Acute lymphoblastic leukemia(166;0.074)	Myeloproliferative disorder(586;0.0393)	OV - Ovarian serous cystadenocarcinoma(33;5.42e-18)			gaggggaggCAGAGAGAGAGAG	0.198													4	3	---	---	---	---	
ZNF326	284695	broad.mit.edu	37	1	90470357	90470358	+	Intron	INS	-	TTT	TTT	rs67753518		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:90470357_90470358insTTT	uc001dnq.2	+						ZNF326_uc001dnp.3_Intron|ZNF326_uc009wda.1_Intron|ZNF326_uc001dnr.2_Intron	NM_182976	NP_892021	Q5BKZ1	ZN326_HUMAN	zinc finger protein 326 isoform 1						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nuclear matrix	DNA binding			ovary(1)	1		all_lung(203;0.0116)|Lung NSC(277;0.0417)		all cancers(265;0.00728)|Epithelial(280;0.0265)		AATATCAGGGCttttttttttt	0.228													2	5	---	---	---	---	
C1orf26	54823	broad.mit.edu	37	1	185191344	185191344	+	Intron	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:185191344delA	uc001grg.3	+						C1orf26_uc001grh.3_Intron	NM_001105518	NP_001098988	Q5T5J6	SWT1_HUMAN	hypothetical protein LOC54823												0						GTGTTAAGTGAAAAAAAAAAg	0.020													4	2	---	---	---	---	
ZBTB41	360023	broad.mit.edu	37	1	197141236	197141237	+	Intron	DEL	TA	-	-	rs10572836		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:197141236_197141237delTA	uc001gtx.1	-						ZBTB41_uc009wyz.1_Intron	NM_194314	NP_919290	Q5SVQ8	ZBT41_HUMAN	zinc finger and BTB domain containing 41						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|skin(1)	2						CTGATTACACTATATATATCTC	0.267													6	3	---	---	---	---	
CR1	1378	broad.mit.edu	37	1	207726288	207726289	+	Intron	INS	-	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:207726288_207726289insT	uc001hfy.2	+						CR1_uc009xcl.1_Intron|CR1_uc001hfx.2_Intron|CR1_uc009xcj.1_Intron|CR1_uc009xck.1_Intron	NM_000573	NP_000564	P17927	CR1_HUMAN	complement receptor 1 isoform F precursor						complement activation, classical pathway|innate immune response	integral to plasma membrane	complement receptor activity			ovary(3)	3						AGGCTATTGCCACCTGCTCTTA	0.441													4	2	---	---	---	---	
PTPN14	5784	broad.mit.edu	37	1	214706877	214706877	+	Intron	DEL	T	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr1:214706877delT	uc001hkk.1	-						PTPN14_uc010pty.1_Intron|PTPN14_uc001hkl.1_Intron	NM_005401	NP_005392	Q15678	PTN14_HUMAN	protein tyrosine phosphatase, non-receptor type						lymphangiogenesis	cytoplasm|cytoskeleton	protein tyrosine phosphatase activity|receptor tyrosine kinase binding			breast(2)|ovary(1)|kidney(1)|skin(1)	5				OV - Ovarian serous cystadenocarcinoma(81;0.00181)|all cancers(67;0.00194)|Epithelial(68;0.0157)|GBM - Glioblastoma multiforme(131;0.155)		GCGGTTTaaataaaaaaaaaa	0.234													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	22328543	22328543	+	IGR	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:22328543delA								None (None upstream) : None (None downstream)																							ggaaggaaggaaggaaggaag	0.139													4	2	---	---	---	---	
CAD	790	broad.mit.edu	37	2	27459886	27459888	+	Intron	DEL	TTT	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:27459886_27459888delTTT	uc002rji.2	+						CAD_uc010eyw.2_Intron	NM_004341	NP_004332	P27708	PYR1_HUMAN	carbamoylphosphate synthetase 2/aspartate						'de novo' pyrimidine base biosynthetic process|drug metabolic process|glutamine metabolic process|peptidyl-threonine phosphorylation|protein autophosphorylation|pyrimidine nucleoside biosynthetic process|pyrimidine nucleotide biosynthetic process	cytosol|neuronal cell body|nuclear matrix|terminal button	aspartate binding|aspartate carbamoyltransferase activity|ATP binding|carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity|dihydroorotase activity|enzyme binding|identical protein binding|metal ion binding|protein kinase activity			ovary(4)|large_intestine(2)|kidney(2)|lung(1)|pancreas(1)	10	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				L-Aspartic Acid(DB00128)|L-Glutamine(DB00130)	GTCTGAGGAAttttttttttttt	0.236													4	2	---	---	---	---	
PRKCE	5581	broad.mit.edu	37	2	46378420	46378427	+	Intron	DEL	ACACACAC	-	-	rs72199610		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:46378420_46378427delACACACAC	uc002rut.2	+							NM_005400	NP_005391	Q02156	KPCE_HUMAN	protein kinase C, epsilon						activation of phospholipase C activity|induction of apoptosis|intracellular signal transduction|nerve growth factor receptor signaling pathway|platelet activation	cytosol|endoplasmic reticulum|plasma membrane	ATP binding|enzyme activator activity|metal ion binding|signal transducer activity			lung(4)|ovary(3)|kidney(1)|breast(1)|large_intestine(1)	10		all_hematologic(82;0.155)|Acute lymphoblastic leukemia(82;0.209)	LUSC - Lung squamous cell carcinoma(58;0.171)			TCCTCCCCCTacacacacacacacacac	0.466													8	5	---	---	---	---	
MSH6	2956	broad.mit.edu	37	2	48032323	48032323	+	Intron	DEL	T	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:48032323delT	uc002rwd.3	+						MSH6_uc010fbj.2_Intron|MSH6_uc010yoi.1_Intron|MSH6_uc010yoj.1_Intron	NM_000179	NP_000170	P52701	MSH6_HUMAN	mutS homolog 6						determination of adult lifespan|DNA damage response, signal transduction resulting in induction of apoptosis|isotype switching|meiotic mismatch repair|negative regulation of DNA recombination|positive regulation of helicase activity|reciprocal meiotic recombination|response to UV|somatic hypermutation of immunoglobulin genes	MutSalpha complex	ATP binding|DNA-dependent ATPase activity|protein binding			large_intestine(53)|central_nervous_system(28)|endometrium(28)|stomach(22)|haematopoietic_and_lymphoid_tissue(9)|lung(7)|skin(6)|urinary_tract(5)|breast(5)|ovary(3)|thyroid(1)|upper_aerodigestive_tract(1)	168		Acute lymphoblastic leukemia(82;0.0299)|all_hematologic(82;0.0358)	Lung(47;0.101)|LUSC - Lung squamous cell carcinoma(58;0.151)			TCTCTCTCTCttttttttttt	0.139			Mis|N|F|S		colorectal	colorectal|endometrial|ovarian		MMR	Lynch_syndrome|Muir-Torre_syndrome|Turcot_syndrome|Constitutional_Mismatch_Repair_Deficiency_Syndrome				6	3	---	---	---	---	
