Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	i_ACHILLES_Top_Genes	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	i_CCLE_SEQ_overlapping_mutations	i_CCLE_SEQ_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	i_tumor_f	i_init_t_lod	i_t_lod_fstar	t_alt_count	t_ref_count	i_judgement	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	i_t_ALT_F1R2	i_t_ALT_F2R1	i_t_REF_F1R2	i_t_REF_F2R1	i_t_Foxog	dataset	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	newbase	is_coding	is_flank	is_indel	is_ins	is_del	is_missense	is_nonsense	is_splice	is_silent	context_orig	context65	categ	categ_ignoring_null_categ	gene_idx	pat_idx
RERE	473	broad.mit.edu	37	1	8420616	8420616	+	Missense_Mutation	SNP	T	G	G			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:8420616T>G	uc001ape.2	-	19	3761	c.2951A>C	c.(2950-2952)CAC>CCC	p.H984P	RERE_uc001apf.2_Missense_Mutation_p.H984P|RERE_uc010nzx.1_Missense_Mutation_p.H716P|RERE_uc001apd.2_Missense_Mutation_p.H430P	NM_012102	NP_036234	Q9P2R6	RERE_HUMAN	atrophin-1 like protein isoform a	984	Pro-rich.			H -> N (in Ref. 2; no nucleotide entry).	multicellular organismal development|NLS-bearing substrate import into nucleus	mitochondrion	poly-glutamine tract binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2	Ovarian(185;0.0661)	all_epithelial(116;1.17e-21)|all_lung(118;1.4e-06)|Lung NSC(185;3.06e-06)|Renal(390;0.000147)|Breast(348;0.000206)|Colorectal(325;0.00187)|Hepatocellular(190;0.00825)|Ovarian(437;0.0253)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|all cancers(8;9.64e-67)|GBM - Glioblastoma multiforme(8;9.89e-33)|Colorectal(212;1.45e-07)|COAD - Colon adenocarcinoma(227;3.42e-05)|Kidney(185;6e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000533)|KIRC - Kidney renal clear cell carcinoma(229;0.00106)|STAD - Stomach adenocarcinoma(132;0.00118)|READ - Rectum adenocarcinoma(331;0.0419)|Lung(427;0.195)		GGGTGGGGGGTGAGCCGACGG	0.701																0.156863	2.645542	8.849354	8	43	KEEP	---	---	---	---	9	2	43	16	-1	capture	Missense_Mutation	SNP	8420616	8420616	RERE	1	T	G	G	G	1	0	0	0	0	1	0	0	0	767	59	4	4	13126	51
APITD1	378708	broad.mit.edu	37	1	10511616	10511616	+	Missense_Mutation	SNP	G	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:10511616G>T	uc001arf.2	+	5	875	c.459G>T	c.(457-459)AGG>AGT	p.R153S	APITD1_uc001arg.2_3'UTR|CORT_uc001ari.2_Missense_Mutation_p.R144S	NM_198544	NP_940946	Q8N2Z9	CENPS_HUMAN	apoptosis-inducing, TAF9-like domain 1 isoform	Error:Variant_position_missing_in_Q8N2Z9_after_alignment					DNA repair|mitotic prometaphase|transcription initiation, DNA-dependent	chromosome, centromeric region|cytosol|Fanconi anaemia nuclear complex	chromatin binding|DNA binding|protein binding			ovary(1)	1	Ovarian(185;0.203)	all_lung(284;1.31e-05)|Lung NSC(185;2.19e-05)|Renal(390;0.000147)|Breast(348;0.00093)|Colorectal(325;0.00205)|Hepatocellular(190;0.00913)|Ovarian(437;0.0228)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;3.31e-07)|COAD - Colon adenocarcinoma(227;7.32e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000297)|Kidney(185;0.000747)|KIRC - Kidney renal clear cell carcinoma(229;0.00258)|STAD - Stomach adenocarcinoma(132;0.0167)|READ - Rectum adenocarcinoma(331;0.0487)		TGCCCTGCAGGAACTTCTTCT	0.567																0.465116	56.597144	56.642423	20	23	KEEP	---	---	---	---	14	7	12	12	0.666666666667	capture	Missense_Mutation	SNP	10511616	10511616	APITD1	1	G	T	T	T	1	0	0	0	0	1	0	0	0	529	41	4	4	768	51
RSPO1	284654	broad.mit.edu	37	1	38082340	38082340	+	Silent	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:38082340G>A	uc001cbl.1	-	5	890	c.102C>T	c.(100-102)GCC>GCT	p.A34A	RSPO1_uc001cbm.1_Silent_p.A34A|RSPO1_uc009vvf.1_Silent_p.A7A|RSPO1_uc009vvg.1_Silent_p.A34A	NM_001038633	NP_001033722	Q2MKA7	RSPO1_HUMAN	R-spondin1 precursor	34	FU 1.				positive regulation of canonical Wnt receptor signaling pathway|regulation of receptor internalization		heparin binding				0		Myeloproliferative disorder(586;0.0255)|all_neural(195;0.164)				GGCTCCCCTCGGCACTGACTG	0.557	GBM(122;680 2230 27822 42821)															0.447552	201.882667	202.225265	64	79	KEEP	---	---	---	---	39	28	51	32	-1	capture	Silent	SNP	38082340	38082340	RSPO1	1	G	A	A	A	1	0	0	0	0	0	0	0	1	496	39	1	1	13601	51
HIPK1	204851	broad.mit.edu	37	1	114515777	114515777	+	Silent	SNP	G	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:114515777G>T	uc001eem.2	+	16	3437	c.3276G>T	c.(3274-3276)TCG>TCT	p.S1092S	HIPK1_uc001een.2_Silent_p.S1092S|HIPK1_uc001eeo.2_Silent_p.S718S|HIPK1_uc001eep.2_Silent_p.S698S|HIPK1_uc001eeq.2_Silent_p.S384S	NM_198268	NP_938009	Q86Z02	HIPK1_HUMAN	homeodomain-interacting protein kinase 1 isoform	1092	Interaction with TP53.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|nucleus	ATP binding|protein binding|protein serine/threonine kinase activity			ovary(4)	4	Lung SC(450;0.184)	all_cancers(81;4.5e-08)|all_epithelial(167;1.09e-07)|all_lung(203;1.53e-05)|Lung NSC(69;2.76e-05)		Lung(183;0.0234)|Colorectal(144;0.0686)|all cancers(265;0.0792)|Epithelial(280;0.0866)|COAD - Colon adenocarcinoma(174;0.111)|LUSC - Lung squamous cell carcinoma(189;0.133)		CGCTACACTCGACAGGGCACC	0.647				p.S1092S(MFE319-Tumor)	365											0.395722	208.020513	209.795869	74	113	KEEP	---	---	---	---	34	59	49	76	0.365591397849	capture	Silent	SNP	114515777	114515777	HIPK1	1	G	T	T	T	1	0	0	0	0	0	0	0	1	470	37	4	4	7041	51
CD2	914	broad.mit.edu	37	1	117311264	117311264	+	Silent	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:117311264G>A	uc001egu.3	+	5	944	c.915G>A	c.(913-915)CAG>CAA	p.Q305Q		NM_001767	NP_001758	P06729	CD2_HUMAN	CD2 molecule precursor	305	Cytoplasmic (Potential).|Pro-rich.				blood coagulation|cell surface receptor linked signaling pathway|cell-cell adhesion|induction of apoptosis|leukocyte migration|membrane raft polarization|natural killer cell activation|positive regulation of myeloid dendritic cell activation|regulation of T cell differentiation|T cell activation	integral to plasma membrane	receptor activity			breast(1)	1	Lung SC(450;0.225)	all_cancers(81;3.15e-06)|Acute lymphoblastic leukemia(138;1.7e-08)|all_epithelial(167;8.38e-07)|all_lung(203;3.37e-06)|Lung NSC(69;2.31e-05)		Epithelial(280;6.71e-26)|OV - Ovarian serous cystadenocarcinoma(397;4.74e-24)|all cancers(265;1.93e-22)|Lung(183;0.0543)|Kidney(133;0.0813)|Colorectal(144;0.174)|KIRC - Kidney renal clear cell carcinoma(1967;0.176)|LUSC - Lung squamous cell carcinoma(189;0.189)|BRCA - Breast invasive adenocarcinoma(282;0.201)	Alefacept(DB00092)	ACCGTGTTCAGCACCAGCCTC	0.622	NSCLC(14;263 555 26380 43512 51332)															0.441718	222.677168	223.159708	72	91	KEEP	---	---	---	---	37	46	49	45	-1	capture	Silent	SNP	117311264	117311264	CD2	1	G	A	A	A	1	0	0	0	0	0	0	0	1	438	34	2	2	2950	51
TCHH	7062	broad.mit.edu	37	1	152084995	152084995	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:152084995C>T	uc001ezp.2	-	2	698	c.698G>A	c.(697-699)CGG>CAG	p.R233Q	TCHH_uc009wne.1_Missense_Mutation_p.R233Q	NM_007113	NP_009044	Q07283	TRHY_HUMAN	trichohyalin	233					keratinization	cytoskeleton	calcium ion binding			ovary(3)|kidney(1)|central_nervous_system(1)	5	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			TCTGTCTTGCCGCTCTCGCCT	0.577																0.483607	374.246611	374.303163	118	126	KEEP	---	---	---	---	85	40	102	36	-1	capture	Missense_Mutation	SNP	152084995	152084995	TCHH	1	C	T	T	T	1	0	0	0	0	1	0	0	0	299	23	1	1	15585	51
PAPPA2	60676	broad.mit.edu	37	1	176526161	176526161	+	Missense_Mutation	SNP	C	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:176526161C>A	uc001gkz.2	+	2	1867	c.703C>A	c.(703-705)CCA>ACA	p.P235T	PAPPA2_uc001gky.1_Missense_Mutation_p.P235T|PAPPA2_uc009www.2_RNA	NM_020318	NP_064714	Q9BXP8	PAPP2_HUMAN	pappalysin 2 isoform 1	235					cell differentiation|proteolysis|regulation of cell growth	extracellular region|intracellular|membrane	metalloendopeptidase activity|zinc ion binding			ovary(7)|central_nervous_system(5)|skin(2)|lung(1)|breast(1)	16						CAAAAAGAGTCCACCGGAGGA	0.527																0.424581	209.364769	210.253334	76	103	KEEP	---	---	---	---	45	34	57	53	0.430379746835	capture	Missense_Mutation	SNP	176526161	176526161	PAPPA2	1	C	A	A	A	1	0	0	0	0	1	0	0	0	390	30	4	4	11337	51