CCDC88A	55704	broad.mit.edu	37	2	55528549	55528561	+	Intron	DEL	AACTAGAAACTGG	-	-	rs72439134		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:55528549_55528561delAACTAGAAACTGG	uc002ryv.2	-						CCDC88A_uc010yoz.1_Intron|CCDC88A_uc010ypa.1_Intron|CCDC88A_uc010fbw.2_Intron|CCDC88A_uc002ryu.2_Intron|CCDC88A_uc002rys.2_Intron|CCDC88A_uc002ryw.2_Intron|CCDC88A_uc010fby.1_Intron	NM_001135597	NP_001129069	Q3V6T2	GRDN_HUMAN	coiled-coil domain containing 88A isoform 1						activation of protein kinase B activity|cell migration|cellular membrane organization|DNA replication|lamellipodium assembly|microtubule cytoskeleton organization|regulation of actin cytoskeleton organization|regulation of cell proliferation|regulation of DNA replication|regulation of neuron projection development|TOR signaling cascade	cytoplasmic membrane-bounded vesicle|cytosol|endoplasmic reticulum|Golgi apparatus|lamellipodium|plasma membrane	actin binding|microtubule binding|phosphatidylinositol binding|protein homodimerization activity|protein kinase B binding			ovary(2)|skin(2)	4						TCATAGACTCAACTAGAAACTGGAACTAGGAAT	0.300													2	6	---	---	---	---	
C2orf65	130951	broad.mit.edu	37	2	74788337	74788337	+	Intron	DEL	G	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:74788337delG	uc002smy.2	-						C2orf65_uc010ysa.1_Intron|C2orf65_uc010ffp.2_Intron|C2orf65_uc002smx.2_Intron	NM_138804	NP_620159	Q8TC57	CB065_HUMAN	hypothetical protein LOC130951						chromatin assembly|female gamete generation|RNA processing|spermatogenesis	integral to membrane				ovary(1)|pancreas(1)	2						aggaggaggaggaggagaagg	0.055													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	122630749	122630765	+	IGR	DEL	TTTTCTTTTCTTTTCTT	-	-	rs72208841		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:122630749_122630765delTTTTCTTTTCTTTTCTT								TSN (105323 upstream) : None (None downstream)																							TGAGGttttcttttcttttcttttcttttttcttttc	0.217													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	2	134765658	134765666	+	IGR	DEL	GGAAGGAAG	-	-	rs57450899	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr2:134765658_134765666delGGAAGGAAG								NCKAP5 (439627 upstream) : MGAT5 (246164 downstream)																							gagggagggaggaaggaaggaaggaagga	0.100													3	3	---	---	---	---	
TWF2	11344	broad.mit.edu	37	3	52272945	52272946	+	Intron	INS	-	G	G	rs140204155	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:52272945_52272946insG	uc003ddd.2	-						TWF2_uc010hmc.2_Intron|uc003dde.2_5'Flank	NM_007284	NP_009215	Q6IBS0	TWF2_HUMAN	twinfilin-like protein							cytoskeleton|perinuclear region of cytoplasm	actin binding|ATP binding			stomach(1)|ovary(1)|lung(1)	3				BRCA - Breast invasive adenocarcinoma(193;2.43e-05)|Kidney(197;0.000539)|KIRC - Kidney renal clear cell carcinoma(197;0.000716)		GGCCGAGAGCCGGGGGGGGGCG	0.718													9	6	---	---	---	---	
GNB4	59345	broad.mit.edu	37	3	179119234	179119236	+	Intron	DEL	AAT	-	-	rs74384746		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr3:179119234_179119236delAAT	uc003fjv.3	-						GNB4_uc003fju.3_Intron	NM_021629	NP_067642	Q9HAV0	GBB4_HUMAN	guanine nucleotide-binding protein, beta-4						cellular response to glucagon stimulus|energy reserve metabolic process	plasma membrane	signal transducer activity			skin(2)	2	all_cancers(143;2.01e-16)|Ovarian(172;0.0172)|Breast(254;0.191)		OV - Ovarian serous cystadenocarcinoma(80;5.78e-26)|GBM - Glioblastoma multiforme(14;0.0169)|BRCA - Breast invasive adenocarcinoma(182;0.237)			TCAGttaaaaaataataataatt	0.271													5	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	4	49110504	49110518	+	IGR	DEL	GTGTTGATTCCATTG	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr4:49110504_49110518delGTGTTGATTCCATTG								CWH43 (46411 upstream) : None (None downstream)																							cattccattcgtgttgattccattgcattccattc	0.000													4	2	---	---	---	---	
PDZD2	23037	broad.mit.edu	37	5	32091384	32091385	+	Intron	DEL	AC	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:32091384_32091385delAC	uc003jhl.2	+						PDZD2_uc003jhm.2_Intron	NM_178140	NP_835260	O15018	PDZD2_HUMAN	PDZ domain containing 2						cell adhesion	cell-cell junction|endoplasmic reticulum|extracellular region|nucleus				central_nervous_system(4)|ovary(2)|skin(2)|large_intestine(1)	9						gttcccacttactttttttttt	0.040													4	2	---	---	---	---	
PPIP5K2	23262	broad.mit.edu	37	5	102526891	102526892	+	Intron	INS	-	A	A			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:102526891_102526892insA	uc003kod.3	+						PPIP5K2_uc011cva.1_Intron|PPIP5K2_uc003koe.2_Intron|PPIP5K2_uc003kof.2_Intron	NM_015216	NP_056031	O43314	VIP2_HUMAN	Histidine acid phosphatase domain containing 1						inositol metabolic process	cytosol	acid phosphatase activity|ATP binding|diphosphoinositol-pentakisphosphate kinase activity|inositol 1,3,4,5,6-pentakisphosphate kinase activity|inositol hexakisphosphate 5-kinase activity			ovary(1)|skin(1)	2						TTCTTCTTACCAAAAAAAAACA	0.322													4	2	---	---	---	---	