OR11L1	391189	broad.mit.edu	37	1	248004304	248004304	+	Nonsense_Mutation	SNP	C	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:248004304C>A	uc001idn.1	-	1	895	c.895G>T	c.(895-897)GAA>TAA	p.E299*		NM_001001959	NP_001001959	Q8NGX0	O11L1_HUMAN	olfactory receptor, family 11, subfamily L,	299	Cytoplasmic (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3	all_cancers(71;8.78e-05)|all_epithelial(71;9.15e-06)|Breast(184;0.0117)|Ovarian(71;0.0377)|all_lung(81;0.0786)|Lung NSC(105;0.0858)		OV - Ovarian serous cystadenocarcinoma(106;0.0319)			CTAACAGCTTCTTTGAAGTCT	0.393																0.534247	232.54583	232.693633	78	68	KEEP	---	---	---	---	47	33	44	28	0.4125	capture	Nonsense_Mutation	SNP	248004304	248004304	OR11L1	1	C	A	A	A	1	0	0	0	0	0	1	0	0	416	32	5	4	10834	51
AGAP6	414189	broad.mit.edu	37	10	51768724	51768724	+	Missense_Mutation	SNP	G	C	C			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr10:51768724G>C	uc001jix.3	+	8	1237	c.839G>C	c.(838-840)AGA>ACA	p.R280T		NM_001077665	NP_001071133	Q5VW22	AGAP6_HUMAN	ArfGAP with GTPase domain, ankyrin repeat and PH	280					regulation of ARF GTPase activity		ARF GTPase activator activity|zinc ion binding			skin(1)	1						GGGAGCGGTAGAGCCATCCCC	0.507																0.178988	106.597214	131.51293	46	211	KEEP	---	---	---	---	16	34	82	157	-1	capture	Missense_Mutation	SNP	51768724	51768724	AGAP6	10	G	C	C	C	1	0	0	0	0	1	0	0	0	429	33	4	4	372	51
PTEN	5728	broad.mit.edu	37	10	89692835	89692835	+	Missense_Mutation	SNP	G	C	C	rs57374291		TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr10:89692835G>C	uc001kfb.2	+	6	1350	c.319G>C	c.(319-321)GAT>CAT	p.D107H		NM_000314	NP_000305	P60484	PTEN_HUMAN	phosphatase and tensin homolog	107	Phosphatase tensin-type.		D -> Y (in BZS and glioblastoma; loss of phosphatase activity towards Ins(1,3,4,5)P4).		activation of mitotic anaphase-promoting complex activity|apoptosis|canonical Wnt receptor signaling pathway|cell proliferation|central nervous system development|induction of apoptosis|inositol phosphate dephosphorylation|negative regulation of cell migration|negative regulation of cyclin-dependent protein kinase activity involved in G1/S|negative regulation of focal adhesion assembly|negative regulation of G1/S transition of mitotic cell cycle|negative regulation of protein kinase B signaling cascade|negative regulation of protein phosphorylation|nerve growth factor receptor signaling pathway|phosphatidylinositol dephosphorylation|phosphatidylinositol-mediated signaling|positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process|positive regulation of sequence-specific DNA binding transcription factor activity|protein stabilization|regulation of neuron projection development|T cell receptor signaling pathway	cytosol|internal side of plasma membrane|PML body	anaphase-promoting complex binding|enzyme binding|inositol-1,3,4,5-tetrakisphosphate 3-phosphatase activity|lipid binding|magnesium ion binding|PDZ domain binding|phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity|phosphatidylinositol-3,4-bisphosphate 3-phosphatase activity|phosphatidylinositol-3-phosphatase activity|protein serine/threonine phosphatase activity|protein tyrosine phosphatase activity|protein tyrosine/serine/threonine phosphatase activity	p.R55fs*1(4)|p.D107Y(3)|p.?(2)|p.Y27fs*1(2)|p.Y27_N212>Y(2)|p.D107N(1)|p.D107A(1)|p.F56fs*2(1)|p.P103fs*3(1)		endometrium(831)|central_nervous_system(657)|skin(121)|haematopoietic_and_lymphoid_tissue(101)|large_intestine(99)|prostate(97)|breast(73)|lung(65)|ovary(58)|thyroid(29)|stomach(29)|upper_aerodigestive_tract(25)|cervix(24)|liver(20)|vulva(17)|kidney(15)|NS(14)|soft_tissue(13)|urinary_tract(12)|eye(8)|pancreas(6)|salivary_gland(5)|bone(5)|biliary_tract(4)|autonomic_ganglia(2)|meninges(2)|testis(1)|oesophagus(1)	2334		all_cancers(4;3.61e-31)|all_epithelial(4;3.96e-23)|Prostate(4;8.12e-23)|Breast(4;0.000111)|Melanoma(5;0.00146)|all_hematologic(4;0.00227)|Colorectal(252;0.00494)|all_neural(4;0.00513)|Acute lymphoblastic leukemia(4;0.0116)|Glioma(4;0.0274)|all_lung(38;0.132)	KIRC - Kidney renal clear cell carcinoma(1;0.214)	UCEC - Uterine corpus endometrioid carcinoma (6;0.000228)|all cancers(1;4.16e-84)|GBM - Glioblastoma multiforme(1;7.77e-49)|Epithelial(1;7.67e-41)|OV - Ovarian serous cystadenocarcinoma(1;6.22e-15)|BRCA - Breast invasive adenocarcinoma(1;1.1e-06)|Lung(2;3.18e-06)|Colorectal(12;4.88e-06)|LUSC - Lung squamous cell carcinoma(2;4.97e-06)|COAD - Colon adenocarcinoma(12;1.13e-05)|Kidney(1;0.000288)|KIRC - Kidney renal clear cell carcinoma(1;0.00037)|STAD - Stomach adenocarcinoma(243;0.218)		CTTTTGTGAAGATCTTGACCA	0.368			31		264	D|Mis|N|F|S		glioma| prostate|endometrial	harmartoma|glioma| prostate|endometrial			Proteus_syndrome|Cowden_syndrome|Juvenile_Polyposis|Hereditary_Mixed_Polyposis_Syndrome_type_1|Bannayan-Riley-Ruvalcaba_syndrome	HNSCC(9;0.0022)|TCGA GBM(2;<1E-08)|TSP Lung(26;0.18)			0.810811	108.372032	111.7153	30	7	KEEP	---	---	---	---	16	17	8	7	-1	capture	Missense_Mutation	SNP	89692835	89692835	PTEN	10	G	C	C	C	1	0	0	0	0	1	0	0	0	429	33	4	4	12633	51
BNIP3	664	broad.mit.edu	37	10	133787377	133787377	+	Nonsense_Mutation	SNP	A	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr10:133787377A>T	uc001lkv.1	-	2	243	c.117T>A	c.(115-117)TAT>TAA	p.Y39*	BNIP3_uc010qut.1_Nonsense_Mutation_p.Y39*	NM_004052	NP_004043	Q12983	BNIP3_HUMAN	BCL2/adenovirus E1B 19kD-interacting protein 3	39					cellular response to cobalt ion|cellular response to hypoxia|cellular response to mechanical stimulus|chromatin remodeling|defense response to virus|DNA fragmentation involved in apoptotic nuclear change|induction of apoptosis|interspecies interaction between organisms|mitochondrial fragmentation involved in apoptosis|negative regulation of membrane potential|negative regulation of mitochondrial fusion|negative regulation of survival gene product expression|neuron apoptosis|positive regulation of mitochondrial fission|positive regulation of protein complex disassembly|positive regulation of release of cytochrome c from mitochondria|reactive oxygen species metabolic process|regulation of mitochondrial membrane permeability	dendrite|integral to mitochondrial outer membrane|nuclear envelope|nucleoplasm	GTPase binding|protein heterodimerization activity|protein homodimerization activity			lung(1)|skin(1)	2		all_cancers(35;4e-11)|all_epithelial(44;5.07e-08)|Ovarian(717;2.61e-05)|Lung NSC(174;0.00237)|all_lung(145;0.00354)|Breast(234;0.023)|all_neural(114;0.0299)|Colorectal(31;0.109)|Melanoma(40;0.123)|Glioma(114;0.203)		Epithelial(32;1.59e-12)|all cancers(32;3.75e-11)|OV - Ovarian serous cystadenocarcinoma(35;2.57e-08)|BRCA - Breast invasive adenocarcinoma(275;0.208)		TGTCTCCATTATAAATAGAAA	0.517					137											0.565217	212.190316	212.617149	65	50	KEEP	---	---	---	---	34	33	26	27	-1	capture	Nonsense_Mutation	SNP	133787377	133787377	BNIP3	10	A	T	T	T	1	0	0	0	0	0	1	0	0	206	16	5	4	1466	51
MRGPRX4	117196	broad.mit.edu	37	11	18195500	18195500	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:18195500G>A	uc001mnv.1	+	1	1117	c.697G>A	c.(697-699)GGC>AGC	p.G233S		NM_054032	NP_473373	Q96LA9	MRGX4_HUMAN	MAS-related GPR, member X4	233	Helical; Name=6; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			skin(1)	1						CCTGCCCTTCGGCATTCTGGG	0.527																0.459459	160.924193	161.081482	51	60	KEEP	---	---	---	---	32	21	34	27	-1	capture	Missense_Mutation	SNP	18195500	18195500	MRGPRX4	11	G	A	A	A	1	0	0	0	0	1	0	0	0	507	39	1	1	9679	51
LRRC4C	57689	broad.mit.edu	37	11	40137192	40137192	+	Silent	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:40137192C>T	uc001mxa.1	-	2	2615	c.651G>A	c.(649-651)CCG>CCA	p.P217P	LRRC4C_uc001mxc.1_Silent_p.P213P|LRRC4C_uc001mxd.1_Silent_p.P213P|LRRC4C_uc001mxb.1_Silent_p.P213P	NM_020929	NP_065980	Q9HCJ2	LRC4C_HUMAN	netrin-G1 ligand precursor	217	LRR 6.				regulation of axonogenesis	integral to membrane	protein binding			ovary(4)|skin(3)|central_nervous_system(1)	8		all_lung(304;0.0575)|Lung NSC(402;0.138)				GTTTTATGAGCGGTGTGAGGT	0.458																0.273585	71.747881	76.632793	29	77	KEEP	---	---	---	---	16	13	57	24	-1	capture	Silent	SNP	40137192	40137192	LRRC4C	11	C	T	T	T	1	0	0	0	0	0	0	0	1	340	27	1	1	8923	51
LRRC55	219527	broad.mit.edu	37	11	56950084	56950084	+	Missense_Mutation	SNP	T	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:56950084T>A	uc001njl.1	+	1	864	c.717T>A	c.(715-717)AAT>AAA	p.N239K		NM_001005210	NP_001005210	Q6ZSA7	LRC55_HUMAN	leucine rich repeat containing 55	209	LRRCT.					integral to membrane					0						TCGGTGGCAATCCCTGGGTGT	0.632																0.446154	170.036099	170.363595	58	72	KEEP	---	---	---	---	41	33	52	39	-1	capture	Missense_Mutation	SNP	56950084	56950084	LRRC55	11	T	A	A	A	1	0	0	0	0	1	0	0	0	647	50	4	4	8926	51
DAGLA	747	broad.mit.edu	37	11	61511858	61511858	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:61511858G>A	uc001nsa.2	+	20	3137	c.3026G>A	c.(3025-3027)AGT>AAT	p.S1009N		NM_006133	NP_006124	Q9Y4D2	DGLA_HUMAN	neural stem cell-derived dendrite regulator	1009	Cytoplasmic (Potential).				cell death|lipid catabolic process|platelet activation	integral to membrane|plasma membrane	acylglycerol lipase activity|metal ion binding|triglyceride lipase activity			ovary(2)|central_nervous_system(1)	3				READ - Rectum adenocarcinoma(4;0.219)		ACGGGCCTCAGTAGCCAGGAA	0.657																0.320388	86.138383	89.090705	33	70	KEEP	---	---	---	---	17	23	46	42	-1	capture	Missense_Mutation	SNP	61511858	61511858	DAGLA	11	G	A	A	A	1	0	0	0	0	1	0	0	0	468	36	2	2	4185	51
STX5	6811	broad.mit.edu	37	11	62593006	62593006	+	Missense_Mutation	SNP	G	C	C			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:62593006G>C	uc001nvh.2	-	6	583	c.429C>G	c.(427-429)ATC>ATG	p.I143M	STX5_uc010rmi.1_Missense_Mutation_p.I47M|STX5_uc009yoh.2_RNA|STX5_uc001nvi.2_Missense_Mutation_p.I89M|STX5_uc010rmj.1_Missense_Mutation_p.I143M|STX5_uc001nvj.2_Translation_Start_Site	NM_003164	NP_003155	Q13190	STX5_HUMAN	syntaxin 5	143	Cytoplasmic (Potential).				intracellular protein transport|retrograde transport, endosome to Golgi|vesicle targeting	ER-Golgi intermediate compartment membrane|Golgi membrane|integral to membrane|nucleus|SNARE complex	protein N-terminus binding|SNAP receptor activity			ovary(1)|breast(1)	2						TGAGGCTATTGATGTCCTGGT	0.507																0.039683	-17.538902	11.255015	5	121	KEEP	---	---	---	---	3	2	68	66	-1	capture	Missense_Mutation	SNP	62593006	62593006	STX5	11	G	C	C	C	1	0	0	0	0	1	0	0	0	577	45	4	4	15238	51
NUMA1	4926	broad.mit.edu	37	11	71717271	71717271	+	Silent	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:71717271C>T	uc001orl.1	-	22	5674	c.5502G>A	c.(5500-5502)TCG>TCA	p.S1834S	NUMA1_uc001orj.2_Silent_p.S16S|NUMA1_uc009ysw.1_Silent_p.S1401S|NUMA1_uc001ork.1_Silent_p.S698S|NUMA1_uc001orm.1_Silent_p.S1820S	NM_006185	NP_006176	Q14980	NUMA1_HUMAN	nuclear mitotic apparatus protein 1	1834					G2/M transition of mitotic cell cycle|mitotic anaphase|nucleus organization	chromosome|cytosol|nucleoplasm|spindle microtubule|spindle pole	protein binding|structural molecule activity			ovary(3)|lung(2)|skin(2)|central_nervous_system(1)	8						TGCTGTAGAACGATGAGTTGG	0.552					525	T	RARA	APL								0.415584	94.592286	95.069521	32	45	KEEP	---	---	---	---	11	22	31	14	-1	capture	Silent	SNP	71717271	71717271	NUMA1	11	C	T	T	T	1	0	0	0	0	0	0	0	1	236	19	1	1	10657	51
FOLR4	390243	broad.mit.edu	37	11	94040846	94040846	+	Silent	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:94040846G>A	uc010rud.1	+	4	720	c.720G>A	c.(718-720)CCG>CCA	p.P240P		NM_001080486	NP_001073955	A6ND01	FOLR4_HUMAN	folate receptor 4 (delta) homolog	247						extracellular region	folic acid binding|receptor activity			ovary(1)	1						TGTTCCTGCCGTTCCTTTCCT	0.617																0.512712	376.182852	376.216502	121	115	KEEP	---	---	---	---	110	66	95	81	-1	capture	Silent	SNP	94040846	94040846	FOLR4	11	G	A	A	A	1	0	0	0	0	0	0	0	1	509	40	1	1	5928	51
BCAT1	586	broad.mit.edu	37	12	25047326	25047326	+	Silent	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:25047326C>T	uc001rgd.3	-	3	604	c.162G>A	c.(160-162)ACG>ACA	p.T54T	BCAT1_uc001rgc.2_Silent_p.T53T|BCAT1_uc010six.1_Silent_p.T66T|BCAT1_uc010siy.1_Silent_p.T54T|BCAT1_uc001rge.3_Silent_p.T30T	NM_005504	NP_005495	P54687	BCAT1_HUMAN	branched chain aminotransferase 1, cytosolic	54					branched chain family amino acid biosynthetic process|branched chain family amino acid catabolic process|cell proliferation|G1/S transition of mitotic cell cycle	cytosol	L-isoleucine transaminase activity|L-leucine transaminase activity|L-valine transaminase activity			lung(1)|breast(1)	2	Acute lymphoblastic leukemia(6;0.00112)|all_hematologic(7;0.00152)|Ovarian(17;0.107)|Colorectal(261;0.196)				Gabapentin(DB00996)|L-Glutamic Acid(DB00142)|L-Isoleucine(DB00167)|L-Leucine(DB00149)|L-Valine(DB00161)|Pyridoxal Phosphate(DB00114)	GCATATGATCCGTGAACACAG	0.453																0.545455	56.752298	56.811755	18	15	KEEP	---	---	---	---	16	2	9	7	-1	capture	Silent	SNP	25047326	25047326	BCAT1	12	C	T	T	T	1	0	0	0	0	0	0	0	1	288	23	1	1	1343	51
CIT	11113	broad.mit.edu	37	12	120142198	120142198	+	Silent	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:120142198G>A	uc001txi.1	-	40	5201	c.5148C>T	c.(5146-5148)AAC>AAT	p.N1716N	CIT_uc001txh.1_Silent_p.N1235N|CIT_uc001txj.1_Silent_p.N1758N	NM_007174	NP_009105	O14578	CTRO_HUMAN	citron	1716	CNH.				intracellular signal transduction		ATP binding|metal ion binding|protein serine/threonine kinase activity|SH3 domain binding|small GTPase regulator activity			ovary(6)|urinary_tract(1)|lung(1)|breast(1)|skin(1)	10	all_neural(191;0.0804)|Medulloblastoma(191;0.0922)	Myeloproliferative disorder(1001;0.0255)		BRCA - Breast invasive adenocarcinoma(302;0.211)		TGAGGTTTTCGTTGTAGCGGA	0.512				p.N1758N(NCIH1793-Tumor)	1263											0.394737	85.437291	86.17296	30	46	KEEP	---	---	---	---	16	21	30	22	-1	capture	Silent	SNP	120142198	120142198	CIT	12	G	A	A	A	1	0	0	0	0	0	0	0	1	516	40	1	1	3403	51
AACS	65985	broad.mit.edu	37	12	125621257	125621257	+	Silent	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:125621257C>T	uc001uhc.2	+	17	1934	c.1728C>T	c.(1726-1728)AAC>AAT	p.N576N	AACS_uc001uhd.2_Intron|AACS_uc009zyh.2_RNA|AACS_uc009zyi.2_Silent_p.N174N	NM_023928	NP_076417	Q86V21	AACS_HUMAN	acetoacetyl-CoA synthetase	576					fatty acid metabolic process	cytosol	acetoacetate-CoA ligase activity|ATP binding			ovary(1)|liver(1)|central_nervous_system(1)	3	all_neural(191;0.101)|Medulloblastoma(191;0.163)			OV - Ovarian serous cystadenocarcinoma(86;9.82e-05)|Epithelial(86;0.000642)|all cancers(50;0.00843)		CCCAGTATAACAAGTACAGGG	0.597																0.401786	126.348115	127.293975	45	67	KEEP	---	---	---	---	29	18	49	28	-1	capture	Silent	SNP	125621257	125621257	AACS	12	C	T	T	T	1	0	0	0	0	0	0	0	1	220	17	2	2	9	51
GALNT9	50614	broad.mit.edu	37	12	132688129	132688129	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:132688129C>T	uc001ukc.3	-	7	1300	c.1184G>A	c.(1183-1185)CGC>CAC	p.R395H	GALNT9_uc009zyr.2_Missense_Mutation_p.R169H|GALNT9_uc001ukb.2_Missense_Mutation_p.R252H|GALNT9_uc001uka.2_Missense_Mutation_p.R29H	NM_001122636	NP_001116108	Q9HCQ5	GALT9_HUMAN	UDP-N-acetyl-alpha-D-galactosamine:polypeptide	395	Lumenal (Potential).				protein O-linked glycosylation	Golgi membrane|integral to membrane	polypeptide N-acetylgalactosaminyltransferase activity|sugar binding				0	all_neural(191;0.0982)|Medulloblastoma(191;0.163)	all_epithelial(31;0.241)		OV - Ovarian serous cystadenocarcinoma(86;7.49e-08)|Epithelial(86;3.55e-07)|all cancers(50;2.09e-05)		CAGGGCGTTGCGCTTGGCATA	0.637	Colon(186;2147 2752 13553 41466)															0.467626	185.35996	185.48663	65	74	KEEP	---	---	---	---	36	33	45	35	-1	capture	Missense_Mutation	SNP	132688129	132688129	GALNT9	12	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	6160	51
HTR2A	3356	broad.mit.edu	37	13	47466570	47466570	+	Missense_Mutation	SNP	T	C	C			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr13:47466570T>C	uc001vbq.2	-	2	702	c.568A>G	c.(568-570)ACT>GCT	p.T190A	HTR2A_uc001vbr.2_Missense_Mutation_p.T90A|HTR2A_uc010acr.2_Missense_Mutation_p.T190A	NM_000621	NP_000612	P28223	5HT2A_HUMAN	5-hydroxytryptamine receptor 2A isoform 1	190	Cytoplasmic (By similarity).				ERK1 and ERK2 cascade|phosphatidylinositol 3-kinase cascade|phosphatidylinositol biosynthetic process|release of sequestered calcium ion into cytosol|response to drug|synaptic transmission	integral to plasma membrane	1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding|drug binding|phosphatidylinositol phospholipase C activity|serotonin binding|serotonin receptor activity			ovary(3)|upper_aerodigestive_tract(1)|central_nervous_system(1)|skin(1)	6		all_lung(13;7.2e-10)|Lung NSC(96;3.77e-07)|Breast(56;2.06e-05)|Prostate(109;0.00116)|Hepatocellular(98;0.0207)|Lung SC(185;0.0262)|Myeloproliferative disorder(33;0.0333)		GBM - Glioblastoma multiforme(144;4.67e-05)|COAD - Colon adenocarcinoma(199;0.224)	Aripiprazole(DB01238)|Chlorpromazine(DB00477)|Chlorprothixene(DB01239)|Cisapride(DB00604)|Clomipramine(DB01242)|Clozapine(DB00363)|Cyclobenzaprine(DB00924)|Cyproheptadine(DB00434)|Dihydroergotamine(DB00320)|Donepezil(DB00843)|Epinastine(DB00751)|Ergotamine(DB00696)|Fluvoxamine(DB00176)|Mesoridazine(DB00933)|Methysergide(DB00247)|Mianserin(DB06148)|Minaprine(DB00805)|Mirtazapine(DB00370)|Nefazodone(DB01149)|Olanzapine(DB00334)|Paliperidone(DB01267)|Paroxetine(DB00715)|Prochlorperazine(DB00433)|Promazine(DB00420)|Promethazine(DB01069)|Propiomazine(DB00777)|Quetiapine(DB01224)|Risperidone(DB00734)|Sertindole(DB06144)|Thiethylperazine(DB00372)|Thioridazine(DB00679)|Tranylcypromine(DB00752)|Trazodone(DB00656)|Venlafaxine(DB00285)|Ziprasidone(DB00246)	AATGCCTTAGTTCTGGAGTTG	0.493																0.338462	424.99186	433.985264	132	258	KEEP	---	---	---	---	88	69	195	120	-1	capture	Missense_Mutation	SNP	47466570	47466570	HTR2A	13	T	C	C	C	1	0	0	0	0	1	0	0	0	780	60	3	3	7366	51