EIF4E1B	253314	broad.mit.edu	37	5	176070831	176070831	+	Intron	DEL	C	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr5:176070831delC	uc010jkf.1	+							NM_001099408	NP_001092878	A6NMX2	I4E1B_HUMAN	eukaryotic translation initiation factor 4E						regulation of translation	cytoplasm|mRNA cap binding complex	translation initiation factor activity				0	all_cancers(89;0.00185)|Renal(175;0.000269)|Lung NSC(126;0.00902)|all_lung(126;0.0142)	Medulloblastoma(196;0.00498)|all_neural(177;0.0212)	Kidney(164;3.85e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)			GGCCTTTCAGCCTTTGTGAGG	0.602													3	6	---	---	---	---	
SSR1	6745	broad.mit.edu	37	6	7310458	7310458	+	Intron	DEL	T	-	-	rs34240897		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:7310458delT	uc003mxf.3	-						SSR1_uc003mxg.3_Intron|SSR1_uc010jny.2_Intron	NM_003144	NP_003135	P43307	SSRA_HUMAN	signal sequence receptor, alpha precursor						cotranslational protein targeting to membrane|positive regulation of cell proliferation	endoplasmic reticulum membrane|integral to membrane	signal sequence binding				0	Ovarian(93;0.0398)					TGCATATCAAttttttttttt	0.164													4	2	---	---	---	---	
HLA-DRB5	3127	broad.mit.edu	37	6	32521545	32521546	+	Intron	INS	-	AAGG	AAGG	rs70993877		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:32521545_32521546insAAGG	uc003obk.3	-						HLA-DRB1_uc011dqa.1_Intron|HLA-DRB6_uc003obm.1_Intron|HLA-DRB6_uc003obn.1_Intron	NM_002125	NP_002116	Q30154	DRB5_HUMAN	major histocompatibility complex, class II, DR						antigen processing and presentation of peptide or polysaccharide antigen via MHC class II|immune response	endoplasmic reticulum membrane|Golgi apparatus|integral to membrane|late endosome membrane|lysosomal membrane|MHC class II protein complex					0						TTGGGGAAAGACTTTATCCAGG	0.436													5	3	---	---	---	---	
TREML4	285852	broad.mit.edu	37	6	41193282	41193283	+	5'Flank	INS	-	AAGGA	AAGGA	rs112102768		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:41193282_41193283insAAGGA	uc003oqc.2	+							NM_198153	NP_937796	Q6UXN2	TRML4_HUMAN	triggering receptor expressed on myeloid							extracellular region				breast(1)	1	Ovarian(28;0.0327)|Colorectal(47;0.196)					aggaaggaaggaaggaaggaag	0.144													4	3	---	---	---	---	
GSTA4	2941	broad.mit.edu	37	6	52847697	52847702	+	Intron	DEL	GAGAGC	-	-	rs3063729	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:52847697_52847702delGAGAGC	uc003pbc.2	-						GSTA4_uc003pbd.2_Intron|GSTA4_uc003pbe.2_Intron|GSTA4_uc003pbf.2_Intron	NM_001512	NP_001503	O15217	GSTA4_HUMAN	glutathione S-transferase alpha 4						glutathione metabolic process|xenobiotic metabolic process	cytosol	glutathione transferase activity|protein homodimerization activity				0	Lung NSC(77;0.103)				Glutathione(DB00143)	gagagagagagagagcgagagagaga	0.257													4	2	---	---	---	---	
DST	667	broad.mit.edu	37	6	56466769	56466769	+	Intron	DEL	T	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:56466769delT	uc003pdf.2	-						DST_uc003pcz.3_Intron|DST_uc011dxj.1_Intron|DST_uc011dxk.1_Intron|DST_uc003pcy.3_Intron	NM_001144769	NP_001138241	Q03001	DYST_HUMAN	dystonin isoform 2						cell adhesion|cell cycle arrest|cell motility|hemidesmosome assembly|integrin-mediated signaling pathway|intermediate filament cytoskeleton organization|maintenance of cell polarity|microtubule cytoskeleton organization|response to wounding	actin cytoskeleton|axon|axon part|basement membrane|cell cortex|cell leading edge|cytoplasmic membrane-bounded vesicle|endoplasmic reticulum membrane|hemidesmosome|hemidesmosome|integral to membrane|intermediate filament|intermediate filament cytoskeleton|microtubule cytoskeleton|microtubule plus end|nuclear envelope|sarcomere|Z disc	actin binding|calcium ion binding|integrin binding|microtubule plus-end binding|protein binding|protein C-terminus binding|protein homodimerization activity			ovary(7)|central_nervous_system(6)|upper_aerodigestive_tract(1)	14	Lung NSC(77;0.103)		LUSC - Lung squamous cell carcinoma(124;0.0485)|Lung(124;0.0956)			GGCAAAGACCTAACTTAGGTA	0.279													4	2	---	---	---	---	
KHDRBS2	202559	broad.mit.edu	37	6	62652910	62652911	+	Intron	DEL	AG	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:62652910_62652911delAG	uc003peg.2	-							NM_152688	NP_689901	Q5VWX1	KHDR2_HUMAN	KH domain-containing, RNA-binding, signal						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	SH3 domain binding			skin(7)|ovary(3)|liver(1)	11				BRCA - Breast invasive adenocarcinoma(397;0.149)		aaagaaagaaagagagagagag	0.000													3	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	6	98688793	98688796	+	IGR	DEL	GGAA	-	-	rs58687659		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:98688793_98688796delGGAA								MIR2113 (216296 upstream) : POU3F2 (593784 downstream)																							gaagagggagggaaggaaggaagg	0.108													4	3	---	---	---	---	
CNKSR3	154043	broad.mit.edu	37	6	154734274	154734275	+	Intron	DEL	AC	-	-	rs113546547		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:154734274_154734275delAC	uc003qpy.2	-							NM_173515	NP_775786	Q6P9H4	CNKR3_HUMAN	CNKSR family member 3						negative regulation of ERK1 and ERK2 cascade|negative regulation of peptidyl-serine phosphorylation|positive regulation of sodium ion transport	cytoplasm|membrane				ovary(2)|breast(1)|skin(1)	4		Ovarian(120;0.196)		OV - Ovarian serous cystadenocarcinoma(155;5.03e-11)|BRCA - Breast invasive adenocarcinoma(81;0.00627)		AATTTATGGTacacacacacac	0.233													4	3	---	---	---	---	
ACAT2	39	broad.mit.edu	37	6	160199454	160199455	+	Intron	DEL	TT	-	-	rs71808548		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr6:160199454_160199455delTT	uc010kjy.2	+						ACAT2_uc011efw.1_Intron	NM_005891	NP_005882	Q9BWD1	THIC_HUMAN	acetyl-Coenzyme A acetyltransferase 2							mitochondrion|nucleolus	acetyl-CoA C-acetyltransferase activity|protein binding			ovary(1)|central_nervous_system(1)	2		Breast(66;0.000776)|Ovarian(120;0.0303)		OV - Ovarian serous cystadenocarcinoma(65;1.51e-18)|BRCA - Breast invasive adenocarcinoma(81;5.87e-06)		CTTCCCAAGGTTTaaaaaaaaa	0.317													4	2	---	---	---	---	
C7orf28B	221960	broad.mit.edu	37	7	6839053	6839054	+	Intron	INS	-	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:6839053_6839054insT	uc003sqx.1	-						C7orf28B_uc011jxd.1_Intron	NM_198097	NP_932765	P86791	CCZ1_HUMAN	hypothetical protein LOC221960							lysosomal membrane					0		Ovarian(82;0.232)		UCEC - Uterine corpus endometrioid carcinoma (126;0.175)		CTAGGCAAGAAttttttttttt	0.144													6	3	---	---	---	---	
HIBADH	11112	broad.mit.edu	37	7	27672200	27672200	+	Intron	DEL	A	-	-	rs143191859		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:27672200delA	uc003szf.2	-						HIBADH_uc003szg.2_Intron|HIBADH_uc003szh.2_Intron|HIBADH_uc003szi.2_Intron	NM_152740	NP_689953	P31937	3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase precursor						branched chain family amino acid catabolic process|pentose-phosphate shunt|valine metabolic process	mitochondrial matrix	3-hydroxyisobutyrate dehydrogenase activity|NAD binding|phosphogluconate dehydrogenase (decarboxylating) activity			ovary(2)	2			GBM - Glioblastoma multiforme(3;0.0368)		NADH(DB00157)	GCAAATGACCAAAAAAAAAAA	0.313													6	3	---	---	---	---	
BMPER	168667	broad.mit.edu	37	7	34118338	34118338	+	Intron	DEL	T	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:34118338delT	uc011kap.1	+							NM_133468	NP_597725	Q8N8U9	BMPER_HUMAN	BMP-binding endothelial regulator precursor						blood vessel endothelial cell proliferation involved in sprouting angiogenesis|endothelial cell activation|negative regulation of BMP signaling pathway|positive regulation of ERK1 and ERK2 cascade|regulation of endothelial cell migration|regulation of pathway-restricted SMAD protein phosphorylation	extracellular space				ovary(2)|central_nervous_system(1)	3						AAACGACCACTTTTTTTTTTA	0.383													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	7	68195077	68195078	+	IGR	INS	-	AAAA	AAAA	rs10657254		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:68195077_68195078insAAAA								None (None upstream) : AUTS2 (868827 downstream)																							gagaaagaaagaaagaaagaaa	0.000													3	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	7	99578706	99578706	+	Intron	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:99578706delA	uc003usi.2	+											RecName: Full=Putative zinc-alpha-2-glycoprotein-like 2; Flags: Precursor;																		cttagtttacagtgaaaacaa	0.164													6	4	---	---	---	---	
SRPK2	6733	broad.mit.edu	37	7	104811273	104811276	+	Intron	DEL	AGAA	-	-	rs57379359		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:104811273_104811276delAGAA	uc003vct.2	-						SRPK2_uc003vcu.2_Intron|SRPK2_uc003vcv.2_Intron|SRPK2_uc003vcw.1_Intron	NM_182691	NP_872633	P78362	SRPK2_HUMAN	serine/arginine-rich protein-specific kinase 2						angiogenesis|cell differentiation|intracellular protein kinase cascade|negative regulation of viral genome replication|nuclear speck organization|positive regulation of cell cycle|positive regulation of cell proliferation|positive regulation of gene expression|positive regulation of neuron apoptosis|positive regulation of viral genome replication|spliceosome assembly	cytoplasm|nucleolus	14-3-3 protein binding|ATP binding|magnesium ion binding|protein serine/threonine kinase activity			central_nervous_system(3)|ovary(2)|upper_aerodigestive_tract(1)	6						ggagagaaagagaaagaaaggaag	0.000													2	4	---	---	---	---	
DGKI	9162	broad.mit.edu	37	7	137237501	137237501	+	Intron	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:137237501delA	uc003vtt.2	-						DGKI_uc003vtu.2_Intron	NM_004717	NP_004708	O75912	DGKI_HUMAN	diacylglycerol kinase, iota						activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway|intracellular signal transduction|platelet activation	nucleus|plasma membrane	ATP binding|diacylglycerol kinase activity|metal ion binding			ovary(1)|kidney(1)|skin(1)	3						ctaaaaatacaaaaaaaaaaa	0.000													4	2	---	---	---	---	
TPK1	27010	broad.mit.edu	37	7	144380279	144380279	+	Intron	DEL	T	-	-	rs137896700		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr7:144380279delT	uc003weq.2	-						TPK1_uc003weo.2_Intron|TPK1_uc003wep.2_Intron|TPK1_uc003wer.2_Intron|TPK1_uc003wes.2_Intron	NM_022445	NP_071890	Q9H3S4	TPK1_HUMAN	thiamin pyrophosphokinase 1 isoform a						thiamine diphosphate biosynthetic process	cytosol	ATP binding|kinase activity|thiamine diphosphokinase activity			ovary(2)	2					Thiamine(DB00152)	tttctgcatcttttttttttt	0.129													6	3	---	---	---	---	
DOCK5	80005	broad.mit.edu	37	8	25265381	25265385	+	Intron	DEL	AAAAA	-	-	rs67164560		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:25265381_25265385delAAAAA	uc003xeg.2	+						PPP2R2A_uc003xek.2_Intron|DOCK5_uc003xej.2_Intron	NM_024940	NP_079216	Q9H7D0	DOCK5_HUMAN	dedicator of cytokinesis 5							cytoplasm	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(3)	3		all_cancers(63;0.0361)|Ovarian(32;0.000711)|all_epithelial(46;0.0153)|Hepatocellular(4;0.115)|Prostate(55;0.13)|Breast(100;0.143)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0267)|Epithelial(17;1.07e-11)|Colorectal(74;0.0276)|COAD - Colon adenocarcinoma(73;0.0828)		accctgtctcaaaaaaaaaaaaaaa	0.146													5	3	---	---	---	---	