DIS3	22894	broad.mit.edu	37	13	73355005	73355005	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr13:73355005G>A	uc001vix.3	-	2	739	c.365C>T	c.(364-366)ACT>ATT	p.T122I	PIBF1_uc001vja.1_5'Flank|PIBF1_uc010aeo.1_5'Flank|PIBF1_uc001vjb.2_5'Flank|PIBF1_uc001vjc.2_5'Flank|PIBF1_uc010aep.2_5'Flank|DIS3_uc001viy.3_Intron|DIS3_uc001viz.2_RNA	NM_014953	NP_055768	Q9Y2L1	RRP44_HUMAN	DIS3 mitotic control isoform a	122	PINc.				CUT catabolic process|exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay|rRNA catabolic process|rRNA processing	cytosol|exosome (RNase complex)|nucleolus|nucleoplasm	3'-5'-exoribonuclease activity|endonuclease activity|guanyl-nucleotide exchange factor activity|protein binding|RNA binding			central_nervous_system(1)	1		Breast(118;0.0074)|Acute lymphoblastic leukemia(28;0.0195)		GBM - Glioblastoma multiforme(99;0.000181)		ATTAGTGAAAGTATAGAAATG	0.388													Multiple Myeloma(4;0.011)			0.527397	243.079372	243.174542	77	69	KEEP	---	---	---	---	47	40	46	28	-1	capture	Missense_Mutation	SNP	73355005	73355005	DIS3	13	G	A	A	A	1	0	0	0	0	1	0	0	0	468	36	2	2	4493	51
KIAA0430	9665	broad.mit.edu	37	16	15692768	15692768	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr16:15692768C>T	uc002ddr.2	-	26	5120	c.4927G>A	c.(4927-4929)GTT>ATT	p.V1643I	KIAA0430_uc002ddq.2_Missense_Mutation_p.V1477I|KIAA0430_uc010uzv.1_Missense_Mutation_p.V1639I|KIAA0430_uc010uzw.1_Missense_Mutation_p.V1642I	NM_014647	NP_055462	Q9Y4F3	LKAP_HUMAN	limkain b1	1642						peroxisome	nucleotide binding|RNA binding				0						TGGAGGATAACGGGGTCTGGT	0.592																0.271186	40.976732	43.760761	16	43	KEEP	---	---	---	---	7	11	27	22	-1	capture	Missense_Mutation	SNP	15692768	15692768	KIAA0430	16	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	8099	51
VPS35	55737	broad.mit.edu	37	16	46694426	46694426	+	Silent	SNP	T	G	G			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr16:46694426T>G	uc002eef.3	-	17	2448	c.2349A>C	c.(2347-2349)TCA>TCC	p.S783S	VPS35_uc002eed.2_3'UTR|VPS35_uc002eee.2_Silent_p.S744S	NM_018206	NP_060676	Q96QK1	VPS35_HUMAN	vacuolar protein sorting 35	783					protein transport|retrograde transport, endosome to Golgi	cytosol|endosome|membrane	protein binding				0		all_cancers(37;7.65e-05)|all_epithelial(9;0.000154)|all_lung(18;0.00585)|Lung NSC(13;0.0496)|Breast(268;0.116)				CGGATTCTGGTGATTCCCGCC	0.438																0.438596	78.080869	78.26476	25	32	KEEP	---	---	---	---	23	8	21	16	-1	capture	Silent	SNP	46694426	46694426	VPS35	16	T	G	G	G	1	0	0	0	0	0	0	0	1	756	59	4	4	17085	51
ABCC11	85320	broad.mit.edu	37	16	48247385	48247385	+	Missense_Mutation	SNP	G	A	A	rs148839428		TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr16:48247385G>A	uc002eff.1	-	9	1675	c.1325C>T	c.(1324-1326)ACG>ATG	p.T442M	ABCC11_uc002efg.1_Missense_Mutation_p.T442M|ABCC11_uc002efh.1_Missense_Mutation_p.T442M|ABCC11_uc010vgk.1_RNA	NM_033151	NP_149163	Q96J66	ABCCB_HUMAN	ATP-binding cassette, sub-family C, member 11	442	Cytoplasmic (Potential).|ABC transmembrane type-1 1.					integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			ovary(3)|skin(2)|central_nervous_system(1)	6		all_cancers(37;0.127)|all_lung(18;0.132)|Breast(268;0.166)				CTTGGAATTCGTGAGACCTTT	0.552												Cerumen_Type				0.52459	100.414752	100.448116	32	29	KEEP	---	---	---	---	18	16	15	15	-1	capture	Missense_Mutation	SNP	48247385	48247385	ABCC11	16	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	51	51
CNGB1	1258	broad.mit.edu	37	16	57993926	57993926	+	Silent	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr16:57993926G>A	uc002emt.2	-	10	692	c.627C>T	c.(625-627)GCC>GCT	p.A209A	CNGB1_uc010cdh.2_Silent_p.A203A|CNGB1_uc002emu.2_Silent_p.A209A	NM_001297	NP_001288	Q14028	CNGB1_HUMAN	cyclic nucleotide gated channel beta 1 isoform	209	Pro-rich.				sensory perception of smell	intracellular cyclic nucleotide activated cation channel complex	cAMP binding|intracellular cAMP activated cation channel activity			breast(3)|pancreas(1)	4						GGGTCTCCCGGGCCTGCAGCT	0.687	Colon(156;1293 1853 16336 28962 38659)															0.4	11.097204	11.184879	4	6	KEEP	---	---	---	---	5	1	4	3	-1	capture	Silent	SNP	57993926	57993926	CNGB1	16	G	A	A	A	1	0	0	0	0	0	0	0	1	548	43	2	2	3565	51
SMTNL2	342527	broad.mit.edu	37	17	4496362	4496362	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:4496362G>A	uc002fyf.1	+	3	693	c.626G>A	c.(625-627)GGG>GAG	p.G209E	SMTNL2_uc002fye.2_Missense_Mutation_p.G65E	NM_001114974	NP_001108446	Q2TAL5	SMTL2_HUMAN	smoothelin-like 2 isoform 1	209											0				READ - Rectum adenocarcinoma(115;0.0325)		AGGTTCTCTGGGGAGACCTCA	0.657																0.088889	3.250164	18.599398	8	82	KEEP	---	---	---	---	5	5	54	43	-1	capture	Missense_Mutation	SNP	4496362	4496362	SMTNL2	17	G	A	A	A	1	0	0	0	0	1	0	0	0	559	43	2	2	14708	51
TMEM220	388335	broad.mit.edu	37	17	10628403	10628403	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:10628403G>A	uc002gmx.2	-	4	690	c.212C>T	c.(211-213)ACG>ATG	p.T71M	TMEM220_uc002gmy.2_Missense_Mutation_p.T61M	NM_001004313	NP_001004313	Q6QAJ8	TM220_HUMAN	transmembrane protein 220	71	Helical; (Potential).					integral to membrane					0						AGCCCACACCGTACAAAAGAG	0.448																0.04	-16.485333	6.33257	4	96	KEEP	---	---	---	---	2	2	64	41	-1	capture	Missense_Mutation	SNP	10628403	10628403	TMEM220	17	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	16027	51
HAP1	9001	broad.mit.edu	37	17	39884047	39884047	+	Silent	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:39884047C>T	uc002hxm.1	-	8	1254	c.1242G>A	c.(1240-1242)TCG>TCA	p.S414S	JUP_uc010wfs.1_Intron|HAP1_uc002hxn.1_Silent_p.S414S|HAP1_uc002hxo.1_Intron|HAP1_uc002hxp.1_Intron	NM_177977	NP_817084	P54257	HAP1_HUMAN	huntingtin-associated protein 1 isoform 2	414	Glu-rich.|HAP1 N-terminal.				brain development|protein localization|synaptic transmission	actin cytoskeleton	protein binding			ovary(2)	2		Breast(137;0.000162)	BRCA - Breast invasive adenocarcinoma(4;0.0677)			TTTCCTTCTCCGAAGCCAGCT	0.622																0.47619	90.281933	90.30923	30	33	KEEP	---	---	---	---	14	19	22	18	-1	capture	Silent	SNP	39884047	39884047	HAP1	17	C	T	T	T	1	0	0	0	0	0	0	0	1	288	23	1	1	6880	51
MUC16	94025	broad.mit.edu	37	19	9071728	9071728	+	Missense_Mutation	SNP	T	C	C			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:9071728T>C	uc002mkp.2	-	3	15922	c.15718A>G	c.(15718-15720)AAG>GAG	p.K5240E		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	5242	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57						ACTGTGGACTTATCATGGTCT	0.478																0.42	280.079553	281.193374	84	116	KEEP	---	---	---	---	55	37	84	37	-1	capture	Missense_Mutation	SNP	9071728	9071728	MUC16	19	T	C	C	C	1	0	0	0	0	1	0	0	0	793	61	3	3	9883	51
GLTSCR2	29997	broad.mit.edu	37	19	48259848	48259848	+	Nonsense_Mutation	SNP	C	T	T	rs141718194		TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:48259848C>T	uc002phm.2	+	11	1384	c.1360C>T	c.(1360-1362)CGA>TGA	p.R454*	GLTSCR2_uc002phk.2_3'UTR|GLTSCR2_uc002phl.2_Nonsense_Mutation_p.R454*|GLTSCR2_uc010elj.2_Intron|GLTSCR2_uc010elk.1_RNA	NM_015710	NP_056525	Q9NZM5	GSCR2_HUMAN	glioma tumor suppressor candidate region gene 2	454				EGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFR EIQL -> RGQHSFETGSRAFRGGI (in Ref. 3; AAG30413).|PEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAF REIQ -> VLTVSCRGAPCPVMTPSLLPVPPRGYGRHHGCP WAGPVGPMPRG (in Ref. 5).		nucleolus				central_nervous_system(1)	1		all_cancers(25;1.47e-06)|all_lung(116;6.89e-05)|all_epithelial(76;0.000108)|Lung NSC(112;0.000117)|all_neural(266;0.0332)|Ovarian(192;0.086)		all cancers(93;0.000301)|OV - Ovarian serous cystadenocarcinoma(262;0.00031)|Epithelial(262;0.0149)|GBM - Glioblastoma multiforme(486;0.0278)		GATCGAGCCTCGAGAGAGAGC	0.632	Colon(58;613 1041 9473 10089 15241)															0.419355	76.438096	76.790225	26	36	KEEP	---	---	---	---	18	17	27	22	-1	capture	Nonsense_Mutation	SNP	48259848	48259848	GLTSCR2	19	C	T	T	T	1	0	0	0	0	0	1	0	0	399	31	5	1	6411	51
NLRP12	91662	broad.mit.edu	37	19	54304629	54304629	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:54304629C>T	uc002qch.3	-	7	2828	c.2608G>A	c.(2608-2610)GCT>ACT	p.A870T	NLRP12_uc010eqw.2_Missense_Mutation_p.A153T|NLRP12_uc002qci.3_Missense_Mutation_p.A870T|NLRP12_uc002qcj.3_Missense_Mutation_p.A871T|NLRP12_uc002qck.3_Intron|NLRP12_uc010eqx.2_Intron	NM_144687	NP_653288	P59046	NAL12_HUMAN	NLR family, pyrin domain containing 12 isoform	870	LRR 2.				negative regulation of I-kappaB kinase/NF-kappaB cascade|negative regulation of interleukin-1 secretion|negative regulation of interleukin-6 biosynthetic process|negative regulation of protein autophosphorylation|negative regulation of Toll signaling pathway|positive regulation of inflammatory response|positive regulation of interleukin-1 beta secretion|regulation of interleukin-18 biosynthetic process|release of cytoplasmic sequestered NF-kappaB	cytoplasm	ATP binding|caspase activator activity|protein binding			ovary(4)|upper_aerodigestive_tract(2)|lung(1)	7	Ovarian(34;0.19)			GBM - Glioblastoma multiforme(134;0.026)		CAGGCAGCAGCAGTGAGGCGG	0.468																0.322034	48.09988	49.76172	19	40	KEEP	---	---	---	---	8	13	25	20	-1	capture	Missense_Mutation	SNP	54304629	54304629	NLRP12	19	C	T	T	T	1	0	0	0	0	1	0	0	0	325	25	2	2	10381	51
SMEK2	57223	broad.mit.edu	37	2	55791468	55791468	+	Silent	SNP	C	T	T	rs145292231		TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:55791468C>T	uc002rzc.2	-	15	2616	c.2241G>A	c.(2239-2241)AAG>AAA	p.K747K	SMEK2_uc002rzb.2_Silent_p.K662K|SMEK2_uc002rzd.2_Silent_p.K715K|SMEK2_uc002ryz.2_Silent_p.K174K|SMEK2_uc002rza.2_Silent_p.K531K	NM_001122964	NP_001116436	Q5MIZ7	P4R3B_HUMAN	SMEK homolog 2, suppressor of mek1 isoform 1	747						microtubule organizing center|nucleus	protein binding			skin(1)	1			LUSC - Lung squamous cell carcinoma(58;0.127)|Lung(47;0.132)			TCTCCATAAACTTTTCATAAT	0.333																0.32	42.780179	44.220714	16	34	KEEP	---	---	---	---	12	6	25	11	-1	capture	Silent	SNP	55791468	55791468	SMEK2	2	C	T	T	T	1	0	0	0	0	0	0	0	1	259	20	2	2	14686	51
TTN	7273	broad.mit.edu	37	2	179594120	179594120	+	Missense_Mutation	SNP	T	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:179594120T>A	uc010zfg.1	-	61	15255	c.15031A>T	c.(15031-15033)AAC>TAC	p.N5011Y	TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Missense_Mutation_p.N1672Y	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	5938							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			ATATGGAGGTTAAACACAGAC	0.463					8722											0.356757	169.091724	172.393768	66	119	KEEP	---	---	---	---	40	29	83	44	-1	capture	Missense_Mutation	SNP	179594120	179594120	TTN	2	T	A	A	A	1	0	0	0	0	1	0	0	0	793	61	4	4	16617	51
INPP5D	3635	broad.mit.edu	37	2	233944058	233944058	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:233944058G>A	uc010zmo.1	+	2	301	c.148G>A	c.(148-150)GTT>ATT	p.V50I	INPP5D_uc010zmp.1_Missense_Mutation_p.V50I	NM_001017915	NP_001017915	Q92835	SHIP1_HUMAN	SH2 containing inositol phosphatase isoform a	50	SH2.				apoptosis|blood coagulation|leukocyte migration|T cell receptor signaling pathway	cytosol	inositol-polyphosphate 5-phosphatase activity|phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity|SH3 domain binding			ovary(1)|central_nervous_system(1)	2		Breast(86;0.0013)|Renal(207;0.00339)|all_hematologic(139;0.0116)|all_lung(227;0.0273)|Acute lymphoblastic leukemia(138;0.0328)|Lung NSC(271;0.0843)		Epithelial(121;1.16e-17)|BRCA - Breast invasive adenocarcinoma(100;0.000479)|LUSC - Lung squamous cell carcinoma(224;0.00655)|Lung(119;0.00802)|GBM - Glioblastoma multiforme(43;0.0185)		TCGGAATTGCGTTTACACTTA	0.403	NSCLC(82;1215 1426 16163 20348 41018)				816											0.53125	106.653039	106.707432	34	30	KEEP	---	---	---	---	18	17	26	9	-1	capture	Missense_Mutation	SNP	233944058	233944058	INPP5D	2	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	7679	51
WFDC13	164237	broad.mit.edu	37	20	44334525	44334525	+	Missense_Mutation	SNP	T	C	C			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr20:44334525T>C	uc002xpd.2	+	3	371	c.263T>C	c.(262-264)GTC>GCC	p.V88A	WFDC10B_uc002xpb.2_5'Flank|WFDC10B_uc002xpc.2_5'Flank	NM_172005	NP_742002	Q8IUB5	WFD13_HUMAN	WAP four-disulfide core domain 13 precursor	88						extracellular region	peptidase inhibitor activity				0		Myeloproliferative disorder(115;0.0122)				GGCTCAGAAGTCATCATGCCT	0.353																0.352273	99.903481	101.595073	31	57	KEEP	---	---	---	---	19	16	39	23	-1	capture	Missense_Mutation	SNP	44334525	44334525	WFDC13	20	T	C	C	C	1	0	0	0	0	1	0	0	0	754	58	3	3	17232	51
LRRC3B	116135	broad.mit.edu	37	3	26751911	26751911	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:26751911G>A	uc003cdp.2	+	2	1337	c.748G>A	c.(748-750)GAT>AAT	p.D250N	LRRC3B_uc003cdq.2_Missense_Mutation_p.D250N	NM_052953	NP_443185	Q96PB8	LRC3B_HUMAN	leucine rich repeat containing 3B precursor	250						integral to membrane				pancreas(2)|ovary(1)|skin(1)	4						GAAGAAAGCAGATGAACCTGA	0.418																0.409836	75.162881	75.596325	25	36	KEEP	---	---	---	---	13	12	22	17	-1	capture	Missense_Mutation	SNP	26751911	26751911	LRRC3B	3	G	A	A	A	1	0	0	0	0	1	0	0	0	429	33	2	2	8911	51
AZI2	64343	broad.mit.edu	37	3	28381958	28381958	+	Nonsense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:28381958G>A	uc003ceb.2	-	2	683	c.151C>T	c.(151-153)CGA>TGA	p.R51*	AZI2_uc003cec.2_Translation_Start_Site|AZI2_uc003ced.2_Nonsense_Mutation_p.R51*|AZI2_uc003cee.3_Nonsense_Mutation_p.R51*|AZI2_uc003ceg.2_Nonsense_Mutation_p.R51*|AZI2_uc011axd.1_Nonsense_Mutation_p.R51*|AZI2_uc003cef.2_Nonsense_Mutation_p.R51*	NM_022461	NP_071906	Q9H6S1	AZI2_HUMAN	5-azacytidine induced 2 isoform a	51	Potential.					mitochondrion|plasma membrane				ovary(2)	2						TCCTTAAGTCGTTTTTTGATG	0.338																0.133333	5.682438	9.594786	4	26	KEEP	---	---	---	---	2	3	19	9	-1	capture	Nonsense_Mutation	SNP	28381958	28381958	AZI2	3	G	A	A	A	1	0	0	0	0	0	1	0	0	519	40	5	1	1231	51
IMPG2	50939	broad.mit.edu	37	3	100951684	100951684	+	Silent	SNP	A	G	G			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:100951684A>G	uc003duq.1	-	15	3377	c.3174T>C	c.(3172-3174)CCT>CCC	p.P1058P	IMPG2_uc011bhe.1_Silent_p.P921P|IMPG2_uc010hpj.1_RNA	NM_016247	NP_057331	Q9BZV3	IMPG2_HUMAN	interphotoreceptor matrix proteoglycan 2	1058	Extracellular (Potential).|EGF-like 2.				visual perception	integral to membrane|proteinaceous extracellular matrix	extracellular matrix structural constituent|heparin binding|hyaluronic acid binding|receptor activity			ovary(2)|haematopoietic_and_lymphoid_tissue(1)	3						AGCAGAAGTCAGGCTGTAGGT	0.488																0.321429	49.228409	50.815498	18	38	KEEP	---	---	---	---	9	10	18	21	-1	capture	Silent	SNP	100951684	100951684	IMPG2	3	A	G	G	G	1	0	0	0	0	0	0	0	1	80	7	3	3	7652	51
DZIP3	9666	broad.mit.edu	37	3	108353719	108353719	+	Missense_Mutation	SNP	G	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:108353719G>T	uc003dxd.2	+	10	1240	c.818G>T	c.(817-819)GGA>GTA	p.G273V	DZIP3_uc003dxf.1_Missense_Mutation_p.G273V|DZIP3_uc011bhm.1_Intron|DZIP3_uc003dxe.1_Missense_Mutation_p.G273V|DZIP3_uc003dxg.1_5'UTR	NM_014648	NP_055463	Q86Y13	DZIP3_HUMAN	DAZ interacting protein 3, zinc finger	273					protein polyubiquitination	cytoplasm	polyubiquitin binding|RNA binding|ubiquitin-protein ligase activity|zinc ion binding			ovary(1)|central_nervous_system(1)	2						TTTTTCCAGGGATTTTTTCAG	0.254																0.592593	46.299419	46.50072	16	11	KEEP	---	---	---	---	12	4	10	1	0.75	capture	Missense_Mutation	SNP	108353719	108353719	DZIP3	3	G	T	T	T	1	0	0	0	0	1	0	0	0	533	41	4	4	4820	51
CEP70	80321	broad.mit.edu	37	3	138289888	138289888	+	Missense_Mutation	SNP	T	C	C			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:138289888T>C	uc003esl.2	-	5	470	c.272A>G	c.(271-273)AAT>AGT	p.N91S	CEP70_uc011bmk.1_Missense_Mutation_p.N71S|CEP70_uc011bml.1_Missense_Mutation_p.N73S|CEP70_uc011bmm.1_Intron|CEP70_uc003esm.2_Missense_Mutation_p.N91S|CEP70_uc003esn.2_Missense_Mutation_p.N91S	NM_024491	NP_077817	Q8NHQ1	CEP70_HUMAN	centrosomal protein 70 kDa	91	Potential.				G2/M transition of mitotic cell cycle	centrosome|cytosol	protein binding			skin(1)	1						AAGCTGTTGATTAGTTTCTAT	0.318																0.42	68.968491	69.247337	21	29	KEEP	---	---	---	---	12	13	27	9	-1	capture	Missense_Mutation	SNP	138289888	138289888	CEP70	3	T	C	C	C	1	0	0	0	0	1	0	0	0	676	52	3	3	3227	51