TMEM74	157753	broad.mit.edu	37	8	109769028	109769031	+	Intron	DEL	AGGA	-	-	rs112425656		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:109769028_109769031delAGGA	uc003ymx.2	-									Q96NL1	TMM74_HUMAN	Homo sapiens cDNA FLJ30668 fis, clone FCBBF1000675.						autophagy	autophagic vacuole membrane|cytoplasmic vesicle|integral to membrane|lysosomal membrane				ovary(1)|lung(1)|kidney(1)|skin(1)	4			OV - Ovarian serous cystadenocarcinoma(57;3.08e-10)			agggaaggggaggaaggaaggaag	0.123													3	6	---	---	---	---	
Unknown	0	broad.mit.edu	37	8	142723793	142723795	+	IGR	DEL	TGG	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr8:142723793_142723795delTGG								FLJ43860 (206463 upstream) : MIR1302-7 (143808 downstream)																							atggtgatgatggtggtggtggt	0.020													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	9	67331368	67331369	+	IGR	DEL	AA	-	-	rs76774868	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:67331368_67331369delAA								AQP7P1 (41876 upstream) : FAM27B (461561 downstream)																							GTTGGGGGGGAAAAACCTGTAT	0.386													5	3	---	---	---	---	
PCSK5	5125	broad.mit.edu	37	9	78506448	78506453	+	Intron	DEL	CACACA	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:78506448_78506453delCACACA	uc004ajz.2	+						PCSK5_uc004ajy.2_Intron|PCSK5_uc004aka.2_Intron	NM_006200	NP_006191	Q92824	PCSK5_HUMAN	proprotein convertase subtilisin/kexin type 5						anterior/posterior pattern formation|cell-cell signaling|cytokine biosynthetic process|embryo implantation|embryonic digestive tract development|embryonic skeletal system development|heart development|kidney development|limb morphogenesis|nerve growth factor processing|nerve growth factor receptor signaling pathway|peptide biosynthetic process|renin secretion into blood stream|respiratory tube development|signal peptide processing|viral assembly, maturation, egress, and release	extracellular space|Golgi lumen|stored secretory granule	peptide binding|serine-type endopeptidase activity			ovary(2)|skin(1)	3						CGCGCGTacgcacacacacacacaca	0.505													3	3	---	---	---	---	
UGCG	7357	broad.mit.edu	37	9	114694304	114694304	+	Intron	DEL	A	-	-	rs34569956		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:114694304delA	uc004bft.2	+							NM_003358	NP_003349	Q16739	CEGT_HUMAN	ceramide glucosyltransferase						epidermis development|glucosylceramide biosynthetic process	Golgi membrane|integral to membrane|membrane fraction	ceramide glucosyltransferase activity			ovary(1)	1				OV - Ovarian serous cystadenocarcinoma(323;0.0433)	Miglustat(DB00419)	cgtctcaagtaaaaaaaaaaa	0.104													6	3	---	---	---	---	
PRPF4	9128	broad.mit.edu	37	9	116052508	116052508	+	Intron	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:116052508delA	uc004bgx.2	+						PRPF4_uc004bgy.2_Intron	NM_004697	NP_004688	O43172	PRP4_HUMAN	PRP4 pre-mRNA processing factor 4 homolog							Cajal body|nuclear speck|spliceosomal complex|U4/U6 snRNP	protein binding			ovary(2)|pancreas(1)	3						tcaaaagaagaaaaaaaaaaa	0.189													5	3	---	---	---	---	
NR6A1	2649	broad.mit.edu	37	9	127288844	127288844	+	Intron	DEL	A	-	-	rs111378093		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:127288844delA	uc004bor.1	-						NR6A1_uc004boq.1_Intron|NR6A1_uc010mwq.1_Intron	NM_033334	NP_201591	Q15406	NR6A1_HUMAN	nuclear receptor subfamily 6, group A, member 1						cell proliferation|negative regulation of transcription from RNA polymerase II promoter|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor|spermatogenesis	transcription factor complex	protein homodimerization activity|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|zinc ion binding			ovary(3)	3						CAGTTTGAAGAAAAAAAAAAA	0.418													6	3	---	---	---	---	
NCS1	23413	broad.mit.edu	37	9	132985259	132985259	+	Intron	DEL	C	-	-	rs68053432		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:132985259delC	uc004bzi.2	+						NCS1_uc010myz.1_Intron	NM_014286	NP_055101	P62166	NCS1_HUMAN	frequenin homolog isoform 1						negative regulation of calcium ion transport via voltage-gated calcium channel activity|regulation of neuron projection development	cell junction|Golgi cisterna membrane|perinuclear region of cytoplasm|postsynaptic density|postsynaptic membrane	calcium ion binding|protein binding				0						AAGAGGGGGGCGGCCCTCATC	0.657													8	4	---	---	---	---	
MED27	9442	broad.mit.edu	37	9	134953129	134953129	+	Intron	DEL	A	-	-	rs76460072		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr9:134953129delA	uc004cbe.1	-						MED27_uc004cbf.1_Intron|MED27_uc011mco.1_Intron|MED27_uc004cbg.3_Intron	NM_004269	NP_004260	Q6P2C8	MED27_HUMAN	mediator complex subunit 27						regulation of transcription from RNA polymerase II promoter|transcription initiation from RNA polymerase II promoter	cytoplasm|nucleolus|transcription factor complex	protein binding|transcription coactivator activity			skin(1)	1		Myeloproliferative disorder(178;0.206)		OV - Ovarian serous cystadenocarcinoma(145;6.82e-06)|Epithelial(140;0.000193)		TGGGACACTTAAAAAAAAAAA	0.368													4	2	---	---	---	---	
OPTN	10133	broad.mit.edu	37	10	13150910	13150911	+	Intron	INS	-	CACA	CACA	rs146972277	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:13150910_13150911insCACA	uc001ilu.1	+						OPTN_uc001ilv.1_Intron|OPTN_uc001ilw.1_Intron|OPTN_uc001ilx.1_Intron|OPTN_uc001ily.1_Intron|OPTN_uc010qbr.1_Intron|OPTN_uc001ilz.1_Intron	NM_001008213	NP_001008214	Q96CV9	OPTN_HUMAN	optineurin						cell death|Golgi ribbon formation|Golgi to plasma membrane protein transport|protein targeting to Golgi|signal transduction	perinuclear region of cytoplasm|trans-Golgi network	protein C-terminus binding			ovary(2)	2						acatgcgcgtgcacacacacac	0.163													4	3	---	---	---	---	