PHC3	80012	broad.mit.edu	37	3	169840418	169840418	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:169840418C>T	uc010hws.1	-	9	1931	c.1867G>A	c.(1867-1869)GGG>AGG	p.G623R	PHC3_uc003fgl.2_Missense_Mutation_p.G635R|PHC3_uc011bpq.1_Missense_Mutation_p.G582R	NM_024947	NP_079223	Q8NDX5	PHC3_HUMAN	polyhomeotic like 3	623	Pro-rich.				multicellular organismal development	PcG protein complex	DNA binding|zinc ion binding			ovary(1)|central_nervous_system(1)	2	all_cancers(22;2.67e-22)|all_epithelial(15;4.73e-27)|all_lung(20;6.31e-17)|Lung NSC(18;2.61e-16)|Ovarian(172;0.000337)|Breast(254;0.169)		Lung(28;2.71e-13)|STAD - Stomach adenocarcinoma(35;0.0655)			TCTCCTCTCCCCACTGTTATA	0.393																0.067797	-2.449938	8.959613	4	55	KEEP	---	---	---	---	2	3	40	20	-1	capture	Missense_Mutation	SNP	169840418	169840418	PHC3	3	C	T	T	T	1	0	0	0	0	1	0	0	0	286	22	2	2	11721	51
FNDC3B	64778	broad.mit.edu	37	3	172096143	172096143	+	Missense_Mutation	SNP	A	G	G			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:172096143A>G	uc003fhy.2	+	24	3264	c.3092A>G	c.(3091-3093)CAG>CGG	p.Q1031R	FNDC3B_uc003fhz.3_Missense_Mutation_p.Q1031R	NM_022763	NP_073600	Q53EP0	FND3B_HUMAN	fibronectin type III domain containing 3B	1031	Fibronectin type-III 8.					endoplasmic reticulum|integral to membrane				ovary(2)|breast(1)	3	all_cancers(22;1.01e-18)|Ovarian(172;0.00167)|Breast(254;0.165)		LUSC - Lung squamous cell carcinoma(14;3.57e-14)|Lung(28;9.39e-14)	GBM - Glioblastoma multiforme(1;0.0494)		TTCAGAATCCAGGCAGCAAGC	0.493																0.302326	74.917914	77.917625	26	60	KEEP	---	---	---	---	14	16	43	27	-1	capture	Missense_Mutation	SNP	172096143	172096143	FNDC3B	3	A	G	G	G	1	0	0	0	0	1	0	0	0	91	7	3	3	5914	51
SH3TC1	54436	broad.mit.edu	37	4	8229589	8229589	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:8229589C>T	uc003gkv.3	+	12	2269	c.2168C>T	c.(2167-2169)CCC>CTC	p.P723L	SH3TC1_uc003gkw.3_Missense_Mutation_p.P647L|SH3TC1_uc003gkx.3_RNA|SH3TC1_uc003gky.2_5'Flank	NM_018986	NP_061859	Q8TE82	S3TC1_HUMAN	SH3 domain and tetratricopeptide repeats 1	723							binding			large_intestine(2)|pancreas(1)	3						AAGTGCCTGCCCCACCTGGTG	0.657	NSCLC(145;2298 2623 35616 37297)															0.582418	166.048503	166.582378	53	38	KEEP	---	---	---	---	39	24	23	30	-1	capture	Missense_Mutation	SNP	8229589	8229589	SH3TC1	4	C	T	T	T	1	0	0	0	0	1	0	0	0	286	22	2	2	14154	51
DRD5	1816	broad.mit.edu	37	4	9784937	9784937	+	Silent	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:9784937C>T	uc003gmb.3	+	1	1680	c.1284C>T	c.(1282-1284)GAC>GAT	p.D428D		NM_000798	NP_000789	P21918	DRD5_HUMAN	dopamine receptor D5	428	Cytoplasmic (Potential).				activation of adenylate cyclase activity by dopamine receptor signaling pathway|activation of phospholipase C activity by dopamine receptor signaling pathway|cellular calcium ion homeostasis|negative regulation of NAD(P)H oxidase activity|reactive oxygen species metabolic process|synaptic transmission, dopaminergic	integral to plasma membrane				skin(1)	1					Apomorphine(DB00714)|Carphenazine(DB01038)|Fenoldopam(DB00800)|Zuclopenthixol(DB01624)	TGGACAACGACGAGGAGGAGG	0.582																0.527273	177.251169	177.322251	58	52	KEEP	---	---	---	---	37	22	29	29	-1	capture	Silent	SNP	9784937	9784937	DRD5	4	C	T	T	T	1	0	0	0	0	0	0	0	1	246	19	1	1	4715	51
KIAA1211	57482	broad.mit.edu	37	4	57181748	57181748	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:57181748G>A	uc003hbk.2	+	8	2471	c.2080G>A	c.(2080-2082)GGT>AGT	p.G694S	KIAA1211_uc010iha.2_Missense_Mutation_p.G687S|KIAA1211_uc011bzz.1_Missense_Mutation_p.G604S|KIAA1211_uc003hbm.1_Missense_Mutation_p.G580S	NM_020722	NP_065773	Q6ZU35	K1211_HUMAN	hypothetical protein LOC57482	694										ovary(1)|skin(1)	2	Glioma(25;0.08)|all_neural(26;0.101)					GTTGAGGCCCGGTGATGAGTC	0.602																0.592857	271.848673	272.904412	83	57	KEEP	---	---	---	---	44	43	38	27	-1	capture	Missense_Mutation	SNP	57181748	57181748	KIAA1211	4	G	A	A	A	1	0	0	0	0	1	0	0	0	507	39	1	1	8137	51
OTUD4	54726	broad.mit.edu	37	4	146077118	146077118	+	Silent	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:146077118C>T	uc003ika.3	-	8	603	c.465G>A	c.(463-465)GTG>GTA	p.V155V	OTUD4_uc003ijz.3_Silent_p.V155V	NM_001102653	NP_001096123	Q01804	OTUD4_HUMAN	OTU domain containing 4 protein isoform 3	220							protein binding			ovary(2)|breast(1)	3	all_hematologic(180;0.151)					TAAATCCATTCACATCAGCAG	0.328																0.511628	58.695545	58.699295	22	21	KEEP	---	---	---	---	13	11	16	8	-1	capture	Silent	SNP	146077118	146077118	OTUD4	4	C	T	T	T	1	0	0	0	0	0	0	0	1	366	29	2	2	11218	51
EFNA5	1946	broad.mit.edu	37	5	106762936	106762936	+	Nonsense_Mutation	SNP	G	A	A	rs142282920		TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:106762936G>A	uc003kol.2	-	2	682	c.400C>T	c.(400-402)CGA>TGA	p.R134*	EFNA5_uc010jbr.1_Nonsense_Mutation_p.R134*	NM_001962	NP_001953	P52803	EFNA5_HUMAN	ephrin-A5 precursor	134					cell-cell signaling	anchored to plasma membrane|caveola|extracellular space	ephrin receptor binding				0		all_cancers(142;5.15e-06)|all_epithelial(76;4.39e-07)|Prostate(80;0.00726)|Lung NSC(167;0.0736)|Ovarian(225;0.0797)|all_lung(232;0.0854)|Colorectal(57;0.241)		Epithelial(69;1.25e-12)|OV - Ovarian serous cystadenocarcinoma(64;1.32e-11)|BRCA - Breast invasive adenocarcinoma(61;0.0376)|COAD - Colon adenocarcinoma(37;0.109)		AAATATTCTCGGCCTGGCCTG	0.428																0.441176	93.853714	94.056065	30	38	KEEP	---	---	---	---	21	14	20	21	-1	capture	Nonsense_Mutation	SNP	106762936	106762936	EFNA5	5	G	A	A	A	1	0	0	0	0	0	1	0	0	506	39	5	1	4909	51
TBC1D9B	23061	broad.mit.edu	37	5	179315134	179315134	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:179315134C>T	uc003mlh.2	-	7	1260	c.1223G>A	c.(1222-1224)AGG>AAG	p.R408K	TBC1D9B_uc003mli.2_Missense_Mutation_p.R408K|TBC1D9B_uc003mlj.2_Missense_Mutation_p.R408K	NM_198868	NP_942568	Q66K14	TBC9B_HUMAN	TBC1 domain family, member 9B (with GRAM domain)	408						integral to membrane|intracellular	calcium ion binding|Rab GTPase activator activity			breast(1)|skin(1)	2	all_cancers(89;0.000197)|all_epithelial(37;6.84e-05)|Renal(175;0.000159)|Lung NSC(126;0.00136)|all_lung(126;0.00243)	all_cancers(40;0.0236)|Medulloblastoma(196;0.00498)|all_neural(177;0.0138)	Kidney(164;2.23e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000178)			ACTGGCTTTCCTGCTCCCGAT	0.567																0.32093	205.500935	211.623925	69	146	KEEP	---	---	---	---	54	28	113	55	-1	capture	Missense_Mutation	SNP	179315134	179315134	TBC1D9B	5	C	T	T	T	1	0	0	0	0	1	0	0	0	312	24	2	2	15515	51
KHDRBS2	202559	broad.mit.edu	37	6	62604633	62604633	+	Silent	SNP	T	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr6:62604633T>A	uc003peg.2	-	6	964	c.717A>T	c.(715-717)GCA>GCT	p.A239A		NM_152688	NP_689901	Q5VWX1	KHDR2_HUMAN	KH domain-containing, RNA-binding, signal	239	Pro-rich.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	SH3 domain binding			skin(7)|ovary(3)|liver(1)	11				BRCA - Breast invasive adenocarcinoma(397;0.149)		GGACACCTCTTGCTACAGGTG	0.607																0.365591	98.725117	100.202671	34	59	KEEP	---	---	---	---	21	16	40	20	-1	capture	Silent	SNP	62604633	62604633	KHDRBS2	6	T	A	A	A	1	0	0	0	0	0	0	0	1	808	63	4	4	8069	51
GIMAP6	474344	broad.mit.edu	37	7	150325381	150325381	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:150325381G>A	uc003whn.2	-	3	729	c.305C>T	c.(304-306)CCC>CTC	p.P102L	GIMAP6_uc003whm.2_Intron	NM_024711	NP_078987	Q6P9H5	GIMA6_HUMAN	GTPase, IMAP family member 6	102							GTP binding			upper_aerodigestive_tract(1)|ovary(1)|skin(1)	3			OV - Ovarian serous cystadenocarcinoma(82;0.0145)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)		CGAGACCTGGGGGGACAGAAT	0.622																0.190476	85.176549	103.985986	40	170	KEEP	---	---	---	---	23	21	127	59	-1	capture	Missense_Mutation	SNP	150325381	150325381	GIMAP6	7	G	A	A	A	1	0	0	0	0	1	0	0	0	559	43	2	2	6322	51
ABP1	26	broad.mit.edu	37	7	150554420	150554420	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:150554420C>T	uc003why.1	+	3	5080	c.862C>T	c.(862-864)CGC>TGC	p.R288C	ABP1_uc003whz.1_Missense_Mutation_p.R288C|ABP1_uc003wia.1_Missense_Mutation_p.R288C	NM_001091	NP_001082	P19801	ABP1_HUMAN	amiloride binding protein 1 precursor	288					amine metabolic process	extracellular space|peroxisome	copper ion binding|diamine oxidase activity|heparin binding|histamine oxidase activity|methylputrescine oxidase activity|primary amine oxidase activity|propane-1,3-diamine oxidase activity|quinone binding			ovary(2)|breast(2)|skin(2)	6	all_neural(206;0.219)		OV - Ovarian serous cystadenocarcinoma(82;0.0121)	UCEC - Uterine corpus endometrioid carcinoma (81;0.168)	Amiloride(DB00594)|Spermine(DB00127)	CCACAAGCCCCGCGGGGACTT	0.697	Pancreas(195;1227 3054 24912 28503)															0.347826	45.586941	46.526727	16	30	KEEP	---	---	---	---	9	7	19	18	-1	capture	Missense_Mutation	SNP	150554420	150554420	ABP1	7	C	T	T	T	1	0	0	0	0	1	0	0	0	299	23	1	1	98	51
CPA6	57094	broad.mit.edu	37	8	68419124	68419124	+	Splice_Site	SNP	C	G	G			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:68419124C>G	uc003xxq.3	-	6	791	c.535_splice	c.e6-1	p.L179_splice	CPA6_uc003xxr.3_Splice_Site_p.L31_splice|CPA6_uc003xxs.2_Splice_Site_p.L179_splice	NM_020361	NP_065094	Q8N4T0	CBPA6_HUMAN	carboxypeptidase A6 isoform 1 precursor						proteolysis	proteinaceous extracellular matrix	metallocarboxypeptidase activity|zinc ion binding			ovary(2)	2			Epithelial(68;0.04)|OV - Ovarian serous cystadenocarcinoma(28;0.0593)|all cancers(69;0.136)			GTCTGCCCAGCTGAAAACAAG	0.408																0.411765	44.2446	44.47561	14	20	KEEP	---	---	---	---	7	7	11	10	-1	capture	Splice_Site	SNP	68419124	68419124	CPA6	8	C	G	G	G	1	0	0	0	0	0	0	1	0	364	28	5	4	3759	51
CDH17	1015	broad.mit.edu	37	8	95189845	95189845	+	Silent	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:95189845G>A	uc003ygh.2	-	4	380	c.255C>T	c.(253-255)GAC>GAT	p.D85D	CDH17_uc011lgo.1_Silent_p.D85D|CDH17_uc011lgp.1_Silent_p.D85D	NM_004063	NP_004054	Q12864	CAD17_HUMAN	cadherin 17 precursor	85	Extracellular (Potential).|Cadherin 1.					integral to membrane	calcium ion binding			ovary(5)|skin(1)	6	Breast(36;4.65e-06)		BRCA - Breast invasive adenocarcinoma(8;0.00691)			TTGTTTCCCTGTCCAAGGCTC	0.458																0.059322	-10.876817	13.116992	7	111	KEEP	---	---	---	---	7	0	74	50	-1	capture	Silent	SNP	95189845	95189845	CDH17	8	G	A	A	A	1	0	0	0	0	0	0	0	1	620	48	2	2	3073	51
NFIB	4781	broad.mit.edu	37	9	14307244	14307244	+	Silent	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:14307244C>T	uc003zle.2	-	2	741	c.306G>A	c.(304-306)CCG>CCA	p.P102P	NFIB_uc003zlf.2_Silent_p.P102P|NFIB_uc011lmo.1_Silent_p.P102P	NM_005596	NP_005587	O00712	NFIB_HUMAN	nuclear factor I/B	102	CTF/NF-I.				anterior commissure morphogenesis|chondrocyte differentiation|Clara cell differentiation|commissural neuron axon guidance|DNA replication|glial cell differentiation|lung ciliated cell differentiation|negative regulation of DNA binding|negative regulation of epithelial cell proliferation involved in lung morphogenesis|negative regulation of mesenchymal cell proliferation involved in lung development|positive regulation of transcription from RNA polymerase II promoter|principal sensory nucleus of trigeminal nerve development|Type I pneumocyte differentiation|Type II pneumocyte differentiation	cerebellar mossy fiber|nucleolus|nucleus	RNA polymerase II transcription corepressor activity|sequence-specific DNA binding RNA polymerase II transcription factor activity				0				GBM - Glioblastoma multiforme(50;4.4e-08)|LUAD - Lung adenocarcinoma(58;0.119)|Lung(218;0.164)		AGACACAGCACGGGTGCTTCT	0.527	Esophageal Squamous(132;921 1730 14828 40753 46471)					T	MYB|HGMA2	adenoid cystic carcinoma|lipoma								0.457746	194.963619	195.183699	65	77	KEEP	---	---	---	---	40	33	55	27	-1	capture	Silent	SNP	14307244	14307244	NFIB	9	C	T	T	T	1	0	0	0	0	0	0	0	1	236	19	1	1	10278	51
SHB	6461	broad.mit.edu	37	9	37948668	37948668	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:37948668C>T	uc004aax.2	-	5	1878	c.1310G>A	c.(1309-1311)AGC>AAC	p.S437N		NM_003028	NP_003019	Q15464	SHB_HUMAN	Src homology 2 domain containing adaptor protein	437	SH2.				angiogenesis|apoptosis|cell differentiation|signal transduction	cytoplasm|plasma membrane	SH3/SH2 adaptor activity			central_nervous_system(2)|skin(1)	3		all_epithelial(88;0.122)		GBM - Glioblastoma multiforme(29;3.27e-05)|Lung(182;0.0658)		GCTGGTCTGGCTGTTCCGGAC	0.647																0.479167	139.645337	139.681432	46	50	KEEP	---	---	---	---	31	22	35	24	-1	capture	Missense_Mutation	SNP	37948668	37948668	SHB	9	C	T	T	T	1	0	0	0	0	1	0	0	0	364	28	2	2	14161	51
ALDOB	229	broad.mit.edu	37	9	104187273	104187273	+	Missense_Mutation	SNP	A	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:104187273A>T	uc004bbk.2	-	8	933	c.851T>A	c.(850-852)CTC>CAC	p.L284H		NM_000035	NP_000026	P05062	ALDOB_HUMAN	aldolase B, fructose-bisphosphate	284			L -> P (in HFI).		fructose 1,6-bisphosphate metabolic process|fructose catabolic process|gluconeogenesis|glycolysis|NADH oxidation|positive regulation of ATPase activity|vacuolar proton-transporting V-type ATPase complex assembly	centriolar satellite|cytosol	ATPase binding|cytoskeletal protein binding|fructose binding|fructose-bisphosphate aldolase activity|identical protein binding			skin(1)	1		Acute lymphoblastic leukemia(62;0.0559)				GATAGCATTGAGGTTGAGAGT	0.517																0.032787	-22.108033	6.973517	4	118	KEEP	---	---	---	---	4	0	70	58	-1	capture	Missense_Mutation	SNP	104187273	104187273	ALDOB	9	A	T	T	T	1	0	0	0	0	1	0	0	0	143	11	4	4	508	51
PTGS1	5742	broad.mit.edu	37	9	125146014	125146014	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:125146014C>T	uc004bmg.1	+	8	1124	c.989C>T	c.(988-990)ACG>ATG	p.T330M	PTGS1_uc011lys.1_Missense_Mutation_p.T305M|PTGS1_uc010mwb.1_Missense_Mutation_p.T221M|PTGS1_uc004bmf.1_Missense_Mutation_p.T330M|PTGS1_uc004bmh.1_Missense_Mutation_p.T221M|PTGS1_uc011lyt.1_Missense_Mutation_p.T221M	NM_000962	NP_000953	P23219	PGH1_HUMAN	prostaglandin-endoperoxide synthase 1 isoform 1	330					cyclooxygenase pathway|hormone biosynthetic process|regulation of blood pressure|response to oxidative stress|xenobiotic metabolic process	endoplasmic reticulum membrane|Golgi apparatus|microsome|plasma membrane	heme binding|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|peroxidase activity|prostaglandin-endoperoxide synthase activity			ovary(1)|skin(1)	2					Acetaminophen(DB00316)|Aspirin(DB00945)|Balsalazide(DB01014)|Bromfenac(DB00963)|Ciclopirox(DB01188)|Diclofenac(DB00586)|Diflunisal(DB00861)|Dipyrone(DB04817)|Etodolac(DB00749)|Fenoprofen(DB00573)|Flurbiprofen(DB00712)|gamma-Homolinolenic acid(DB00154)|Ibuprofen(DB01050)|Icosapent(DB00159)|Indomethacin(DB00328)|Ketoprofen(DB01009)|Ketorolac(DB00465)|Lumiracoxib(DB01283)|Meclofenamic acid(DB00939)|Mefenamic acid(DB00784)|Mesalazine(DB00244)|Minoxidil(DB00350)|Nabumetone(DB00461)|Naproxen(DB00788)|Phenacetin(DB03783)|Piroxicam(DB00554)|Rofecoxib(DB00533)|Salicyclic acid(DB00936)|Salsalate(DB01399)|Sulindac(DB00605)|Suprofen(DB00870)|Tenoxicam(DB00469)|Tolmetin(DB00500)	CTTTTCCAGACGACCCGCCTC	0.607																0.372881	61.144001	61.97764	22	37	KEEP	---	---	---	---	16	9	23	22	-1	capture	Missense_Mutation	SNP	125146014	125146014	PTGS1	9	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	12650	51
COQ4	51117	broad.mit.edu	37	9	131088069	131088069	+	Missense_Mutation	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:131088069G>A	uc004bur.3	+	4	658	c.311G>A	c.(310-312)CGG>CAG	p.R104Q	COQ4_uc011max.1_Missense_Mutation_p.R104Q|COQ4_uc004bus.2_Missense_Mutation_p.R80Q|COQ4_uc010mxy.2_Missense_Mutation_p.R80Q	NM_016035	NP_057119	Q9Y3A0	COQ4_HUMAN	coenzyme Q4 homolog precursor	104					ubiquinone biosynthetic process	mitochondrial inner membrane					0						GAGCGTCCCCGGATTTCGACA	0.587																0.440678	154.206801	154.579209	52	66	KEEP	---	---	---	---	29	27	46	28	-1	capture	Missense_Mutation	SNP	131088069	131088069	COQ4	9	G	A	A	A	1	0	0	0	0	1	0	0	0	507	39	1	1	3712	51
KLHL15	80311	broad.mit.edu	37	X	24006559	24006559	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:24006559C>T	uc004dba.3	-	4	1550	c.1294G>A	c.(1294-1296)GGT>AGT	p.G432S		NM_030624	NP_085127	Q96M94	KLH15_HUMAN	kelch-like 15	432	Kelch 3.									ovary(1)|breast(1)	2						GTGATTCCACCGGTGATAAAC	0.443																0.052885	-21.598605	22.279379	11	197	KEEP	---	---	---	---	7	4	131	78	-1	capture	Missense_Mutation	SNP	24006559	24006559	KLHL15	23	C	T	T	T	1	0	0	0	0	1	0	0	0	299	23	1	1	8291	51
FGD1	2245	broad.mit.edu	37	X	54496521	54496521	+	Silent	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:54496521G>A	uc004dtg.2	-	4	1763	c.1029C>T	c.(1027-1029)GAC>GAT	p.D343D	FGD1_uc011moi.1_Silent_p.D101D	NM_004463	NP_004454	P98174	FGD1_HUMAN	faciogenital dysplasia protein	343					actin cytoskeleton organization|apoptosis|filopodium assembly|induction of apoptosis by extracellular signals|nerve growth factor receptor signaling pathway|organ morphogenesis|regulation of Cdc42 GTPase activity|regulation of cell shape|small GTPase mediated signal transduction	cytoskeleton|cytosol|Golgi apparatus|lamellipodium|nucleus|plasma membrane|ruffle	metal ion binding|Rho guanyl-nucleotide exchange factor activity|small GTPase binding			ovary(3)|skin(2)|central_nervous_system(1)	6						cctcctcgtcgtcctcctcct	0.507																0.368421	38.541702	39.119205	14	24	KEEP	---	---	---	---	13	5	19	10	-1	capture	Silent	SNP	54496521	54496521	FGD1	23	G	A	A	A	1	0	0	0	0	0	0	0	1	516	40	1	1	5778	51