KIAA1462	57608	broad.mit.edu	37	10	30362576	30362577	+	Intron	INS	-	TCCT	TCCT			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:30362576_30362577insTCCT	uc001iuz.2	-									Q9P266	K1462_HUMAN	RecName: Full=Uncharacterized protein KIAA1462;											ovary(4)	4						TAGCAAGATTGtccttccttcc	0.158													3	3	---	---	---	---	
LOC441666	441666	broad.mit.edu	37	10	42860636	42860637	+	Intron	DEL	TC	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:42860636_42860637delTC	uc010qey.1	-							NR_024380				Homo sapiens noncoding mRNA sequence.												0						CCAGGAGATGTCTCTCTGACCC	0.465													4	2	---	---	---	---	
CPN1	1369	broad.mit.edu	37	10	101816474	101816475	+	Intron	INS	-	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:101816474_101816475insT	uc001kql.2	-							NM_001308	NP_001299	P15169	CBPN_HUMAN	carboxypeptidase N, polypeptide 1 precursor						proteolysis	extracellular space	metallocarboxypeptidase activity|zinc ion binding			central_nervous_system(3)|pancreas(1)	4		Colorectal(252;0.234)		Epithelial(162;4.77e-10)|all cancers(201;3.82e-08)		gcttggctatcttttttttttt	0.000													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	10	111000355	111000358	+	IGR	DEL	GAAG	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr10:111000355_111000358delGAAG								None (None upstream) : XPNPEP1 (624166 downstream)																							agggaggaaagaaggaaggaagga	0.020													4	2	---	---	---	---	
COPB1	1315	broad.mit.edu	37	11	14512339	14512339	+	Intron	DEL	T	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:14512339delT	uc001mli.2	-						COPB1_uc001mlg.2_Intron|COPB1_uc001mlh.2_Intron	NM_016451	NP_057535	P53618	COPB_HUMAN	coatomer protein complex, subunit beta 1						COPI coating of Golgi vesicle|interspecies interaction between organisms|intra-Golgi vesicle-mediated transport|intracellular protein transport|retrograde vesicle-mediated transport, Golgi to ER	COPI vesicle coat|cytosol|ER-Golgi intermediate compartment|plasma membrane	protein binding|structural molecule activity			ovary(1)|central_nervous_system(1)	2						ATACttttgcttttttttttt	0.119													5	3	---	---	---	---	
AGBL2	79841	broad.mit.edu	37	11	47727193	47727194	+	Intron	INS	-	A	A	rs76492621		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:47727193_47727194insA	uc001ngg.2	-						AGBL2_uc010rhq.1_Intron|AGBL2_uc001ngh.1_Intron	NM_024783	NP_079059	Q5U5Z8	CBPC2_HUMAN	carboxypeptidase 2, cytosolic						proteolysis	cytosol	metallocarboxypeptidase activity|zinc ion binding			ovary(2)	2						aagtctgtgtcaaaaaaaaaaa	0.104													5	6	---	---	---	---	
Unknown	0	broad.mit.edu	37	11	56460942	56460944	+	IGR	DEL	TTG	-	-	rs72311916		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:56460942_56460944delTTG								OR5AR1 (28850 upstream) : OR9G9 (6920 downstream)																							ATGCAAGGATttgttgttgttgt	0.394													4	2	---	---	---	---	
PAAF1	80227	broad.mit.edu	37	11	73610451	73610453	+	Intron	DEL	CTC	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:73610451_73610453delCTC	uc001ouk.1	+						PAAF1_uc001oul.1_Intron|PAAF1_uc009ytx.1_Intron|PAAF1_uc001oum.1_Intron	NM_025155	NP_079431	Q9BRP4	PAAF1_HUMAN	proteasomal ATPase-associated factor 1						interspecies interaction between organisms	proteasome complex	protein binding			ovary(1)|skin(1)	2	Breast(11;7.42e-05)					ttttctttttctctttttttttt	0.192													4	2	---	---	---	---	
CHORDC1	26973	broad.mit.edu	37	11	89943548	89943549	+	Intron	INS	-	CAGA	CAGA	rs150562845	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr11:89943548_89943549insCAGA	uc001pdg.2	-						CHORDC1_uc009yvz.2_Intron	NM_012124	NP_036256	Q9UHD1	CHRD1_HUMAN	cysteine and histidine-rich domain-containing						chaperone-mediated protein folding|regulation of response to stress|response to stress		Hsp90 protein binding|identical protein binding				0		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.00915)				ATGATGCTACTCAgagtctctt	0.104													4	4	---	---	---	---	
SLCO1B3	28234	broad.mit.edu	37	12	21201605	21201616	+	Intron	DEL	TGTGTGTGTATA	-	-	rs67112786	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:21201605_21201616delTGTGTGTGTATA	uc010sil.1	+						LST-3TM12_uc010sim.1_Intron|LST-3TM12_uc010sin.1_Intron			Q9NPD5	SO1B3_HUMAN	SubName: Full=Liver-specific organic anion transporter 3TM13; SubName: Full=Organic anion transporter LST-3c;						bile acid metabolic process|sodium-independent organic anion transport	basolateral plasma membrane|cytoplasm|integral to plasma membrane	bile acid transmembrane transporter activity|organic anion transmembrane transporter activity			large_intestine(2)|ovary(1)|skin(1)	4	Esophageal squamous(101;0.149)					tgtgtgtgtgtgtgtgtgtatatatTTACAGC	0.165													4	2	---	---	---	---	
RASSF9	9182	broad.mit.edu	37	12	86199850	86199851	+	Intron	INS	-	T	T	rs149030946	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:86199850_86199851insT	uc001taf.1	-							NM_005447	NP_005438	O75901	RASF9_HUMAN	Ras association (RalGDS/AF-6) domain family						endosome transport|protein targeting|signal transduction	cytosol|endosome|trans-Golgi network transport vesicle membrane	protein binding|transporter activity			ovary(1)	1						TGAGAGAGGCATTTTTTTtctg	0.163													4	2	---	---	---	---	
MYO1H	283446	broad.mit.edu	37	12	109881161	109881162	+	Intron	DEL	AC	-	-	rs10545297		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:109881161_109881162delAC	uc010sxo.1	+						MYO1H_uc010sxn.1_Intron			Q8N1T3	MYO1H_HUMAN	SubName: Full=cDNA FLJ54829, moderately similar to Myosin Ic; SubName: Full=Myosin IH, isoform CRA_a;							myosin complex	motor activity				0						gtgtgtatatacacacacacac	0.104													6	4	---	---	---	---	
TMEM132B	114795	broad.mit.edu	37	12	125833807	125833808	+	Intron	DEL	TG	-	-	rs145483970		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr12:125833807_125833808delTG	uc001uhe.1	+							NM_052907	NP_443139	Q14DG7	T132B_HUMAN	transmembrane protein 132B							integral to membrane				skin(11)|ovary(5)|large_intestine(1)|pancreas(1)|breast(1)	19	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;0.000423)|Epithelial(86;0.00394)|all cancers(50;0.0362)		CTCCCCACTCTGTGCTGTCTTT	0.465													3	5	---	---	---	---	
Unknown	0	broad.mit.edu	37	13	54591893	54591896	+	IGR	DEL	AGGG	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr13:54591893_54591896delAGGG								OLFM4 (965707 upstream) : MIR1297 (294211 downstream)																							gaaggaaggaagggagggagggag	0.127													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	14	31745938	31745939	+	IGR	INS	-	T	T			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:31745938_31745939insT								HECTD1 (69023 upstream) : HEATR5A (15056 downstream)																							tccttccttccttccttccttc	0.000													4	2	---	---	---	---	
ADAM6	8755	broad.mit.edu	37	14	106825288	106825294	+	Intron	DEL	TTGTCTT	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr14:106825288_106825294delTTGTCTT	uc010tyt.1	-											Parts of antibodies, mostly variable regions.												0						ATCCCCCAGGTTGTCTTGGGTCCTCTC	0.531													5	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	22448174	22448174	+	IGR	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:22448174delA								OR4N3P (33789 upstream) : MIR1268 (65055 downstream)																							caaacaaaccaaaaaaaaaaa	0.095													4	3	---	---	---	---	
LPCAT4	254531	broad.mit.edu	37	15	34656628	34656628	+	Intron	DEL	T	-	-	rs10718217		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:34656628delT	uc001zig.2	-						LPCAT4_uc010bav.1_Intron	NM_153613	NP_705841	Q643R3	LPCT4_HUMAN	lysophosphatidylcholine acyltransferase 4						phospholipid biosynthetic process	endoplasmic reticulum membrane|integral to membrane	acyltransferase activity|calcium ion binding				0						tttttttttctgttgttgttg	0.199													4	2	---	---	---	---	
CASC5	57082	broad.mit.edu	37	15	40921694	40921706	+	Intron	DEL	TTTTTTTTTTTTT	-	-	rs71104709		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:40921694_40921706delTTTTTTTTTTTTT	uc010bbs.1	+						CASC5_uc010bbt.1_Intron	NM_170589	NP_733468	Q8NG31	CASC5_HUMAN	cancer susceptibility candidate 5 isoform 1						acrosome assembly|attachment of spindle microtubules to kinetochore|cell division|CenH3-containing nucleosome assembly at centromere|mitotic prometaphase|spindle assembly checkpoint	acrosomal vesicle|condensed chromosome kinetochore|cytosol|nucleoplasm	protein binding			breast(3)|central_nervous_system(1)|skin(1)	5		all_cancers(109;2.03e-18)|all_epithelial(112;4.26e-15)|Lung NSC(122;1.12e-10)|all_lung(180;2.59e-09)|Melanoma(134;0.0574)|Ovarian(310;0.0822)|Colorectal(260;0.0946)		GBM - Glioblastoma multiforme(113;4.99e-05)|BRCA - Breast invasive adenocarcinoma(123;0.0861)|COAD - Colon adenocarcinoma(120;0.211)		ttgccttttcttttttttttttttttttttttt	0.103													9	8	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	51099433	51099456	+	IGR	DEL	CTTCCTTCCTTCCTTCCTTCCTTC	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:51099433_51099456delCTTCCTTCCTTCCTTCCTTCCTTC								SPPL2A (41523 upstream) : AP4E1 (101490 downstream)																							ccttccttttcttccttccttccttccttccttccttccttcct	0.062													12	12	---	---	---	---	
Unknown	0	broad.mit.edu	37	15	102299886	102299887	+	5'Flank	INS	-	G	G			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr15:102299886_102299887insG	uc002bzh.1	-						uc002bzk.2_5'Flank|uc002bzn.2_5'Flank|uc010uso.1_5'Flank|uc002bzs.2_5'Flank|uc010usv.1_5'Flank|uc002cal.2_5'Flank|uc002cam.2_5'Flank|uc010usx.1_5'Flank|uc002cao.2_5'Flank|uc002cap.2_5'Flank|uc002caq.2_5'Flank|uc010usz.1_5'Flank|uc010uta.1_5'Flank|uc002cas.2_5'Flank|uc002cat.1_5'Flank|uc002cau.2_5'Flank|uc010utb.1_5'Flank|uc002cav.2_5'Flank|uc002caw.2_5'Flank|uc002cax.2_5'Flank|uc010utc.1_5'Flank|uc002cay.2_5'Flank|uc002cbb.2_5'Flank|uc002cbc.1_5'Flank|uc002cbd.2_5'Flank|uc002cbe.2_5'Flank|uc002cbg.2_5'Flank|uc002cbh.2_5'Flank|uc002cbi.2_5'Flank|uc002cbk.2_5'Flank|uc002cbl.2_5'Flank|uc010utd.1_5'Flank					DQ575740																		AACCTGTACTCGCGTCGGAACC	0.589													10	6	---	---	---	---	
AQP8	343	broad.mit.edu	37	16	25239588	25239588	+	Intron	DEL	A	-	-	rs73551053	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:25239588delA	uc002doc.2	+							NM_001169	NP_001160	O94778	AQP8_HUMAN	aquaporin 8						cellular response to cAMP	integral to plasma membrane	water channel activity			upper_aerodigestive_tract(1)|breast(1)|pancreas(1)	3				GBM - Glioblastoma multiforme(48;0.044)		tgtctcaattaaaaaaaaaaa	0.219													4	3	---	---	---	---	
GSG1L	146395	broad.mit.edu	37	16	27991009	27991009	+	Intron	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:27991009delA	uc002doz.2	-						GSG1L_uc010bya.1_Intron	NM_001109763	NP_001103233	Q6UXU4	GSG1L_HUMAN	GSG1-like isoform 1							integral to membrane				ovary(1)	1						agaaagaaagaaggaaggaag	0.000													6	5	---	---	---	---	
CLEC18C	283971	broad.mit.edu	37	16	70066043	70066043	+	Intron	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr16:70066043delA	uc002exy.2	+						PDXDC2_uc002eyb.2_Intron|PDXDC2_uc002eyc.2_Intron	NM_182619	NP_872425	Q8NCF0	CL18C_HUMAN	secretory protein LOC348174 precursor							extracellular region	sugar binding				0						AGCCAAGCCGAAAAAAAAAAA	0.289													5	3	---	---	---	---	