ZMYM3	9203	broad.mit.edu	37	X	70467290	70467290	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:70467290C>T	uc004dzh.1	-	13	2306	c.2219G>A	c.(2218-2220)CGT>CAT	p.R740H	BCYRN1_uc011mpt.1_Intron|ZMYM3_uc004dzi.1_Missense_Mutation_p.R740H|ZMYM3_uc004dzj.1_Missense_Mutation_p.R740H	NM_201599	NP_963893	Q14202	ZMYM3_HUMAN	zinc finger protein 261	740					multicellular organismal development	nucleus	DNA binding|zinc ion binding			ovary(1)	1	Renal(35;0.156)					GCAGAAATGACGGATCTGCCC	0.582																0.35	18.319866	18.716454	7	13	KEEP	---	---	---	---	6	2	10	11	-1	capture	Missense_Mutation	SNP	70467290	70467290	ZMYM3	23	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	17581	51
CAPN6	827	broad.mit.edu	37	X	110494147	110494147	+	Missense_Mutation	SNP	G	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:110494147G>T	uc004epc.1	-	8	1324	c.1156C>A	c.(1156-1158)CAG>AAG	p.Q386K	CAPN6_uc011msu.1_Missense_Mutation_p.Q131K	NM_014289	NP_055104	Q9Y6Q1	CAN6_HUMAN	calpain 6	386	Domain III.				microtubule bundle formation|proteolysis|regulation of cytoskeleton organization	perinuclear region of cytoplasm|spindle microtubule	calcium-dependent cysteine-type endopeptidase activity|microtubule binding			ovary(2)|upper_aerodigestive_tract(1)|large_intestine(1)|lung(1)|skin(1)	6						ACTCAAACCTGGGGATTCTGC	0.453																0.375405	331.114471	335.328861	116	193	KEEP	---	---	---	---	71	52	120	108	0.577235772358	capture	Missense_Mutation	SNP	110494147	110494147	CAPN6	23	G	T	T	T	1	0	0	0	0	1	0	0	0	611	47	4	4	2606	51
DDX26B	203522	broad.mit.edu	37	X	134714081	134714081	+	Missense_Mutation	SNP	G	C	C			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:134714081G>C	uc004eyw.3	+	15	2740	c.2377G>C	c.(2377-2379)GGT>CGT	p.G793R	DDX26B_uc004eyx.3_Missense_Mutation_p.G394R	NM_182540	NP_872346	Q5JSJ4	DX26B_HUMAN	DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide	793											0	Acute lymphoblastic leukemia(192;6.56e-05)					TCGAAAGTTTGGTCGAAGTAA	0.373																0.561644	126.67731	126.918054	41	32	KEEP	---	---	---	---	38	8	14	24	-1	capture	Missense_Mutation	SNP	134714081	134714081	DDX26B	23	G	C	C	C	1	0	0	0	0	1	0	0	0	611	47	4	4	4311	51
GPR101	83550	broad.mit.edu	37	X	136113330	136113330	+	Silent	SNP	G	A	A			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:136113330G>A	uc011mwh.1	-	1	504	c.504C>T	c.(502-504)TAC>TAT	p.Y168Y		NM_054021	NP_473362	Q96P66	GP101_HUMAN	G protein-coupled receptor 101	168	Helical; Name=4; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(3)|lung(1)|skin(1)	5	Acute lymphoblastic leukemia(192;0.000127)					GGCCCCAGCCGTAGAGTGGAG	0.607																0.068966	-3.745911	7.400149	4	54	KEEP	---	---	---	---	2	5	41	35	-1	capture	Silent	SNP	136113330	136113330	GPR101	23	G	A	A	A	1	0	0	0	0	0	0	0	1	516	40	1	1	6556	51
SOX3	6658	broad.mit.edu	37	X	139587063	139587063	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:139587063C>T	uc004fbd.1	-	1	163	c.163G>A	c.(163-165)GCT>ACT	p.A55T		NM_005634	NP_005625	P41225	SOX3_HUMAN	SRY (sex determining region Y)-box 3	55					face development|hypothalamus development|negative regulation of neuron differentiation|pituitary gland development|regulation of transcription, DNA-dependent|sensory organ development|sex determination|transcription, DNA-dependent	nucleus	DNA binding			pancreas(1)	1	Acute lymphoblastic leukemia(192;7.65e-05)					GGGGCTGGAGCGGCCACGGTG	0.667																0.375	8.122639	8.232473	3	5	KEEP	---	---	---	---	1	2	2	6	-1	capture	Missense_Mutation	SNP	139587063	139587063	SOX3	23	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	14843	51
SLITRK2	84631	broad.mit.edu	37	X	144906039	144906039	+	Missense_Mutation	SNP	C	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:144906039C>T	uc004fcd.2	+	5	3086	c.2096C>T	c.(2095-2097)CCC>CTC	p.P699L	SLITRK2_uc010nsp.2_Missense_Mutation_p.P699L|SLITRK2_uc010nso.2_Missense_Mutation_p.P699L|SLITRK2_uc011mwq.1_Missense_Mutation_p.P699L|SLITRK2_uc011mwr.1_Missense_Mutation_p.P699L|SLITRK2_uc011mws.1_Missense_Mutation_p.P699L|SLITRK2_uc004fcg.2_Missense_Mutation_p.P699L|SLITRK2_uc011mwt.1_Missense_Mutation_p.P699L|CXorf1_uc004fch.2_5'Flank	NM_032539	NP_115928	Q9H156	SLIK2_HUMAN	SLIT and NTRK-like family, member 2 precursor	699	Cytoplasmic (Potential).					integral to membrane				ovary(5)|central_nervous_system(1)|pancreas(1)	7	Acute lymphoblastic leukemia(192;6.56e-05)					TGCCAAAACCCCATCTACATG	0.478																0.328859	138.325036	142.193705	49	100	KEEP	---	---	---	---	29	22	43	58	-1	capture	Missense_Mutation	SNP	144906039	144906039	SLITRK2	23	C	T	T	T	1	0	0	0	0	1	0	0	0	286	22	2	2	14635	51
GPR50	9248	broad.mit.edu	37	X	150348278	150348278	+	Missense_Mutation	SNP	A	G	G			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:150348278A>G	uc010ntg.1	+	2	358	c.223A>G	c.(223-225)ATG>GTG	p.M75V	uc004fes.1_5'Flank|GPR50_uc011myc.1_Missense_Mutation_p.M75V	NM_004224	NP_004215	Q13585	MTR1L_HUMAN	G protein-coupled receptor 50	75	Helical; Name=2; (Potential).				cell-cell signaling	integral to plasma membrane	melatonin receptor activity			large_intestine(1)|lung(1)|ovary(1)|pancreas(1)	4	Acute lymphoblastic leukemia(192;6.56e-05)					TGTGGCCGATATGCTGGTGGC	0.507																0.318091	479.174321	493.941614	160	343	KEEP	---	---	---	---	121	68	276	151	-1	capture	Missense_Mutation	SNP	150348278	150348278	GPR50	23	A	G	G	G	1	0	0	0	0	1	0	0	0	208	16	3	3	6630	51
RPL5	6125	broad.mit.edu	37	1	93301897	93301898	+	Frame_Shift_Ins	INS	-	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:93301897_93301898insT	uc001doz.2	+	5	553_554	c.475_476insT	c.(475-477)GTTfs	p.V159fs	FAM69A_uc001dpc.2_Intron|RPL5_uc001dpa.2_RNA|RPL5_uc001dpb.2_Frame_Shift_Ins_p.V109fs|RPL5_uc001dpd.2_5'UTR|SNORD21_uc001dpe.2_5'Flank	NM_000969	NP_000960	P46777	RL5_HUMAN	ribosomal protein L5	159					endocrine pancreas development|ribosomal large subunit biogenesis|rRNA processing|translational elongation|translational termination|viral transcription	cytosolic large ribosomal subunit|nucleolus	5S rRNA binding|protein binding|structural constituent of ribosome				0		all_lung(203;0.00265)|Lung NSC(277;0.0056)|all_neural(321;0.185)|Melanoma(281;0.192)|Glioma(108;0.203)		GBM - Glioblastoma multiforme(16;0.000305)|all cancers(265;0.000343)|Epithelial(280;0.0927)		TGGCAATAAAGTTTTTGGTGCC	0.495																0.46			74	87		---	---	---	---						capture_indel	Frame_Shift_Ins	INS	93301897	93301898	RPL5	1	-	T	T	T	1	0	1	1	0	0	0	0	0	468	36	5	5	13489	51
CD22	933	broad.mit.edu	37	19	35832284	35832285	+	Frame_Shift_Ins	INS	-	T	T			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:35832284_35832285insT	uc010edt.2	+	8	1623_1624	c.1546_1547insT	c.(1546-1548)CTTfs	p.L516fs	CD22_uc010xst.1_Frame_Shift_Ins_p.L344fs|CD22_uc010edu.2_Frame_Shift_Ins_p.L428fs|CD22_uc010edv.2_Frame_Shift_Ins_p.L516fs|CD22_uc002nzb.3_Frame_Shift_Ins_p.L339fs|CD22_uc010edx.2_RNA	NM_001771	NP_001762	P20273	CD22_HUMAN	CD22 molecule precursor	516	Extracellular (Potential).|Ig-like C2-type 5.				cell adhesion		protein binding|sugar binding			ovary(5)|lung(3)|breast(1)	9	all_lung(56;9.78e-09)|Lung NSC(56;1.46e-08)|Esophageal squamous(110;0.162)		Epithelial(14;5.83e-19)|OV - Ovarian serous cystadenocarcinoma(14;3.19e-18)|all cancers(14;3.41e-16)|LUSC - Lung squamous cell carcinoma(66;0.0417)		OspA lipoprotein(DB00045)	AATCAAGCCCCTTTCCGAGATT	0.574	Ovarian(42;1009 1133 23674 26041)															0.45			40	48		---	---	---	---						capture_indel	Frame_Shift_Ins	INS	35832284	35832285	CD22	19	-	T	T	T	1	0	1	1	0	0	0	0	0	312	24	5	5	2956	51
GPR85	54329	broad.mit.edu	37	7	112724285	112724288	+	Frame_Shift_Del	DEL	TGAG	-	-			TCGA-06-0216-01	TCGA-06-0216-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:112724285_112724288delTGAG	uc010ljv.2	-	2	1006_1009	c.489_492delCTCA	c.(487-492)TACTCAfs	p.Y163fs	GPR85_uc003vgp.1_Frame_Shift_Del_p.Y163fs|GPR85_uc003vgq.2_Frame_Shift_Del_p.Y163fs|GPR85_uc010ljw.1_Frame_Shift_Del_p.Y163fs	NM_001146266	NP_001139738	P60893	GPR85_HUMAN	G protein-coupled receptor 85	163_164	Extracellular (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			ovary(1)|central_nervous_system(1)	2						CCCTAATGAATGAGTAAGTGCCCA	0.500																0.27			47	128		---	---	---	---						capture_indel	Frame_Shift_Del	DEL	112724285	112724288	GPR85	7	TGAG	-	-	-	1	0	1	0	1	0	0	0	0	652	51	5	5	6648	51