CCDC144C	348254	broad.mit.edu	37	17	20266495	20266496	+	Intron	INS	-	AT	AT			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr17:20266495_20266496insAT	uc010cqy.1	+							NR_023380				Homo sapiens cDNA FLJ59693 complete cds, moderately similar to Ankyrin repeat domain-containing protein 26.												0						cacacacacacacacaTTTGGG	0.277													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	18	11610675	11610675	+	IGR	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr18:11610675delA								FAM38B (908696 upstream) : GNAL (78461 downstream)																							GACTGAAGACaaaaaaaaaaa	0.303													3	3	---	---	---	---	
Unknown	0	broad.mit.edu	37	19	4731044	4731044	+	IGR	DEL	G	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:4731044delG								DPP9 (7189 upstream) : C19orf30 (38073 downstream)																							tcccctccctgccctctcctc	0.000													4	2	---	---	---	---	
TMEM146	257062	broad.mit.edu	37	19	5778219	5778219	+	Intron	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:5778219delA	uc002mda.2	+							NM_152784	NP_689997	Q86XM0	TM146_HUMAN	transmembrane protein 146 precursor							integral to membrane				ovary(1)|central_nervous_system(1)|pancreas(1)	3						actccgactcaaaaaaaaaaa	0.234													3	3	---	---	---	---	
INSR	3643	broad.mit.edu	37	19	7149948	7149975	+	Intron	DEL	GAAGGAAGGAAGGAAGGAAGGAAGGAAG	-	-	rs8105223	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7149948_7149975delGAAGGAAGGAAGGAAGGAAGGAAGGAAG	uc002mgd.1	-						INSR_uc002mge.1_Intron	NM_000208	NP_000199	P06213	INSR_HUMAN	insulin receptor isoform Long precursor						activation of MAPK activity|activation of protein kinase B activity|carbohydrate metabolic process|fibroblast growth factor receptor signaling pathway|G-protein coupled receptor protein signaling pathway|glucose homeostasis|heart morphogenesis|peptidyl-tyrosine phosphorylation|positive regulation of cell migration|positive regulation of cell proliferation|positive regulation of developmental growth|positive regulation of DNA replication|positive regulation of glucose import|positive regulation of glycogen biosynthetic process|positive regulation of glycolysis|positive regulation of MAPKKK cascade|positive regulation of mitosis|positive regulation of nitric oxide biosynthetic process|positive regulation of protein kinase B signaling cascade|positive regulation of protein phosphorylation|positive regulation of respiratory burst|protein autophosphorylation|protein heterotetramerization|regulation of embryonic development|regulation of transcription, DNA-dependent|transformation of host cell by virus	caveola|endosome membrane|insulin receptor complex|microsome	ATP binding|GTP binding|insulin binding|insulin receptor activity|insulin receptor substrate binding|insulin-like growth factor I binding|insulin-like growth factor II binding|insulin-like growth factor receptor binding|metal ion binding|phosphatidylinositol 3-kinase binding|PTB domain binding|receptor signaling protein tyrosine kinase activity|SH2 domain binding			ovary(4)|lung(3)|central_nervous_system(2)|large_intestine(1)|stomach(1)|skin(1)	12					Insulin Glargine recombinant(DB00047)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)	aaaaaagaaagaaggaaggaaggaaggaaggaaggaaggaaggaagga	0.171													4	4	---	---	---	---	
Unknown	0	broad.mit.edu	37	19	7429288	7429289	+	IGR	INS	-	AGGC	AGGC	rs11260009	by1000genomes	TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:7429288_7429289insAGGC								INSR (135277 upstream) : ARHGEF18 (18431 downstream)																							ggaaggaaggaaggcaggCTGA	0.084													3	5	---	---	---	---	
ZNF709	163051	broad.mit.edu	37	19	12597357	12597357	+	5'Flank	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chr19:12597357delA	uc002mtv.3	-						ZNF709_uc002mtw.3_Intron|ZNF709_uc002mtx.3_Intron	NM_152601	NP_689814	Q8N972	ZN709_HUMAN	zinc finger protein 709 isoform a						regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						ggaaggaaggaaaaaaaaagg	0.005													4	2	---	---	---	---	
Unknown	0	broad.mit.edu	37	X	1895506	1895509	+	IGR	DEL	CTTC	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:1895506_1895509delCTTC								ASMT (133533 upstream) : DHRSX (242048 downstream)																							ttctttctttcttccttccttcct	0.000													5	3	---	---	---	---	
ASB9	140462	broad.mit.edu	37	X	15273107	15273107	+	Intron	DEL	A	-	-			TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:15273107delA	uc004cwl.2	-						ASB9_uc004cwk.2_Intron|ASB9_uc004cwm.2_Intron|ASB9_uc010ner.2_Intron|ASB9_uc004cwn.2_Intron	NM_001031739	NP_001026909	Q96DX5	ASB9_HUMAN	ankyrin repeat and SOCS box-containing 9 isoform						intracellular signal transduction						0	Hepatocellular(33;0.183)					TATTGACTTTAAaaaaaaaaa	0.224													4	2	---	---	---	---	
NXF5	55998	broad.mit.edu	37	X	101093049	101093049	+	Intron	DEL	A	-	-	rs66689050		TCGA-BP-4971-01A-01D-1462-08	TCGA-BP-4971-11A-01D-1462-08									Somatic	Phase_I	Capture				Illumina GAIIx	g.chrX:101093049delA	uc011mrk.1	-						NXF5_uc004eih.1_Intron|NXF5_uc004eii.1_Intron|NXF5_uc004eij.1_Intron|NXF5_uc004eik.1_Intron|NXF5_uc004eil.1_Intron	NM_032946	NP_116564	Q9H1B4	NXF5_HUMAN	nuclear RNA export factor 5						mRNA export from nucleus|multicellular organismal development	actin cytoskeleton|cytoplasm|nucleus	nucleocytoplasmic transporter activity|nucleotide binding|protein binding|RNA binding			central_nervous_system(1)	1						ACCTGTGGGGAAAGCAGTGAG	0.577													2	4	---	---	---	---	
